Sei sulla pagina 1di 109

GUIDA TECNICA

La distribuzione in bassa tensione Dispositivi di apertura

Scemi di collegamento a terra _________________________________________________ 480 -NQLDCHBNRSQTYHNMD($" __________________________________________ 511


Tensioni, sovratensioni ___________________________________________________________________ 482 -NQLDCHHMRS@KK@YHNMD($" _________________________________________ 513
Qualità dell’energia ___________________________________________________________________________ 483 Scelta di un apparecchio di apertura _________________________________ 514
Miglioramento della qualità della rete _________________________________ 488 Esempi d'uso ________________________________________________________________________________________ 515
(MkTDMYDDRSDQMD ________________________________________________________________________________ 489 Limiti d'uso ______________________________________________________________________________________________ 

Correnti di sovraccarico
Protezione fusibile
#DSDQLHM@YHNMDCDKK@BNQQDMSD(2 _____________________________________________ 490
#DSDQLHM@YHNMDCDKK@BNQQDMSD@LLHRRHAHKD(Y _______________ 481 Caratteristiche generali __________________________________________________________________ 518

/QNSDYHNMDCDKKDB@M@KHYY@YHNMHBNMSQNHRNUQ@BB@QHBGH +HLHS@YHNMDCDKK@BNQQDMSDCHBNQSNBHQBTHSN ____________________ 518


mediante fusibili gG 495
__________________________________________________________________________ Scelta di un fusibile "gG" o "aM" ___________________________________________ 519
/QNSDYHNMDCDKKDB@M@KHYY@YHNMHBNMSQN
i sovraccarichi mediante fusibili gG ______________________________________ 522
Correnti di corto circuito /QNSDYHNMDCDKK@B@M@KHYY@YHNMHBNMETRHAHKH _____________________ 523
/QNSDYHNMDBNMSQNHBNMS@SSHHMCHQDSSH
Calcolo della IccCHTM@ENMSDCH@KHLDMS@YHNMD _____________ 494 con fusibili ________________________________________________________________________________________________ 524
Calcolo della Icc di un impianto in bassa tensione  ____
Curve caratteristiche dei fusibili gG _____________________________________ 528
/QNSDYHNMDCDKK@B@M@KHYY@YHNMH ________________________________________________ 502 Curve caratteristiche dei fusibili aM _____________________________________ 
/QNSDYHNMDCDKK@B@M@KHYY@YHNMHBNMETRHAHKH _____________________ 503 Scelta di un fusibile UR __________________________________________________________________ 529
Selettività __________________________________________________________________________________________________ 530

Contatti diretti e indiretti

/QNSDYHNMDBNMSQNHBNMS@SSHCHQDSSH _________________________________________ 504


/QNSDYHNMDBNMSQNHBNMS@SSHCHQDSSH _________________________________________ 505
/QNSDYHNMDBNMSQNHBNMS@SSHHMCHQDSSHBNMETRHAHKH __________ 508 Sistema di gestione dell’energia
/QNSDYHNMDBNMSQNHBNMS@SSHHMCHQDSSHBNMQDKĠ
(MSQNCTYHNMD ____________________________________________________________________________________________ 534
CHEEDQDMYH@KD
____________________________________________________________________________________________ 509
Tariffario
______________________________________________________________________________________________________ 534
Misura elettrica _____________________________________________________________________________________ 535
Conteggio di energia 535
Cadute di tensione
_______________________________________________________________________

2NQUDFKH@MY@ ___________________________________________________________________________________________ 


Calcolo della caduta di tensione in un cavo di Controllo comando ___________________________________________________________________________ 
KTMFGDYY@+ ________________________________ 510
Qualità dell’energia ___________________________________________________________________________ 
,DSNCNCDSSNCDKKDŭ2DYHNMHDBNMNLHBGDŭ _______ 510

478 Catalogo Generale 2012-2013 SOCOMEC


Reti di comunicazione Controllori Permanenti d’Isolamento

"NLTMHB@YHNMD@M@KNFHB@ ___________________________________________________________  Generalità _________________________________________________________________________________________________ 


"NLTMHB@YHNMDCHFHS@KD _________________________________________________________________ 538 #DjMHYHNMH _________________________________________________________________________________________________ 
Il protocollo JBUS / MODBUS __________________________________________________ 539 "@RHCHTSHKHYYN _______________________________________________________________________________________ 
Il bus RS 485 _________________________________________________________________________________________ 542 Collegamento dei CPI _____________________________________________________________________ 
Il protocollo PROFIBUS _______________________________________________________________ 

Limitatore di sovratensione

Misura elettrica Generalità _________________________________________________________________________________________________ 


(MCTSS@MY@CHKHLHS@YHNMDCDKK@BNQQDMSD _____________________________ 
Dispositivo ferromagnetico _________________________________________________________ 548 +HUDKKNDEEDSSHUNCHOQNSDYHNMD@RRHBTQ@SNC@TM
Dispositivo a bobina mobile _______________________________________________________ 548 limitatore di sovratensione __________________________________________________________ 
#HRONRHSHUN@ANAHM@LNAHKDC@Q@CCQHYY@SNQD ______________ 548 3DMRHNMHMNLHM@KHCHMMDRB@LDMSN@EQDPTDMY@
industriale _________________________________________________________________________________________________ 
/NRHYHNMDCTSHKHYYN ____________________________________________________________________________ 548
Collegamento del dispositivo limitatore ____________________________ 
4SHKHYYNCHSQ@RENQL@SNQHCHSDMRHNMD ______________________________________ 548
"NMUDQSHSNQDCHONSDMY@ _________________________________________________________________ 549
Classe di precisione _________________________________________________________________________ 549
Consumo dei cavi in rame __________________________________________________________ 549 Gli scaricatori
Trasformatore sommatore ___________________________________________________________ 550
/QNSDYHNMDBNMSQNKDRNUQ@SDMRHNMHSQ@MRHSNQHD ______________ 
TA saturabili ____________________________________________________________________________________________ 550
Sovratensioni dovute a fulmini _________________________________________________ 
C@SS@LDMSNCDHQ@OONQSHCHSQ@RENQL@YHNMD _________________ 550
Principali regolamenti e norme ________________________________________________ 
Tecnologia ________________________________________________________________________________________________ 
"NRSHSTYHNMDHMSDQM@ _________________________________________________________________________ 
Principali caratteristiche degli scaricatori _________________________ 
Protezione digitale delle reti
2BDKS@DHLOKDLDMS@YHNMDCDFKHRB@QHB@SNQHCHSDRS@ ______ 
Generalità _________________________________________________________________________________________________ 551 /QNSDYHNMDCDKKD@OO@QDBBGH@STQDDRB@QHB@SNQHCH
%TMYHNMHCHOQNSDYHNMD _____________________________________________________________________ 551 CHRSQHATYHNMD 
___________________________________________________________________________________________

"TQUDCHOQNSDYHNMD@SDLONCHODMCDMSD _______________________ 551 Regole e scelta degli scaricatori _____________________________________________ 581

1DKġCHOQNSDYHNMD ______________________________________________________________________________ 551 +@X NTSDL@MTSDMYHNMD _______________________________________________________________ 582

1@OOQDRDMS@YHNMDCDKKDBTQUD __________________________________________________ 551


$PT@YHNMDCDKKDBTQUD ____________________________________________________________________ 551
/QNSDYHNMDCDKMDTSQN ______________________________________________________________________ 552 Cassette
/QNSDYHNMDŭFT@RSN@SDQQ@ŭ ________________________________________________________ 552
Effetti termici __________________________________________________________________________________________ 583
"TQU@CHOQNSDYHNMD@SDLONHMCHODMCDMSD ___________________ 552
Calcolo termico delle cassette _________________________________________________ 584
/QNSDYHNMDBNMSQNHKQHSNQMNCHONSDMY@ ______________________________ 552
2BDKS@CDKK@BKHL@SHYY@YHNMD ________________________________________________________ 584
Scelta de TA ___________________________________________________________________________________________ 552

Barre di distribuzione
Protezione differenziale
Scelta del materiale delle barre _______________________________________________ 
Generalità _________________________________________________________________________________________________ 553
#DSDQLHM@YHNMDCH(ccCHBQDRS@HMETMYHNMD
#DjMHYHNMH _________________________________________________________________________________________________ 554 della IccDEjB@BD ____________________________________________________________________________________ 
OOKHB@YHNMH _____________________________________________________________________________________________ 555 Effetto termico del corto circuito ____________________________________________ 
(MRS@KK@YHNMD ____________________________________________________________________________________________ 558 Effetti elettrochimici ___________________________________________________________________________ 

SOCOMEC Catalogo Generale 2012-2013 479


La distribuzione in bassa tensione

Scemi di collegamento a terra


4MNRBGDL@CHBNKKDF@LDMSN@SDQQ@NfQDFHLDCHMDTSQNtHMTM@QDSD@A@RR@SDMRHNMD UHDMDCDjMHSNC@CTDKDSSDQD

La primaCDjMHRBDHKBNKKDF@LDMSN@ collegato a terra T T collegate a terra


La secondaCDjMHRBDHKBNKKDF@LDMSN
terra del secondario del trasformatore isolato a terra I T collegate a terra
a terra delle masse
(molto spesso il punto-neutro) collegato a terra T N collegate al neutro

TT : regime “Neutro a terra”


Questo regime di neutro viene imposto dall’ENEL per le
L1
reti di distribuzione pubblica in bassa tensione in Italia.
L2
In caso di guasto d’isolamento, c’è il distacco parziale o
L3
totale degli utilizzatori.
N
L’apertura è obbligatoria al primo guasto.
L’insieme dei carichi deve essere dotato di una protezione
differenziale istantanea.
La protezione differenziale può essere generale o suddivisa,
in funzione dei tipi e dell’importanza dell’installazione. Massa
0TDRSN QDFHLD RH HMBNMSQ@ MDH RDFTDMSH B@RH CNLDRSHBN 
OHBBNKNSDQYH@QHN OHBBNKDNEjBHMD RS@AHKHLDMSHRBNK@RSHBHBNM PE
catec 004 b 1 it cat

laboratori di esercitazione, ecc.


Massa a terra
dell’alimentazione

TN : regime “Collegamento con neutro a terra”


Questo principio di distribuzione è usato in ogni installazione in cui è tollerata un’apertura al primo guasto.
La messa in opera e l’utilizzo di questo tipo di rete sono economici ma necessitano di un’istallazione molto precisa dei circuiti
di protezione.
I conduttori del neutro (N) e di protezione (PE) possono essere identici (TN-C) o separati (TN-S).

Schema TN-C Schema TN-S


Il conduttore PEN (Protezione e Neutro) non deve mai Una rete TN-S può essere creata a valle di una rete TN-C,
essere sezionato. I conduttori PEN devono avere una mentre il contrario è vietato. Di solito, i conduttori di neutro
sezione superiore a 10 mm2 se in rame e a 16 mm2 se in nel regime TN-S sono sezionati, non vengono protetti e le
alluminio e non devono comprendere installazioni mobili loro sezioni sono obbligatoriamente uguali a quelle delle
B@UHkDRRHAHKH fasi corrispondenti.

L1 L1

L2 L2

L3 L3

PEN N
PE
Impianto fisso con sezione
≥ di 10 mm2 Cu
≥ di 16 mm2 Al

Massa
PEN

catec 001 b 1 it cat


catec 005 c 1 it cat

Messa a terra Messa a terra


Masse
dell’alimentazione dell’alimentazione

R
S
T
Schema TNC-S
PEN (KSDQLHMDRBGDL@3-" 2CDjMHRBDTM@CHRSQHATYHNMDMDKK@
iN iN quale i conduttori di neutro e i conduttori di protezione
sono posti in una parte dell’installazione e distinti dal resto
catec 044 c 1 it cat

R S T N R S T N R S T N dell’installazione.
SI NO SI

La funzione di “protezione” del conduttore PEN è prevalente


rispetto alla funzione di “neutro”.

480 Catalogo Generale 2012-2013 SOCOMEC


La distribuzione in bassa tensione

Scemi di collegamento a terra (seguito)


IT : regime “Neutro isolato”
Questo regime di neutro viene usato per garantire la continuità di esercizio della rete cioè quando l’apertura al primo guasto
d’isolamento è compromettente per il buon funzionamento dell’impianto o per la sicurezza delle persone.
L’utilizzo di questo regime impone la presenza costante di personale competente sul luogo per interventi veloci al momento
CDKOQHLNFT@RSNCHRNK@LDMSN ODQF@Q@MSHQDK@BNMSHMTHSĐCDRDQBHYHNOQHL@BGDRHUDQHjBGHTMDUDMST@KDRDBNMCNFT@RSNBGD
provocherebbe il fuori servizio dell’impianto.
Un limitatore di sovratensione è obbligatorio per permettere di scaricare a terra eventuali sovratensioni provenienti da
installazioni in alta tensione (guasto del trasformatore in alta o media tensione, manovre, fulmine…).

+@OQNSDYHNMDCDKKDODQRNMDĠ@RRHBTQ@S@C@
- l’interconnessione e la messa a terra delle masse,
- il monitoraggio del primo guasto tramite CPI (Controllore Permanente d’Isolamento),
- l’apertura al secondo guasto mediante i dispositivi di protezione contro le sovracorrenti o mediante i dispositivi differenziali.
Questo regime viene usato, per esempio, negli ospedali (sale operatorie) o nei circuiti di sicurezza (illuminazione) e nelle
industrie in cui la continuità di esercizio è fondamentale o quando si vuole ridurre considerevolmente i rischi di incendio o di
esplosione per la debole corrente di guasto.

L1 L1

L2 L2

L3 L3

(1) CPI (1) CPI

Massa PE PE
catec 002 c 1 it cat

catec 003 c 1 it cat

Messa a terra
Messa a terra
dell’alimentazione
dell'alimentazione
(1) Limitatore di sovratensione (in caso di trasformatore HT/BT) (1) Limitatore di sovratensione (in caso di trasformatore HT/BT)

Schema IT senza neutro distribuito. Schema IT con neutro distribuito

SOCOMEC Catalogo Generale 2012-2013 481


La distribuzione in bassa tensione

Tensioni, sovratensioni
"K@RRHkB@YHNMDCDFKHHLOH@MSH
In Bassa Tensione, gli impianti si possono suddividere in due parti secondo la norma IEC 60364 e tre parti secondo il decreto
del 14.11.88.

"K@RRHjB@YHNMD Tensione nominale Un


Decreto IEC AC CC
!3!@RRHRRHL@3DMRHNMD I ­Ű5 ­Ű5
!3 !@RR@3DMRHNMD II 5Ű4n­Ű5 5Ű4n­5
!3!!@RR@3DMRHNMD! II 5Ű4n­5 54n­5

3DMRHNMDMNQL@KHYY@S@HM "
(MLNMNE@RD5
(MSQHE@RD55D55
Evoluzione delle tensioni e delle tolleranze (IEC 60038)
Periodi Tensioni di Tolleranze
/QHL@CDK 555 ± 10 %
#@K@ 555
 
Dopo il 2003 555 ± 10 %

/QNSDYHNMDBNMSQNKDRNUQ@SDMRHNMHSQ@MRHSNQHD
$@RRHBTQ@S@

#@KK@RBDKS@CDKK@OO@QDBBGH@STQ@HMETMYHNMDCH4HLO
+DMNQLD($"CDjMHRBNMNB@SDFNQHDCTRN

Categoria I Materiali o componenti elettronici con Uimp bassa.


Es.: circuiti elettronici
Categoria II OO@QDBBGHCTRNCDRSHM@SH@DRRDQDBNMMDRRH@KKHLOH@MSNDKDSSQHBNCDKKDCHjBHN 
Es.: - attrezzatura portatile…
HMENQL@SHBN 35 'Hk @KK@QLH DKDSSQNCNLDRSHBHBNMOQNFQ@LL@YHNMDDKDSSQNMHB@w
Categoria III OO@QDBBGH@OO@QSDMDMSH@HMRS@KK@YHNMHjRRDD@KSQH@OO@QDBBGHODQHPT@KHĠQHBGHDRSNTMKHUDKKNOHŔ@KSNCH@EjC@AHKHSĐ
Es.: - armadi di distribuzione…
(MRS@KK@YHNMHkRRD LNSNQHw
"@SDFNQH@(5 Apparecchiatura situata all’origine dell’installazione o vicina all’origine dell’installazione a monte del quadro di distribuzione.
Es.: - sensori, trasformatori…
- Apparecchi principali di protezione contro le sovracorrenti

Sovratensione in kV secondo la classe d’utilizzo


Rete trifase Rete monofase (5 III II I
55 5 6 4 2,5 1,5
55 8 6 4 2,5
55 Xx
7W5@KNQHOQNOONRSHC@HBNRSQTSSNQHCDKKD@OO@QDBBGH@STQD #HCDE@TKS HU@KNQHCDKK@QHF@PTHRNOQ@ONRRNMNDRRDQDRBDKSH

Dagli scaricatori UDCDQDO@FHM@


- ! +DRNUQ@SDMRHNMHCHNQHFHMD@SLNREDQHB@MNMRTAHRBNMN@SSDMT@YHNMDRHFMHkB@SHU@@U@KKDMDKK@L@FFHNQDO@QSDCDKKDHMRS@KK@YHNMH
#HBNMRDFTDMY@ K@RBDKS@CDKKDB@SDFNQHDCHRNUQ@SDMRHNMHCDFKH@OO@QDBBGHMNMğRTEkBHDMSDODQDRDFTHQDTM@OQNSDYHNMDBNMSQN
KDRNUQ@SDMRHNMH 4M@M@KHRHCDHQHRBGH@C@SS@CDUDDRRDQDQD@KHYY@S@ODQCDkMHQDFKHRB@QHB@SNQHMDBDRR@QH@HCHUDQRHKHUDKKHCDKKHLOH@MSN

1HFHCHSĒCHDKDSSQHB@@Ů'Y
+D@OO@QDBBGH@STQDCDKKHLOH@MSN! 3 CDUNMN@UDQDKDRDFTDMSHQHFHCHSĐCHDKDSSQHBGD

Durata 3DMRHNMD@LLHRRHAHKD5
Ű Uo
Ű
­ Uo
Ű

482 Catalogo Generale 2012-2013 SOCOMEC


La distribuzione in bassa tensione

Qualità dell’ energia


Le tolleranze di solito ammesse (EN 50160) per un buon funzionamento di una rete che comporta dei carichi sensibili alle
perturbazioni (componenti elettronici, materiale informatico…) sono sintetizzate nelle rubriche seguenti.

"@CTSDCHSDMRHNMDD@ODQSTQD
#DkMHYHNMD
Una caduta di tensione è una diminuzione dell’ampiezza della tensione per un tempo compreso tra 10 ms e 1 sec.
La variazione di tensione è espressa in % della tensione nominale (tra 10 e 100 %). Una caduta di tensione del 100 % è
detta apertura.
2DFTDMCNHKSDLONSCH@ODQSTQ@ RHCHRSHMFTNMN
LRSRDB KDLHBQN@ODQSTQDCNUTSD ODQDRDLOHN @KKDQHBGHTRTQDQ@OHCDRTFT@RSHSQ@MRHSNQHv
RDB SLHM KDAQDUH@ODQSTQDCNUTSD@KETMYHNM@LDMSNCDKKDOQNSDYHNMH @KK@LDRR@HMRDQUHYHNCDFKH@OO@QDBBGHBNM
elevata corrente di spunto…
LHM SKDKTMFGD@ODQSTQDCNUTSDCHRNKHSN@KK@QDSD@C@KS@SDMRHNMD
Cadute di tensione secondo la norma EN 50160 (condizione)
Tolleranze
normale eccezionale in funzione dei carichi
Numero da x 10 a x 1000 1000 Elevato
Durata R >1s
Profondità  > 60 % tra 10 e 15 %

Aperture brevi secondo la norma EN 50160 (per periodo di un anno)


Tolleranze
Numero n da x 10 a x 1000
Durata RODQCHM

Aperture lunghe secondo la norma EN 50160 (per periodo di un anno)


Tolleranze
Numero n da x 10 a x 1000
Durata ŰLHM
B@SDB@AWB@S

B@SDBA@WB@S

Caduta di tensione. Apertura.

"NMRDFTDMY@CDKKDB@CTSDCHSDMRHNMDDCDKKD@ODQSTQD
Apertura dei contattori (picchi > 30 %).
Perdita di sincronismo dei motori sincroni, instabilità dei motori asincroni.
 OOKHB@YHNMHHMENQL@SHBGDODQCHSDCHHMENQL@YHNMHv
Interferenza dell’illuminazione con lampade a scarica (spegnimento a causa della cadute del 50 % per 50 ms, la riaccensione
avviene soltanto dopo qualche minuto.

2NKTYHNMH
0T@KTMPTDRH@HKSHONCHB@QHBN
LNCHjB@QDK@RSQTSSTQ@CDKK@QDSDUDCDQDO@FHM@
2DBNMCNHKSHONCHB@QHBN
- alimentazione delle bobine dei contattori con tensioni concatenate,
- aumento dell’inerzia dei motori,
- uso di lampade a riaccensione immediata.

SOCOMEC Catalogo Generale 2012-2013 483


La distribuzione in bassa tensione

Qualità dell’ energia (seguito)


5@QH@YHNMHCHEQDPTDMY@
Esse sono dovute di solito a delle défaillances dei gruppi elettrogeni. La soluzione consiste nell’utilizzare dei convertitori statici
o degli UPS.
Frequenza in rete BT (Un = 230 V) e rete AT (1 < UnœN9 VHFRQGRODQRUPD(1 SHUSHULRGRGLGLHFLVHFRQGL
Tolleranze
Rete interconnessa Rete non interconnessa (isolata)
 CDKK@MMN Ű'YŸ Ű'YŸ
100 % del tempo Ű'YŸ@  Ű'YŸ

5@QH@YHNMDCDKK@SDMRHNMDD%KHBJDQ
#DkMHYHNMD Variazione della tensione secondo la norma EN 50160
(per periodo di una settimana)
(K kHBJDQ Ġ TMN RE@UHKKHN CDKK@ KTBD CNUTSN @KKD Q@OHCD
x % del numero di Un eff con media su 10 min Tolleranze
variazioni della tensione. Produce un effetto sgradevole
 Un ± 10 %
per le persone. Le rapide variazioni di tensione sono
dovute agli apparecchi in cui la potenza assorbita varia 100 % Un + 10 % a Un - 15 %
LNKSNQ@OHC@LDMSDENQMH@C@QBN L@BBGHMDODQR@KC@STQ@  Variazione rapida della tensione secondo la norma EN 50160
laminatoi…
Tolleranze
Di solito 5 % di Un
Eventualmente 10 % di Un

Effetto di sfavillio (effetto Flicker) secondo la norma EN 50160


B@SDBAWB@S

(per periodo di una settimana)


Tolleranze
CDKSDLON PLT­(

Sovratensioni temporanee (a causa dello spostamento del


2NKTYHNMH punto della tensione concatenata)
UPS (per i piccoli carichi). Tolleranze
inserimento di induttanze o batterie di condensatori nel Guasto a monte del trasformatore  ŰJ5
circuito dei carichi.
Collegamento ad un trasformatore dedicato ad alta,
media e bassa tensione (forni ad arco).

2NUQ@SDMRHNMHSQ@MRHSNQHD
#DkMHYHNMD
I fenomeni transitori sono essenzialmente costituiti da
RNUQ@SDMRHNMHLNKSNDKDU@SDjMN@J5DUDKNBHCNUTSD
ai fulmini,
alle manovre o ai guasti sulla rete in alta tensione,
agli archi elettrici dell’apparecchiatura,
alle commutazioni di carichi induttivi,
B@SDBAWB@S

@KK@KHLDMS@YHNMDCHBHQBTHSHENQSDLDMSDB@O@BHSHUH
- reti di cavi estese,
- macchine che provocano delle perturbazioni sulla rete.

Tolleranze
5@KNQD CHRNKHSNŰJ5
Tempo di salita da μs a x ms

$EEDSSH
Sganci intempestivi dei dispositivi di protezione,
Distruzione di materiali elettronici (schede di PLC, variatori di velocità…),
Rottura della guaina di isolamento dei cavi,
Surriscaldamento e invecchiamento prematuro delle apparecchiature dei sistemi informatici.

2NKTYHNMH
Utilizzo di scaricatori e limitatori di sovratensioni.
Aumento della potenza di corto-circuito della sorgente.
Corretta realizzazione della messa a terra in alta, media e bassa tensione.

484 Catalogo Generale 2012-2013 SOCOMEC


La distribuzione in bassa tensione

Qualità dell’ energia (seguito)


 QLNMHBGD
#DkMHYHNMD
Le componenti armoniche di corrente o di tensione sono delle correnti o tensioni “parassite” della rete elettrica. Esse
CDENQL@MNKNMC@RHMTRNHC@KDCHBNQQDMSDNCHSDMRHNMDDOQNUNB@MN
@TLDMSNCDKU@KNQDDEjB@BDCDKK@BNQQDMSD
- circolazione di una corrente nel neutro, anche superiore alla corrente di fase,
- saturazione dei trasformatori,
- perturbazioni nelle reti con piccole correnti,
- sgancio intempestivo delle apparecchiature di protezione…
- misure sbagliate (corrente, tensione, energia…).
Le armoniche di corrente sono dovute ai trasformatori di corrente, agli archi elettrici (forni ad arco, saldatrici, lampade
fosforescenti o a scarica) e soprattutto ai carichi non lineari quali raddrizzatori e convertitori statici (elettronica di potenza).
Questi carichi sono detti carichi deformanti (vedere qui di seguito). Le armoniche di tensione sono dovute alla circolazione
delle armoniche di corrente nell’impedenza delle reti e dei trasformatori.
3DMRHNMHCH@QLNMHBGD
(MTMODQHNCNCHTM@RDSSHL@M@ CDKKDSDMRHNMHCH@QLNMHBGDBNMLDCH@RTLHM CDUNMNDRRDQDHMEDQHNQH@HU@KNQHCDKK@
S@ADKK@RDFTDMSD (MOHŔ HK3'#FKNA@KDRTKKDSDMRHNMHCDUDDRRDQDHMEDQHNQD@@MBGDjMN@KFQ@CNBNMUDMYHNM@KD
Valore massimo delle tensioni di armoniche in % di Un.
Armoniche dispari Armoniche pari
non multiplo di 3 multiplo di 3
&Q@CN' % UC &Q@CN' % UC &Q@CN' % UC
5 6 3 5 2 2
 5  1,5 4 1
11 3,5 15 0,5 6 a 24 0,5
13 3 21 0,5
 2
@ 1,5

I I U
B@SDBAWB@S

catec 010 b 1 x cat

catec 100 b 1 x cat

t t t

Corrente “sinusoidale” fondamentale. Corrente deformata dalle armoniche. Tensione deformata dalle armoniche.
Solutions
Self in linea.
Utilizzo di raddrizzatori.
Declassamento degli apparecchi.
Aumento della potenza di corto-circuito.
4SHKHYYNCHjKSQH
Aumento delle sezioni dei conduttori.
Sovradimensionamento delle apparecchiature.

"@QHBGHKHMD@QH B@QHBGHCDENQL@MSH
Un carico è detto lineare quando la corrente che lo Un carico è detto deformante quando la forma della
@SSQ@UDQR@G@K@RSDRR@ENQL@CDKK@SDMRHNMD BNQQDMSDMNMBNQQHRONMCDOHŔ@KK@ENQL@CDKK@SDMRHNMD

U I U I
I I
U U

t t t t
catec 102 b 1 it cat
catec 101 b 1 it cat

Tensione Carico Corrente


Tensione Carico Corrente
lineare
non lineare

I carichi deformanti producono una corrente di circolazione


nel conduttore di neutro che può essere molto superiore al
valori della corrente di fase.

SOCOMEC Catalogo Generale 2012-2013 485


La distribuzione in bassa tensione

Qualità dell’ energia (seguito)


 QLNMHBGDRDFTHSN
%@SSNQDCHOHBBNEB
-DKB@RNCDHB@QHBGHCDENQL@MSH K@CDENQL@YHNMDCDKK@BNQQDMSDOTŁDRRDQDB@Q@SSDQHYY@S@C@KE@SSNQDCHOHBBN

fc = Ipicco
Ieff

Esempi di valori di fc :
I
I pico - carico resistivo (sinusoide fondamentale): 2 
TMHSďBDMSQ@KDHMENQL@SHB@@ 
BNLOTSDQSHON/" @
I AC
t
RS@LO@MSH@
Alcuni di questi valori del fattore di picco mostrano che
catec 103 b 1 it cat

l’onda di corrente può essere molto lontana dalla sinusoide


fondamentale.

Tensione deformata dalle armoniche.

.QCHMDCDKKD@QLNMHBGD
+D EQDPTDMYD CDKKD @QLNMHBGD RNMN LTKSHOKH CDKK@ EQDPTDMY@ CDKK@ QDSD  'Y  (K E@SSNQD CH LNKSHOKHB@YHNMD Ġ CDSSN NQCHMD
dell’armonica.
Esempio : QLNMHB@CHBNQQDMSDCHNQCHMDG@TM@EQDPTDMY@CHW'Y'Y  QLNMHB@CHBNQQDMSDCHNQCHMDğCDSS@gENMC@LDMS@KDu

 QLNMHBGDCHBNQQDMSDOQDRDMSHRTKK@QDSD
La corrente circolante nella rete è la somma della corrente sinusoidali del primo ordine (detta “fondamentale”) e di un certo
numero di armoniche di corrente dipendenti dal tipo di carico.
Tabella A: corrente armoniche presenti sulla rete
Fonti Ordini delle armoniche
2 3 4 5 6  8  10 11 12 13 14 15 16  18  20
Raddrizzatori 1 pulsazione r r r r r r r r r r r r r r r r r r r
2 pulsazioni r r r r r r r r r
3 pulsazioni r r r r r r r r r r r r r
6 pulsazioni r r r r r r
12 pulsazioni r r
Lampade a scarica r r r r r r r r r
Forni ad arco r r r r r r r r r
Esempio:TM@K@LO@C@@RB@QHB@FDMDQ@TMHB@LDMSD@QLNMHBGDCHBNQQDMSDCHNQCHMD    D +D@QLNMHBGDCHBNQQDMSDCHNQCHMD
O@QH  wRNMN@RRDMSH

/DQSTQA@YHNMDCDFKH@OO@QDBBGHCHLHRTQ@
Gli apparecchi di misura ad indice di tipo ferromagnetico (amperometri, voltmetri…) sono concepiti per misurare delle
FQ@MCDYYDRHMTRNHC@KH@CTM@EQDPTDMY@RODBHjB@CHRNKHSN 'Y +NRSDRRN@UUHDMDODQFKH@OO@QDBBGHCHFHS@KHCHUDQRH
dagli apparecchi campione. Questi apparecchi hanno una misura falsata in caso di segnale non sinusoidale cioè deformato
dalle armoniche (vedere esempio qui sotto).
2NK@LDMSDFKH@OO@QDBBGHBGDLHRTQ@MNHU@KNQHHMUDQN1,2NU@KNQDDEjB@BDHMSDFQ@MNKDBNLONMDMSHCDKRDFM@KDDC@MMN
HKU@KNQDDEjB@BDQD@KDDRDLOHNHK#(1(2

Esempio :
I
(K RDFM@KD  ğ ODQSTQA@SN C@KK@ OQDRDMY@ CH TM@QLNMHB@ CDK §
100 A
NQCHMD  (K U@KNQD DEkB@BD CH TM@ RHMTRNHCD CDKKN RSDRRN U@KNQD CDK
1 Segnale reale
picco sarà:

2 Sinusoide dello stesso 100 A



valore del pico
2
catec 104 b 1 it cat

Perturbazione della misura

486 Catalogo Generale 2012-2013 SOCOMEC


La distribuzione in bassa tensione

Qualità dell’ energia (seguito)


 QLNMHBGDRDFTHSN

"@KBNKNCDKK@BNQQDMSDDEkB@BD
#HRNKHSN HKB@KBNKNCDKK@BNQQDMSDDEjB@BDĠRHFMHjB@SHUNODQHOQHLHNQCHMHCDKKD@QLNMHBGDBHNĠjMN@KKNQCHMDN
Per fase Sul neutro

Ieff = I2n + I22 + I23 + …+ I2J Ieff neutro = I2N3 + I2- + …

In : corrente nominale 2HRNLL@MNKD@QLNMHBGDCHBNQQDMSDCHNQCHMDCHRO@QH LTKSHOKDCH


( (w@QLNMHBGDCHBNQQDMSDCHNQCHMD w

(U@KNQHDEjB@BHCDKKD@QLNMHBGDCHBNQQDMSD( ( DBB RNMNCHEjBHKHC@CDSDQLHM@QD"NMRTKS@QBHOQDBHR@MCNBHHKSHONCHB@QHBN 


il fattore di picco, la potenza del carico e la tensione delle reti).
Esempio
Calcolo della corrente di fase e del neutro in una rete alimentata da un raddrizzatore a doppia pulsazione
%@SSNQDCHOHBBN 
"@QHBNJ5 BNQQDMSDDEkB@BDŭ'Y

J5 = 260 A
3 W5
Armoniche calcolate :
(   ŭ'Y
(   ŭ'Y
(   ŭ'Y
(   ŭ'Y
(   ŭ'Y
Le correnti armoniche di ordini più elevati sono trascurabili.
Corrente in una fase :

Ip = (182)2+ (146)2+ … = 260 A

Corrente nel neutro :

INeutro = (3x146)2+ (3 x 13)2 = 440 A

+@BNQQDMSDMDKMDTSQNğRTODQHNQD@KK@BNQQDMSDCHE@RD -DKB@KBNKNCDKKDRDYHNMHCHBNKKDF@LDMSN BNRĮBNLDODQK@RBDKS@CDKKD@OO@QDBBGH@STQD RH


CNUQďNOONQSTM@LDMSDBNMRHCDQ@QDPTDRS@CHEEDQDMY@

3@RRNCHCHRSNQRHNMDSNS@KDDS@RRNCHCHRSNQRHNMD@QLNMHBN

I22 + I23 + …+ I2J


T=
Ieff

SOCOMEC Catalogo Generale 2012-2013 487


La distribuzione in bassa tensione

Miglioramento della qualità della rete


%NMSH@KSDQM@SHUD
(CHUDQRHSHOHCHENMSH@KSDQM@SHUDRNMNCDRBQHSSHMDKK@S@ADKK@PTHRNSSN
Tipi di fonte Perturbazioni eliminate
Generatori sincroni alimentati dalla rete q@ODQSTQ@LRRDFTDMCNHKUNK@MNCHHMDQYH@
qOHBBGHCHSDMRHNMD
qU@QH@YHNMHCHEQDPTDMY@
UPS  EjB@BHBNMSQNSTSSDKDODQSTQA@YHNMH SQ@MMDKD@ODQSTQDKTMFGDC@LHM @NQ@
$
(seguendo la potenza installata e la potenza dell’UPS).
Generatori (autonomi)  EjB@BHHMSTSSHHB@RH L@BNMTM@HMSDQQTYHNMDCDKK@KHLDMS@YHNMDODQK@BNLLTS@YHNMD
$
MNQL@KDDLDQFDMY@
UPS + generatori Questa soluzione copre tutti i tipi di perturbazione elencati.

+DQDSHCHRNBBNQRNBGDTSHKHYY@MNCDHFQTOOHDKDSSQNFDMHRNMNBK@RRHjB@SDHMCHUDQRDB@SDFNQHDNBK@RRHjB@SDRDBNMCNHKSDLON
CHQHRONRS@QHBGHDRSNOQHL@CDKK@QHO@QSDMY@CDKB@QHBN
Categoria Tempo d’Intervento Avviamento generatore Commenti
D MNMRODBHjB@SN manuale Tempo di salita in velocità e potenza dipendente delle
temperature ambienti e motori
C @ODQSTQ@KTMF@­R alla mancanza della rete Mantenimento del riscaldamento del gruppo per permettere un
avviamento immediato
B @ODQSTQ@BNQS@­R rotazione permanente Avviamento rapido del motore grazie all’inerzia motrice.Motore
in condizione di pre-riscaldamento
A senza apertura collegato alla fonte Ripresa immediata del carico in caso di apertura
dell’alimentazione della rete.

/QDB@TYHNMHCHHMRS@KK@YHNMD
(RNK@QDHB@QHBGHODQSTQA@MSH
Mediante una rete separata, partendo da un arrivo in
media o alta tensione dedicato (per dei carichi importanti).
,DCH@MSDK@RTCCHUHRHNMDCDHBHQBTHSHTMFT@RSNRTTMBHQBTHSN
deve interferire il meno possibile con un altro circuito.
Mediante la separazione dei circuiti che alimentano carichi
perturbanti. Questi circuiti sono separati dagli altri al livello Carico
catec 106 b 1 it cat

perturbante
OHŔ@KSNONRRHAHKDCDKKHMRS@KK@YHNMDHMA@RR@SDMRHNMDODQ Carico Circuiti
perturbante perturbati
ADMDjBH@QDCDKKHMCDANKHLDMSNCDKKDODQSTQA@YHNMHCNUTS@
NO SI
all’impedenza dei cavi.

2BDFKHDQDTMQDFHLDCHMDTSQN@C@SSN
Il regime IT garantisce una continuità d’esercizio evitando, per esempio, l’apertura dei circuiti mediante lo sgancio intempestivo
di un dispositivo differenziale in seguito alla perturbazione transitoria.

 RRHBTQ@QDK@RDKDSSHUHSĒCDKKDOQNSDYHNMH
La selettività delle protezioni permette di limitare l’apertura solamente al circuito guasto UDCDQDO@FHMDC@@D.

"TQ@QDK@LDRR@HMONR@CDKK@QDSDCDKKDL@RRD
,DCH@MSDKHLOH@MSNCHQDSHBNML@RRDOQNOQHDCDCHB@SD@BDQSD@OOKHB@YHNMHHMENQL@SHB@vNFMHQDSDUHDMDL@FKH@S@@KjMDCH
NSSDMDQDK@LHFKHNQDDPTHONSDMYH@KHSĐONRRHAHKDK@OHŔOHBBNK@QDRHRSDMY@SQ@HCHUDQRHOTMSHCDKK@QDSDCHL@RR@
(MSDQBNKKDF@MCNPTDRSDL@RRD@RSDKK@ HKOHŔUHBHMNONRRHAHKD@KO@KDSSNCHSDQQ@
Utilizzando i percorsi di cavi, delle canalizzazioni, dei tubi, delle linee metalliche regolarmente collegati alla massa e
intercollegati tra loro.
2DO@Q@MCNHBHQBTHSHODQSTQA@MSHC@HBHQBTHSHOHŔRDMRHAHKHBGDUDMFNMN@KHLDMS@SHC@KK@RSDRR@KHMD@
4SHKHYY@MCNHKOHŔONRRHAHKDKDL@RRDLDBB@MHBGD@QL@CH RSQTSSTQDvODQQD@KHYY@QDCDKKDL@RRDDPTHONSDMYH@KH
Collegamento alla struttura metallica
Informatica
Parafulmine Protezione metallica
Rete magliata
Separazione

Pannello
di
distribuzione
Motore Circuiti sensibili
catec 108 b it cat

o basso livello
B@SDBAHS

Ponticello di terra Circuiti


di potenza

488 Catalogo Generale 2012-2013 SOCOMEC


La distribuzione in bassa tensione

,QƃXHQ]HHVWHUQH
&Q@CNCHOQNSDYHNMD(/
(KFQ@CNCHOQNSDYHNMDĠCDjMHSNC@CTDBHEQDDDUDMST@KLDMSDC@TM@KDSSDQ@@FFHTMS@
2HRBQHUDQĐODQDRDLOHN(/NT(/WW!WRHFMHjB@U@KNQDHMCHEEDQDMSD
/HFLIUHHOHOHWWHUHDJJLXQWHVRQRGHĺQLWHTXLVRWWR
1a cifra 2a cifra Grado di
Protezione contro la penetrazione dei corpi solidi Protezione contro la penetrazione dei liquidi protezione
IP Tests IP Tests Lettera Descrizione
0 Nessuna protezione 0 Nessuna protezione aggiunta(2) abbreviata
ø 52,5 mm Protetto contro i corpi Protetto contro
Protetto contro
solidi di diametro le cadute verticali
1 1 A l’accesso della
superiore o uguale di gocce d’acqua
mano
a 50 mm (condensa)
ø 12,5 mm Protetto contro i corpi Protetto contro le
Protetto contro
solidi di diametro cadute di gocce
2(1) 2 B l’accesso con
superiore o uguale C@BPT@jMN@¦
un dito
a 12 mm dalla verticale
Protetto contro i corpi
Protetto contro Protetto contro
ø 2,5 mm solidi di diametro
3 3 K@BPT@@OHNFFH@jMN C l’accesso con
superiore o uguale a
@¦C@KK@UDQSHB@KD un attrezzo
2,5 mm
Protetto contro i corpi
Protetto contro i getti Protetto contro
ø 1 mm solidi di diametro
4 4 d’acqua in tutte le D l’accesso con
superiore o uguale
direzioni TMjKN
a 1 mm

Protetto contro Protetto contro i getti


5 le polveri (nessun 5 d’acqua dall’idrante
deposito nocivo) in tutte le direzioni

Protetto contro i getti


Totalmente protetto
6 6 d’acqua assimilabili
contro le polveri
a grosse onde

 DCTDOQHLDBHEQDB@Q@SSDQHRSHBGDRNMNCDjMHSDMDKKN
+ 15cm
Protetto adatta
stesso modo dalle norme  1m mini
all’immersione
-%$- ($"D#(-

Nota Esempio
+@RDBNMC@BHEQ@ğCDSDQLHM@S@C@CTDOQNUD un apparecchio è munito di un’apertura che permette l’accesso di
- MDRRTM@ODMDSQ@YHNMDCHTM@REDQ@CDKCH@LDSQNCH LL un dito. Non sarà classato IP2x. Invece, se le parti accessibili al dito
- MDRRTM@@BBDRRHAHKHSďCDKCHSNCHOQNU@CDKCH@LDSQNCHŭLL MNMRNMNODQHBNKNRDRGNBJDKDSSQHBN AQTBH@STQ@w K@OO@QDBBGHN
+@KDSSDQ@@FFHTMS@CDkMHRBDK@BBDRRNRNK@LDMSD@KK@O@QSH
potrà essere classato xxB.
pericolose.

&Q@CHCHOQNSDYHNMDBNMSQNFKHTQSHLDBB@MHBH
(M%Q@MBH@ K@-%"CDjMHU@TM@SDQY@BHEQ@BGDC@U@HKFQ@CNCHOQNSDYHNMDBNMSQNFKHTQSHLDBB@MHBH 0TDRS@SDQY@BHEQ@Ġ
sparita per lasciare il posto ad un grado IK (norme EN 50102, NF C 20015).
Correspondances IK / AG
Energia d‘urto (J) 0 0,15 0,2 0,35 0,5   1 2 5 6 10 20
Grado IK 0 1 2 3 4 5 6  8  10
"K@RRHjB@YHNMD &-%" AG1 AG2 AG3 AG4
5DBBGH@¦BHEQ@(/ 0 1 3 5  

SOCOMEC Catalogo Generale 2012-2013 489


Correnti di sovraccarico

"Si devono predisporre dispositivi di protezione per interrompere qualsiasi corrente di sovraccarico nei conduttori del circuito
prima che possa provocare un riscaldamento dannoso per l’isolamento, le connessioni, i terminali o per l’ambiente delle
canalizzazioni" (IEC 60364 § 433).

/DQPTDRSNRHCDjMHRBNMNKDRDFTDMSHBNQQDMSH
- Ib : corrente d’uso del circuito
- Iz : corrente ammissibile del conduttore
- In : corrente del dispositivo di protezione
- I2 : orrente che assicura effettivamente il funzionamento del dispositivo di protezione; in pratica I2ĠOQDR@TFT@KD
 @KK@BNQQDMSDCHETMYHNM@LDMSNMDKSDLONBNMUDMYHNM@KDODQFKHHMSDQQTSSNQH@TSNL@SHBH
 @KK@BNQQDMSDCHETRHNMDMDKSDLONBNMUDMYHNM@KDODQHETRHAHKHCHSHONF&

(BNMCTSSNQHRNMNOQNSDSSHRDRNMNRNCCHRE@SSDKDCTDBNMCHYHNMH
(b­(n­(z
(2­ (z

Esempio
Ib
Iz 1,45 Iz Alimentazione di un carico di 150 kW a 400 V trifase.
le
Co ibi za
Ib = 216 A corrente necessaria al carico
rre iss en
nt m er
ed ad ref i Caratteristiche In = 250 A carico del fusibile gG di protezione del circuito
’u nt
e di av
so rre re i c dei Iz = 298 A BNQQDMSDL@RRHL@@LLHRRHAHKDODQTMB@UNWŭLL2
Co lo de
Va conduttori
rispondente alle modalità di posa e alle condizioni
esterne fornite dal metodo indicato nelle pagine
seguenti
0 I2 = 400 A corrente di fusione del fusibile da 250 A
(1,6 x 250 A = 400 A)
Co
rre Caratteristiche
ale di nte
in del dispositivo 1,45 Iz = 1,45 x 298 = 432 A.
m ne fu co
nz nv
no zio
catec 018 b 1 it cat

e a ion en di protezione
nt ol am zio
rre reg en na Le condizioni 1 e 2 sono soddisfatte:
Co di to le
o Ib ­(n ­(z = 298 A
In I2
I2 ­ (z = 432 A.

Determinazione della corrente I2


"NQQDMSDBGD@RRHBTQ@HKETMYHNM@LDMSNDEEDSSHUNCDKCHRONRHSHUNCHOQNSDYHNMD
%TRHAHKHF&($"   Corente I2
"@KHAQN­ 2,1 In
 "@KHAQN  (n
&DOLEURĨ$ ,n
Interruttore automatico  (n

490 Catalogo Generale 2012-2013 SOCOMEC


Correnti di sovraccarico

Determinazione della corrente ammissibile Iz (secondo la norma IEC 60364)


Correnti ammissibili nei cavi
+@S@ADKK@BGDRDFTDENQMHRBDHKU@KNQDCDKK@BNQQDMSDL@RRHL@(z ammissibile per ciascuna sezione dei cavi di rame e alluminio.
3@KHU@KNQHU@MMNBNQQDSSHHMETMYHNMDCDHBNDEjBHDMSHRDFTDMSH
- Km BNDEjBHDMSDODQHKSHONCHONR@(vedere pagina 492)
- Kn BNDEjBHDMSDBGDSHDMDBNMSNCDKMTLDQNCHB@UHBNKKNB@SHHMRHDLD(vedere pagina 492)
- Kt BNDEjBHDMSDBGDSHDMDBNMSNCDKK@SDLODQ@STQ@@LAHDMSDDCDKSHONCHB@UN(vedere pagina 494).
(BNDEjBHDMSH*m, Kn et KtRNMNCDSDQLHM@SHHMETMYHNMDCDKKDB@SDFNQHDCHMRS@KK@YHNMDCDHB@UH! " $N%(vedere pagina 494).

+@RDYHNMDBNMRHCDQ@S@CDUDDRRDQDS@KDBGD
Ib
Iz®(z =
Km x Kn x Kt
(B@UHRHRTCCHUHCNMNHMCTDE@LHFKHD/5"D/1 (vedere tabella a pagina 494) +@BHEQ@BGDRDFTDK@RHFK@HMCHB@HKMTLDQNCH
B@UHRNSSNB@QHBN (B@UHHRNK@SHBNMDK@RSNLDQHB@TBBHŔ ATSHKD DBB RNMN@RRDFM@SH@KK@E@LHFKH@/1

Esempio
PVC 3 indica un cavo della famiglia PVC con 3 conduttori sotto carico (3 fasi o 3 fasi + neutro).

Tabella A
"@SDFNQH@ IzBNQQDMSDL@RRHL@@LLHRRHAHKDMDHBNMCTSSNQH 
! /5" /5" /1 /1
C PVC3 PVC2 PR3 PR2
E /5" /5" /1 /1
NC PVC3 PVC2 PR3 PR2
S mm2 in rame
          22 23 24 26
  24  27 30  33 
4 28 32 34 36 40 42  
   43 48    
10   60 63 70  80 86
   80  94   
   101 112  127 138  161
         200
 134 144  168   207  242
70     229   289 
 207 223 238  278  328  377
 239   299 322  382  437
   344 371  441 473 
   392 424    
240 403 430 461    641 
300  497      783
400    
 749   
630   1088 
S mm2 in alluminio
        21 23 24 26 28
4 22   28  32  38
6 28 32 33 36  42  
 39 44  49    
16   61 66 73 77 84 
 70 73 78 83 90 97   
 86   103 112 120 126  
         
70 133 140  160 174 187  211 237
      227   289
120 188  212 226  263 280 300 337
 227   283 304 324  389
  280  323 347 371  447
240  330  382 409 439 470 
300  381 406 440 471   613
400    740
 610  770 
  808 899 

SOCOMEC Catalogo Generale 2012-2013 491


Correnti di sovraccarico

Determinazione della corrente ammissibile Iz (secondo la norma IEC 60364) (seguito)


"NDEkBHDMSD*m

"@SDFNQH@ Tipo di posa Km


(a) (b) (c) (d)
1. In pareti termicamente isolate 0,77 - 0,70 0,77
 ,NMS@FFHN@UHRS@ HMRDQHSNRNSSNO@QDSDNRNSSNOQNjK@SN 1 -   -
!  (MB@UDCHBNRSQTYHNMDNBNMSQNRNEjSSH   -    
4. In canaline     -  
 (MB@M@KHMD LNC@M@STQD YNBBNKH - 1 -  
1. Cavi mono o pluriconduttori inseriti direttamente in una parete,
- - - 1
senza protezione meccanica
qRTTMLTQN - - - 1
C  "@UHjRR@SH
q@KRNEjSSN - - -  
3. Conduttori nudi o isolati su isolatore - 1,21 - -
 "@UHRTFTHCDCHB@UHMNMOQDENQ@SD - - - 1
1. Canaline porta-cavi preforate
E Cavi pluriconduttori su 2. Mensole, scale
o o - - - 1
NC Cavi monoconduttori su 3. Staffe distanziate dalla parete
4. Cavi sospesi a un cavo portante
(a) Conduttore isolato posto in un condotto.
(b) Conduttore isolato non posto in un condotto.
(c) Cavo posto in un condotto.
(d) Cavo non posto in un condotto.

"NDEkBHDMSD*n
Tabella A
"@SDFNQH@ Disposizione dei cavi Fattore di correzione Kn
Numero di circuiti o di cavi pluriconduttori
1 2 3 4  6 7 8  12 16 20
! " (MRDQHSHN@MMDF@SHMDKK@O@QDSD 1,00 0,80 0,70   0,60           0,40 0,40
Simple couche sur les murs ou les
1,00       0,73 0,72 0,72 0,71 0,70
C planchers ou tablettes non perforées
2DLOKHBDONR@RTKRNEjSSN   0,81 0,72 0,68 0,66 0,64 0,63 0,62 0,61 Nessun fattore
di riduzione
Semplice posa su ripiani orizzontali supplementare
preforati o ripiani verticali 1,00 0,88 0,82 0,77   0,73 0,73 0,72 0,72 per più di
E, F B@UH
Semplice posa su scale per cavi,
1,00 0,88 0,82 0,80 0,80     0,78 0,78
mensole, ecc.

0T@MCNHB@UHRNMNCHRONRSHRTOHŔRSQ@SH NBBNQQDLNKSHOKHB@QD*MODQ
Tabella B
Numero di strati 2 3 D 6a8 DOHŔ
"NDEjBHDMSD 0,80 0,73 0,70 0,68 0,66

Esempio
Su un ripiano preforato sono disposti :
- 2 cavi tripolari (2 circuiti a e b),
- 1 gruppo di 3 cavi unipolari (1 circuito c),
catec 046 b 1 it cat

- 1 gruppo formato da 2 conduttori per fase (2 circuiti d),


- 1 cavo tripolare per il quale si cerca Kn (1 circuito e).

a b c d e Il numero totale di circuiti è 6. Il metodo di riferimento è quello E


(ripiano preforato). Kn = 0,55.

IEC 60364 § 523.6


(MFDMDQ@KD ĠBNMRHFKH@SNLDSSDQDLDMNB@UHONRRHAHKDHMO@Q@KKDKN "NLTMPTD HKKNQNMTLDQNMNMCDUDRTODQ@QDPT@SSQN
/DQOHŔCHPT@SSQNĠBNMRHFKH@AHKDKTRNCHB@M@KHMD

N.B.: metodi particolarmente interessanti per la protezione di conduttori in parallelo contro le sovracorrenti tramite fusibili sono forniti nella
pubblicazione IEC 60364-4-41.

492 Catalogo Generale 2012-2013 SOCOMEC


Correnti di sovraccarico

Determinazione della corrente ammissibile Iz (secondo la norma IEC 60364) (seguito)


Modalità di posa
&DWHJRULD%

Conduttori isolati in Cavi pluriconduttori Conduttori isolati Cavi mono o Conduttori isolati Cavi mono o Conduttori isolati in Cavi mono o
condotti inseriti in in condotti inseriti in in condotti montati pluriconduttori in HMBNMCNSSH OQNjK@SH pluriconduttori in condotti inseriti in pluriconduttori in
pareti termicamente pareti termicamente a vista. condotti montati montati a vista. BNMCNSSH OQNjK@SH una parete. condotti inseriti in una
isolate. isolate. a vista. montati a vista. parete.

Categoria B - 2

Conduttori isolati Conduttori isolati Conduttori isolati in Cavi mono o Conduttori isolati in Cavi mono o
o cavi mono o o cavi mono o canaline inserite nei pluriconduttori in canaline sospese. pluriconduttori in
pluriconduttori in pluriconduttori in pavimenti canaline inserite nei canaline sospese.
B@M@KHMDjRR@SD@KKD B@M@KHMDjRR@SD@KKD pavimenti.
O@QDSHHMODQBNQRN O@QDSHHMODQBNQRN
orizzontale. verticale
Categoria B - 3

Cavi mono o Conduttori isolati in Cavi mono o Conduttori isolati in Cavi mono o Conduttori isolati Cavi mono o Cavi mono o
pluriconduttori in condotti nei vuoti di pluriconduttori in BNMCNSSH OQNjK@SHMDH pluriconduttori in HMBNMCNSSH OQNjK@SH pluriconduttori in OKTQHBNMCTSSNQH
cave di costruzione costruzione. condotti nei vuoti di vuoti di costruzione. BNMCNSSH OQNjK@SHMDH inseriti nella BNMCNSSH OQNjK@SH qMDHBNMSQNRNEjSSH
costruzione. vuoti di costruzione. costruzione. inseriti nella qMDHRNEjSSHRNRODRH
costruzione

Catagoria B - 4 &DWHJRULD%

TV

Cavi pluriconduttori Conduttori isolati Conduttori isolati in Cavi mono o Conduttori isolati in Conduttori isolati Conduttori isolati Conduttori isolati in
inseriti direttamente in condotti o cavi condotti in canaline pluriconduttori in modanature o cavi mono o in condotti o condotti o cavi mono
nelle pareti isolate multiconduttori in ventilate. canaline aperte o pluriconduttori in cavi mono o o pluriconduttori nei
termicamente. canaline chiuse, in ventilate. zoccolini scanalati. pluriconduttori nelle SDK@HCDKKDjMDRSQD
percorsi orizzontali o BNQMHBHCDFKHHMjRRH
verticali.
&DWHJRULD& Categoria C - 2 Categoria C - 3 Categoria C - 4

Cavi mono o Cavi mono o Cavi mono o Cavi mono o Conduttori nudi o isolati su isolatori. Cavi mono o pluriconduttori su passerelle
pluriconduttori pluriconduttori pluriconduttori, pluriconduttori, con porta-cavi o ripiani non perforati.
inseriti direttamente inseriti direttamente con o senza NRDMY@@QL@STQ@
nelle pareti, senza nelle pareti con @QL@STQ@jRR@SH@ jRR@SH@RNEjSSN
protezione meccanica protezione meccanica parete
supplementare. supplementare
&DWHJRULD(  H)  Categoria E - 2  e F - 2  Categoria E - 3  e F - 3  Categoria E - 4  e F - 4 

Su passerelle porta-cavi o ripiani preforati, Su mensole. Su scale per cavi. Fissati a staffe distanziate dalla parete. Cavi mono o pluriconduttori sospesi a un
in percorsi orizzontali o verticali. cavo portante o autoportante.

(1) Cavi pluriconduttori. (2) Cavi monoconduttore

SOCOMEC Catalogo Generale 2012-2013 493


Correnti di sovraccarico

Determinazione della corrente ammissibile Iz (secondo la norma IEC 60364) (seguito)


"NDEkBHDMSD*t
Tabella C
Temperatura ambiante Isolanti
(°C) Élastomero (caucciù) /5" /1$/1
10   1,22  
   
20   1,12 1,08
   
      
40   
 0,71   0,87
   
 - 0,61 0,76
 -  
 - -  
70 - - 
Esempio
Per un cavo isolato in PVC che si trova in un locale in cui la temperatura ambiente raggiunge i 40 °C. Kt = 0,87.

(CDMSHkB@YHNMDCDHB@UH

Tabella A: Esempi
equivalenze tra la vecchia e la nuova denominazione (cavi) Si vuole alimentare un carico trifase con neutro avente una corrente
5DBBGH@CDMNLHM@YHNMD Nuova denominazione nominale di 80 A (cioè Ib = 80 A). Il cavo utilizzato, di tipo U 1000
(norma nazionale) (norma armonizzata) R2V, è posato su un ripiano preforato con altri tre circuiti, a una
45&5 55 4NT1 temperatura ambiente di 40 °C.
86&1 H 07 RN - F Iz deve essere tale che:
4255 55 % Ib
8699 Iz®(z =
Km x Kn x Kt
7DEHOOD%FODVVLĺFD]LRQHGHLFDYL
"@UH/1 "@UH/5" Determinazione di I’z
U1000 1- %1 - 6 4 1 - tipo di posa : E quindi Km = 1 (vedere tabella pagina 492)
8 R2V )51 :$5 - numero totale di circuiti: 4 quindi Kn = 0,77 (vedere tabella A
U1000 15%5 %1 - 5+5 4 1 O@FHM@ŭ
8 RGPFV )51 9/9$5 - temperatura ambiante: 40 °C quindi Kt = 0,91 (vedere tabella C).
H 07 1- % H 07 55' % Da cui
FR-N 07 RN-F H 07 VVD3H2-F 
I’z = 
 1- % ' 55 % W W 
)51 ;; + VVH2-F
%1 - 7& %1 - 55 % Determinazione di Iz
)51 ;;=; )51 99&9) Il cavo U 1000 R2V è di tipo PR (vedi tabella B). Il numero di
%1 - 7&9&  55 % conduttori sotto carico è 3. Occorre pertanto andare alla colonna
FR-N 07 ;;) $ VVH2-F PR3 della tabella A di pagina 491 corrispondente alla categoria E.
  1HSNQSH Occorre scegliere Iz immediatamente superiore a I’z, e quindi
)51 ;'9$5$6$8 Iz = 127 A, che corrisponde a un cavo di rame di 3 x 25 mm2,
' 1- % protetto da un fusibile gG da 100 A, o a un cavo d’alluminio di
3 x 35 mm2, protetto da un fusibile gG da 100 A.
$ RN-F
' 11 %
$ RR-F

494 Catalogo Generale 2012-2013 SOCOMEC


Correnti di sovraccarico

Protezione delle canalizzazioni contro i sovraccarichi mediante fusibili gG


La colonna Iz dfornisce il valore della corrente massima ammissibile per ciascuna sezione dei cavi di rame e di alluminio,
RDBNMCNK@MNQL@($"DK@FTHC@43$ 
+@BNKNMM@%ENQMHRBDHKB@KHAQNCDKETRHAHKDF&@RRNBH@SN@KK@RDYHNMDD@KSHONCHB@UN
+DB@SDFNQHD! " $D%BNQQHRONMCNMN@HCHEEDQDMSHSHOHCHONR@CDHB@UH(vedere pagina 493).
(B@UHRHRTCCHUHCNMNHMCTDE@LHFKHD/5"D/1(vedere tabelle pagina 494) +@BHEQ@BGDRDFTDK@RHFK@HMCHB@HKMTLDQNCH
BNMCTSSNQHRNSSNB@QHBN/5"HMCHB@TMB@UNCDKK@E@LHFKH@/5"BNMBNMCTSSNQHRNSSNB@QHBNE@RHNE@RH
MDTSQN

Esempio: un cavo PR3 di rame di 25 mm2 installato in categoria E è limitato a 127 A e protetto da un fusibile da 100 A gG.

"@SDFNQH@ Corrente admissibile (Iz) protezione fusibile associato (F)


! /5" /5" /1 /1
C PVC3 PVC2 PR3 PR2
E /5" /5" /1 /1
NC PVC3 PVC2 PR3 PR2
S mm2
1@LD Iz NC Iz NC Iz NC Iz NC Iz NC Iz NC Iz NC Iz NC Iz NC
    10   10   16   16 22 16 23 20 24 20 26 20
   24 20  20 27 20 30    33   32
4 28  32  34  36 32 40 32 42 32  40  40
  32  32 43 40  40  40      
10  40   60  63  70 63  63 80 63 86 63
     80    94 80  80  80  
  80  80 101 80 112 100  100 127 100 138    161 
                 200 
 134 100 144    168   160  160 207 160  200 242 200
70         229 200  200   289   
 207 160 223 200 238 200  200 278    328    377 
 239 200  200   299  322    382    437 400
     344  371    441 400 473 400  400
     392  424   400  400    
240 403  430  461 400  400  400   641   
300  400 497 400  400         783 
400    630  630 840 800
 749   800  800  
630  630  800 1088 800  1000
KKTLHMHN
    10   10   16 21 16 23 20 24 20 26 20 28 
4 22   20  20 28    32   32 38 32
6 28 20 32  33  36 32  32 42 32  40  40
 39 32 44 40  40 49 40        
16  40   61  66  73 63 77 63 84 63  80
 70  73  78  83  90 80 97 80  80    
 86 80  80  80 103 80 112 100 120 100 126 100    
  80                
70 133 100 140    160  174 160 187 160  160 211 160 237 200
           227 200  200  200 289 
120 188 160  160 212 160 226 200  200 263  280  300  337 
 227 200  200  200 283  304  324    389 
  200 280    323  347  371    447 400
240   330    382  409  439 400 470 400  400
300   381  406  440 400 471 400  400   613 
400  400     740 
 610   630 770 630  630
   808  899 800  800

SOCOMEC Catalogo Generale 2012-2013 495


Correnti di corto circuito

Una corrente di corto circuito è una corrente provocata da un guasto d’impedenza trascurabile tra due punti dell’impianto che
presentano normalmente una differenza di potenziale:
- la corrente di corto circuito di cresta (Icc cresta)
corrispondente al valore estremo dell’onda, che genera Corrente
forze elettrodinamiche elevate, in particolare per le barre
di distribuzione e per i contatti o le connessioni delle
apparecchiature,
- la corrente di FRUWRFLUFXLWRHIðFDFH (IccDEEU@KNQDDEjB@BD
della corrente di guasto che provoca riscaldamenti degli
apparecchi e dei conduttori e può portare le masse dei
materiali elettrici a un potenziale pericoloso,
- la corrente di corto circuito minimo (IccLHMU@KNQDDEjB@BD
della corrente di guasto che si stabilisce nei circuiti a elevata

catec 131 a 1 it cat


impedenza (conduttore di sezione ridotta, canalizzazione di
considerevole lunghezza ecc.), nei quali inoltre tale impedenza
è aumentata dal riscaldamento della canalizzazione in guasto.
Occorre eliminare rapidamente questo tipo di guasto, detto
impedente, con i mezzi più opportuni.

Calcolo della Icc di una fonte di alimentazione


Con 1 trasformatore
Valutazione rapida in funzione della potenza del trasformatore:
Settori In Icc eff
127 / 220 V S (kVA) x 2,5 In x 20
220 / 380 V S (kVA) x 1,5 In x 20

Valutazione rapida in funzione della tensione di corto circuito del trasformatore (u):
S: potenza (VA) u: tensione di corto circuito (%)
S 100 x k
Icc (A eff) = x U: tensione concatenata (V) k: coefficiente per tenere conto delle
U 3 u impedenze a monte (0,8 per esempio).

Con "n" trasformatori in parallelo


T1 T2 T3
« n » numero dei trasformatori.
T1 ; T2 ; T3 identici. A B C
Corto circuito in A, B o C, gli apparecchi 1, 2 o 3 devono
sopportare:
1 2 3
IccA = (n-1) x Icc di un trasformatore (2 x Icc nell‘esempio
catec 132 a 1 x cat

di destra).
Corto circuito in D, l’apparecchio 4 deve sopportare: 4 D
IccD = n x Icc di un trasformatore (3 x Icc nell‘esempio di
destra). Corto circuito con più trasformatori in parallelo

Icc batterie
I valori di Icc a valle di una batteria di accumulatori sono approssimativamente:
Icc = 15 x Q (piombo aperta)
Icc = 40 x Q (piombo stagna)
Icc = 20 x Q (Ni-Cd)
Q (Ah) : capacità in Ampere-ora.

496 Catalogo Generale 2012-2013 SOCOMEC


Correnti di corto circuito

Calcolo della Icc di una fonte di alimentazione (seguito)


Icc dei gruppi generatori
L’impedenza interna di un alternatore dipende dalla sua costruzione. Che si può caratterizzare con due valori espressi in %:

la reattanza transitoria X’d :


- dal 15 al 20% di un turboalternatore,
- dal 25 al 35% per un alternatore a poli sporgenti (senza contare la reattanza subtransitoria).

la reattanza omopolare X’o:


Si può valutare nel 6 % in assenza di indicazioni più precise. Si può calcolare:

Icc3 = k3 x P
U0 x X’d P: Potenza dell’alternatore in kVA
U0 : Tensione di fase
X’d : Reattanza transitoria
Icc2 = 0,86 x Icc3 k3 = 0,37 per Icc3 max
k3 = 0,33 per Icc3 min
X’0 : Reattanza omopolare
Icc1 = k1 x P k1 = 1,1 per Icc1 max
U0 (2X’d + X’0) k1 = 1,1 per Icc1 min

Esempio: P = 400 kVA X’d = 30 % X’0 = 6 % U0 = 230 V

Icc3 max = 0,37 x 400 = 2,14 kA


230 x 30
100

1,1 x 400
Icc1 max = 230 x 2 x 30 + 6 = 2,944 kA Icc2 max = 1,844 kA
[ 100 100 ]

Calcolo della Icc di un impianto in bassa tensione


Generalità
Il calcolo delle correnti di corto circuito ha lo scopo di determinare: Il calcolo delle correnti di corto circuito può essere
il potere d’interruzione del dispositivo di protezione, effettuato secondo uno dei tre metodi seguenti:
la sezione dei conduttori che permettono:
- di sopportare la sollecitazione termica della corrente di Metodo convenzionale
corto circuito,
- di garantire l’apertura del dispositivo di protezione Consente di calcolare Icc min.
contro i contatti indiretti nei tempi prescritti dalle norme
IEC 60364, Metodo delle impedenze
la tenuta meccanica dei supporti del conduttore (sforzi
Il metodo delle impedenze consiste nel calcolare
elettrodinamici).
l’impedenza Z del circuito di guasto, tenendo conto
Il potere d’interruzione del dispositivo di protezione si
dell’impedenza della fonte d’alimentazione (rete, batterie,
determina a partire dalla Icc massima calcolata dai suoi
gruppo, ecc.). Questo metodo è preciso e permette di
morsetti.
calcolare Icc max. e Icc min., ma richiede la conoscenza dei
La sezione dei conduttori dipende dalla Icc minima calcolata
parametri del circuito in guasto (vedere pagina 499).
ai morsetti dell’utilizzatore.
La tenuta meccanica dei supporti dei conduttori è
determinata a partire dal calcolo della Icc di cresta dedotta Metodo rapido
dalla Icc massima. l metodo rapido va applicato nel caso in cui i parametri
del circuito di guasto non siano del tutto noti. La corrente
Dispositivo di
protezione
Utilizzatore di corto circuito Icc è determinata in un punto della rete,
conoscendo sia Icc a monte, sia la lunghezza e la sezione
catec 133 b 1 it cat

del collegamento nel punto a monte (vedere pagina 501)


PdC Icc max.
Icc cresta
Icc min. . Questo metodo fornisce solo il valore della Icc massima.

SOCOMEC Catalogo Generale 2012-2013 497


Correnti di corto circuito

Calcolo della Icc di un impianto in bassa tensione (seguito)


Metodo convenzionale
Fornisce il valore di Icc min. all’estremità di un impianto che non sia alimentato da un alternatore.

Icc = A x 0,8 U x S
2lL

U: tensione tra le fasi in V


L: lunghezza in metri della canalizzazione
S: sezione dei conduttori in mm2
l = 0,028 mW.m per il rame e protezione con fusibile
0,044 mW.m per l’alluminio e protezione con fusibile
0,023 mW.m per il rame e protezione con interruttore automatico
0,037 mW.m per l’alluminio e protezione con interruttore automatico
A = 1 per i circuiti con neutro (sezione neutro = sezione fase)
1,73 per i circuiti senza neutro
0,67 per i circuiti con neutro (sezione neutro = 1/2 sezione fase)

Per sezioni dei cavi superiori o uguali a 150 mm2, occorre tenere conto della reattanza dividendo il valore di Icc per: cavo da
150 mm2: 1,15 ; cavo da 185 mm2: 1,2 ; cavo da 240 mm2: 1,25 ; cavo da 300 mm2: 1,3

Metodo delle impedenze


Il metodo delle impedenze consiste nel sommare tutte le resistenze R e tutte le reattanze X del circuito a monte del corto
circuito (vedi pagina seguente), e poi nel calcolare l’impedenza Z.

ZLƄ = R2 LƄ+ X2 LƄ

Questo metodo permette di calcolare:

Icc3 : corrente di corto circuito trifase Icc cresta


Nel caso in cui sia necessario conoscere gli sforzi
Icc3 = 1,1 x U0
Z3 elettrodinamici, per esempio su un supporto delle barre,
occorre calcolare la Icc cresta:
U0 : tensione di fase (230 V in una rete 230 / 400)
Z3 : impedenza del circuito trifase (vedere pagina 500). Icc cresta (kA)= Icc eff (kA) x 2 x k
Icc2 : corrente di corto circuito tra 2 fasi
NFRHIðFLHQWHGLDVLPPHWULDIRUQLWRTXLVRWWR
Icc2 = 0,86 x Icc3
k = 1 in regime simmetrico (cos = 1).
K
Icc1 : corrente di corto circuito monofase 0,1 0,2 0,3 0,4 0,5 0,6 0,7
2,0

Icc1 = 1,1 x U0 1,9


Z1 1,8
1,7
U0 : tensione di fase (230 V in una rete 230 / 400)
Z1 : impedenza del circuito monofase (vedere pagina 500). 1,6
1,5
1,4
1,3
catec 134 a 1 x cat

1,2
1,1
R
1,0
0 0,1 0,2 0,3 0,4 0,5 0,6 0,7 0,8 0,9 1 1,1 1,2 X

Fig. 1

Nota: sarà ovvio utilizzare maggiormente il valore di R/X, più facilmente


utilizzabile in questo diagramma.

498 Catalogo Generale 2012-2013 SOCOMEC


Correnti di corto circuito

Calcolo della Icc di un impianto in bassa tensione (seguito)


Metodo delle impedenze (seguito)
Determinazione dei valori di « R » e di « X » (rete) R = resistenza X = reattanza
 @ S@ADKK@ PTH RNSSN ENQMHRBD H U@KNQH CH 1 D CH 7 ODQ KD CHUDQRD O@QSH CDK BHQBTHSN jMN @K OTMSN CDK BNQSN BHQBTHSN 
+
Per calcolare l’impedenza del circuito in guasto, occorrerà sommare separatamente le R e le X (vedere pagina 500) .
Schema Valori di R e di X
Rete a monte
Valori di “R” e di “X” a monte dei trasformatori ad alta, media e bassa tensione (400 V) in
funzione della potenza di corto circuito (Pcc in MVA) di questa rete.
MVA Rete 1LƄ 7LƄ
500 > 63 kV 0,04 0,35
250 > 24 kV vicino alle centrali 0,07 0,7
125 > 24 kV lontano dalle centrali 0,14 1,4
Se la potenza di corto circuito (Pcc) è nota
Uo tensione a vuoto (400 V o 230 V in AC a 50 Hz).
3,3 x U02
RLƄ= 0,1 x XLƄ XLƄ=
Pcc kVA

Trasformatori immersi con secondario a 400 V


Valori di “R” e “X” in funzione della potenza del trasformatore.
P (kVA) 50 100 160 200 250 400 630 1000 1250 1600 2000 2500
Icc3 (kA) 1,80 3,60 5,76 7,20 9,00 14,43 22,68 24,01 30,03 38,44 48,04 60,07
1LƄ 43,7 21,9 13,7 10,9 8,7 5,5 3,5 3,3 2,6 2,0 1,6 1,31
7LƄ 134 67 41,9 33,5 26,8 16,8 10,6 10,0 8,0 6,3 5,0 4,01

Conduttori
x I(m) con LƄWLL2
RLƄ= =

S(mm2) m

Resistività in10-6LƄ L
Icc maxi Icc mini
Protezione fusibile Protezione interrutore auto.
Rame 18,51 28 23
Alluminio 29,4 44 35
XLƄ = 0,08 x I(m) (avi multipolari o cavi monopolari in treccia)(1)
XLƄ = 0,13 x I(m) (cavi monopolari in guaina)(1)
XLƄ = 0,09 x I(m) (cavi monoconduttori separati)

XLƄ= 0,15 x I(m) (barra)(1)

(1) Rame e alluminio

Apparecchio in posizione chiusa

1D7 LƄ

SOCOMEC Catalogo Generale 2012-2013 499


Correnti di corto circuito

Calcolo della Icc di un impianto in bassa tensione (seguito)


Metodo delle impedenze (seguito)
Esempio di calcolo della Icc massima
Fasi Neutro Protezione
 rame = 18,51  alluminio = 29,4 Uo = 230 V R X R X R X

Rete: 250 MVA 1 LƄ 7 LƄ 0,07 0,7

Trasformatore
R = 3,5 mW 7 LƄ 3,5 10,6
de 630 kVA
Cavi: alluminio
Ph : I = 10 m Ph : R = 29,4 x 10 = 0,306 m Ƅ X = 0,13 x 10 = 0,325 m Ƅ 0,306 0,325
4 x 240 mm2 240 x 4 4

N : I = 10 m N: R = 29,4 x 10 = 0,612 m Ƅ X = 0,13 x 10 = 0,65 m Ƅ 0,612 0,65


2 x 240 mm2 240 x 2 2

PE : I = 12 m PE : R = 29,4 x 10 = 1,47 m Ƅ X = 0,13 x 12 = 1,56 m Ƅ 1,47 1,56


1 x 240 mm2 240
Apparecchio (protezione del trasformatore) 7 LƄ 0,15

Totale parziale: livello “arrivo” trasformatori


Icc 3,87 11,77 0,612 0,65 1,47 1,56
GLGLVWULEX]LRQHSULPDULD7*%7 Ī

Barre di Icc
distribuzione
rame I = 3 m

Ph : R = 18,51 x 3 = 0,055 m Ƅ X = 0,15 x 3 = 0,45 m Ƅ


Ph : 2 x 100 x 5 0,055 0,45
2 x 100 x 5

N: R = 18,51 x 3 = 0,011 m Ƅ X = 0,15 x 3 = 0,45 m Ƅ


N : 1 x 100 x 5 0,11 0,45
1 x 100 x 5

PE : R = 18,51 x 3 = 0,277 m Ƅ X = 0,15 x 3 = 0,45 m Ƅ


PE : 1 x 40 x 5 0,277 0,45
40 x 5
7RWDOHDOLYHOORGHOOHEDUUH Ī  3,925 12,22 0,722 1,1 1,75 2,01
All’arrivo nel trasformatori di distribuzione primaria All’arrivo sulle barre
Impedenza del circuito trifase: Impedenza del circuito trifase:
2 2
Z3 = Rph +X ph Z3 = Rph2 + Xph2

Z3 = (3,87)2 + (11,77)2  LƄ Z3 = (3,925)2 + (12,22)2  LƄ


1,1 x 230 V 1,1 x 230 V
Icc3 maxi = = 20,5 kA I’cc3 maxi = = 19,8 kA
 LƄ  LƄ
Icc2 maxi = 0,86 x 20,5 kA = 17,6 kA I’cc2 maxi = 0,86 x 19,8 kA = 17 kA
Impedenza del circuito monofase
R 3,925
= = 0,32 BNLDC@kFTQ@O@FHM@, k = 1,4
Z1 = (Rph + Rn)2 + (Xph + Xn)2 X 12,22

Z1 = (3,87 + 0,612)2 + (11,77 + 0,65)2 LƄ I’cc cresta = 19,8 x 2 x 1,4 = 39,2 kA
1,1 x 230 V
Icc1 = = 19,2 kA
 LƄ  TDRSNU@KNQDCH J CHBQDRS@ĠMDBDRR@QHNODQCDjMHQD
0
la tenuta dinamica delle barre e dell’apparecchiatura.
Impedenza del circuito monofase:

Z1 = (Rph + Rn)2 + (Xph + Xn)2

Z1 = (3,925 + 0,722)2 + (12,22 + 1,1)2 LƄ


1,1 x 230 V
I’cc1 = = 18 kA
 LƄ
Esempio di calcolo della Icc minima
Il calcolo della Icc minima è identico al calcolo precedente, sostituendo la resistività del rame e dell’alluminio con:
rame = 28 allu = 44

Impedenza del circuito monofase fase/neutro: Impedenza del circuito monofase fase/protezione:
Z1 = (4,11 + 1,085)2 + (12,22 + 1,1)2 LƄ Z1 = (4,11 + 2,62)2 + (12,22 + 2,01)2 LƄ
230 V 230 V
Icc1 mini = = 16 kA Icc1 mini = = 14,6 kA
 LƄ  LƄ

500 Catalogo Generale 2012-2013 SOCOMEC


Correnti di corto circuito

Calcolo della Icc di un impianto in bassa tensione (seguito)


Metodo rapido
Questo metodo rapido ma approssimativo permette di determinare Icc in un punto della rete conoscendo la Icc a monte e la
lunghezza e la sezione del collegamento al punto a monte (secondo la guida UTE 15-105).
Le tabelle che seguono valgono per le reti con tensione tra le fasi di 400 V (con o senza neutro).
Come procedere? Nella parte 1 (conduttori di rame) o 3 (conduttori d’alluminio) della tabella, trovare la riga corrispondente
@KK@RDYHNMDCDHBNMCTSSNQHCHE@RD 2ONRS@QRHPTHMCHKTMFNK@QHF@jMN@KU@KNQDHLLDCH@S@LDMSDHMEDQHNQD@KK@KTMFGDYY@CDKK@
B@M@KHYY@YHNMD #HRBDMCDQDQ@LDNQHR@KHQD@KKTLHMHNUDQSHB@KLDMSDKTMFNK@BNKNMM@jMN@KK@O@QSDCDKK@S@ADKK@DEDQL@QRH
alla riga corrispondente alla Icc a monte. Il valore che si trova all’intersezione è il valore di Icc cercato.
Esempio: Icc a monte = 20 kA, canalizzazione: 3 x 35 mm2 rame, lunghezza 17 m. Alla riga 35 mm2, la lunghezza immediatamente
inferiore a 17 m è 15 m. L’intersezione della colonna 15 m e della riga 20 kA da Icc a valle = 12,3 kA.

Sezione dei conduttori di fase (mm2) Lunghezza della canalizzazione in m


Rame 1,5 1,3 1,8 2,6 3,6 5,1 7,3 10,3 15 21
2,5 1,1 1,5 2,1 3,0 4,3 6,1 8,6 12 17 24 34
4 1,7 1,9 2,6 3,7 5,3 7,4 10,5 15 21 30 42
6 1,4 2,0 2,8 4,0 5,6 7,9 11,2 16 22 32 45 63
10 2,1 3,0 4,3 6,1 8,6 12,1 17 24 34 48 68 97 137
16 1,7 2,4 3,4 4,8 6,8 9,7 14 19 27 39 55 77 110 155 219
25 1,3 1,9 2,7 3,8 5,4 7,6 10,7 15 21 30 43 61 86 121 171 242 342
35 1,9 2,6 3,7 5,3 7,5 10,6 15 21 30 42 60 85 120 170 240 339 479
50 1,8 2,5 3,6 5,1 7,2 10,2 14 20 29 41 58 81 115 163 230 325 460
70 2,6 3,7 5,3 7,5 10,6 15 21 30 42 60 85 120 170 240 339
95 2,5 3,6 5,1 7,2 10,2 14 20 29 41 58 81 115 163 230 325 460
120 1,6 2,3 3,2 4,5 6,4 9,1 13 18 26 36 51 73 103 145 205 291 411
150 1,2 1,7 2,5 3,5 4,9 7,0 9,9 14 20 28 39 56 79 112 158 223 316 447
185 1,5 2,1 2,9 4,1 5,8 8,2 11,7 16 23 33 47 66 93 132 187 264 373 528
240 1,8 2,6 3,6 5,1 7,3 10,3 15 21 29 41 58 82 116 164 232 329 465 658
300 2,2 3,1 4,4 6,2 8,7 12,3 17 25 35 49 70 99 140 198 279 395 559
2 x 120 2,3 3,2 4,5 6,4 9,1 12,8 18 26 36 51 73 103 145 205 291 411 581
2 x 150 2,5 3,5 4,9 7,0 9,9 14,0 20 28 39 56 79 112 158 223 316 447 632
2 x 185 2,9 4,1 5,8 8,2 11,7 16,5 23 33 47 66 93 132 187 264 373 528 747
3 x 120 3,4 4,8 6,8 9,6 13,6 19 27 39 54 77 109 154 218 308 436 616
3 x 150 3,7 5,2 7,4 10,5 14,8 21 30 42 59 84 118 168 237 335 474 670
3 x 185 4,4 6,2 8,8 12,4 17,5 25 35 49 70 99 140 198 280 396 560
Icc a monte (kA) Icc al punto considerato(kA)
Icc 100 93,5 91,1 87,9 83,7 78,4 71,9 64,4 56,1 47,5 39,01 31,2 24,2 18,5 13,8 10,2 7,4 5,4 3,8 2,8 2,0 1,4 1,0
90 82,7 82,7 80,1 76,5 72,1 66,6 60,1 52,8 45,1 37,4 30,1 23,6 18,1 13,6 10,1 7,3 5,3 3,8 2,7 2,0 1,4 1,0
80 74,2 74,2 72,0 69,2 65,5 61,0 55,5 49,2 42,5 35,6 28,9 22,9 17,6 13,3 9,9 7,3 5,3 3,8 2,7 2,0 1,4 1,0
70 65,5 65,5 63,8 61,6 58,7 55,0 50,5 45,3 39,5 33,4 27,5 22,0 17,1 13,0 9,7 7,2 5,2 3,8 2,7 1,9 1,4 1,0
60 56,7 56,7 55,4 53,7 51,5 48,6 45,1 40,9 36,1 31,0 25,8 20,9 16,4 12,6 9,5 7,1 5,2 3,8 2,7 1,9 1,4 1,0
50 47,7 47,7 46,8 45,6 43,9 41,8 39,2 36,0 32,2 28,1 23,8 19,5 15,6 12,1 9,2 6,9 5,1 3,7 2,7 1,9 1,4 1,0
40 38,5 38,5 37,9 37,1 36,0 34,6 32,8 30,5 27,7 24,6 21,2 17,8 14,5 11,4 8,8 6,7 5,0 3,6 2,6 1,9 1,4 1,0
35 33,8 33,8 33,4 32,8 31,9 30,8 29,3 27,5 25,2 22,6 19,7 16,7 13,7 11,0 8,5 6,5 4,9 3,6 2,6 1,9 1,4 1,0
30 29,1 29,1 28,8 28,3 27,7 26,9 25,7 24,3 22,5 20,4 18,0 15,5 12,9 10,4 8,2 6,3 4,8 3,5 2,6 1,9 1,4 1,0
25 24,4 24,4 24,2 23,8 23,4 22,8 22,0 20,9 19,6 18,0 161 14,0 11,9 9,8 7,8 6,1 4,6 3,4 2,5 1,9 1,3 1,0
20 19,6 19,6 19,5 19,2 19,0 18,6 18,0 17,3 16,4 15,2 13,9 12,3 10,6 8,9 7,2 5,7 4,4 3,3 2,5 1,8 1,3 1,0
15 14,8 14,8 14,7 14,6 14,4 14,2 13,9 13,4 12,9 12,2 11,3 10,2 9,0 7,7 6,4 5,2 4,1 3,2 2,4 1,8 1,3 0,9
10 9,9 9,9 9,9 9,8 9,7 9,6 9,5 9,3 9,0 8,6 8,2 7,6 6,9 6,2 5,3 4,4 3,6 2,9 2,2 1,7 1,2 0,9
7 7,0 7,0 6,9 6,9 6,9 6,8 6,7 6,6 6,5 6,3 6,1 5,7 5,3 4,9 4,3 3,7 3,1 2,5 2,0 1,6 1,2 0,9
5 5,0 5,0 5,0 5,0 4,9 4,9 4,9 4,8 4,7 4,6 4,5 4,3 4,1 3,8 3,5 3,1 2,7 2,2 1,8 1,4 1,1 0,8
4 4,0 4,0 4,0 4,0 4,0 3,9 3,9 3,9 3,8 3,8 3,7 3,6 3,4 3,2 3,0 2,7 2,3 2,0 1,7 1,3 1,0 0,8
3 3,0 3,0 3,0 3,0 3,0 3,0 3,0 2,9 2,9 2,9 2,8 2,7 2,6 2,5 2,4 2,2 2,0 1,7 1,5 1,2 1,0 0,8
2 2,0 2,0 2,0 2,0 2,0 2,0 2,0 2,0 2,0 1,9 1,9 1,9 1,8 1,8 1,7 1,6 1,5 1,3 1,2 1,0 0,8 0,7
1 1,0 1,0 1,0 1,0 1,0 1,0 1,0 1,0 1,0 1,0 1,0 1,0 1,0 0,9 0,9 0,9 0,8 0,38 0,7 0,7 0,6 0,5
Sezione dei conduttori di fase (mm2) Longueur de la canalisation en m
Alluminio 2,5 1,3 1,9 2,7 3,8 5,4 7,6 10,8 15 22
4 1,1 1,5 2,2 3,0 4,3 6,1 8,6 12 17 24 34
6 1,6 1,7 2,5 3,5 4,9 7,0 9,9 14 20 28 40
10 1,5 2,1 2,9 4,1 5,8 8,2 11,6 16 23 33 47 66
16 2,2 3,0 4,3 6,1 8,6 12 17 24 34 49 69 98 138
25 1,7 2,4 3,4 4,8 6,7 9,5 13 19 27 38 54 76 108 152 216
35 1,7 2,4 3,3 4,7 6,7 9,4 13 19 27 38 53 75 107 151 213 302
50 1,6 2,3 3,2 4,5 6,4 9,0 13 18 26 36 51 72 102 145 205 290 410
70 2,4 3,3 4,7 6,7 9,4 13 19 27 38 53 75 107 151 213 302 427
95 2,3 3,2 4,5 6,4 9,0 13 18 26 36 51 72 102 145 205 290 410
120 2,9 4,0 5,7 8,1 11,4 16 23 32 46 65 91 129 183 259 366
150 3,1 4,4 6,2 8,8 12 18 25 35 50 70 99 141 199 281 398
185 2,6 3,7 5,2 7,3 10,4 15 21 29 42 59 83 117 166 235 332 470
240 1,6 2,3 3,2 4,6 6,5 9,1 13 18 26 37 52 73 103 146 207 293 414
300 1,4 1,9 2,7 3,9 5,5 7,8 11,0 16 22 31 44 62 88 124 176 249 352 497
2 X 120 1,4 2,0 2,9 4,0 5,7 8,1 11,4 16 23 32 46 65 91 129 183 259 366 517
2 x 150 1,6 2,2 3,1 4,4 6,2 8,8 12 18 25 35 50 70 99 141 199 281 398
2 X 185 1,8 2,6 3,7 5,2 7,3 10,4 15 21 29 42 59 83 117 166 235 332 470
2 X 240 2,3 3,2 4,6 6,5 9,1 12,9 18 26 37 52 73 103 146 207 293 414 585
3 X 120 2,1 3,0 4,3 6,1 8,6 12,1 17 24 34 48 69 97 137 194 274 388 549
3 x 150 2,3 3,3 4,7 6,6 9,3 13,2 19 26 37 53 75 105 149 211 298 422 596
3 x 185 2,8 3,9 5,5 7,8 11,0 15,6 22 31 44 62 88 125 176 249 352 498 705
3 X 240 3,4 4,8 6,9 9,7 13,7 19 27 39 55 78 110 155 219 310 439 621

SOCOMEC Catalogo Generale 2012-2013 501


Correnti di corto circuito

Protezione delle canalizzazioni


Le correnti di corto circuito provocano una sollecitazione termica nei conduttori. Per evitare il degrado degli isolanti dei cavi
(che potrebbe in seguito causare guasti d’isolamento) o un deterioramento dei supporti sbarre, occorre utilizzare conduttori
con le sezioni minime indicate qui sotto.

Coppie di barre
L’effetto termico della corrente di corto circuito al livello Icc (kA)
di una serie di barre si traduce nel riscaldamento dei S mini. (mm2) = 1000 x x t (s)
70
conduttori. Tale riscaldamento deve essere compatibile
S mini. : sezione minima per fase
con le caratteristiche dei supporti sbarre. IccBNQQDMSDDEkB@BDCHBNQSNBHQBTHSN
Esempio: per un supporto sbarre SOCOMEC (temperatura t : tempo di apertura del dispositivo di protezione.
sbarre di 80°C prima del corto circuito.
Vedere anche il calcolo sistema barre a pagina 586.

Conduttori isolati
La sezione minima si ottiene con l’espressione IEC 60364:
I (kA) Icc mini : corrente di corto circuito in kA eff. (vedere pagina 496)
S mini. (mm2) = 1000 x cc x t (s)
k t : tempo d’apertura del dispositivo di protezione in s
k : costante dipendente dall’isolante (vedere tabella B).

Tabella B: costante k IEC 60364


Condittori
Isolanti
Rame Alluminio
Conduttori attivi o di protezione che fanno parte della PVC 115 76
canalizzazione PR-EPR 143 94
Conduttori di protezione che fanno parte della canalizzazione PVC 143 95
PR-EPR 176 116
nudi(1) 159(1) 138(2) 105(1) 91(2)
1) Locali che non presentano rischi d’incendio. 2) Locali che presentano rischi d’incendio.

 DQDUHS@QDHKB@KBNKN RHONSQĐQHBNQQDQD@KK@S@ADKK@ BGDENQMHRBDHKBNDEjBHDMSDODQHKPT@KDNBBNQQDLNKSHOKHB@QDK@BNQQDMSDCH


/
corto circuito per ottenere la sezione minima.

Sezione mini. (mm2) = kcc x Icc mini. (kA)

Lunghezza massima dei conduttori


Una volta determinata la sezione minima dei conduttori, occorre accertarsi che il dispositivo di protezione posto a monte dei
conduttori si apra in un tempo compatibile con i limiti termici massimi dei conduttori. Perciò occorre che la corrente di corto
BHQBTHSNLHMHL@RH@RTEjBHDMSD@E@QDRB@SS@QDHKCHRONRHSHUNCHOQNSDYHNMD +@KTMFGDYY@CDHBNMCTSSNQHCDUDKHLHS@QRH@HU@KNQH
forniti nelle tabelle A e B a pagina 503 (fusibile).
7DEHOOD$FRHIĺFLHQWH.FF
Per una corrente di corto circuito di 1 kA eff
Sezione min. dei condutorri Sezione min. dei condutorri
attivi di rame di protezione di rame
Conduttori facenti Conduttori non facenti
Tempo di parte della canalizzazione parte della canalizzazione
Isolante PVC PR-EPR
interruzione en m/s
PVC PR PVC PR NUE
5 0,62 0,50 0,62 0,50 0,50 0,40 0,45
10 0,87 0,70 0,87 0,70 0,70 0,57 0,63
15 1,06 0,86 1,06 0,86 0,86 0,70 0,77
20 1,37 1,10 1,37 1,10 1,10 0,89 0,99
35 1,63 1,31 1,63 1,31 1,31 1,06 1,18
50 1,94 1,58 1,94 1,56 1,56 1,27 1,40
60 2,13 1,72 2,13 1,72 1,72 1,40 1,54
75 2,38 1,89 2,38 1,89 1,89 1,54 1,72
100 2,75 2,21 2,75 2,21 2,21 1,79 1,99
125 3,07 2,47 3,07 2,47 2,47 2,00 2,22
150 3,37 2,71 3,37 2,71 2,71 2,20 2,44
175 3,64 2,93 3,64 2,93 2,93 2,38 2,63
200 3,89 3,13 3,89 3,13 3,13 2,54 2,81
250 4,35 3,50 4,35 3,50 3,50 2,84 3,15
300 4,76 3,83 4,76 3,83 3,83 3,11 3,44
400 5,50 4,42 5,50 4,42 4,42 3,59 3,98
500 6,15 4,95 6,15 4,95 4,95 4,02 4,45
1000 8,70 6,99 8,70 6,99 6,99 5,68 6,29
Conduttori d’alluminio: moltiplicare i valori della tabella per 1,5.

502 Catalogo Generale 2012-2013 SOCOMEC


Correnti di corto circuito

Protezione della canalizzazioni con fusibili


Lunghezza massima dei conduttori protetti con fusibili
Le tabelle A e B forniscono le lunghezze massime alle seguenti condizioni:
- circuito trifase 230 V / 400 V,
- sezione del neutro = sezione di fase,
- corrente di corto circuito minima
- conduttori di rame.

Le tabelle sono valide indipendentemente dall’isolante dei cavi (PVC, PR, EPR). Quando sono indicati due valori, il primo
corrisponde ai cavi in PVC, il secondo ai cavi in PR/EPR.
+DKTMFGDYYDU@MMNLNKSHOKHB@SDODQHBNDEjBHDMSHCDKK@S@ADKK@"ODQFKH@KSQHTSHKHYYH
Cavo d’alluminio: moltiplicare le lunghezze delle tabelle per 0,41.
Tabella A: unghezze massime (in m) dei conduttori protetti con fusibili gG.

HP C 16 20 25 32 40 50 63 80 100 125 160 200 250 315 400 500 630 800 1000 1250
S (mm2)
1,5 82 59/61 38/47 18/22 13/16 6/7
2,5 102 82 49/56 35/43 16/20 12/15 5/7
4 131 89 76 42/52 31/39 14/17 8/10 4/5
6 134 113 78 67/74 31/39 18/23 10/12 7/9
10 189 129 112 74 51/57 27/34 19/24 9/12 7/9 3/4
16 179 119 91 67 49/56 24/30 18/23 9/11 5/7 3/4
25 186 143 104 88 59/61 45/53 22/27 13/16 7/9 4/5
35 200 146 123 86 75 43/52 25/36 14/18 8/11 4/5
50 198 167 117 101 71 45/74 26/33 16/22 8/11 5/7
70 246 172 150 104 80 57/60 34/42 17/22 11/14
95 233 203 141 109 82 62 32/40 20/25 9/11
120 256 179 137 103 80 51/57 32/40 14/18
150 272 190 145 110 85 61 42/48 20/24
185 220 169 127 98 70 56 27/34
240 205 155 119 85 68 43/46

Tabella B: lunghezze massime (in m) dei conduttori protetti con fusibili aM.

HP C
16 20 25 32 40 50 63 80 100 125 160 200 250 315 400 500 630 800 1000 1250
S (mm2)
1,5 28/33 19/23 13/15 8/10 6/7
2,5 67 47/54 32/38 20/24 14/16 9/11 6/7
4 108 86 69 47/54 32/38 22/25 14/17 9/11 6/7
6 161 129 104 81 65/66 45/52 29/34 19/23 13/15 9/10 6/7
10 135 108 88 68 47/54 32/38 21/25 14/16 9/11 6/7
16 140 109 86 69 49/55 32/38 21/25 14/17 9/11
25 135 108 86 67 47/54 32/38 21/25 14/16 9/11
35 151 121 94 75 58/60 38/45 25/30 17/20 11/13 7/9
50 128 102 82 65 43/51 29/36 19/24 13/15 8/10
70 151 121 96 75 58/60 38/45 25/30 17/20 11/13
95 205 164 130 102 82 65 43/51 29/34 19/23
120 164 129 104 82 65 44/52 29/35
150 138 110 88 69 55 37/44
185 128 102 80 64 51
240 123 97 78 62

7DEHOOD&FRHIĺFLHQWHGLFRUUH]LRQHSHUDOWUHUHWL
Casi di utilizzo "NDEjBHDMSD
Sezione del neutro = 0,5 x sezione fase 0,67
Circuito privo di neutro 1,73
(1) Si accede alla tabella con la sezione delle fasi.

SOCOMEC Catalogo Generale 2012-2013 503


Contatti diretti e indiretti

Protezione contro i contatti diretti


#DkMHYHNMD
 NMS@SSNCHQDSSNCHTM@ODQRNM@BNMTM@O@QSD@SSHU@E@RH 
" R
neutro) normalmente sotto tensione (sistema sbarre,
S
terminali, ecc.).
T

id

catec 011 b 1 it cat


Terra

"NMS@SSNCHQDSSN

Mezzi di protezione
La protezione contro i contatti diretti è assicurata da uno dei mezzi seguenti (decreto del 14/11/88):
mettendo fuori portata i conduttori attivi per mezzo di ostacoli o protezioni,
isolamento dei conduttori attivi,
barriera o cassetta: il grado di protezione minimo garantito dalla cassetta deve essere IP2x o xxB per le parti attive,
l’apertura di una cassetta deve essere possibile solo nei casi seguenti:
- con l’ausilio di un utensile o di una chiave,
- dopo avere tolto la tensione alle parti attive,
- se una seconda barriera IP > 2x o xxB si trova all’interno della cassetta UDCDQDCDkMHYHNMD(/O@FHM@,
impiego di dispositivi a corrente differenziale-residua di 30 mA (vedi oltre “Protezione supplementare contro i contatti diretti”),
utilizzo del TBT (tensioni molto basse).

Utilizzo del TBT


L’utilizzo del TBT SDMRHNMHLNKSNA@RRDUDCDQDCDkMHYHNMDO@FHM@ costituisce una protezione contro i contatti diretti e
indiretti. Possiamo distinguerli:
il TBTS (Un­5 "D­5#"
Tensioni molto basse di sicurezza che devono essere:
- prodotte da una rete come quella di un trasformatore di sicurezza, UPS, batterie, gruppo generatore…
- essere completamente indipendente da tutti gli elementi suscettibili di essere portato a un potenziale differente (terra di
una installazione differente, altri circuiti…),
il TBTP
Tensioni molto basse di protezione identiche al TBTS, ma che hanno una connessione a terra per delle ragioni funzionali
(elettronica informatica…). L’utilizzo del TBTP ha qualche restrizione in rapporto al TBTS a livello della protezione contro i
BNMS@SSHCHQDSSH@O@QSHQDC@5 "DC@5#"($"d
il TBTF
3DMRHNMH LNKSN A@RRD ETMYHNM@KH Q@FFQTOO@MN STSSD KD @KSQD @OOKHB@YHNMH CDK 3!3  $RRD MNM BNRSHSTHRBNMN TM@ OQNSDYHNMD
contro i contatti diretti o indiretti.

Protezione supplementare contro i contatti diretti


Indipendentemente dal regime del neutro, una protezione supplementare contro i contatti diretti è assicurata, in particolare,
C@KKTSHKHYYNCH##1@C@KS@RDMRHAHKHSĐ­L 
+DMNQLD($"HLONMFNMNHMO@QSHBNK@QDKTSHKHYYNCHS@KHCHRONRHSHUHMDHB@RHRDFTDMSH
BHQBTHSHCH@KHLDMS@YHNMDCDKKDA@RHCHOQDRDCHBNQQDMSD­
- installazioni temporanee, installazioni mobili,
- installazioni da cantiere,
- bagni, piscine,
- roulotte, imbarcazioni turistiche,
- alimentazione di veicoli,
- impianti agricoli,
B@UHDQHUDRSHLDMSHQHRB@KC@MSHM@RBNRSHMDKRTNKNNMDKKDO@QDSHCHTMDCHjBHN
3@KDCHRONRHYHNMDCHOQNSDYHNMDRTOOKDLDMS@QDBNMSQNHBNMS@SSHCHQDSSH RDBNMCNK@MNQL@($" MNMĠOHŔ@BBDSS@AHKD
PT@MCNK@SDMRHNMDCHBNMS@SSNQHRBGHCHQ@FFHTMFDQDH5KHLODCDMY@TL@M@QHRBGH@CHK@RBH@QDO@RR@QDTM@BNQQDMSD
ODQHBNKNR@RTODQHNQD@L

504 Catalogo Generale 2012-2013 SOCOMEC


Contatti diretti e indiretti

Protezione contro i contatti indiretti


#DkMHYHNMD
Il "contatto indiretto" è il contatto di una persona con masse R
messe accidentalmente sotto tensione in seguito a un
S
guasto d’isolamento.
T
La protezione contro i contatti indiretti si può ottenere:
- senza interruzione automatica dell’alimentazione N
- con interruzione automatica dell’alimentazione.

catec 012 b 1 it cat


id

Terra

"NMS@SSNHMCHQDSSN

Protezione senza interruzione automatica dell’alimentazione


La protezione contro i contatti indiretti senza interruzione automatica dell’alimentazione può essere assicurata con:
- L’utilizzo del TBT (tensioni molto basse) UDCDQDO@FHM@
- la separazione delle masse in modo tale che una persona non possa essere contemporaneamente in contatto con le due
masse,
- il doppio isolamento del materiale (classe II),
- la connessione equipotenziale, non collegata a terra, di tutte le masse accessibili contemporaneamente,
K@RDO@Q@YHNMDDKDSSQHB@BNMSQ@RENQL@SNQDODQBHQBTHSH5

Protezione con interruzione automatica dell’alimentazione


La protezione contro i contatti indiretti con interruzione automatica dell’alimentazione consiste nel separare dall’alimentazione
il circuito o il materiale che presentano un difetto d’isolamento tra una parte attiva e la massa.
/DQDUHS@QDDEEDSSHjRHNKNFHBHODQHBNKNRHODQTM@ODQRNM@BGDUDMF@@BNMS@SSNBNMK@O@QSDCHEDSSNR@ RHKHLHS@K@SDMRHNMDCH
contatto Uc a un valore limite UL.
Quest’ultimo dipende:
- dalla corrente IL ammissibile per il corpo umano,
- dal tempo di passaggio della corrente UDCDQDO@FHM@
- dallo schema del collegamento a terra,
- dalle condizioni dell’impianto.

Tensione di contatto presunta Tempo d‘interruzione massima del dispositivo di protezione (s)
5 UL5
 
50 5
  
90 0,45
110 -
120 0,34
  
220 0,17
230 -
280 0,12
 0,08
500 0,04

Questa esclusione della tensione dall’impianto si effettua diversamente a seconda degli schemi dei collegamenti (regimi del
neutro).
+DMNQLD($"CDjMHRBNMNHKSDLONCHMSDQQTYHNMDL@RRHLNCDKCHRONRHSHUNCHOQNSDYHNMDHMBNMCHYHNMHMNQL@KH4L =
5 4LĠK@SDMRHNMDCHBNMS@SSNOHŔDKDU@S@BGDRHOTŁL@MSDMDQDHMCDjMHS@LDMSDRDMY@ODQHBNKNODQKDODQRNMDUDCDQD
tabella).

SOCOMEC Catalogo Generale 2012-2013 505


Contatti diretti e indiretti

Protezione contro i contatti indiretti (seguito)


Protezione con interruzione automatica dell’alimentazione (seguito)
In regime TN e IT
Quando la rete non è protetta da un dispositivo differenziale, occorre assicurarsi del buon coordinamento tra il dispositivo
di protezione e la scelta dei conduttori. In effetti, se l’impedenza del conduttore è troppo elevata, si rischia di avere una
debole corrente di guasto, che fa scattare il dispositivo di protezione in un tempo superiore a quello prescritto dalla norma
($" 3@KDBNQQDMSDOQNUNB@@KKNQ@TM@SDMRHNMDCHBNMS@SSNODQHBNKNR@ /DQKHLHS@QDKHLODCDMY@CDKBHQBTHSN NBBNQQD
limitare la lunghezza dei conduttori di una data sezione.
Nota: K@ OQNSDYHNMD BNMSQN KD RNUQ@BNQQDMSH BNM HMSDQQTYHNMD @TSNL@SHB@ CDKK@KHLDMS@YHNMD ğ DEkB@BD RNKN HM OQDRDMY@ CH FT@RSH UDQH  -DKK@
OQ@SHB@ TMFT@RSNCHRNK@LDMSNOTŀOQDRDMS@QD CNUD@OO@QHRBD TMHLODCDMY@MNMSQ@RBTQ@AHKDBGDRS@ODQKHLHS@QDK@BNQQDMSDCHFT@RSN
(CHRONRHSHUHCHEEDQDMYH@KH1$282N(2.,#+1#TSHKHYY@SHBNLDOQD@KK@QLD RNMNLDYYHDEkB@BHODQOQDUDMHQDHFT@RSHHLODCDMSHDK@ODQRHRSDMY@
CHSDMRHNMHODQHBNKNRD

Tempo massimo d’interruzione


+DMNQLD($"RODBHjB@MNTMSDLONCHMSDQQTYHNMDL@RRHLNHMETMYHNMDCDKK@QDSDDKDSSQHB@DCDKK@SDMRHNMDKHLHSDCH5
Tabella A: tempo massimo d’interruzione in secondi del dispositivo di protezione
540­5 540­5 540­5 U05
Tempo d’interruzione (s) alternata continuo alternata continuo alternata continuo alternata continuo
Schema TN o IT 0,8  0,4  0,2 0,4 0,1 0,1
Schema TT 0,3  0,2 0,4   0,2 0,04 0,1
Caso particolare
(MQDFHLD3- HKSDLONCHMSDQQTYHNMDOTŁDRRDQDRTODQHNQD@KSDLONENQMHSNC@KK@S@ADKK@ RDLOQDQDRS@MCNHMEDQHNQD@R 
se:
il circuito non è un circuito terminale e non alimenta carichi mobili o portatili > 32 A,
risulti soddisfatta una delle due condizioni seguenti:
- il collegamento equipotenziale principale sia raddoppiato con un collegamento equipotenziale identico al collegamento
principale
 K@QDRHRSDMY@CDKBNMCTSSNQDCHOQNSDYHNMD1ODĠS@KDBGD
UNSDMRHNMDRDLOKHBDCHE@RD
 Z@HLODCDMY@BNLOQDMCDMSDK@ENMSDDHKBNMCTSSNQD@SSHUNEHMN@KOTMSN
1OD W1OD
9@
Uo CHFT@RSN

Lunghezza massima dei conduttori (L en ml)


La lunghezza limite dei conduttori può essere determinata con un calcolo approssimato, valido per impianti alimentati con un
trasformatore ad accoppiamento stella triangolo o stella-zig zag.
UNSDMRHNMDCHE@RD5HMTM@QDSD
Uo x S 2RDYHNMDHMLLDHBNMCTSSNQHCHE@RDHMQDFHLD3-D(3RDMY@MDTSQN
L=K L22OD2ODRDYHNMDCDK/$N/$-

L(d (CBNQQDMSDCHFT@RSNHM 
/QNSDYHNMDBNMETRHAHKDBNQQDMSDQ@FFHTMS@ODQTMSDLONCHETRHNMD
TFT@KD@KSDLONL@RRHLNC@ODQSTQ@CDKCHRONRHSHUNCHOQNSDYHNMDKD
KTMFGDYYDL@RRHLDRNMNENQMHSDMDKK@S@ADKK@!O@FHM@
*U@QH@AHKDHMETMYHNMDCDKQDFHLDCDKMDTSQNDCDKK@M@STQ@CDKBNMCTSSNQD
(vedere tabella B)
Tabella B: valori di K
Schema TN IT
"NMCTSSNQD senza neutro con neutro
1@LD   30  
Alluminio     11

Per sezioni inferiori ai 120 mm2RHSQ@RBTQ@KHMkTDMY@CDKKDQD@SS@MYD  KCHRNOQ@CHPTDRSNU@KNQD NBBNQQDL@FFHNQ@QDK@QDRHRSDMY@


CDK ODQK@RDYHNMDCHLL2,
ODQK@RDYHNMDCHLL2,
ODQK@RDYHNMDCHLL2,
ODQK@RDYHNMDCHLL2.
/DQRDYHNMHRTODQHNQHNBBNQQDE@QDTMB@KBNKNCHLODCDMY@DR@SSNBNM7 LƄL

506 Catalogo Generale 2012-2013 SOCOMEC


Contatti diretti e indiretti

Protezione contro i contatti indiretti (seguito)


Protezione con interruzione automatica dell’alimentazione (seguito)
In regime TT
In regime TT, la protezione è assicurata da dispositivi Fonte
differenziali. In questo caso, la sezione e la lunghezza dei
conduttori non intervengono.
Occorre semplicemente assicurarsi che la resistenza della
presa di terra sia tale che:
UL
13
I·M
U+SDMRHNMDKHLHSD
(·MBNQQDMSDCHQDFNK@YHNMDCDKCHRONRHSHUNCHEEDQDMYH@KD
Esempio:RHOTŀKHLHS@QDK@SDMRHNMDCHBNMS@SSNHMB@RNCHFT@RSN
@4+5 Utilizattore
(KCHRONRHSHUNCHEEDQDMYH@KDğQDFNK@SN@(·ML  

B@SDBAHSB@S
+@QDRHRSDMY@CDKK@OQDR@CHSDQQ@MNMCNUQďRTODQ@QD
5 RT
1T maxi = = 100
 
"NQQDMSDCHFT@RSNHMQDFHLD33

Effetto della corrente elettrica sul corpo umano


"NMHRTNHDEEDSSHjRHNO@SNKNFHBH K@BNQQDMSDBGD@SSQ@UDQR@HKBNQONTL@MNHMkTHRBDRTKKDETMYHNMHBHQBNK@SNQHDDQDROHQ@SNQHDD
può provocare gravi ustioni o addiritura causare la morte.

(ms) (ms)
10000 10000
a b c1 c2 c3 a b c1 c2 c3
5000 5000
Durata del passagio di corrente t
Durata del passagio dicorrente t

AC-4.1 AC-4.1
2000 AC-4.2 2000 AC-4.2
1000 AC-4.3 1000 AC-4.3
500 500
AC-1 AC-2 AC-3 AC-4 DC-1 DC-2 DC-3 DC-4
200 200
100 100
50 50
20 20
catec 144 b 1 it cat

B@SDBAHSB@S

10 10
0,1 0,2 0,5 1 2 5 10 20 50 100 200 500 2000 10000 (mA) 0,1 0,2 0,5 1 2 5 10 20 50 100 200 500 2000 10000 (mA)
1000 5000 1000 5000
Corrente che attraversa il corpo IB Corrente che attraversa il corpo IB

"NQQDMSD@KSDQM@SHU@C@@'Y "NQQDMSDBNMSHMT@

Le zone da -1 a -4 corrispondono ai diversi livelli di effetti:


"#" MDRRTM@ODQBDYHNMD
"#" ODQBDYHNMD RDMY@DEEDSSHjRHNKNFHBH
"#" DEEDSSHQDUDQRHAHKH BNMSQ@YHNMHLTRBNK@QH
"#" ONRRHAHKHSĐCHDEEDSSHHQQDUDQRHAHKH

SOCOMEC Catalogo Generale 2012-2013 507


Contatti diretti e indiretti

Protezione contro i contatti indiretti con fusibili


Lunghezza massima dei conduttori protetti con fusibili
La lunghezza dei conduttori protetti contro i contatti indiretti deve essere limitata.
+DS@ADKKD!D"ENQMHRBNMNTM@KDSSTQ@CHQDSS@CDKKDKTMFGDYYDL@RRHLDCDHBNMCTSSNQHCHQ@LD $RRDRNMNCDSDQLHM@SD@KKD
seguenti condizioni:
QDSD@5
- schema TN,
- tensione di contatto massima UL5
Ø ph
- = m = 1.
Š/$
/DQ@KSQHTSHKHYYH NBBNQQDLNKSHOKHB@QDHKU@KNQDSQNU@SNMDKKDS@ADKKD!D"ODQHKBNDEjBHDMSDCDKK@S@ADKK@
Tabella A
"NDEjBHDMSDCHBNQQDYHNMD
"NMCTSSNQDCH@KKTLHMHN  
Sezione neutro = 1/2 sezione fase (m = 2) 0,67
senza neutro  
1DFHLD(3
con neutro  
Tempo di interruzione de 5s admis. per canalizzazioni protette con fusilbili gG 1,88
(circuite di distribuzione) per canalizzazione protette con fusilbili aM 1,53

Tabella B: lunghezze massime (in m) dei conduttori protetti con fusibili gG


(A)
 20  32 40   80 100   200   400   800 1000 
S (mm2)
   40 32 22 18 13 11  8 4 3
2,5 88 66 53 36 31 21 18 12 9 7 6 4
4 141     33    11    4
6 212 159 127 87 73 50 43 29 22 16 14 10 8 6 4
10   212  122 84  48  28 23  14 10   4
16 566 424 339 231 196 134 116 77 59 43 36 25 22 15 12 9 7 5 4
 884      181 120    40  24 18 14 11 8  4
35 928 742 506 428 293 253 169 129 94 80 56 48 34 26 20 15 11 9 6
    343   128 108      20  12 8
70 856 586 506 337 259 189 159 11 97 67 52 39 30 22 17 11
        131    41  23 
120 868 578 444 323 273 191 166 116 89 67 62 37 23 20
   343  203  123     31 21
185 714 547 399 336 235 205 145 110 82 64 46 36 24
240       133 100   44 
300 566 477 334 290 202 155 117 90 65 51 34

Tabella C: lunghezze massime (in m) dei conduttori protetti con fusibili aM


(A)
 20  32 40   80 100   200   400   800 1000 
S (mm2)
  28 23 18 14 11     4
2,5 47 38 30 24 19 15 12 9 8 6 5
4   48 38 30 24   12 10 8   4
6 113 90 72 57 45 36 29 23 18 14 11 9 7 6 5 4
10 188  121    48 38 30 24   12 10 8   4
16 301 241 193 151 121 96 77 60 48 39 30 24 19 15 12 10 8 6 5 4
   302  188  120     38 30 24   12  8 
35 658 527 422 330 264 211 167 132 105 84 66 53 42 33 26 21 17 13 11 8
         144        23 18 14 11
70 845 660 527 422 335 264 211 169 132 105 84 67 53 42 33 26 21 17
         143        23
120 904 723 574 462 362 289 226 181 145 115 90 72 57 45 36 29
      248        40 32
185 744 586 469 375 293 234 188 149 117 94 74 59 47 38
240      234       
300 702 562 439 351 281 223 175 140 11 88 70 56
Esempio: 4MBHQBTHSNğBNRSHSTHSNC@TMB@UNCHQ@LDWLLOQNSDSSNBNMTMETRHAHKDC@ F& +@RT@KTMFGDYY@CNUQďDRRDQDHMEDQHNQD
@LODQBGĠK@OQNSDYHNMDBNMSQNHBNMS@SSHHMCHQDSSHRH@@RRHBTQ@S@HM3-55
2DHKB@UNğCH@KKTLHMHN K@KTMFGDYY@L@RRHL@ğCH WL L
(MRBGDL@(3BNMMDTSQNDB@UNC@KKTLHMHN K@KTMFGDYY@ğCH W WL L
(MRBGDL@(3BNMMDTSQNDB@UNC@KKTLHMHNODQTM@KHLDMS@YHNMDCH@QL@CHNCHO@QSDMY@TSDMYD K@KTMFGDYY@ğCH W W  L

508 Catalogo Generale 2012-2013 SOCOMEC


Contatti diretti e indiretti

Protezione contro i contatti indiretti con relè differenziale


In regime TT
La protezione differenziale rappresenta praticamente l’unico mezzo di protezione contro i contatti indiretti in questo regime.
/DQDUHS@QD ODQDRDLOHN TM@SDMRHNMDCHBNMS@SSNRTODQHNQD@5 NBBNQQDBGDK@BNQQDMSD(·MRH@S@KDBGD

I·M­
1p
1OQDRHRSDMY@CDKK@OQDR@CHSDQQ@HM

(MB@RNCHOQDRDCHSDQQ@C@KK@QD@KHYY@YHNMDO@QSHBNK@QLDMSDCHEjBHKD HBTHU@KNQHONRRNMNRTODQ@QDHKBDMSHM@HNCHNGL@KS@LNMS@FM@ 
YNMD@QHCDDBB  K@CHRONRHYHNMDOQDBDCDMSDOTŁDRRDQDRNCCHRE@SS@BNMKHMRS@KK@YHNMDCH@OO@QDBBGH@C@KS@RDMRHAHKHSĐ' 2 

In regime TNS
In questo regime, la corrente di guasto equivale a una
corrente di corto circuito tra fase e neutro. Quest’ultima
è eliminata con dispositivi adeguati (fusibili, interruttori
automatici ecc.) in un tempo compatibile con la protezione
contro i contatti indiretti. Quando questo tempo non può
essere rispettato (canalizzazioni troppo lunghe, per cui
(BB LHM  HMRTEjBHDMSD  SDLON CH QD@YHNMD CDFKH @OO@QDBBGH
di protezione troppo lungo ecc.), occorre accompagnare
B@SDBAWB@S

la protezione contro le sovracorrenti con una protezione


differenziale. Questa applicazione permette di garantire
una protezione contro i contatti indiretti, praticamente
indipendente dalla lunghezza della canalizzazione.

In regime TT
Normalmente non occorre aprire il circuito al primo guasto. Al secondo guasto si può produrre una tensione di contatto
pericolosa sia su masse collegate a prese di terra non interconnesse o lontane, sia tra masse accessibili simultaneamente e
collegate a una stessa presa di terra, con circuiti di protezione dall’impedenza troppo elevata.
Id
Per queste ragioni, in regime IT è obbligatorio un dispositivo
differenziale:
- all’origine delle parti dell’impianto alle quali sono collegate
le reti di protezione o le masse, con prese di terra non
interconnesse, CPI
- nella stessa situazione indicata in TNS (condizioni
d’interruzione al secondo guasto non assicurata dai
catec 148 b 1 it cat

dispositivi di protezione contro le sovracorrenti nelle


RA
condizioni di sicurezza richieste).

Protezione contro i contatti indiretti dei gruppi di masse collegate a prese di terra indipendenti
In regime di neutro TT come in IT, quando le masse
degli apparecchi elettrici sono collegate a prese di terra
separate a valle di una stessa alimentazione, ogni gruppo
di masse deve essere protetto rispettivamente da un
apposito dispositivo.
B@SDBAWB@S

Dispensa da protezione ad alta sensibilità (H.S.) sulle prese d’alimentazione degli apparecchi informatici
Gli apparecchi informatici possono presentare notevoli correnti di fuga, che ne rendono aleatorio l’utilizzo a valle di un
CHRONRHSHUNCHEEDQDMYH@KD@C@KS@RDMRHAHKHSĐ
(K LHMHRSDQN CDK K@UNQN G@ E@SSN TM@ OQNONRS@  BNM KNQCHM@MY@ CDKK  BGD jRR@ KD LNC@KHSĐ OQ@SHBGD ODQ K@
realizzazione di misure di protezione supplementari contro i contatti diretti; è pertanto possibile non installare
CHRONRHSHUH ' 2  ODQ KD OQDRD CH BNQQDMSD ů   BGD @KHLDMS@MN @OO@QDBBGH CH BK@RRD ( jRRH N RDLHjRRH  RD
l’interruzione di tali prese, non provocata da un guasto d’isolamento, sia incompatibile con le esigenze di servizio.
+@CDBHRHNMDRTKKNOONQSTMHSĐCHTRTEQTHQDCHPTDRS@CDQNF@ODQCDSDQLHM@SDOQDRDRODSS@DRBKTRHU@LDMSD@KB@ONQDO@QSN 3@KH
OQDRD@OONRHSD OQHUDCHOQNSDYHNMD' 2 CDUNMNDRRDQDRNSSNONRSD@TM@RODBHjB@HCDMSHjB@YHNMDODQHLODCHQMDKTSHKHYYNHM
applicazioni diverse.

SOCOMEC Catalogo Generale 2012-2013 509


Cadute di tensione

La caduta di tensione è la differenza di tensione osservata Tabella A: NF C 15100 caduta massima di tensione
tra il punto d’origine dell’impianto e il punto di collegamento Illuminazione Altri impieghi
di un‘utenza. Alim. diretta da rete di distribuz.
3% 5%
Per assicurare il buon funzionamento utilizzatori, le norme pubblica a bassa tensione
Alimentazione da stazione ad alta,
($"  CDjMHRBNMN TM@ B@CTS@ CH SDMRHNMD L@RRHL@ media e bassa tensione
6% 8%
(vedere tabella A).

Calcolo della caduta di tensione in un cavo di lunghezza L


·T*TW( W+JL

Tabella B: valori di Ku
Sezione Cavi pluriconduttori Cavi monoconduttori Cavi monoconduttori
Corrente o monoconduttori in trefolo messi insieme separati
del cavo
continua
mm2 cos 0,3 cos 0,5 cos 0,8 cos 0,3 cos 0,5 cos 0,8 cos 0,3 cos 0,5 cos 0,8
1,5 30,67 4,68 7,74 12,31 4,69 7,74 12,32 4,72 7,78 12,34
2,5 18,40 2,84 4,67 7,41 2,85 4,68 7,41 2,88 4,71 7,44
4 11,50 1,80 2,94 4,65 1,81 2,95 4,65 1,85 2,99 4,68
6 7,67 1,23 1,99 3,11 1,24 1,99 3,12 1,27 2,03 3,14
10 4,60 0,77 1,22 1,89 0,78 1,23 1,89 0,81 1,26 1,92
16 2,88 0,51 0,79 1,20 0,52 0,80 1,20 0,55 0,83 1,23
25 1,84 0,35 0,53 0,78 0,36 0,54 0,78 0,40 0,57 0,81
35 1,31 0,27 0,40 0,57 0,28 0,41 0,58 0,32 0,44 0,60
50 0,92 0,21 0,30 0,42 0,22 0,31 0,42 0,26 0,34 0,45
70 0,66 0,17 0,23 0,31 0,18 0,24 0,32 0,22 0,28 0,34
95 0,48 0,15 0,19 0,24 0,16 0,20 0,25 0,20 0,23 0,27
120 0,38 0,13 0,17 0,20 0,14 0,17 0,21 0,18 0,21 0,23
150 0,31 0,12 0,15 0,17 0,13 0,15 0,18 0,17 0,19 0,20
185 0,25 0,11 0,13 0,15 0,12 0,14 0,15 0,16 0,17 0,18
240 0,19 0,10 0,12 0,12 0,11 0,13 0,13 0,15 0,16 0,15
300 0,15 0,10 0,11 0,11 0,11 0,12 0,12 0,15 0,15 0,14
400 0,12 0,09 0,10 0,09 0,10 0,11 0,10 0,14 0,14 0,12
Circuiti monofase: moltiplicare i valori per 2.

Esempio
Un motore da 132 kW consuma 233 A a 400 V. È alimentato con cavi monoconduttori in rame, con sezione di 150 mm2 e lunghezza di
200 m (0,2 km).
In funzionamento normale cos = 0,8 ; Ku = 0,18
·T WW  5NRRH@ CH5
In avviamento diretto cos  DS(C(MW  *T 
·T WW  5NRRH@ CH5
+@RDYHNMDCDKBNMCTSSNQDğRTEkBHDMSDODQHKQHRODSSNCDKKDB@CTSDCHSDMRHNMDL@RRHLDHLONRSDC@KK@MNQL@($"
Nota
Questo calcolo è valido per 1 cavo per fase. Per n cavi per fase, basta dividere la caduta di tensione per n.

Metodo detto delle “Sezioni economiche”


La norma IEC 60364, che regolamenta l’installazione, Costo
autorizza un dimensionamento delle canalizzazioni con
cadute di tensione che possono raggiungere il 16 %
per circuiti monofasi. Per la maggiore parte dei circuiti
Costo globale
di distribuzione, la pratica è di accettare l’8 % che €
corrisponde alla proporzione di energia persa. La norma

($"  OQNONMD ODQCDjMHQDTM@B@M@KHYY@YHNMD TM Costo dei cavi
approccio complementare che prende in considerazione
l’investimento e il consumo di energia previsto. P=RI2
catec 258 a it cat

Sezione mm2
NF C 15100 IEC 60287-3-2

510 Catalogo Generale 2012-2013 SOCOMEC


Dispositivi di apertura

Norme di costruzione IEC 60947-1 e IEC 60947-3


#DkMHYHNMH
Interruttore (IEC 60947-3 § 2.1) Interruttore-sezionatore (IEC 60947-3 § 2.3)
" Apparecchio meccanico di collegamento capace: Interruttore che nella sua posizione di apertura
- di stabilire, di sopportare e di interrompere le RNCCHRE@KDBNMCHYHNMHCHHRNK@LDMSNRODBHjBGDODQ
correnti in condizioni normali (a) del circuito, ivi un sezionatore.
BNLOQDRDDUDMST@KLDMSDKDBNMCHYHNMHRODBHjBGD
di sovraccarichi di servizio,
CHRNOONQS@QDODQTM@CTQ@S@RODBHjB@CDKKDBNQQDMSH
in condizioni anomale del circuito come quelle del Interruttore-sezionatore con fusibili (IEC 60947-3 § 2.9)
corto circuito” (un interruttore può essere capace Interruttore-sezionatore nel quale uno o più poli
di stabilire delle correnti di corto circuito, ma di non hanno un fusibile in serie in un apparecchio
essere capace di aprirle). combinato.
* Le condizioni normali corrispondono di solito all’uso di
un’apparecchiatura in una temperatura ambiente di 40
°C per una durata di 8 ore. Apparechi

Azioni
Sezionatore (IEC 60947-3 § 2.2)
" Apparecchio meccanico di collegamento che Stabilire (1) (1) (1)

soddisfa, in posizione di apertura, le prescrizioni


Sopportare
RODBHjBGD ODQ K@ ETMYHNMD CH RDYHNM@LDMSN  Ì
capace di sopportare delle correnti in condizioni Interrompere (2)

normali del circuito e delle correnti per una durata 2NFKH@MNMEHRR@S@C@KK@MNQL@ #@KETRHAHKD
RODBHjB@HMBNMCHYHNMH@MNQL@KH ŭ
Corrente normale
2DYHNM@SNQDCDkMHYHNMD@AHST@KD@OO@QDBBGHNBGDMNMG@ Corrente di sovraccarico
il potere di chiusura e di apertura sotto carico. Corrente di cortocircuito

Funzioni
Azione di separazione dei contatti
Questa azione è assicurata dall’insieme degli apparecchi detti « adatti al sezionamento » che seguono la norma degli
apparecchi meccanici di collegamento, IEC 60947-3 o che seguono la norma IEC 60364 § 537-2.
+@UDQHjB@RDBNMCNK@MNQL@($" CDKKHCNMDHSĐ@KRDYHNM@LDMSNUHDMDDEEDSST@S@SQ@LHSDOQNUD
K@OQNU@CHDKDSSQHB@BGDCDjMHRBDTM@QDRHRSDMY@@KKHMMDRBN4imp: tensione di tenuta agli shock) che caratterizza la distanza
CH@ODQSTQ@CDHBNMS@SSHMDKK@QH@ #HRNKHSN4impJ5ODQ4e = 400/690 V,
- la misura delle correnti di fuga (IfBGDCDjMHRBDTM@QDRHRSDMY@CHHRNK@LDMSNMDKK@ONRHYHNMD@ODQS@B@Q@SSDQHYY@S@HMO@QSD
C@KKDKHMDDCHETF@  CH4e, If < 0,5 mA (apparecchio nuovo) e If < 6 mA (apparecchio al termine del ciclo di vita)
- il controllo della robustezza del meccanismo del dispositivo di comando e dell’indicatore di posizione il cui obiettivo è
PTDKKNCHBNMEDQL@QDK@EjC@AHKHSĐfLDBB@MHB@tCDKKDHMCHB@YHNMHCHONRHYHNMD +@OQNU@BNMRHRSD BNMK@OO@QDBBGHNAKNBB@SN
UNKNMS@QH@LDMSDHMONRHYHNMDf(t CH@OOKHB@QD ODQ@OQHQDK@OO@QDBBGHN TM@ENQY@SQDUNKSDRTODQHNQD@KKNRENQYNMNQL@KDRTK
dispositivo di comando.
(K KTBBGDSS@FFHN CDKK@OO@QDBBGHN HM ONRHYHNMD f.t MNM CDUD DRRDQD ONRRHAHKD CTQ@MSD K@OOKHB@YHNMD CH PTDRSN RENQYN 
+@OO@QDBBGHNMNMCDUDHMCHB@QDK@ONRHYHNMDf.tCNONK@OOKHB@YHNMDCDKK@ENQY@ 0TDRS@OQNU@MNMĠMDBDRR@QH@PT@MCN
esiste un altro mezzo del dispositivo di comando per indicare l’apertura dei contatti: indicatore meccanico di stato, solidale
@KK@A@QQ@CDHBNMS@SSH UHRHAHKHSĐCHQDSS@CDHBNMS@SSHv
0TDRS@ SDQY@ OQNU@ QHRONMCD @KK@ CDjMHYHNMD CDKK@ BGHTRTQ@ fOHDM@LDMSD @OO@QDMSDt ODQ @RRHBTQ@QD K@ ETMYHNMD CH
RDYHNM@LDMSNHMA@RRHRRHL@SDMRHNMD54­5 "D54­5#"
"DSSDCDQMHĠQDB@Q@BSġQHRSHPTDDRSCDL@MCġDO@QK@-%Ű"Ű R@TEONTQK@3!32NT3!3/4­5 "N5#"

Azione di apertura sotto carico e in sovraccarico


0TDRS@@YHNMDĠ@RRHBTQ@S@C@FKH@OO@QDBBGHCDjMHSHODQRS@AHKHQDD@OQHQDHMMNQL@KHBNMCHYHNMHCHB@QHBNDCHRNUQ@BB@QHBN
+DOQNUDCHPTDRSNSHONODQLDSSNMNCHB@Q@SSDQHYY@QDFKH@OO@QDBBGH@C@SSH@RS@AHKHQDD@C@OQHQDB@QHBGHRODBHjBH 0TDRSHTKSHLH
possono avere delle correnti di punta molto elevate con un cos molto basso (motore in fase di avviamento o a rotore
bloccato).
Queste caratteristiche corrispondono alle categorie di impiego degli apparecchi.

Azione di apertura in caso di corto circuito


4MHMSDQQTSSNQDCHL@MNUQ@MNMĠCDRSHM@SN@C@OQHQDTM@BNQQDMSDCHBNQSNBHQBTHSN 3TSS@UH@K@RT@SDMTS@CHM@LHB@CDUD
DRRDQDS@KDBGDDRRNRNOONQSHHKFT@RSNjMN@KK@RT@DKHLHM@YHNMDFQ@YHD@KCHRONRHSHUNCHOQNSDYHNMD@RRNBH@SN
Sugli interruttori con fusibili, il corto circuito è interrotto dai fusibili UDCDQDB@OHSNKNf/QNSDYHNMDETRHAHKHfO@FHM@D con il
FQ@MCDU@MS@FFHNCHKHLHS@QDKDBNQQDMSHCHFT@RSNCHENQSDHMSDMRHSĐ

SOCOMEC Catalogo Generale 2012-2013 511


Dispositivi di apertura

Norme di costruzione IEC 60947-1 e IEC 60947-3 (seguito)


Caratteristiche
Condizione e categoria di impiego che seguono la norma IEC 60947-3

Tabella A
Categoria d’impiego 4RN Applicazione
AC-20 DC-20 Chiusura e apertura a vuoto. Sezionatori (1)
Carichi resistivi compresi moderati Interruttori a monte dell’installazione o per utilizzatori resistivi
AC-21 DC-21
sovraccarichi. QHRB@KC@LDMSN HKKTLHM@YHNMD SQ@MMDK@LO@CD@RB@QHB@v
Carichi misti resistivi e induttivi compresi Interruttori nei circuiti secondari o per utilizzatori reattivi
AC-22 DC-22
moderati sovraccarichi. A@SSDQHDCHBNMCDMR@SNQH K@LO@CD@RB@QHB@ LNSNQHRGTMS@SHv
Carichi costituiti da motori o altri carichi (MSDQQTSSNQHBGD@KHLDMS@MNTMNNOHŔLNSNQHNTSHKHYY@SNQHRODBHjBH
AC-23 DC-23
fortemente induttivi. @RBDMRNQH DKDSSQNEQDMH LNSNQHHMRDQHDv
0TDRSH@OO@QDBBGH@SST@KLDMSDRNMNRNRSHSTHSHC@HMSDQQTSSNQH RDYHNM@SNQHODQDUHCDMSHLNSHUHCHRHBTQDYY@CDKK@L@MNUQ@

Poteri di apertura e di chiusura


Contrariamente agli interruttori automatici per i quali questi criteri designano le caratteristiche di sgancio o di chiusura su
corto circuiti che possano aver bisogno della sostituzione dell’apparecchio, i poteri di apertura e di chiusura per gli interruttori
corrispondono ai valori massimi di performance delle categorie di impiego.
(MRDFTHSN@PTDRSHTRHDRSQDLH KHMSDQQTSSNQDCNUQĐ@MBNQ@@RRHBTQ@QDKDRTDETMYHNMHDL@MSDMDQDKDRTDB@Q@SSDQHRSHBGD HM
particolare per quel che riguarda le resistenza alle correnti di fuga e al surriscaldamento.
Tabella B
I/Ie
Numero di 10
AC-23
Impianto Apertura cicli di
monovre
I/Ie cos I/Ie cos
AC-21 1,5 0,95 1,5 0,95 5
AC-22 3 0,65 3 0,65 5
AC-23 Ie­ 10 0,45 8 0,45 5 3
Ie > 100 A 10 0,35 8 0,35 3 AC-22

L/R (ms) L/R (ms)


catec 054 e 1 x cat

1,5
DC-21 1,5 1 1,5 1 5 AC-21
DC-22 4 2,5 4 2,5 5
0
DC-23 4 15 4 15 5 1 0,95 0,65 0,35

Resistenza elettrica e meccanica


Tabella C
+@MNQL@jRR@HKMTLDQNLHMHLNCHL@MNUQDDKDSSQHBGD@OHDMN
carico) e meccaniche (a vuoto) effettuate dall’apparecchio. Ie (A) ­ ­ ­ ­ > 2500
0TDRSD B@Q@SSDQHRSHBGD CDjMHRBNMN  HM SDNQH@  K@ jMD CDKK@ N° di
120 120 60 20 10
cicli/ora
vita utile dell’apparecchio che deve conservare le proprie
N° di manovre nella categoria A
caratteristiche, come è noto, di resistenza alla corrente di
a vuoto 8500 7000 4000 2500 1500
fuga e al surriscaldamento. Queste prestazioni sono legate
a pieno carico 1500 1000 1000 500 500
al calibro dell’apparecchio ed al suo utilizzo. In funzione
3NS@KD 10000 8000 5000 3000 2000
CDKKTSHKHYYNOQDUHRSN RNMNCDjMHSDCTDB@SDFNQHDCHHLOHDFN
-¦CHL@MNUQDMDKK@B@SDFNQH@!
complementari:
a vuoto 1700 1400 800 500 300
- cat A : manovre frequenti (a monte di un’utenza terminale),
a pieno carico 300 200 200 100 100
B@S!L@MNUQDMNMEQDPTDMSH@LNMSDCDKKHMRS@KK@YHNMD
3NS@KD 2000 1600 1000 600 400
o a livello della distribuzione).

Corrente di impiego Ie
La corrente di impiego (Ie) è determinata dalle prove di resistenza (meccanica e elettrica) e dalle prove relative al potere di
apertura e di chiusura.

Caratteristiche di corto circuito


Corrente di breve durata ammissibile (IcwU@KNQDDEjB@BDCDKK@BNQQDMSDBGDKHMSDQQTSSNQDOTŁRNOONQS@QDODQTMCDSDQLHM@SN
intervallo di tempo (1 secondo).
Corrente di chiusura su corto circuito (Icm) : valore di picco della corrente che l’apparecchio può sopportare quando viene
chiuso su un corto circuito.
"NQQDMSDCHBNQSNBHQBTHSNBNMCHYHNM@KDU@KNQDDEjB@BDCDKK@BNQQDMSDOQDRTMS@SNKKDQ@AHKDC@KKHMSDQQTSSNQDPT@MCNĠ@RRNBH@SN
@CTMETRHAHKDN@CTM@KSQNCHRONRHSHUNCHOQNSDYHNMD@SSN@KHLHS@QDKHMSDMRHSĐDK@CTQ@S@CDKBNQSNBHQBTHSN
3DMTS@CHM@LHB@U@KNQDCDKK@BNQQDMSDCHOHBBNBGDK@OO@QDBBGHNOTŁRNOONQS@QDPT@MCNĠBGHTRN
+@B@Q@SSDQHRSHB@jRR@S@C@KK@MNQL@ĠK@BNQQDMSD@LLHRRHAHKDCHAQDUDCTQ@S@Icw) da cui si deduce la tenuta dinamica minima.
Questa tenuta essenziale corrisponde al carico tollerabile dall’apparecchiatura senza che avvenga la saldatura dei contatti.

512 Catalogo Generale 2012-2013 SOCOMEC


Dispositivi di apertura

Norme di installazione IEC 60364


Sezionamento § 536-2
Questa funzione è destinata ad assicurare la messa fuori tensione di tutto o di una parte dell’impianto mediante la separazione
dell’installazione stessa o della parte in questione da qualsiasi sorgente di energia per ragioni di sicurezza.

Le azioni che conseguono dalla funzione di sezionamento possono essere distinte nel modo seguente:
- azione che interessa la totalità dei conduttori attivi,
- azione che può essere assicurata a vuoto a condizione che siano previste delle condizioni complementari che assicurino
TM@NOHŔ@ODQSTQDCHBNQQDMSDCHHLOHDFNBNMS@SSN@TRHKH@QHNCHOQD@ODQSTQ@ O@MMDKKNCHRDFM@K@YHNMDfCHUHDSNCHL@MNUQ@
RNSSNB@QHBNt DBB /DQTM@L@FFHNQDRHBTQDYY@ @SST@KLDMSDK@ODQSTQ@OTŁDRRDQD@RRHBTQ@S@C@TMCHRONRHSHUN@MBGDCNS@SN
di un potere di apertura sotto carico oltre che delle caratteristiche di sezionamento (interruttore di manovra - sezionatore),
- azione di separazione dei contatti.

Apertura per riparazione meccanica § 536-4


Questa funzione ha lo scopo di mettere e mantenere in stato di fermo una macchina per effettuare delle operazioni di
manutenzione o riparazione meccanica che possono comportare rischi di lesioni al personale oppure per fermi macchina di
lunga durata.
2HQHBGHDCDBGDKHMRS@KK@YHNMDCHPTDRSHCHRONRHSHUH @SSH@KKNRBNON KHQDMC@E@BHKLDMSDHCDMSHjB@AHKHDHCNMDH@KKTRNOQDUHRSN
I dispositivi di apertura per la riparazione meccanica devono realizzare la funzione di sezionamento e di apertura di emergenza.
/DQPTDRS@ETMYHNMDUHDMD@MBGDTSHKHYY@S@TM@B@RRDSS@CH@ODQSTQ@KNB@KDCHRHBTQDYY@
All’interno di queste cassette vengono di solito installati degli interruttori di manovra – sezionatori ad apertura visibile, per
@UDQK@ONRRHAHKHSĐC@KKDRSDQMNCHUDQHjB@QDK@ONRHYHNMDCDHBNMS@SSH +TRNCDKK@ODQSTQ@UHRHAHKDĠQHBGHDRSNODQHKQ@EENQY@LDMSN
dei sistemi di sicurezza per il personale chiamato a intervenire in zone pericolose, in particolare su le installazioni ad elevato
rischio meccanico dove la maniglia danneggiata non è più in grado di indicare con sicurezza la posizione dell’interruttore.

Apertura di emergenza § 536-3


0TDRS@ETMYHNMDG@KNRBNONCH@RRHBTQ@QDK@LDRR@ETNQHSDMRHNMDCDFKHTSHKHYY@SNQHDCDHBHQBTHSHSDQLHM@KH .UUDQNCHLDSSDQD
fuori tensione le utenze per prevenire i rischi di incendio, di ustione o di scosse elettriche. Legata a questa funzione è
K@ B@Q@SSDQHRSHB@ CH UDKNBHSĐ  CH E@BHKHSĐ CH @BBDRRN D CH HCDMSHjB@YHNMD CDK BNL@MCN CDKK@OO@QDBBGH@STQ@ RT BTH @MC@QD @
monovrare.
3@KDQ@OHCHSĐCHHMSDQUDMSNCHODMCDC@KKDBNMCHYHNMHCH@FHAHKHSĐCDHKNB@KHHMBTHRNMNHMRS@KK@SHFKHHLOH@MSH C@KKD@OO@QDBBGH@STQD
utilizzate o dalle persone presenti.

Le azioni che conseguono alla funzione di apertura di emergenza possono essere distinte nel seguente modo::
- azione da assicurarsi sotto carico,
- azione che deve interessare la totalità dei conduttori attivi.

Arresto di emergenza IEC 60204 § 10-7


Questa funzione si differenzia dall’apertura di emergenza per il fatto di prendere in considerazione i rischi legati alle parti in
movimento delle macchine.

Le azioni che conseguono alla funzione di arresto di emergenza possono essere distinte nel seguente modo:
- azione da assicurarsi sotto carico,
- azione che deve interessare la totalità dei conduttori attivi,
- considerazioni dell’eventuale frenatura.

Comando funzionale § 536-5


 TSHKHYYNQ@YHNM@KDCHTMHLOH@MSNDKDSSQHBNCDUDOQDUDCDQDK@ONRRHAHKHSĐCHTMHMSDQUDMSNKNB@KDRDMY@LDSSDQDETNQHRDQUHYHN
+
KHLOH@MSNRSDRRN .KSQD@KBNL@MCNRDKDSSHUN HKBNL@MCNETMYHNM@KDBNLOQDMCDK@BNLLTS@YHNMD HKCHRS@BBNB@QHBGH DBB

Le azioni che conseguono dalla funzione di comando funzionale possono essere distinte nel seguente modo:
- azione da assicurarsi sotto carico,
- azione che non deve interessare la totalità dei conduttori attivi (per esempio solo due fasi su tre di un motore).

SOCOMEC Catalogo Generale 2012-2013 513


Dispositivi di apertura

Scelta di un apparecchio di apertura


Scelta in funzione alla tensione di isolamento
+DSDMRHNMDCHHRNK@LDMSNCDjMHRBDK@SDMRHNMDL@RRHL@CHTSHKHYYNCDKK@OO@QDBBGH@STQ@HMBNMCHYHNMHMNQL@KHCDKK@QDSD
400 V
Esempio
(MTM@QDSD55 AHRNFMDQďRBDFKHDQDTM@OO@QDBBGHNHMBTHK@SDMRHNMDCHRNK@LDMSN
Ui®5UDCDQDkF 
(M TM@ QDSD  5 5  AHRNFMDQď OQDMCDQD HM BNMRHCDQ@YHNMD TM @OO@QDBBGHN HM BTH K@
tensione d’isolamento Ui®5

Ui ≥400V
catec 006 b 1 x cat

%HF 

Prove dielettriche
 DQB@Q@SSDQHYY@QDK@PT@KHSĐCHRNK@LDMSNCHDKDSSQHBNCHTM@OO@QDBBGHN K@MNQL@($" OQDUDCDKDRDFTDMSHOQNUD
/
SDMTS@@4impRTHMTNUH@OO@QDBBGHOQHL@CDKKDOQNUDBNQSN BHQBTHSH QDRHRSDMYDv
UDQHjB@CDKK@QHFHCHSĐCHDKDSSQHB@CNONPTDRSDOQNUDBNMK@SDMRHNMD W4i.

Tensione della tenuta agli urti Uimp


Essa caratterizza l’utilizzo di un apparecchio in condizioni Fulmine Uimp
anormali della rete per sovratensioni dovute ad esempio:
- all’azione del fulmine sulle linee aeree,
- alle manovre sulle apparecchiatura dei circuiti in alta
tensione.
catec 007 b 1 it cat

0TDRS@ B@Q@SSDQHRSHB@ DROQHLD @MBGD K@ PT@KHSĐ CHDKDSSQHB@


CDKK@OO@QDBBGHNDRDLOHN4imp = 8 kV).

Tenuta del apparechio a Uimp.

Scelta in base al regime di neutro


Rete trifase con neutro distribuito
Regime 2DYHNMDMDTSQN®RDYHNMDE@RD Sezione neutro < sezione fase
N R S T N R S T

33
(1)

PEN R S T PEN R S T

3-"

N R S T

3-2

N R S T N R S T

(3
con neutro
(2) (2)

Apertura Protezione

(KMDTSQNMNMğC@OQNSDFFDQDRDHKBNMCTSSNQDCHMDTSQNğOQNSDSSNBNMSQNHBNQSNBHQBTHSHC@KCHRONRHSHUNCHOQNSDYHNMDCDKKDE@RHDRDK@BNQQDMSD
L@RRHL@CHFT@RSNRTKMDTSQNğCHLNKSNHMEDQHNQD@KK@BNQQDMSDL@RRHL@@LLHRRHAHKDODQHKB@UN($"
+@LDRR@HMRDQUHYHNCHTMETRHAHKDRTKMDTSQNCDUDDRRDQDNAAKHF@SNQH@LDMSD@RRNBH@SN@TMCHRONRHSHUNCHRB@SSNETRHAHKDCDKKNRSDRRNETRHAHKD 
0TDRS@CDSDYHNMDCDUDOQNUNB@QDK@ODQSTQ@CDKKDE@RHBNQQHRONMCDMSHODQDUHS@QDHKETMYHNM@LDMSNCHTM@HMRS@KK@YHNMDRDMY@HKMDTSQN

514 Catalogo Generale 2012-2013 SOCOMEC


Dispositivi di apertura

Scelta di un apparecchio di apertura (seguito)


Dimensionamento del polo neutro in funzione della presenza di armoniche
Sezione del neutro < Sezione delle fasi
In presenza di armoniche della corrente di grado 3 e multipli di 3 di cui il tasso è inferiore a 15%.

Sezione del neutro = Sezione delle fasi


In presenza di armoniche della corrente di grado 3 e multipli di 3 di cui il tasso è compreso tra 15% è 33% (distribuzione per
K@LO@CD@RB@QHB@ CDHSTAHkTNQDRBDMSH ODQDRDLOHN

Sezione del neutro > Sezione delle fasi


In presenza di armoniche della corrente di grado 3 e multipli di 3 di cui il tasso è superiore a 33% (circuiti dedicati
all‘informatica per esempio), il paragrafo 524.2 della IEC 60364 propone una sezione uguale a 1.45 volte la sezione delle fasi.

Utilizzo in corrente continua


+DB@Q@SSDQHRSHBGDCHBNQQDMSDCHLOHDFNHMCHB@SDMDKB@S@KNFNFDMDQ@KDRNMNCDjMHSDODQK@jF  SQ@MMDRDUHDMDOQDBHR@SN
ŭONKHHMRDQHDŭ(MPTDRSNB@RN UDCDQDK@jF 

Esempio 1 :BNKKDF@LDMSNHMO@Q@KKDKNCDHONKH
4M@OO@QDBBGHN2(1". TR@SNRTTM@QDSD@5#"BNMTM@BNQQDMSDCHHLOHDFNCH MDKK@B@SDFNQH@#"CDUD@UDQDONKHHM
RDQHDODQONK@QHSď
catec 056b b 1 x cat
catec 056a b 1 x cat

%HF ONKNODQONK@QHS@ %HF ONKHHMRDQHDODQONK@QHS@

Esempio 2 :BNKKDF@LDMSNHMO@Q@KKDKNCDHONKH
OO@QDBBGHNONKHTSHKHYY@SNHMWONKHHMO@Q@KKDKN
/QDB@TYHNMDCHBNKKDF@LDMSNE@QDHMLNCNBGDK@BNQQDMSDRH@BNQQDSS@LDMSDQHO@QSHS@MDHCTDQ@LH
catec 057 b 1 x cat

Esempi d’uso
Uso per protezione
-DK B@RN CH TSHKHYYN CH @OO@QDBBGH BNM ANAHM@ CH RF@MBHN 2(#$1, 3  %42., 3 N (#$ ODQ K@ OQNSDYHNMD BNMSQN H BNMS@SSH
indiretti o contro i corto circuiti, bisogna tener conto dei tempi di apertura di questi apparecchi. L’intervallo di tempo tra il
momento in cui viene impartito il comando e l’apertura effettiva è inferiore a 0,05 sec.

Uso per commutazione di rete


Il tempo di manovra 0 - I o 0 - II va da 0,7 a 2,1 sec. a seconda degli apparecchi.
Il tempo di commutazione I - II va da 1,1 a 3,6 sec.

SOCOMEC Catalogo Generale 2012-2013 515


Dispositivi di apertura

Esempi d’uso (seguito)


Uso a monte di una batteria di condensatori
Scegliere in generale un interruttore di cui il calibro sia Ith
superiore a 1,5 volte il valore della corrente nominale della
batteria di condensatori (Ic).

catec 058 b 1 x cat


Ic
Ith > 1,5 Ic

Uso al primario di un trasformatore


Assicurarsi che il potere di chiusura dell’interruttore sia superiore al valore di picco della corrente transitoria di magnetizzazione
(Id) del trasformatore.

/NSDQDCHBGHTRTQ@Id Ith In

Tabella A

catec 059 b 1 x cat


/J5 50 100 160 250 400 630 1000 1250 1600 Id
Id / In 15 14,5 14 13 12 11 10 9 8,5
IdBNQQDMSDCHL@FMDSHYY@YHNMDCDKSQ@RENQL@SNQD.
InBNQQDMSDMNLHM@KDCDKSQ@RENQL@SNQD
Uso a monte di un motore
Apertura e sezionamento locale di sicurezza
In apertura locale di sicurezza, l’interruttore deve possedere la caratteristica AC-23 alla corrente nominale del motore (In).
Nei circuiti di alimentazione dei motori con avviamenti frequenti
ÌMDBDRR@QHNCDSDQLHM@QDK@BNQQDMSDSDQLHB@DPTHU@KDMSD
(Ithq). Ith
Le correnti ed i tempi di avvio sono molto variabili a
catec 060 b 1 x cat

seconda del tipo di motore e dell’inerzia del rotore o del


Ith
volano o dell’apparecchio che il motore trascina. Di solito
si trovano, per un avvio diretto, i seguenti range di valori:
- corrente di picco: 8 a 10 In, $RDLOHCHCDBK@RR@LDMSNHMETMYHNMDCDKSHONCH@UUH@LDMSN
- durata della corrente di picco: 20 a 30 ms,
- corrente di avvio Id : 4 a 8 In, Ithq = In x Kd et Ith®(thq
- tempo di avviamento td : da 2 a 4 sec.

Tabella B
Id(4)
3HONCH@UUHU@LDMSN td(4)(s) n(1) Kd(2)
In
n
#HQDSSNjMN@J6 6a8 0,5 a 4 n > 10
3,16
n
8 ·(d/3) 2 a 2,5 3a6 n > 85
9,2
n
diretto-motori a grande inerzia(3) 6a8 6 a 10 n>2
1,4
MMTLDQNCH@UUH@LDMSHODQNQ@@O@QSHQDC@KPT@KDğMDBDRR@QHNCDBK@RR@QDK@OO@QDBBGHN
*dBNDEkBHDMSDCH@UUH@LDMSN®
5DMSHK@SNQD ONLODw
5@KNQHLDCHLNKSNU@QH@AHKH@RDBNMC@CDKSHONCHLNSNQHDCDFKHTSHKHYY@SNQH

In caso di sovraccarichi ciclici (ecluso l’avviamento)


/DQ TSHKHYY@SNQH O@QSHBNK@QH R@KC@SQHBH  LNSNQH  BGD FDMDQ@MN
picchi ciclici di corrente, il calcolo della corrente equivalente corrente (in A)
I1
(Ithq) può essere efettuato nel modo seguente:
(I21 x t1) + (I22 x t2) + In 2 x (tc - [t1 + t2])
Ithq = I2
tc
(BNQQDMSDCHHMRDQYHNMDCDKKTSDMY@ In
catec 061 b 1 it cat

t (in sec.)
(BNQQDMSDDUDMST@KDCHRNUQ@BB@QHBNHMSDQLDCHN I0 t1 t2
InBNQQDMSD@QDFHLD tc ciclo di carico
SDSCTQ@S@HMRDBNMCHQHRODSSHU@LDMSDCDKKDBNQQDMSH(D(
SBCTQ@S@ HM RDBNMCH CDK BHBKN BNM TM KHLHSD HMEDQHNQD kRR@SN @
ŭRDBNMCH Funzionamento ciclico.

516 Catalogo Generale 2012-2013 SOCOMEC


Dispositivi di apertura

Limiti d’uso
 DQSDBNMCHYHNMHCTSHKHYYNHLONMFNMNCHLNCHjB@QDK@BNQQDMSDSDQLHB@LDCH@MSDTME@SSNQDCHBNQQDYHNMDDCHMNMRTODQ@QD
"
il valore così ottenuto.

Kt correzione dovuta alla temperatura


Temperatura dell’aria nella vicinanza dell’apparecchio
Tabella A: fattori di correzione in funzione della temperatura ta Metodo veloce.
Kt : fattore di correzione
Ithu­(th x Kt
0,9 ¦"S@­¦"
0,8 ¦"S@­¦" 4MB@KBNKNOHŔOQDBHRNOTŁDRRDQDE@SSNHMETMYHNMDCHNFMH
0,7 ¦"S@­¦" uso: consultarci.
Utilizzo in combinazione con fusibili
Metodo veloce.
4MHMSDQQTSSNQDCDUDDRRDQDCDBK@RR@SNCHTME@SSNQD PT@MCNKDA@RHCDHETRHAHKHRNMNCHQDSS@LDMSDBNKKDF@SD@HKNQNLNQRDSSH
Esempio:TMRDYHNM@SNQDBNLAHM@SNC@ R@QďBNLONRSNC@TMHMSDQQTSSNQDC@ DCHETRHAHKHC@ F&

4MB@KBNKNOHŔOQDBHRNĠONRRHAHKDHMETMYHNMDCDHCHUDQRHDRDLOHCTRNBNMRTKS@QBH

Altri declassamenti in funzione della temperatura


(MSDQQTSSNQHBNMETRHAHKHODQETRHAHKH41
4SHKHYYN BNMSHMTN RT SQD STQMH  (M BDQSH B@RH Ġ MDBDRR@QHN TM CDBK@RR@LDMSN ODQ ETMYHNM@LDMSN @ OHDMN B@QHBN G
consultarci.

Kf correzione dovuta alla frequenza


Tabella B: fattori di correzione in funzione della frequenza f
Kf : fattore di correzione
Ithu­(th x Kf
0,9 100 Hz < f­'Y
0,8 1000 Hz < f­'Y
0,7 2000 Hz < f­'Y
0,6 6000 Hz < f­'Y

Ka correzione dovuta all’altitudine


Tabella C: fattori di correzione in funzione dell’altitudine A Nessun declassamento in Ith.
L ­L L ­L #DBK@RR@LDMSNHM4DD(DU@KHCNHMBNQQDMSD@KSDQM@S@DHM
 e
4 0,95 0,80 corrente continua.
Ie 0,85 0,85

Kp correzione dovuta alla posizione dell’apparecchio


Collegamento degli interruttori Montaggio e senso di posa degli interruttori
#@K LNLDMSN BGD K@ SNS@KHSĐ CDFKH @OO@QDBBGH BGD
BNLONMFNMN K@ F@LL@ 2.".,$" RNMN @ CNOOH@ Ithu­Ith x Kp
@ODQSTQ@ODQONKNSQ@MMD%42$1!+." %42., 3
 D2(#$1, 3BNLAHM@SH K@KHLDMS@YHNMD@LNMSD
o a valle dell’apparecchio può essere realizzata senza
particolari precauzioni, eccezion fatta per le regole di
localizzazione richieste in caso di alimentazione dal basso. Kp = 0,95 Kp = 0,9

Kp = 1
catec 121 b 1 x cat
catec 120 b 1 x cat

2DMRNCDKLNMS@FFHN #DBK@RR@LDMSNHMETMYHNMDCDKK@ONRHYHNMD

SOCOMEC Catalogo Generale 2012-2013 517


Protezione fusibile

Caratteristiche generali
Il compito di un fusibile è quello di interrompere un circuito elettrico quando questi è soggetto ad una corrente di guasto.
Inoltre, il fusibile ha il vantaggio di limitare considerevolmante le correnti di guasto (vedere esempio qui sotto). La caratteristica
DRRDMYH@KDCDKETRHAHKDĠPTDKK@CHDRRDQDTMCHRONRHSHUNCHOQNSDYHNMD@EjC@AHKD RDLOKHBDDCDBNMNLHBN
Le caratteristiche tecniche del fusibile da tenere in considerazione per una scelta ottimale sono:
tempo di prearco
Tempo necessario ad una corrente per portare alla fusione, e successivamente allo stato di vapore, l’elemento fusibile.
Il tempo di prearco è indipendente dalla tensione della rete.
tempo d’arco
Periodo compreso tra l’istante in cui appare l’arco e la sua estinzione totale (corrente nulla). Il tempo di arco dipende dalla corrente
della rete, ma per i tempi di fusione totale > 40 ms è trascurabile rispetto al tempo di prearco.
tempo di fusione totale
Somma dei tempi di prearco e d‘arco.
potere di apertura
5@KNQDCDKK@BNQQDMSDCHBNQSNBHQBTHSNOQDRTMS@BGDHKETRHAHKDĠHMFQ@CNCHHMSDQQNLODQD@CTM@SDMRHNMDCHHLOHDFNRODBHjB@
t
sollecitazione termica, o I2 dt ĭ
Valore dell’integrale della corrente di interruzione nell’unità di tempo di fusione totale espressa in A2s (Ampere quadrato al
secondo).

Limitazione della corrente di corto circuito


I
I due parametri da prendere in considerazione per la
limitare la corrente di corto circuito sono: Corrente
di pico
- la corrente di cresta realmente raggiunta nel circuito da presunta
proteggere
K@BNQQDMSDDEjB@BDOQDRTMS@ BGDRHRUHKTOODQDAADRDHK Icc eff
circuito fosse privo di fusibile. Corrente presunta
di pico
reale
Il diagramma di limitazione indica la corrispondenza tra questi
due parametri (vedere pagine 525 e 527) Per conoscere la t
corrente di picco, che può realmente svilupparsi nel circuito
elettrico protetto da un fusibile, bisogna: 1 2

- B@KBNK@QD K@ BNQQDMSD CH BNQSN BHQBTHSN DEjB@BD L@RRHL@


catec 036 b 1 it cat

1 Tempo di prearco
(vedere pagina 498) ,
2 Tempo di arco
- riportare questa corrente sul diagramma di limitazione 1+2 Tempo totale di fusione
e leggere il valore di picco in funzione del calibro del
fusibile che protegge il circuito. Osservazione : c’è restrizione solo se tpréarcoŭLRQDSD'Y

Esempio: Si desidera limitare una corrente di corto circuito di 100 kA eff. utilizzando un fusibile 630 A gG.
La corrente eff. presunta di 100 kA eff. conduce ad una corrente di cresta presunta di: 100 x 2,2 = 220 kA.
(KETRHAHKDHME@SSHKHLHS@K@BNQQDMSDCHOHBBN@J BGDQ@OOQDRDMS@HKCDKRTNU@KNQDOQDRTMSNUDCDQDkFTQ@OQNUNB@MCNHMS@KLNCN
TM@QHCTYHNMDCDFKHRENQYHDKDSSQNCHM@LHBH@KCDKU@KNQDRDMY@ETRHAHKDmQHCTYHNMDPTHMCHCDK UDCDQDkFTQ@DTM@CHLHMTYHNMDCDKK@
RNKKDBHS@YHNMDSDQLHB@KHLHS@S@@K CDKRTNU@KNQDUDCDQDkFTQ@
220 kA cdi pico presunti

50 kA di pico
100 kA eff. presunti

catec 038 b 1 it cat


50 kA di pico

50 kA di pico
Fusibile gG
630A 220 kA di pico presunti

Fig. 2 : limitazione degli sforzi elettrodinamici proporzionale al


quadrato della corrente.
Tp. Ta. ti
sun
pre
ico
di p
kA.
0
Tt. = 0,005s 22
220 kA.di pico pre’sunti

eo
ptic
0,02s cri ê
.d
50 kA. di pico

kA
50
catec 039 b 1 it cat
catec 037 b 1 it cat

Tt.
=0
0,0 ,005
2s s

Fig. 1 : limitazione della corrente di picco. Fig. 3 : limitazione della sollecitazione termica I x I x t.

518 Catalogo Generale 2012-2013 SOCOMEC


Protezione fusibile

Scelta di un fusibile “gG” o “aM”


La scelta di una protezione con fusibile deve essere fatta in funzione di 3 parametri:
- le caratteristiche della rete
- le regole di installazione
- le caratteristiche del circuito considerato.
I calcoli che seguono sono forniti a titolo indicativo, consultarci per maggiori dettagli o usi particolari.

Caratteristiche della rete


La tensione
4METRHAHKDMNMOTŁL@HDRRDQDTSHKHYY@SN@CTM@SDMRHNMDDEjB@BDRTODQHNQD@KK@RT@SDMRHNMDMNLHM@KD  SDMRHNMHHMEDQHNQH
funziona senza problemi.

La frequenza
EŰŰ'YRHBNMRHCDQ@BGDK@SDMRHNMDCHHLOHDFN4e) è equivalente ad una tensione continua e UeŰ4CHOHBBN
­ŰEŰŰ'Y
EHM'Y  10 20 30 40
­ŰEŰŰ'YMDRRTMCDBK@RR@LDMSNHMSDMRHNMD
JT     0,78 0,87 0,94
Ue ­JTW4n ku: coefficente di declassamento della tesione dovuto alla frequenza.

Corrente di corto circuito


#NON@UDQDCDSDQLHM@SNK@BNQQDMSDCHBNQSNBHQBTHSN AHRNFM@UDQHjB@QDBGDHKRTNU@KNQDRH@HMEDQHNQD@KONSDQDCH@ODQSTQ@CDK
ETRHAHKDJ DEE 
Regole di installazione
Uso di un fusibile sul neutro (vedere pagina 514).

Schema dei collegamenti a terra


Seguento il regime di neutro, i fusibili avranno generalmente una o due funzioni di protezione:
- contro le sovracorrenti: A
- contro i contatti indiretti: B.
Schemi Protezioni
TT A
IT A+B
TNC A+B
TNS A+B

Caratteristiche del circuito


Limite d’utilizzo dei fusibili in funzione della temperatura ambiente (ta) nelle vicinanze dell’apparecchio.
Ith u : orrente termica d’uso: corrente termica massima che l’apparecchio
Ith u ­*SW(n tollera per 8 ore in condizioni particolari
In : calibro del fusibile
Kt : coefficiente fornito dalla tabella sottostante.

*S Se il fusibile è installato in una cassetta ventilata, bisogna


Fusibile gG Fusibile aM LNKSHOKHB@QDHU@KNQHCH*SODQ*U
Sulla base Sull‘ Sulla base Sull‘ 5DKNBHSĐCDKK@QH@5ŰLR *U
 5
ta
fusibile apparecchiatura fusibile apparecchiatura 5DKNBHSĐCDKK@QH@5®LR *U 
40° 1 1 1 1
45° 1 0,95 1 1 Esempio: un fusibile gG montato su una base portafusibile è
installato in una cassetta ventilata:
¦ 0,93 0,90    
- temperatura nella cassetta: 60 °C
55° 0,90 0,86 0,93 0,90
- velocità dell’aria: 2 m/s
60° 0,86 0,83 0,90 0,86 Kv = 1 + 0,05 x 2 = 1,1
65° 0,83 0,79 0,86 0,83 Kt = 1,1 x 0,86 = 0,95.
70° 0,80 0,76 0,84 0,80

SOCOMEC Catalogo Generale 2012-2013 519


Protezione fusibile

Scelta di un fusibile “gG” o “aM”(seguito)


Caratteristiche del circuito (seguito)
Precauzione d’utilizzo per altitudini > 2000 m
Nessun declassamento in corrente.
Il potere di apertura è limitato: consultarci.
Declassamento di taglia consigliato.

A monte di un trasformatore di separazione


L’inserimento o il distacco completo di un carico su un trasformatore, o l’inserzione dello stesso a vuoto, provoca una
sovracorrente di valore rilevante. Occorre quindi utilizzare un fusibile di tipo aM al primario, più adatto a tollerare sovraccarichi
ripetuti. Il circuito sul secondario sarà protetto da fusibili di tipo gG.

A monte di un motore
La protezione contro i sovraccarichi dei motori è generalmente assicurata da un relè termico. La protezione dei conduttori
d’alimentazione del motore è assicurata dai fusibili aM o gG. La tabella A indica i calibri dei fusibili da associare al relè termico
in funzione della potenza del motore.
Nota:
La corrente nominale di un motore varia da un costruttore all’altro. I valori della tabella A sono forniti a titolo indicativo.
I fusibili aM sono da preferirsi ai fusibili gG per questa applicazione.
In caso di avviamenti frequenti o difficili (avviamento diretto > 7 In per più di 2 sec. o avviamento > 4 In per più di 10 sec.), si consiglia di prendere un calibro
superiore a quello indicato nella tabella. Tuttavia bisogna assicurarsi del coordinamento dell’associazione del fusibile con il contattore (vedere pagina 531)
In caso di fusione di un fusibile aM, si consiglia di sostituire i fusibili anche delle due altre fasi.

Tabella A: protezione dei motori tramite i fusibili aM


Motore
400 V tri 5SQH Calibri Taglia consigliata
*V Ch In A *V Ch In A
  10   11  18,4 20 WNW
11 15 22 15 20 23 25 10 x 38 o 14 x 51
 20 30      40 W
18,5 25 37 25 34 39,4 40 14 x 51
22 30 44 30 40  63 W
25 34 51 40 54 60 63 22 x 58
30 40 60  60  80 W
37 50 72 51 70 75 100 22 x 58
 60  63 109 89 100 W
55 75 105 80 110 112 125 T 00
 100 138 110   160 T0
90 125 170 132 180 187 200 T1
110   160 220 220  T1
132 180 245 220 300 310 315 T2
160 218 300  T2
200 270 370 250 340 360 400 T2
 340    472  T3
315 430 584 450 610 608 630 T3
400    680 680 800 T4

A monte di una batteria di condensatori


Il calibro del fusibile deve essere superiore o uguale al doppio della corrente nominale della batteria di condensatori (Ic).

In ®(c
B@SDBAWB@S

Tabella B: calibro dei fusibili per batteria di condensatori a 400 V


"@O@BHSĐHM*U@Q  10 20 30 40  60  100  
Fusibile gG in A 20 32 63 80  160 200 200  400 400

520 Catalogo Generale 2012-2013 SOCOMEC


Protezione fusibile

Scelta di un fusibile “gG” o “aM”(seguito)


Caratteristiche del circuito (seguito)
Collegamento in parallelo
Il collegamento in parallelo dei fusibili è possibile solo tra due fusibili della stessa taglia e dello stesso calibro.
I’the
Ithe = I’theW

B@SDBA>W>B@S
Icc di picco limitata totale = I’cc di picco limitata W  Ithe
i2t totale = i’2SW 
i 2 t : energia specifica del fusibile

Utilizzo in corrente continua


(M BNQQDMSD BNMSHMT@  HK SDLON CH OQD@QBN Ġ HCDMSHBN @K SDLON CH OQD@QBN HM BNQQDMSD @KSDQM@S@  +D B@Q@SSDQHRSHBGD SDLON
corrente e il diagramma di limitazione restano validi per l’uso dei fusibili in corrente continua. Invece, il tempo d’arco è
MDSS@LDMSDOHŔ@KSNHMBNMSHMT@ODQBGġMNMRHADMDjBH@CDKO@RR@FFHN@YDQNCDKK@SDMRHNMD
L’energia termica da assorbire sarà molto più elevata che in corrente alternata. Per mantenere una sollecitazione termica
equivalente al fusibile, bisogna limitare la sua tensione d’uso.

Tensione massima
in alternata in continua
400 V 260 V
5 5
690 V 5

Utilizzo dei fusibili di tipo gG cilindrici


Taglia del fusibile Tensione Corrente DC Potere di apertura DC
W 5 "5#" 16 A *
5 "5#" 32 A *
W
690 VAC ’ 440 VDC 32 A *
5 "5#" 80 A *
W
690 VAC ’ 440 VDC 80 A *

 HBNMRHFKH@CHTR@QDETRHAHKHCHTM@S@FKH@RTODQHNQD@KK@S@FKH@@AHST@KD L@MSDMDMCNHKB@KHAQNHMU@QH@SNK@CHLDMRHNMDW
2
ĠQHRDQU@S@­ 
In caso di circuiti fortemente induttivi, si raccomanda di mettere due fusibili collegati in serie sul polo positivo.
/DQFKHHLOH@MSHENSNUNKS@HBH ĠENMC@LDMS@KDTSHKHYY@QDCDHETRHAHKHRODBHjBHBNMCDKKDB@Q@SSDQHRSHBGDSDLONBNQQDMSDDHKONSDQDCH
apertura adatte a questi impianti. Questi fusibili sono marchiati col simbolo gPV e devono rispondere alla norma IEC 60269-6.
I fusibili di tipo aM sono inutilizzabili in corrente continua.
/DQCDKKDSDMRHNMHBNLOQDRDSQ@D5#" KTSHKHYYNCHETRHAHKH41ĠONRRHAHKDBNMRTKS@QBH

SOCOMEC Catalogo Generale 2012-2013 521


Protezione fusibile

Protezione delle canalizzazioni contro i sovraccarichi mediante fusibili gG


La colonna Iz dfornisce il valore della corrente massima ammissibile per ciascuna sezione dei cavi di rame e di alluminio,
RDBNMCNK@MNQL@($"DK@FTHC@43$ 
La colonna F fornisce il calibro del fusibile gG associato alla sezione e al tipo di cavo.
Le categorie B, C, E e F corrispondono ai differenti tipi di posa dei cavi (vedere pagina 493).
(B@UHRHRTCCHUHCNMNHMCTDE@LHFKHD/5"D/1(vedere tabelle pagina 494). La cifra che segue la sigla indica il numero di
conduttori sotto carico (PVC 3 indica un cavo della famiglia PVC con 3 conduttori sotto carico: 3 fasi o 3 fasi + neutro).

Esempio: un cavo PR3 di rame di 25 mm2 installato in categoria E è limitato a 127 A e protetto da un fusibile da 100 A gG.

Categoria Corrente admissibile (Iz) protezione fusibile associato (F)


B PVC3 PVC2 /1 /1
C PVC3 PVC2 PR3 PR2
E PVC3 PVC2 /1 /1
F PVC3 PVC2 PR3 PR2
S mm2
1@LD Iz F Iz F Iz F Iz F Iz F Iz F Iz F Iz F Iz F
    10   10   16   16 22 16 23 20 24 20 26 20
2,5 21 16 24 20 25 20 27 20 30 25 31 25 33 25 36 32
4 28  32  34  36 32 40 32 42 32  40 49 40
6 36 32 41 32 43 40 46 40 51 40 54 50 58 50 63 50
10  40   60  63  70 63  63 80 63 86 63
16 68 50 76 63 80 63 85 63 94 80 100 80 107 80 115 100
 89 80 96 80 101 80 112 100 119 100 127 100 138  149  161 
35 110 100 119 100 126 100 138 125 147 125 158 125 171 125 185 160 200 160
 134 100 144    168  179 160 192 160 207 160  200 242 200
70 171 125 184 160 196 160 213 160 229 200 246 200 269 160 289 250 310 250
 207 160 223 200 238 200  200 278  298  328    377 
120 239 200 259 200 276 250 299 250 322 250 346 315 382 315 410 315 437 400
 299  319  344  371  399  441 400 473 400  400
185 341 250 364 315 392 315 424 315 456 400 506 400 542 500 575 500
240 403  430  461 400  400  400   641  679 
300 464 400 497 400 530 400 576 500 621 500 693 630 741 630 783 630
400    630  630 840 800
500 749 630 868 800 946 800 1083 1000
630  630  800 1088 800  1000
Alluminio
    10   10   16 21 16 23 20 24 20 26 20 28 
4 22 16 25 20 26 20 28 25 31 25 32 25 35 32 38 32
6 28 20 32  33  36 32 39 32 42 32  40 49 40
10 39 32 44 40 46 40 49 40 54 50 58 50 62 50 67 50
16  40   61  66  73 63 77 63 84 63 91 80
25 70 63 73 63 78 63 83 63 90 80 97 80 101 80 108 100 121 100
 86 80 90 80 96 80 103 80 112 100 120 100 126 100    
50 104 80 110 100 117 100 125 100 136 125 146 125 154 125 164 125 184 160
70 133 100 140    160  174 160 187 160 198 160 211 160 237 200
95 161 125 170 125 183 160 195 160 211 160 227 200 241 200 257 200 289 250
120 188 160 197 160 212 160 226 200  200 263  280  300  337 
150 227 200 245 200 261 200 283 250 304 250 324 250 346 315 389 315
  200 280  298  323  347  371  397  447 400
240 305 250 330 250 352 315 382 315 409 315 439 400 470 400 530 400
300   381  406  440 400 471 400  400   613 
400 526 400 600 500 663 500 740 630
 610  694 630 770 630  630
630 711 630 808 630 899 800 996 800

522 Catalogo Generale 2012-2013 SOCOMEC


Protezione fusibile

Protezione della canalizzazioni con fusibili


Lunghezza massima dei conduttori protetti con fusibili
Le tabelle A e B forniscono le lunghezze massime alle seguenti condizioni:
BHQBTHSNSQHE@RD55
- sezione del neutro = sezione di fase,
- corrente di corto circuito minima,
- conduttori di rame.

+DS@ADKKDRNMNU@KHCDHMCHODMCDMSDLDMSDC@KKHRNK@MSDCDHB@UH/5" /1 $/1 0T@MCNRNMNHMCHB@SHCTDU@KNQH HKOQHLN


BNQQHRONMCD@HB@UHHM/5" HKRDBNMCN@HB@UHHM/1$/1
+DKTMFGDYYDU@MMNLNKSHOKHB@SDODQHBNDEjBHDMSHCDKK@S@ADKK@"ODQFKH@KSQHTSHKHYYH
Cavo d’alluminio: moltiplicare le lunghezze delle tabelle per 0,41.
Tabella A: lunghezze massime (in m) dei conduttori protetti con fusibili gG.

'/" 16 20  32 40  63 80 100  160 200   400  630 800 1000 
S (mm2)
  82     
2,5 102 82 49/56 35/43 16/20 12/15 5/7
4 131 89 76     
6 134 113 78 67/74 31/39 18/23 10/12 7/9
10 189 129 112 74      
16 179 119 91 67 49/56 24/30 18/23 9/11 5/7 3/4
 186 143 104 88      
35 200 146 123 86 75 43/52 25/36 14/18 8/11 4/5
 198 167 117 101 71     
70 246 172 150 104 80 57/60 34/42 17/22 11/14
 233 203 141 109 82 62   
120 256 179 137 103 80 51/57 32/40 14/18
 272 190  110  61  
185 220 169 127 98 70 56 27/34
240   119  68 

Tabella B: lunghezze massime (in m) dei conduttori protetti con fusibili aM.

'/"
16 20  32 40  63 80 100  160 200   400  630 800 1000 
S (mm2)
      
2,5 67 47/54 32/38 20/24 14/16 9/11 6/7
4 108 86 69      
6 161 129 104 81 65/66 45/52 29/34 19/23 13/15 9/10 6/7
10  108 88 68      
16 140 109 86 69 49/55 32/38 21/25 14/17 9/11
  108 86 67     
35 151 121 94 75 58/60 38/45 25/30 17/20 11/13 7/9
 128 102 82      
70 151 121 96 75 58/60 38/45 25/30 17/20 11/13
  164 130 102 82    
120 164 129 104 82 65 44/52 29/35
 138 110 88 69  
185 128 102 80 64 51
240 123 97 78 62

7DEHOOD&FRHIĺFLHQWHGLFRUUH]LRQHSHUDOWUHUHWL
Casi di utilizzo "NDEjBHDMSD
2DYHNMDCDKMDTSQN WRDYHNMDE@RD 0,67
Circuito privo di neutro 1,73
(1) Si accede alla tabella con la sezione delle fasi.

SOCOMEC Catalogo Generale 2012-2013 523


Protezione fusibile

Protezione contro i contatti indiretti con fusibili


Lunghezza massima dei conduttori protetti con fusibili
La lunghezza dei conduttori protetti contro i contatti indiretti deve essere limitata.
Le tabelle B e C forniscono una lettura diretta delle lunghezze massime dei conduttori di rame. Esse sono determinate alle
seguenti condizioni:
QDSD@5
- schema TN,
- tensione di contatto massima UL5
Ø ph
- = m = 1.
Ø PE
/DQ@KSQHTSHKHYYH NBBNQQDLNKSHOKHB@QDHKU@KNQDSQNU@SNMDKKDS@ADKKD!D"ODQHKBNDEjBHDMSDCDKK@S@ADKK@
Tabella A
"NDEjBHDMSDCHBNQQDYHNMD
Conduttore di alluminio  
Sezione neutro = 1/2 sezione fase (m = 2) 0,67
senza neutro 0,86
1DFHLD(3
con neutro  
Tempo di interruzione de 5s admis. per canalizzazioni protette con fusilbili gG 1,88
(circuite di distribuzione) per canalizzazione protette con fusilbili aM 1,53

Tabella B: lunghezze massime (in m) dei conduttori protetti con fusibili gG


(A)
16 20  32 40  63 80 100  160 200   400  630 800 1000 
S (mm2)
   40 32 22 18 13 11 7 8 4 3
2,5 88 66 53 36 31 21 18 12 9 7 6 4
4 141 106   49 33 29 19  11 9 6 6 4
6 212 159 127 87 73 50 43 29 22 16 14 10 8 6 4
10   212  122 84 72 48 37 28 23 16 14 10 7 6 4
16 566 424 339 231 196 134 116 77 59 43 36 25 22 15 12 9 7 5 4
 884 663  361 306 209 181 120 92 67  40  24 18 14 11 8 6 4
35 928 742 506 428 293 253 169 129 94 80 56 48 34 26 20 15 11 9 6
 687  398 343 229 176 128 108 76 66 46  27 20  12 8
70 856 586 506 337 259 189 159 11 97 67 52 39 30 22 17 11
  687    216  131 92 70  41 29 23 16
120 868 578 444 323 273 191 166 116 89 67 62 37 23 20
  472 343 290 203 178 123 94 71  39 31 21
185 714 547 399 336 235 205 145 110 82 64 46 36 24
240 666  409 286 249 173 133 100 77  44 29
300 566 477 334 290 202 155 117 90 65 51 34

Tabella C: lunghezze massime (in m) dei conduttori protetti con fusibili aM


(A)
16 20  32 40  63 80 100  160 200   400  630 800 1000 
S (mm2)
  28 23 18 14 11 9 7 6  4
2,5 47 38 30 24 19 15 12 9 8 6 5
4  60 48 38 30 24 19  12 10 8 6  4
6 113 90 72 57 45 36 29 23 18 14 11 9 7 6 5 4
10 188  121 94  60 48 38 30 24 19  12 10 8 6  4
16 301 241 193 151 121 96 77 60 48 39 30 24 19 15 12 10 8 6 5 4
 470 377 302 236 188  120 94  60 47 38 30 24 19 16 12 9 8 6
35 658 527 422 330 264 211 167 132 105 84 66 53 42 33 26 21 17 13 11 8
 891 714  447   227 179 144  90 72  46 36 29 23 18 14 11
70 845 660 527 422 335 264 211 169 132 105 84 67 53 42 33 26 21 17
  716    286 229 179 143  91 72   36 29 23
120 904 723 574 462 362 289 226 181 145 115 90 72 57 45 36 29
 794 630 496 397 317 248 198  126 99 79 63  40 32
185 744 586 469 375 293 234 188 149 117 94 74 59 47 38
240 730  467  292 234  146 117 93 73  47
300 702 562 439 351 281 223 175 140 11 88 70 56
Esempio: Un circuito è costituito da un cavo di rame 3 x 6 mm2 protetto con un fusibile da 40 A gG. La sua lunghezza dovrà essere inferiore
a 73 m perché la protezione contro i contatti indiretti sia assicurata in TN 230 V/400 V.
Se il cavo è di alluminio, la lunghezza massima è di: 0,625 x 73 m = 45,6 m
In schema IT con neutro e cavo d’alluminio, la lunghezza è di: 0,625 x 0,5 x 73 m = 22,8 m
In schema IT con neutro e cavo d’alluminio per un’alimentazione di armadio di partenza utenze, la lunghezza è di: 0,625 x 0,5 x 1,88 = 42,8 m.

524 Catalogo Generale 2012-2013 SOCOMEC


Protezione fusibile

Curve caratteristiche dei fusibili gG


Diagramma di limitazione delle correnti

1,5

100 kA cr.

8 1250
7 1000
6 800
5 630
500
4
400
3 315
250
200
2 160

1,5 125
100

80
10 kA 63
50
8 40
7 32
6 25
5 20
4 16
Valore della corrente kA di cresta

12
3
10
8

Corrente nominale dei fusibili gG


2 6

1,5 4

1 kA 2

8
7
6 1
5

1,5

100 A
1,5 3 6 1,5 3 6 1,5 3 6

2 4 8 2 4 8 2 4 8

10 A 100 A 1 kA 10 kA 100 kA eff.


catec 112 f 1 it cat

Corrente presunta kA eff.

SOCOMEC Catalogo Generale 2012-2013 525


Protezione fusibile

Curve caratteristiche dei fusibili gG (seguito)


Diagramma di limitazione delle sollecitazioni termiche

2 690 V A2t totale alle


107 500 V tensioni nominali
7

catec 227 b 1 it cat


5 440 V
3
2 A2t di prearco
106
7
5
3
2
105
I2t (Ampere2 secondi )

7
5
3
2
104
7
5
3
2
103
7
5
3
2
10 2
7
5
3
2
101
6 16 25 40 63 100 160 250 400 630 900 1250
B@SDBBHSB@S

10 20 32 50 80 125 200 315 500 800 1000

Corrente nominale dei fusibili gG

Caratteristiche di funzionamento tempo/corrente


224
280
355
450
560
710
900

In fusibili (A)
1000
1250
400
200
250

500
630
800
315
100
125
160
40
20
25

50
63
80
32
10
12
16
2

6
8
1

4000
3000
2000
1500
1000
800
600
400
300
0,5
200
150
100
80
60
40
30
20
15
10
8
6
Tempo di prearco (sec.)

5
4
3
2
0,25
1,5
1
0,8
0,6
0,4
0,3
0,2
0,15
0,1
0,07
0,05
0,025
0,015
0,01
0,007
0,004
catec 111 d 1 it cat

1,5 3 5 7 1,5 3 5 7 1,5 3 5 7 1,5 3 5 7 1,5 3 5 7


2 4 6 8 2 4 6 8 2 4 6 8 2 4 6 8 2 4 6 8

1A 10 A 100 A 1 kA 10 kA 100 kA eff.

526 Catalogo Generale 2012-2013 SOCOMEC


Protezione fusibile

Curve caratteristiche dei fusibili tipo aM


Diagramma di limitazione delle correnti

IC (kA)

100
9 1250
8
7 1000
800
6
5 630
425
400
4 355
315
3 250
200
160
2 125
100

80

63
10 50
9
8 40
7 35
32
6
5 25

4 20
16
3 10

6
2
Valeur du courant kA crête

Intensité nominale des fusibles aM


1
9
8
7
6
5

0,1 Ip (kA)
3 5 7 9 3 5 7 9 3 5 7 9

2 4 6 8 2 4 6 8 2 4 6 8

0,1 1 10 100
catec 114 g 1 it cat

Courant présumé (kA eff)

SOCOMEC Catalogo Generale 2012-2013 527


Protezione fusibile

Curve caratteristiche dei fusibili aM (seguito)


Diagramma di limitazione delle sollecitazioni termiche
Potenza dissipata con percussore (W)
690 V A2t totale alle Corrente
Taglia dei fusibili
catec 227 b 1 it cat

500 V tensioni nominali


440 V
d’impiego
In (A) 000 00 2 1 2 3 4
A2t di prearco 6 0,33 0,42
10 0,52 0,67
16 0,81 0,98
108 20 0,92 1,04
7
5  1,08 1,17
3
2 32 1,42 1,67
7
10
7    1,72
5
3 40 1,68 1,91
2
6  2,28  
10
7 63 2,9 3,35 3,2
5
3
2
80 4,19 4,93 4,6
I2t (Ampere2 secondi )

10 5 100 5,09 5,72 5,7


7
5
3
 6,29 7,30 6,98 7,6
2 160 7,73 9,50 9,2 9,7
104
7 200 12,3 13,7 13,9
5
3 224 14,0 14,0
2
103
   17,0
7
5 315 26,0 20,6 18,8
3
2    23,9
102 400 29,3 26,5 23,5
7
5
3  28,3
2
500 35,8 34
1
6 16 25 35 50 80 125 200 315 400 500 800 1250 630   49
catec 226 c 1 it cat

10 20 32 40 63 100 160 250 355 425 630 1000 800 70


Corrente nominale dei fusibili gG 1000 80
1250 108

Caratteristiche di funzionamento tempo/corrente

In fusibili (A)
1000
1250
100
125
160
200
250
315
355
400
425
500
630
800
10

16
20
25
32
35
40
50
63
80
6

1000

2
100

2
Tempo di prearco (sec)

10

2
1

2
0,1

2
0,01

3 5 3 5 3 5 3 5
catec 113 d 1 it cat

2 4 6 8 2 4 6 8 2 4 6 8 2 4
10 100 1000 10000

Corrente presunta (A eff)

528 Catalogo Generale 2012-2013 SOCOMEC


Protezione fusibile

Scelta di un fusibile UR
Questi fusibili detti “ultra-rapidi” assicurano la protezione contro le correnti di corto circuito. Per come sono stati concepiti,
il tempo di fusione è molto inferiore a quello dei fusibili gG o aM in presenza di forti corto circuiti.
Vengono usati generalmente nella protezione di semi-conduttori di potenza (i2S41H2t del semi-conduttore da proteggere).
(KKNQNETMYHNM@LDMSNHMRNUQ@BB@QHBN (](M S®RDBNMCH CDUDDRRDQDDUHS@SN 2DMDBDRR@QHN K@OQNSDYHNMDBNMSQNH
sovraccarichi deve essere assicurata da un altro dispositivo.
+@ CDSDQLHM@YHNMD CH TM ETRHAHKD 41 Ġ KNFFDSSN CH TM@ OQNBDCTQ@ QHFNQNR@ BGD  ODQ BDQSD @OOKHB@YHNMH  OTŁ DRRDQD LNKSN
BNLOKDRR@ (KLDSNCNRNSSNHMCHB@SNBNRSHSTHRBDTMOQHLN@OOQNBBHNRDLOKHjB@SN
Consultarci per qualsiasi applicazione particolare.

Sollecitazione termica
ÌHKOQHLNO@Q@LDSQNC@OQDMCDQDHMBNMRHCDQ@YHNMDOQHL@CDKB@KHAQN (ME@SSHHETRHAHKH41RNMNCDRSHM@SH@KK@OQNSDYHNMDCDH
RDLH BNMCTSSNQH (KKHLHSDCHCHRSQTYHNMDCHPTDRSHTKSHLHĠC@S@C@KK@RNKKDBHS@YHNMDSDQLHB@L@RRHL@@LLHRRHAHKD  EjMBGġK@
OQNSDYHNMDRH@DEjB@BD NBBNQQDBGDK@RNKKDBHS@YHNMDSDQLHB@CDKETRHAHKDRH@HMEDQHNQD@KLDMNCDKBHQB@CDKK@RNKKDBHS@YHNMD
termica di distruzione del semi-conduttore.
Esempio: un diodo 30A/400 V sopporta al massimo una sollecitazione termica di 610 A2s. La sollecitazione termica massima del fusibile UR
associato sarà di 610 - 20 % = 488 A2s a 400 V.

Tensione
La sollecitazione termica è data generalmente a 660 V. L’utilizzo ad una tensione diversa dà luogo ad una correzione:
(i2S5*UWH2t) 660 V 1,5
Kv Kv : coeff. di correzione
di i2t
1,0
Esempio: per U = 400 V e Kv = 0,6 Eg : valore efficace della
(i2t) 400 V = 0,6 x (i2t) 660 V] tensione d’utilizzo
0,5

0,3
B@SDBAWB@S

Eg
0,15
0 100 200 300 400 500 600 660

Fattore di correzione Kv.

Fattore di potenza
La sollecitazione termica indicata nel capitolo “Apparecchiatura di apertura a bassa tensione” è data per un fattore di potenza
CH BNR del circuito di guasto). Per altri valori del fattore di potenza, occorre moltiplicare il valore della sollecitazione
SDQLHB@ODQHKBNDEjBDMSD*X
Fattore di potenza 0,1   0,2   0,30   0,40    
X
* 1,04 1,00 0,97 0,93 0,90 0,87   0,82 0,81

Corrente nominale
Una volta determinata la sollecitazione termica massima del fusibile, occorre tenere conto del valore della corrente nominale
del circuito.
Esempio: nell’esempio precedente, è stata determinata la sollecitazione termica massima del fusibile UR: 488 A2s a 400 V.
A 660 V, questo valore vale: 488/0,6 = 813 A2s.
La corrente nel circuito è di 20 A. Si dovrà quindi utilizzare un fusibile UR da 25 A con I2t a 660 V paria 560 A2s.

Correzione in funzione della temperatura ambiente


(KB@KHAQNCHTMETRHAHKD41ĠENQMHSNODQTM@SDLODQ@STQ@@LAHDMSDCH¦"
La corrente massima di utilizzo Ib e dato da:
k
Ib*341W
 UW(n 1,4

In: corrente nominale del fusibile in A 1,2


v:
KTUR: coefficente fornito dalla fig. 2 in funzione 1,0
della temperatura dell’aria in prossimità del fusibile.
0,8
B@SDBAWB@S

0,6

-40 -20 0 20 40 60 80 C°

Fattore di correzione KTUR

SOCOMEC Catalogo Generale 2012-2013 529


Protezione fusibile

Scelta del fusibile “UR” (seguito)


Collegamento in serie
$RBNMRHFKH@S@PT@MCNK@BNQQDMSDCHFT@RSNĠHMRTEjBHDMSDODQE@QENMCDQDHKETRHAHKDHMLDMNCHLR

Collegamento in parallelo
Il collegamento in parallelo dei fusibili è possibile tra due fusibili della stessa taglia e dello stesso calibro. È assicurata generalmente
dal costruttore (consultarci).
(MB@RNCHBNKKDF@LDMSNHMO@Q@KKDKN NBBNQQDBNMSQNKK@QDBGDK@SDMRHNMDCTSHKHYYNMNMRH@RTODQHNQD@KCDKK@SDMRHNMD
nominale del fusibile.

Sovraccarico ciclico
Consultarci.

Perdite in Watt

Sono fornite nella sezione «Apparecchiatura di apertura a 1,0 Kp: coefficente di correzione
0,8 kp
bassa tensione» e corrispondono alla potenza dissipata delle perdite
0,6
alla corrente nominale. 0,5 Ib: valore eff. della corrente
0,4
Per l’uso ad una corrente Ib diversa da In, bisogna di carico in % della corrente
0,3
nominale.
LNKSHOKHB@QD K@ ODQCHS@ HM 6@SS ODQ HK BNDEjBDMSD *p dato
0,2
C@KK@jFTQ@PTHRNSSN
B@SDBAWB@S

0,1

Ib
0,05
20 30 40 50 60 70 80 90 100%

Fattore di correzione Kp.

Selettività
Selettività fusibili tra alta, media e bassa tensione
Il funzionamento di un fusibile a bassa tensione non deve Su rete alimentata da UPS
provocare la fusione del fusibile in media o alta tensione
UPS
installato al primario del trasformatore.
/DQBGġ BHŁ MNM @BB@C@ NBBNQQD UDQHjB@QD BGD K@ O@QSD
inferiore della curva del fusibile in media tensione non
incontri in nessun punto la parte superiore della curva del
catec 027 b 1 it cat

ETRHAHKD HM A@RR@ SDMRHNMD OQHL@ CDK KHLHSD CH (BB L@W  CH
bassa tensione (vedere calcolo pagina 599).

La selettività dei dispositivi di protezione riveste una grande


importanza sulle reti alimentate da UPS in cui lo scatto di
t
1 Fusibile in media una protezione non deve generare nessuna perturbazione
1 tensione. Corrente sul resto della rete.
riportata al secondario
La funzione di selettività deve tenere in considerazione due
2
IBT = IHT x UHT particolarità di questo tipo di reti:
UBT
A@RR@BNQQDMSDCHFT@RSNCDKKNQCHMDCHW(n)
2 Fusibile in bassa tensione
- tempo di guasto massimo generalmente imposto: 10 ms.

Per rispettare questi criteri e assicurare una buona


selettività, occorre che la corrente in ciascun ramo non
A superi i valori riportati nella tabella sottostante.
B Protezzione a mezzo di Corrente max. per partenza
In
Fusibile gG
6
In
%TRHAHKD41
catec 027 b 1 it cat

Icc max. (A) deve essee 3


inferiore all’incrocio (B)
I In
delle 2 curve Interruttori automatici
Icc max. di piccola taglia 8

530 Catalogo Generale 2012-2013 SOCOMEC


Protezione fusibile

Selettività (seguito)
Selettività tra fusibile e contattore
Il fusibile è installato in a monte del contattore a cui
viene associato un relè termico. Un discontacteur est t (s)
Curva di finzionamento del motore
un ensemble constitué d’un contacteur et d’un relais
thermique. Relè termico a caldo
Le curve dei fusibili associati al contattore devono passare
Relè termico a fredo
tra i punti A e B corrispondenti a:
- Ia: limite del potere di apertura del contattore, Fusibili
- IbBNQQDMSDL@W CHROTMSNCDKLNSNQD B

Tipo di avvivamento Ib (1) Tempo di avviamento(1)


Direct 8 In  @R
Stella triangolo  (n 3 a 6 s.
Autotrasformatore  @(n 7 a 12 s.
Da rotore  (n  @R
(1) Valori medi che possono variare a seconda dei tipi di motori e di
utilizzatori.
A

La sollecitazione termica del fusibile deve essere inferiore a


catec 029 b 1 it cat

Corrente
quella sopportata dal contattore.
Tra i diversi calibri di fusibile possibili, scegliere il calibro Ib Ia

maggiore per minimizzare le perdite per dissipazione


termica.

Selettività tra interruttore automatico e fusibile


L’associazione di una protezione fusibile con altri dispositivi (interruttori automatici, …) permette una selettività quasi perfetta
e costituisce una soluzione ottimale sul piano economico e della sicurezza.

Fusibile a monte - interruttore automatico a valle


t
2
1 1 Interruttore
automatico

2 Fusibile
B@SDBHKKAWB@S

A
La curva di fusione di prearco del fusibile deve situarsi al
CHRNOQ@CDKOTMSN jF 
La curva di fusione totale del fusibile deve tagliare la curva
dell’interruttore automatico prima del valore Icc (potere di
apertura) dell’interruttore automatico.
catec 024 b 1 it cata

Dopo il punto di incrocio, la sollecitazione termica del


fusibile deve essere inferiore a quella dell’interruttore B I

automatico.
Le sollecitazioni termiche dell’interruttore automatico e Fig. 1
del fusibile devono sempre essere inferiori a quelle del
cavo.

Fusibili gG a monte - interruttori automatici a valle


Il calibro del fusibile deve essere superiore alla somma
delle correnti degli interruttori automatici simultaneamente
inseriti.
La curva di fusione del fusibile deve essere al di sotto del
OTMSN UDCDQDjF CDKKHMSDQQTSSNQD@TSNL@SHBNBBMHK
calibro più alto.
(KOTMSNCHHMBQNBHN!UDCDQDjF CDUDDRRDQDHMEDQHNQD@K
B@SDBAWB@S

potere di ultima apertura più piccolo di tutti gli interruttori


automatici.
Dopo il punto B, la sollecitazione termica totale del
fusibile deve essere inferiore alla sollecitazione termica di
qualsiasi altro interruttore automatico a valle.

SOCOMEC Catalogo Generale 2012-2013 531


Protezione fusibile

Selettività (seguito)
Selettività tra interruttore automatico e fusibile (seguito)
Interruttore automatico monte - fusibili a valle
I poteri di apertura di tutti i fusibili e dell’interruttore
automatico devono essere superiori alla corrente di corto
circuito massima del circuito.
La taratura della parte termica Ir dell’interruttore
@TSNL@SHBNCDUDDRRDQDS@KDBGD (r®(1 + I2 +…In.
I1 + I2 +…In : somma delle correnti in ogni ramo protetto
dal fusibile.
B@SDBAWB@S

La corrente di taratura Ir deve inoltre rispondere alla seguente condizione:


Tabella A: valori di Kd (segondo IEC 60269-2-1)
Ir®*CW(n
Calibro fusibili gG (In) (A) *C
In : calibro del fusibile del circuito più caricato. In­ 2,1
4 < In < 16 1,9
­(n 1,6
Esempio: il circuito più carico è protetto da un fusibile gG di 100 A. La corrente di taratura minima dell’interruttore a monte, che permette di
assicurare la selettività con il fusibile, sarà: Ir® W 
La sollecitazione termica del fusibile di calibro più alto deve essere inferiore alla sollecitazione termica limitata dall’interruttore automatico.
Questa stessa deve essere inferiore alla sollecitazione termica massima dei cavi.
5@KNQDLHMHLNCHS@Q@STQ@CH(LL@FMDSHB@*C­(L­*C
Kd è fornito dalla tabella A.

Generalità
La selettività delle protezioni è assicurata quando, in caso di guasto in un punto qualsiasi dell’installazione, il dispositivo
di protezione (DP) situato direttamente a monte del guasto scatta senza provocare l’apertura di altri dispositivi presenti
nell’impianto. La selettività permette di avere continuità di utilizzo sul resto della rete.

DP1

DP2 DP3 DP4 DP5


B@SDBBWB@S

A
Un guasto nel punto A deve provocare l’apertura del dispositivo di protezione DP5 senza che ci sia l’apertura degli altri DP.

La selettività totale La selettività parziale


$ @RRHBTQ@S@ PT@MCN KD YNMD SDLONBNQQDMSD BGD Consiste nel limitare la selettività dei DP solamente in una
caratterizzano i dispositivi di protezione non si O@QSDCDKK@KNQNYNM@SDLONBNQQDMSD -DKK@LHRTQ@HMBTHK@
sovrappongono. corrente di guasto è inferiore al punto di incrocio delle curve,
ci si ritrova in un caso di selettività totale.

t t 2 1 Zona tempo/corrente
1 Zona tempo/corrente 1
1 2 del DP5
del DP5
2 Zonea tempo/corrente
2 Zona tempo/corrente del DP1
del DP1
catec 031 b 1 it cat

catec 032 b 1 it cat

Corrente
Corrente
Id max. Is

2DKDSSHUHSďO@QYH@KDK@RDKDSSHUHSďğ@RRHBTQ@S@MDKB@RNHMBTHK@BNQQDMSD
di guasto massima (Icc max) dell’installazione è limitata a Id max et Id
max < Is.

532 Catalogo Generale 2012-2013 SOCOMEC


Protezione fusibile

Selettività (seguito)
Selettività tra fusibili
Selettività fusibili gG e aM
La selettività totale è assicurata dalla scelta dei fusibili nelle tabelle A e B (secondo IEC 60269-1 e 60269-2-1).
Tuttavia, per alcune applicazioni, ci si potrà limitare ad una selettività parziale.
Tabella A Tabella B
Fusibile a monte Fusibile a valle Fusibile a monte Fusibile a valle
gG gG aM aM gG aM
Calibro (A) Calibro (A)
4 1 1 4 4 2
6 2 1 6 6 2
8 2 2 8 8 4
10 4 2 10 10 6
12 4 2 12 4 2
16 6 4 16 16 10
20 6 20 20 12
25 10 8 25 25 12
32 16 10 32 32 20
40 20 12 40 32 25
  16  40 
63 32 20 63 50 40
80 40  80 63 
100 50 32 100 80 63
 63 40  100 80
160 80 63 160 125 100
200 100 80 200 160 
250 125 125 250 160 160
 160   200 200
400 200 160 400 250 250
  200   
630 400 250 630 400 400
800   800  
1000 630 400 1000 500 630
 800   630 800

Selettività fusibili gG / fusibili UR

gG a monte - UR a valle
(KSDLONCHOQD@QBNCDKETRHAHKD41CDUDDRRDQDHMEDQHNQD@KK@LDSĐCDKSDLONCHOQD@QBNCDKETRHAHKDF&MDKK@YNM@BNLOQDR@
tra 0,1 e 1 sec.
UR a monte - gG a valle
(KB@KHAQNCDKETRHAHKD41CDUDDRRDQD@KLDMNTFT@KD@KSQHOKNCDKB@KHAQNCDKETRHAHKDF&

SOCOMEC Catalogo Generale 2012-2013 533


Sistema di gestione dell’energia

Introduzione
Contrariamente all’ultimo decennio, entriamo in un periodo nel quale gestire l’energia è un obbligo sia sotto l’aspetto
ambientale che quello economico. In effetti, i costi dell’energia sono aumentati di maniera considerevole e hanno un impatto
diretto sul prezzo di fabbricazione dei prodotti e sulle spese di funzionamento. Questo nuovo procedimento impone una
conoscenza approfondita dei processi, dell’organizzazione del lavoro nell’azienda e la gestione dei costi di energia calcolati a
partire di un tariffario. Esso permette il calcolo del costo dell’energia in funzione del periodo di utilizzo, sapendo che l’utente
CNUQĐ@CDLOHDQD@TM@AANM@LDMSNCHBTHHKBNRSNR@QĐOQNONQYHNM@KD@KK@ONSDMY@CDKRTNHLOH@MSN KjMDCHCDSDQLHM@QD@K
meglio la sua tariffa, l’utente dovrà stimare precisamente le sue necessità per scegliere il tariffario più adatto. In certi casi, sarà
preferibile avere alcuni superamenti di potenza invece di avere un abbonamento sovradimensionato.

Tariffario
Per dare all’utente le informazioni necessarie
all’ottimizzazione del suo tariffario e della gestione dei
consumi, dovrà installare nei posti strategici dell’impianto
elettrico (trasformatore, motori…) contatori (tipo COUNTIS)
o centraline di misura (tipo DIRIS). Queste apparecchiature
saranno collegate su una rete di comunicazione (vedere §
comunicazione) per centralizzare e gestire i consumi tramite
un software di supervisione (tipo CONTROL VISION).
diris 723 a 1 x cat

DIRIS N

COUNTIS COUNTIS
DIRIS E00 COUNTIS
E00 A40 E40

Interfaccia
DIRIS TCP/IP RS485
A10
M

DIRIS
A20

COUNTIS
COUNTIS E30 Interfaccia
Gas, Acqua, Aria...
ECi TCP/IP RS485
CO
UN
TIS

COUNTIS
E 50
COU
NTIS
E Ci3

E50 API

Interfaccia
TCP/IP RS485
G
TC
mesur 112 b it

VERTELIS VISION

Una volta installate queste apparecchiature, l’utente potrà


DEEDSST@QDKDLNCHjBGDODQ
- alleggerire i circuiti di riscaldamento o di illuminazione per
evitare i superamenti durante le ore a maggior costo,
- anticipare l’avviamento di alcune macchine durante le ore
a minor costo prima dell’arrivo del personale,
- ottimizzare e migliorare l’utilizzo degli automatismi, delle
fonti d’energia o ancora del funzionamento dei mezzi di
produzione.
diris 724 a 1 x cat

In ogni caso, queste apparecchiature si adatteranno


perfettamente alle applicazioni commerciali (illuminazione,
aria condizionata…) o alle applicazioni industriali. Dalla loro
qualità dipenderà la loro precisione di misura delle correnti
e delle tensioni e del calcolo delle energie.

534 Catalogo Generale 2012-2013 SOCOMEC


Sistema di gestione dell’energia

Misura elettrica
Principio di misura
Qualunque sia la rete elettrica alternata AC (monofase, bifase, trifase con o senza neutro), è indispensabile misurare le
correnti e le tensioni. Le correnti saranno misurate a partire da un trasformatore di corrente stando attenti al collegamento
per evitare errori di misura. Le tensioni saranno misurate direttamente o tramite dei trasformatori di tensione per le reti MT e
BT in particolare.

3QNUDQDSDPTHRNSSNKDENQLTKDTSHKHYY@SDODQ@QQHU@QD@HQHRTKS@S
Correnti Potenza apparente

I1= i1TRMS x kTC S1 = V1 x I1

(kTC essendo il rapporto del TA) S1, S2 e S3 sono calcolati direttamente a partire dei valori
i1, i2, i3 sono calcolati direttamente in TRMS integrando le TRMS I e V.
@QLNMHBGDjMN@KFQ@CN E
E
°S = S1 + S2 + S3
i1 + i2 + i3
Isist =
3
Potenza reattiva
Tensioni
Q1 = S12 - P12
V1 = v1TRMS x kTP
Q1, Q2 e Q3 sono calcolati direttamente a partire da P e S.
(kTP essendo il rapporto del trasformatore di tensione) E
v1, v2, v3 sono calcolati direttamente in TRMS integrando
KD@QLNMHBGDjMN@KFQ@CN °Q = Q1 + Q2 + Q3
E
v1 + i2 + i3 Fattore di potenza
Vsist =
3
I
PF =
S
Potenza attiva
PF1, PF2 e PF3 sono calcolati direttamente a partire da
1 T
P e S.
P=
T
³ [v1 x i1] dt
0

P1, P2 e P3 sono calcolati direttamente a partire dei valori Frequenza


TRMS I e V. La misura della frequenza è sempre realizzata sulla fase1.
E

°P = P1 + P2 + P3

Calcolo dell'energia
0T@KRH@RH RHRSDL@ DKDSSQHBN BGD TSHKHYY@ K@ BNQQDMSD @KSDQM@S@ LDSSD HM FHNBN CTD ENQLD CH DMDQFH@  KDMDQFH@ @SSHU@ J6G
e l’energia reattiva (kvarh). Nei processi industriali che utilizzano l’energia elettrica, soltanto l’energia attiva è trasformata
dall’impianto di produzione in energia meccanica, termica o luminosa. Essa può essere positiva o negativa se l’installazione
ĠB@O@BDCHOQNCTQQDCDHJ6GTMHMRS@KK@YHNMDENSNUNKS@HB@@CDRDLOHN
L’altra, l’energia reattiva, serve in particolare all’alimentazione dei circuiti magnetici delle macchine elettriche (motori,
autotrasformatori, ecc…). Inoltre, alcuni componenti delle reti elettriche di trasporto e di distribuzione (trasformatori, linee, ecc…)
consumano anche in alcuni casi energia reattiva. Per seguire queste energie, è indispensabile prendere in considerazione la
OQDBHRHNMDBGDĠCDjMHS@HMTMBNMSDRSNMNQL@SHUN (QHEDQHLDMSHRNMNHRDFTDMSH

"NMS@SNQDCHDMDQFH@@SSHU@J6G
($" HMBK@RRDN
($" HMBK@RRD 2N 2

"NMS@SNQDCHDMDQFH@QD@SSHU@JU@QG($" HMBK@RRD

SOCOMEC Catalogo Generale 2012-2013 535


Sistema di gestione dell’energia

Sorveglianza
Questa funzione permette di sorvegliare le principali
FQ@MCDYYDDKDSSQHBGDODQ A
- proteggere le macchine, 800
- rilevare i buchi di tensione,
720
- rilevare i sovraccarichi anormali di trasformatori, di partenze
- rilevare i sotto-carichi di motore (rottura di cinghia,
funzionamento a vuoto…). 110
100

/DQNFMH@KK@QLD RHCDUDOQNFQ@LL@QD
- la soglia alta > valore alto di sgancio,
- la soglia bassa > valore basso di sgancio,
- l’isteresi > valore di ritorno allo stato normale,
- il relè > modo di lavoro in NA / NC,

catec 230 a 1 it cat


Stato Allarme Allarme
- la temporizzazione > temporizzazione dello sgancio del relè. del relè
1 1
0 0

Esempio di applicazione:
"NMkFTQ@YHNMDCHTMQDKğODQK@RNQUDFKH@MY@CDKKDBNQQDMSHBNMTMNRF@MBHNRD( D( "NMTMHRSDQDRHCHODQHKQHSNQMN@KKN
RS@SNCHQHONRNCDKQDKğ TMLNCNCHK@UNQNCDKQDKğHM- DRDMY@SDLONQHYY@YHNMD

Controllo comando
A partire da un collegamento numerico a un PC o un altro
RHRSDL@CHRTODQUHRHNMD/+" PTDRS@ETMYHNMDODQLDSSD
A1
O@QSHQDC@FKHHMFQDRRHAHM@QH
- di conteggiare gli impulsi provenienti da un contatore di
elettricità, di acqua o di gas, B1
catec 231 c 1 x cat

- di conteggiare il numero di manovre o di controllare


la posizione di un apparecchio di protezione o di un
invertitore di linee.

O@QSHQDC@KKDTRBHSDQDKĠ
- di comandare a distanza il cambio di stato di un apparecchio di protezione a sgancio,
- di comandare a distanza l’avviamento di un motore o di una rampa di illuminazione,
- di alleggerire alcune parti della distribuzione elettrica.

Esempio :
"@LAHNCHRS@SNCHTMQDKğODQBNL@MC@QDK@UUH@LDMSNCHTMLNSNQD

Qualità dell‘energia (vedere pagina 483)

536 Catalogo Generale 2012-2013 SOCOMEC


Reti di comunicazione

Comunicazione analogica
Questa funzione permette di trasmettere a un PLC o a qualsiasi sistema, l’immagine di una misura sotto la forma di un
segnale 0-20 mA o 4-20 mA.

Esempio 1
"NMjFTQ@YHNMDCHTMTRBHS@RTKK@BNQQDMSDBNM @L D @L
mA

20
B@SDB@WB@S

100 2500 A

Esempio 2
"NMjFTQ@YHNMDCHTMTRBHS@RTKK@ONSDMY@@SSHU@SNS@KDY/BNMJ6@L DJ6@L

mA
20
B@SDB@WB@S

0
0 1500 kW

Esempio 3
"NMjFTQ@YHNMDCHTMTRBHS@RTKK@ONSDMY@@SSHU@SNS@KDY/BNM J6@L DJ6@L

mA
20

12
B@SDB@WB@S

4
-1000 1000 kW

Esempio 4
"NMjFTQ@YHNMDCHTMTRBHS@RTKE@SSNQDCHONSDMY@HMCTSSHUNY/%+BNM @L D@L

mA
20
B@SDB@WB@S

0,5 1 cos ϕ

SOCOMEC Catalogo Generale 2012-2013 537


Reti di comunicazione

Comunicazione digitale
Introduzione
4M@ QDSD CH BNLTMHB@YHNMD ODQLDSSD CH BNKKDF@QD SQ@ CH KNQN TM BDQSN MTLDQN CH @OO@QDBBGH @K jMD CH RB@LAH@QD CDKKD
HMENQL@YHNMHCHLHRTQD CHBNMSDFFHN CHBNL@MCNN@MBNQ@CHOQNFQ@LL@QKHBNMTMBNLOTSDQNTM/+"
+@BNLTMHB@YHNMDSQ@OHŔ@OO@QDBBGHMDBDRRHS@CHTMNQF@MHYY@YHNMDDCHTMKHMFT@FFHNBNLTMHHKOQNSNBNKKN

Gli strati OSI


.FMHSHONCHBNKKDF@LDMSNG@HKOQNOQHNOQNSNBNKKNRS@AHKHSNC@KKDMNQLD (MUDBD STSSHHOQNSNBNKKHQHRODSS@MNTM@CHUHRHNMDHM
KHUDKKHCDSSHRSQ@SH.2( .FMHRSQ@SNG@HKBNLOHSNCHQHBDUDQDCDKKDHMENQL@YHNMHDKDLDMS@QHC@KKNRSQ@SNHMEDQHNQD CHSQ@SS@QKDDCH
ENQMHQDCDKKDHMENQL@YHNMHOHŔDK@ANQ@SD@KKNRSQ@SNRTODQHNQD
I nostri prodotti usano gli strati 1, 2 e 7
/NRSN Posto 2
2SQ@SN@OOKHB@YHNMD 2SQ@SN@OOKHB@YHNMD
2SQ@SNOQDRDMS@YHNMD 2SQ@SNOQDRDMS@YHNMD
2SQ@SNRDRRHNMD 2SQ@SNRDRRHNMD
2SQ@SNSQ@RONQSN 2SQ@SNSQ@RONQSN
2SQ@SNQDSH 2SQ@SNQDSH
2SQ@SNBNKKDF@LDMSN 2SQ@SNBNKKDF@LDMSN
2SQ@SNjRHBN 2SQ@SNjRHBN

Strato 1 - Fisico
$KNRSQ@SNRODBHjBN@KK@fSTA@YHNMDtCDKK@QDSD /DQLDSSDCHSQ@RENQL@QDTMRDFM@KDAHM@QHNHMTMRDFM@KDBNLO@SHAHKDBNMHK
RTOONQSNRBDKSNQ@LD jAQ@NSSHB@ '% DBB  0TDRSNRSQ@SNENQMHRBDCDFKHTSDMRHKHCHSQ@RLHRRHNMDCHAHS@KKNRSQ@SNRTODQHNQD 
BGDKHTSHKHYYDQĐRDMY@OQDNBBTO@QRHCDKK@M@STQ@CDKLDYYNTSHKHYY@SN

Strato 2 - Collegamento
0TDRSN RSQ@SN BNMSQNKK@ K@ SQ@RLHRRHNMD CDH C@SH  4M@ SQ@L@ CDUD DRRDQD L@MC@S@ N QHBDUTS@ @ OQDRBHMCDQD C@
DUDMST@KH O@Q@RHSH RTKK@ KHMD@  (K BNMSQNKKN Ġ DEEDSST@SN @K KHUDKKN CDK O@BBGDSSN CH AHSR SQ@L@  SQ@LHSD TM fBGDJRTLt
0TDRSN RSQ@SN ENQMHRBD FKH TSDMRHKH CH SQ@RLHRRHNMD CH O@BBGDSSH CH AHSR SQ@L@ @KKN RSQ@SN RTODQHNQD  +D SQ@RLHRRHNMH RNMN
fF@Q@MSHSDtC@LDBB@MHRLHCHBNMSQNKKNCHU@KHCHSĐ

Strato 7 - Applicazione
+NRBNONCDKKNRSQ@SNCH@OOKHB@YHNMDĠCHENQMHQDTMHMSDQE@BBH@SQ@KTSDMSDDK@QDSD

I dati trasmessi
(KRDFM@KDSQ@RLDRRNCHTM@OO@QDBBGHN@KK@KSQNĠTMDKDLDMSNAHM@QHNCDSSNAHS .FMHSHONCHBNKKDF@LDMSNCHFHS@KDCDjMHRBD
TMKHUDKKN@M@KNFHBNKHUDKKNCHSDMRHNMDODQKNKNFHBNDKKNFHBN +HMENQL@YHNMDĠBNCHjB@S@HMTMHMRHDLDCHAHSR HKSTSSN
ENQL@MCNTM@SQ@L@CHBNLTMHB@YHNMD

Il supporto di comunicazione
0TDRS@SQ@L@CHBNLTMHB@YHNMDRS@ODQSQ@MRHS@QDC@TMOTMSN@KK@KSQNCDKATRRTTMRTOONQSNBGH@L@SNLDCH@NLDYYN
CHBNLTMHB@YHNMD 2DBNMCNHKSHONCHSDBMNKNFH@RBDKSN PTDRSNLDCH@OTŁDRRDQDTMO@HNCHjKHCHQ@LD TMBNKKDF@LDMSN
$SGDQMDS TMB@UNBN@RRH@KD CDKK@jAQ@NSSHB@ TMBNKKDF@LDMSNSDKDENMHBN13"N&2, NOOTQDCDKKDNMCDQ@CHN 0TDRSN
RTOONQSNCHODMCDCDKSHONCHSQ@RLHRRHNMDRBDKSNDCDKK@LAHDMSDCHK@UNQN

I protocolli
(KOQNSNBNKKNCHBNLTMHB@YHNMDCDjMHRBDKDQDFNKDCDKKHMFT@FFHNSQ@HCHUDQRH@SSNQHCDKCH@KNFNHMLNCNS@KDBGDNFMTMNTSHKHYYH
KDRSDRRDQDFNKDDRHB@OHRB@ (M@KBTMHB@RH C@@MBGDTMDWSQ@RHBTQDYY@@KCH@KNFNCDjMDMCNCDHLDYYHCHBNMSQNKKNCDKKDSQ@LD
BNLD@CDRDLOHNHK"1"
" - /1.%(!42#/ (MSDQATR 2 %(/ $(! D!42 ,.#!42)!42 .ODM,.#!42N3"/ (/RNMNCHUDQRHOQNSNBNKKH@UDMSD
NFMTMNHKNQNOQDFHDCHEDSSHHMETMYHNMDCDKK@LAHDMSDCHK@UNQNDCDKKDBNMCHYHNMHMDHPT@KHUDMFNMNTSHKHYY@SH
(OQNCNSSHCDKK@2.".,$"BNLTMHB@MCNTSHKHYY@MNOQHMBHO@KLDMSDHOQNSNBNKKH)!42,.#!42D/1.%(!42#/ /DQŁ UDCQDLN
OHŔ@U@MSHBGDONRRH@LN@MBGDQHRONMCDQD@C@KSQHOQNSNBNKKHBNLD@CDRDLOHNHK3"/ (/

538 Catalogo Generale 2012-2013 SOCOMEC


Reti di comunicazione

Il protocollo JBUS / MODBUS


Presentazione
( OQNSNBNKKH )!42 BNRSQTSSNQD f OQHKt D ,.#!42 BNRSQTSSNQD f,NCHBNMt RNMN CDH OQNSNBNKKH CH CH@KNFN BGD BQD@MN TM@
RSQTSSTQ@FDQ@QBGHB@TML@RSDQDCHUDQRHRK@UD
)!42,.#!42OTŁCH@KNF@QDHM 2"((AHSRNHMAHM@QHN134AHSR
(KU@MS@FFHNCDKLNCN134ĠBGDHC@SHC@SQ@RLDSSDQDOQDMCNMNLDMNRO@YHNPTHMCHLDMNSDLON (MDEEDSSH CH@LNOHŔC@SH
HMBGDHMAHSR
( OQNCNSSH 2.".,$" HM OQNSNBNKKN )!42  ,.#!42  CH@KNF@MN HM LNCN 134 1DLNSD 3DQLHM@K 4MHS  0TDRSN SHON CH
OQNSNBNKKNODQLDSSDCHHMSDQQNF@QD C@KL@RSDQ TMNNCHUDQRHRK@UDHMSDKKHFDMSH 4MBNKKDF@LDMSNCHLNKSHOTMSHKDF@SQ@CHKNQN
L@RSDQDRK@UD
,.#!42134ĠTMOQNSNBNKKNRHBTQNA@R@SNRTKB@KBNKNCHTM"1"NSDRSCHQHCNMC@MY@BHBKHB@ 0TDRSN"1"B@KBNK@SNRT
AHSRE@O@QSDHMSDFQ@MSDCDKLDRR@FFHNDCĠUDQHjB@SNC@KCDRSHM@S@QHN
#TDSHOHCHCH@KNFGHRNMNONRRHAHKHSQ@HKL@RSDQDKNRK@UD
HKL@RSDQCH@KNF@BNMTMNRK@UDD@RODSS@K@RT@QHRONRS@
HKL@RSDQCH@KNF@BNMSTSSHFKHRK@UDRDMY@@RODSS@QDK@KNQNQHRONRS@OQHMBHOHNCDKK@CHEETRHNMDFDMDQ@KD

(KL@RSDQFDRSHRBDHCH@KNFGHDRNKNKTHMDG@KHMHYH@SHU@ 0TDRSNL@RSDQQDHSDQ@K@CNL@MC@CNONTM@SQ@RLHRRHNMDDQQ@S@D
BK@RRHjB@KNRK@UDBNLD@RRDMSDRDMNMG@TM@QHRONRS@CNONTMCDSDQLHM@SNSDLONSHLD NTS 2HOTŁDRRDQDRTKK@KHMD@
RNKNTM@OO@QDBBGHNBGDRS@DLDSSDMCN -DRRTMRK@UDOTŁCDBHCDQDC@RNKNCHL@MC@QDTMLDRR@FFHNRDMY@@UDQD@UTSN
K@BBNQCNCDKL@RSDQ 3TSSDKDBNLTMHB@YHNMHK@SDQ@KHC@RK@UD@RK@UDONRRNMNDRHRSDQDRNKNRDHKRNESV@QDCDKL@RSDQĠRS@SN
OQNFDSS@SNODQQHBDUDQDCDHC@SHDL@MC@QKHCHTMNRK@UD@KK@KSQN

(K L@RSDQ OTŁ BNLTMHB@QD BNM  RK@UD HMCHUHCT@SH C@KKN


, 23$1
RK@UDM¦@KKNRK@UDM¦ 2DHKL@RSDQTSHKHYY@HKMTLDQN )!42,.#!42
CH RK@UD   BNQQHRONMCD @ TM@ BNLTMHB@YHNMD UDQRN STSSH
FKHRK@UDRBQHSSTQ@RNKS@MSN (OQNSNBNKKH)!42D,.#!42
ODQLDSSNMN CH @BBDCDQD @KKD @OO@QDBBGH@STQD BNKKDF@SD 2+ 5$ 2+ 5$ 2+ 5$
RTKKNRSDRRNB@UN  )!42,.#!42 )!42,.#!42 )!42,.#!42
-¦ -¦ -¦W

Composizione delle trame di comunicazione


4M@SQ@L@CHBNLTMHB@YHNMDĠBNLONRS@C@TM@RTBBDRRHNMDC@AXSDENQL@MCNTMLDRR@FFHN NFMHAXSDDRRDMCNBNLONRSN
CHAHSR (C@SHONRRNMNDRRDQDRSNBB@SHRTTMAXSD VNQCAXSD NOOTQDTM@CNOOH@VNQCAXSD

/DQHMHYH@QDTMCH@KNFN HKL@RSDQCDUDL@MC@QDuna trama di domandaCHBTHK@RSQTSSTQ@G@K@RDFTDMSD


AXSD AXSD MAXSD AXSD
(-%.1, 9(.-$
6.1##(
-4,$1. ".#("$ (MCHQHYYNCHVNQC
".-31.++.
#(2+ 5$ %4-9(.-$ 5@KNQDCHVNQC "1"
-TLDQNCHVNQC

+NRK@UDHMSDQQNF@SNQHRONMCD@KKNQ@@KK@QHBGHDRS@SQ@LHSDuna trama di rispostaCHBTHK@RSQTSSTQ@ĠK@RDFTDMSD


AXSD AXSD MAXSD AXSD
# 3(
-TLDQNCHVNQCKDSSD 6.1##(
-4,$1. ".#("$ ".-31.++.
NRBQHSSD
#(2+ 5$ %4-9(.-$ "1"
5@KNQDCHVNQCKDSSD
NRBQHSSD

(MB@RNCHDQQNQDMDKK@SQ@L@DLDRR@C@KL@RSDQ KNRK@UDQHRONMCDC@una trama di erroreCHBTHK@RSQTSSTQ@ĠK@RDFTDMSD


AXSD AXSD MAXSD AXSD
".#("$#($11.1$
"NCHBDETMYHNMD
".#("$ HMBNFMHS@ 6.1##(
-4,$1. %4-9(.-$ ".-31.++.
(MCHQHYYNHMBNQQDSSN
#(2+ 5$
 "1"
#@SNHMBNQQDSSN
2K@UDMNMOQNMSN
#HEDSSNCHRBQHSSTQ@

SOCOMEC Catalogo Generale 2012-2013 539


Reti di comunicazione

Il protocollo JBUS / MODBUS (seguito)


Esempi di trame di comunicazione
3TSSHHOQNCNSSH2.".,$"RNMNENQMHSHBNMTML@MT@KDBGDBNMSHDMDKDS@ADKKD)!42,.#!42 0TDRSDS@ADKKDODQLDSSNMN
CHBNMNRBDQDKHMCHQHYYNCNUDRNMNRSNBB@SHHC@SHBNMHKKNQNENQL@SNS@FKH@CDHC@SHDSHONRDFM@SNNMN

Lista dei parametri in lettura (funzione 3)


Tabella degli indirizzi (decimale ed esadecimale) dei valori reali Tabella degli indirizzi (decimale ed esadecimale) dei valori
delle grandezze dello strumento (Valori reali - 2 word) proporzionali delle grandezze dello strumento su 1 word
Indirizzo Indirizzo Numero 4MHSĐCH Indirizzo Indirizzo Numero 4MHSĐCH
2SDRTQ@ 2SDRTQ@
CDBHL@KD DR@CDB CHVNQC misura CDBHL@KD DR@CDB CHVNQC misura
  2 "NQQDMSDE@RD mA    "NQQDMSDE@RD mA
770 302 2 Corrente fase 2 mA 1793 701 1 Corrente fase 2 mA
  2 "NQQDMSDE@RD mA    "NQQDMSDE@RD mA
774 306 2 Corrente del neutro mA 1795 703 1 Corrente del neutro mA
  2 3DMRHNMDBNMB@SDM@S@4 5    3DMRHNMDBNMB@SDM@S@4 5
778 30A 2 Tensione concatenata U23 V / 100 1797 705 1 Tensione concatenata U23 V / 10
 " 2 3DMRHNMDBNMB@SDM@S@4 5    3DMRHNMDBNMB@SDM@S@4 5
782 30E 2 Tensione di fase fase 1 V / 100 1799 707 1 Tensione di fase fase 1 V / 10
  2 3DMRHNMDCHE@RDE@RD 5    3DMRHNMDCHE@RDE@RD 5
786 312 2 Tensione di fase fase 3 V / 100 1801 709 1 Tensione di fase fase 3 V / 10
  2 Frequenza 'Y    Frequenza 'Y
790 316 2 Y potenza attiva + / - kW / 100 1803 70B 1 S potenza attiva + /- W
  2 YONSDMY@QD@SSHU@
 JU@Q  "  2ONSDMY@QD@SSHU@
 U@Q
794 31A 2 Y potenza apparente + / - kVA / 100 1805 70D 1 S potenza apparente kVA
 " 2 Y fattore di potenza    $  2E@SSNQDCHONSDMY@  
B@O@BHSHUNS
HMCTSSHUN B@O@BHSHUNS
HMCTSSHUN
* Alcuni apparecchi come il DIRIS o l’ATyS possiedono una tabella dove l’informazione è stoccata su una word per potere essere compatibile
con un master JBUS / MODBUS che non accetta il format con 2 word.

+DRDLOHNPTHRNSSNLNRSQ@K@SQ@L@BGDHKL@RSDQ)!42,.#!42L@MC@ODQKDFFDQDTM@S@ADKK@CHKTMFGDYY@CHO@QNKD
7$HMDR@CDBHL@KD
Indirizzo Indirizzo -TLDQNCHVNQC -TLDQNCHVNQC
2K@UD Funzione "1"
ordine alto NQCHMDA@RRN ordine alto NQCHMDA@RRN
   00 00 $ " 

2DODQŁRHCDRHCDQ@QHBTODQ@QDRNKNK@ONSDMY@@SSHU@ ĠRTEjBHDMSDL@MC@QDK@SQ@L@RDFTDMSDHMDR@CDBHL@KD
Indirizzo Indirizzo -TLDQNCHVNQC -TLDQNCHVNQC
2K@UD Funzione "1"
ordine alto NQCHMDA@RRN ordine alto NQCHMDA@RRN
02    00 02 !

-DKK@S@ADKK@OQDBDCDMSD UDCH@LNBGDHRDFMH
DljFTQ@MNODQPTDRSNC@SN (KAHSCHODRNENQSDODQLDSSDCHBNMNRBDQDHK
RDFMNCDKC@SNQHBDUTSN
HKAHSĠ@HKU@KNQDĠMDF@SHUN
HKAHSĠ@HKU@KNQDĠONRHSHUN

1HRONRS@CHTM#(1(2ODQTM@ONSDMY@ONRHSHU@
Numero 5@KNQDODRNENQSD 5@KNQDODRN 5@KNQDODRNENQSD 5@KNQDODRN "1"
2K@UD Funzione
CHAXSD VNQC CDANKDVNQC VNQC CDANKDVNQC 
02  04 00 00 " AC #$
" "GCĐJ6NRRH@ J6

1HRONRS@CHTM#(1(2ODQTM@ONSDMY@MDF@SHU@
Numero 5@KNQDODRNENQSD 5@KNQDODRN 5@KNQDODRNENQSD 5@KNQDODRN "1"
2K@UD Funzione
CHAXSD VNQC CDANKDVNQC VNQC CDANKDVNQC 
02  04 FF FF ! # 
%%%%!#GCĐ J6NRRH@  J6

/DQNSSDMDQDPTDRSNQHRTKS@SN RHCDUDE@QDHKBNLOKDLDMSNOQDMCDQDKHMUDQRNCDKU@KNQDNSSDMTSNHMAHM@QHND@FFHTMFDQD
@KQHRTKS@SN NRRH@
BNLOKDLDMSN@%%%%!#DR@CĐ"DR@
@CCHYHNMDCH"DR@
CDBHL@KD HKU@KNQDDRRDMCNMDF@SHUNDRRNCĐ J6 NRRH@  J6

540 Catalogo Generale 2012-2013 SOCOMEC


Reti di comunicazione

Il protocollo JBUS / MODBUS (seguito)


Il bus RS485 per il protocollo JBUS / MODBUS
4M@SQ@RLHRRHNMDĠBNLONRS@C@TMDLHRRHNMDDC@TM@QHBDYHNMD (CTDRDMRHCHSQ@RLHRRHNMDONRRNMNDRRDQD
RDO@Q@SHRTCTDUHDCHRSHMSDBNKKDF@LDMSNRHLOKDWHMjKH
L@RR@ODQTM@12
QHTMHSHRTTM@RSDRR@UH@ BNMKDLHRRHNMDDK@QHBDYHNMDBGDRHE@MMN@KSDQM@SHU@LDMSDMDHCTDRDMRHG@KE CTOKDWHMjKH

L@RR@
QHTMHSHRTTM@RSDRR@UH@ BNMKDLHRRHNMDDK@QHBDYHNMDBGDRHE@MMNRHLTKS@MD@LDMSDETKK CTOKDWHMjKH

(MNFMHB@RN HKKHUDKKNCHSDMRHNMDĠ@OOKHB@SNHMLNCNCHEEDQDMYH@KD H D RDMY@QHEDQHLDMSNQHRODSSN@KK@L@RR@ $K@CHEEDQDMY@CH


ONSDMYH@KDSQ@HjKHCDKK@UH@BGDBQD@HKRDFM@KD
(KATR12ĠTMATRCHB@LON $RS@SNOQNFDSS@SNODQETMYHNM@QDHM@LAHDMSHHMCTRSQH@KHCHEjBHKHHMSDQLHMDCHODQSTQA@YHNMH
DKDSSQNL@FMDSHBGDN@KSQD

MBGDRDĠQNATRSN PTDRSNATRCDUDQHRODSS@QDKDQDFNKDCHHMRS@KK@YHNMDBGDKNCDjMHRBNMN ODQETMYHNM@QDBNQQDSS@LDMSD


KTMFGDYY@ L@RRHL@    L ODQ TM@ UDKNBHSĐ BGD OTŁ
Q@FFHTMFDQDJAHSRDBNMCN +@KTMFGDYY@OTŁDRRDQD
@TLDMS@S@FQ@YHD@KK@CCHYHNMDCHTMQHODSHSNQDCHKHMD@12 Lunghezza del cavo (m)

UDCDQDjF  10 000


MTLDQNL@RRHLNCHRK@UD)!42,.#!42BNKKDF@SH 
(K MTLDQN OTŁ DRRDQD @TLDMS@S@ FQ@YHD @KK@CCHYHNMD CH
TMQHODSHSNQDCHKHMD@12
1 000
MDRRTMB@AK@FFHNHMRSDKK@
LDSSDQD KD HLODCDMYD 1 sul primo e l’ultimo
@OO@QDBBGHNCDKATR
B@SDBAHSB@S

ONRHYHNM@QD H KHUDKKH CH RHBTQDYY@ QDRHRSDMYD CH OTKK TO D


100
CHOTKK CNVMBGDjRR@MNNFMHjKNCDKATR@TMKHUDKKNCH
SDMRHNMD  O@QSHBNK@QLDMSD PT@MCN HK ATR Ġ @KKN RS@SN CH
QHONRN@KKHUDKKNCDKKHMSDQE@BBH@CHBNLTMHB@YHNMD
TSHKHYY@QD TM B@UN @UDMSD KD B@Q@SSDQHRSHBGD HLODCDMY@ 10

B@O@BHSĐ@C@SSD@KSHONCHBNLTMHB@YHNMDAKHMC@SN (K 10 000 100 000 1 000 000 Velocità (bit/s)

AKHMC@FFHNCHPTDRSNB@UNCDUDDRRDQDBNMSHMTNRTSTSSN
HKATRDCDUDDRRDQDBNKKDF@SN@SDQQ@RNKN@TMONRSNCDK
ATR ODQMNMBQD@QD@MSDMM@ Fig.1.

(KQHRODSSNCDKKeHMRHDLDCHPTDRSDQDFNKDCDUDBNMRDMSHQDKeTSHKHYYNCDKATR12MDFKH@LAHDMSHCHEjBHKH

Esempi di cavi consigliati


'$+4* !$+)$ +H8"8!C2((MCTRSQX $KJSQNMHB"@AKDRDBNMCNK@#(-5#$
!$+#$-/@HQDC +NV"@O@BHS@MBD"NLOTSDQ"@AKDENQ$( 12  OOKHB@SHNMR
+/' ,TKSHO@HQ %NHK!Q@HCRGHDKC/$/5" B@UN@A@RR@B@O@BHSĐ

"NMkFTQ@YHNMH
/DQODQLDSSDQD@KL@RSDQD@FKHRK@UDCHBNLTMHB@QD TMBDQSNMTLDQNCHBNMjFTQ@YHNMHCDKKDB@Q@SSDQHRSHBGDCDKKDSQ@LDCH
BNLTMHB@YHNMDCDUDDRRDQDDEEDSST@SN (O@Q@LDSQHC@BNMjFTQ@QDRNMNHRDFTDMSH
HKMTLDQNCHAHSBGDBNLONMDNFMHAXSDCDKK@SQ@L@NAHS
HKMTLDQNCHAHSCHRSNON
K@O@QHSĐO@QH CHRO@QHNRDMY@
K@UDKNBHSĐCHBNLTMHB@YHNMD DROQDRR@HMA@TCR OTŁU@QH@QDC@A@TCR@,A@TCR  KCHRNOQ@CHJACR K@
KTMFGDYY@L@RRHL@CDKATRĠETMYHNMDCDKK@UDKNBHSĐCHBNLTMHB@YHNMD

I media di comunicazione per il protocollo JBUS / MODBUS


&DMDQ@KLDMSD HKL@RSDQ)!42,.#!42ĠRH@TM/+"@RRNBH@SN@CTMHMRDQHSNQD RH@TMBNLOTSDQ@RRNBH@SN@CTMHMSDQE@BBH@
CHBNLTMHB@YHNMD 2.".,$"OQNONMDTM@F@LL@HMSDQ@CHHMSDQE@BBDCHBNLTMHB@YHNMDODQHBNKKDF@LDMSNBNMTMATR
12 +@RBDKS@CDKKHMSDQE@BBH@TSHKHYY@S@CHODMCDDRRDMYH@KLDMSDCDKK@LAHDMSDMDKPT@KDRHCDRHCDQ@TSHKHYY@QK@ L@@MBGD
CH@KBTMHNAAKHFGHL@SDQH@KHDCHBNMjFTQ@YHNMHCDKK@QDSD

"NRį RHOTŁSQNU@QDCHUDQRHSHOHCHHMSDQE@BBD
12  12
42! 12
12 $3'$1-$3 12
12 BNKKDF@LDMSNSDKDENMHBN13" 12
12 BNKKDF@LDMSNSDKDENMHBN&2, 12
12 BNKKDF@LDMSNQ@CHN 12
12 BNKKDF@LDMSNNSSHBN 12

SOCOMEC Catalogo Generale 2012-2013 541


Reti di comunicazione

Il bus RS485
4MATR12ĠCDjMHSNC@KK@MNQL@$( 3(  DC@KK@FTHC@CH@OOKHB@YHNMD32! 

Tipologia

+@BNMjFTQ@YHNMDQ@BBNL@MC@S@ĠBNKKDF@LDMSNHMRDQHD

1200 M o 32 UL

R = 120 Ω
N1 N2 Nn
R = 120 Ω
PLC
programmabili
#(1(2&(3

Altri sistemi

max 1200 M o 32 UL max 1200 M o 32 UL

+- -+
R = 120 Ω N1 ripetitore Nn
R = 120 Ω R = 120 Ω
RS485 R = 120 Ω
PLC
programmabili
#(1(2&(3

Altri sistemi

4+ŭTMHSXNEKN@CR UDCDQDK@O@FHM@BNQQHRONMCDMSDOHœHMA@RRN
+@BNMjFTQ@YHNMDHMRDQHDĠPTDKK@BGDKHLHS@L@FFHNQLDMSDKDQHkDRRHNMHCDHRDFM@KH

Esempio:"NMUDQRHNMDCHTM@BNMkFTQ@YHNMDMNM@C@SS@S@UDQRNTM@BNMkFTQ@YHNMDCDKATR@C@SS@S@
" 3$" (3

(a) ERRATO (b) OK (c) ERRATO (d) OK (e) ERRATO (f) OK

/DQKNRBGDL@DSTSS@UH@RNMNSNKKDQ@SDCDKKDCDQHU@YHNMHCHBLL@RRHLNBNKKDF@LDMSHUDQSHB@KHRTKKNRBGDL@D

542 Catalogo Generale 2012-2013 SOCOMEC


Reti di comunicazione

Il bus RS485 (seguito)


Tipo di cavo
1@BBNL@MCH@LNCHTSHKHYY@QDTM@BNOOH@@SSNQBHFKH@S@RBGDQL@S@NHMHMFKDRD2GHDKCDC3VHRSDC/@HQRBGDQL@STQ@FDMDQ@KDCH
RDYHNMDLHMHL@ ŰLL£ 6&CHLODCDMY@NGLRCHSHON+(8"8 "8.

Messa a terra
"NKKDF@QDK@RBGDQL@STQ@@TM@RNK@DRSQDLHSĐ@SDQQ@ODQF@Q@MSHQDKeDPTHONSDMYH@KHSĐCDKK@RBGDQL@STQ@
-NMĠMDBDRR@QH@MDRRTM@LDRR@@SDQQ@

(CDMSHkB@YHNMDLNQRDSSHDQ@2.".,$"QHRODSSN@KK@MNQL@12

4M ,@RSDQ2K@UD 12 CH MNQL@ Ġ BNKKDF@SN HM  OTMSH Ì ONRRHAHKD BGD H BNRSQTSSNQH @AAH@MN @RRDFM@SN CDKKD
RTKATR CDMNLHM@YHNMH CHUDQRD C@  ! D " ODQ PT@MSN QHFT@QC@
le morsettiere.
$BBNKeHMSDQOQDS@YHNMDODQBHŁBGDQHFT@QC@2.".,$"
A !Ű

 Ű
Master / Slave "Űŭ5-"ŭ
B (OQNCNSSH2.".,$"MNMG@MMNAHRNFMNCDKLNQRDSSN"ODQ
BNLTMHB@QD
2HCNUQ@MMNNRRDQU@QDKDRDFTDMSHQ@BBNL@MC@YHNMH
MDKK@QDSD@jKHHK¦LNQRDSSN"CNUQĐDRRDQDBNKKDF@SN@K
B@SDB@HS

C LNQRDSSN.5-"
MDKK@ QDSD @  jKH  HK ¦ LNQRDSSN " R@QĐ TSHKHYY@SN ODQ
QD@KHYY@QDK@BNMSHMTHSĐCDKK@RBGDQL@STQ@

Principio di collegamento dei prodotti SOCOMEC

(KLNQRDSSNgŰ.5-"ŰuCDKK@LNQRDSSHDQ@2.".,$"MNMĠ
BNKKDF@SN@KLNQRDSSN"CDKOQNCNSSN12
0TDRSNLNQRDSSNHRNK@SNOTŁDRRDQDTSHKHYY@SNODQE@BHKHS@QDK@
A OV
NC
BNMSHMTHSĐCDKK@RBGDQL@STQ@
Master / Slave -

B +
B@SDB@HS

2BGDL@CHBNKKDF@LDMSNCDHOQNCNSSH2.".,$"HMTM@QDSD@kKH

SOCOMEC Catalogo Generale 2012-2013 543


Reti di comunicazione

Il bus RS485 (seguito)


1DRHRSDMY@CHkMDKHMD@
+@QDRHRSDMY@CHjMDKHMD@DKeHLODCDMY@CHKHMD@CHU@KNQDHCDMSHBNQDRHRSDMY@CHNGLRODQLDSSDCHQHCTQQD@KL@RRHLNK@
QHkDRRHNMDCDKRDFM@KD
$RR@CDUDDRRDQDONRS@@CNFMHDRSQDLHSĐCDKATR @RDBNMC@CDHLNCDKKH OTŁDRRDQDCHQDSS@LDMSDHMSDFQ@S@MDKKeHMSDQE@BBH@
Attivazione dei prodotti: guida pratica
OO@QDBBGHN 1DRHRSDMY@CHSDQLHM@YHNMD
#(1(2       /NRHYHNM@QD
ON
$
V -+ qHCHORVHSBGRT.-ODQ@SSHU@QDK@QDRHRSDMY@
0
1

qHCHORVHSBGRT.%%ODQCHR@SSHU@QDK@QDRHRSDMY@
ON

#(1(2   1DRHRSDMY@HMCHODMCDMSDENQMHS@BNMHKOQNCNSSNODYYN@O@QSD 
".4-3(2$ $  120 Ω
"@AK@FFHNSQ@LNQRDSSN
ŰD
$ $ $ LIYCY-CY

NC + -

RS485

".4-3(2$BH /NRHYHNM@QD
qHCHORVHSBGRT.-ODQ@SSHU@QDK@QDRHRSDMY@
qHCHORVHSBGRT.%%ODQCHR@SSHU@QDK@QDRHRSDMY@

ON

#(1(2- /NRHYHNM@QD
- N+C qHCHORVHSBGRT.-ODQ@SSHU@QDK@QDRHRSDMY@
0-V+
1

qHCHORVHSBGRT.%%ODQCHR@SSHU@QDK@QDRHRSDMY@
12 N
R= O

1
ON
ON

Da notare che all'inizio della linea essa può essere posizionata su un terzo apparecchio o un PLC e non sul primo slave

Polarizzazione del bus


+@MNQL@12HLONMDTMKHUDKKNCHEEDQDMYH@KDCHŰL5
+5V 0V
ODQK@QHKDU@YHNMDCDKRDFM@KD
2D K@ KHMD@ 12 MNM Ġ ONK@QHYY@S@  PTDRSN KHUDKKN MNM Rup Rdown
R@QĐQ@FFHTMSN@QHONRNRDMY@BNLTMHB@YHNMDRTKK@KHMD@ R1
DPTHMCHHKETMYHNM@LDMSNMNMR@QĐF@Q@MSHSN
End of line
 PTDRSN RBNON  RH @OOKHB@ TM@ ONK@QHYY@YHNMD HM  RNKN +
OTMSN CDK ATR  $RR@ OQDEDQHAHKLDMSD Ġ @OOKHB@S@ RTK K@SN
B@SDB@EQ

Line U > 200mV Rend


L@RSDQ 2T@KBTMHLNCDKKHCHHMSDQE@BBH@ ĠONRRHAHKD@SSHU@QD -
questa polarizzazione di linea.
(M B@RN BNMSQ@QHN  AHRNFMDQDAAD @FFHTMFDQD Schema del principio della polarizzazione di un bus
TMe@KHLDMS@YHNMDDRSDQM@ $RR@CDUDF@Q@MSHQDTMKHUDKKNCH
 ŰL5RTSTSSNHKATRPT@MCNMNMBeĠBNLTMHB@YHNMD
Ethernet RS232 Interfaccia / Ripetitore
HM SQ@MRHSN  4M@ SDMRHNMD CH  Ű L5 Ġ TM ATNM Socomec
+5V 0V
BNLOQNLDRRN  $RR@ F@Q@MSHRBD CH DRRDQD RTODQHNQD @
ŰL5DSTSS@UH@MNMBNLONQS@TMBNMRTLNDBBDRRHUN Rup Rdown
/DQ UDQHjB@QD BHŁ  HK LNCN OHŔ OQ@SHBN Ġ CH ONRHYHNM@QD K@ R1
ENMSD CH ONK@QHYY@YHNMD @KKeHMHYHN CDK ATR K@SN HMSDQE@BBH@ D
CH UDQHjB@QD HK KHUDKKN CH SDMRHNMD @KKe@KSQ@ DRSQDLHSĐ CDK ATR 
2H SQ@SS@ CDK B@RN OHŔ RE@UNQDUNKD HK OQHLN @OO@QDBBGHN Linea
BNLTMHB@ BNM KeTKSHLN  0TDRS@ ONK@QHYY@YHNMD Ġ HMSDFQ@S@
RTKKDHMSDQE@BBDDHQHODSHSNQH2.".,$"
SSDMYHNMD  HK RDFM@KD CDKK@ SDMRHNMD 4 CDUD DRRDQD
ONRHSHUN
B@SDB@HS

N1 N2 Nn
R = 120 Ω

Schema di collegamento di un bus con interfacce SOCOMEC con


polarizzazione integrata

544 Catalogo Generale 2012-2013 SOCOMEC


Reti di comunicazione

Il bus RS485 (seguito)


Polarizzazione del bus (seguito)
Il dimensionamento
-DKB@RNCHTMe@KHLDMS@YHNMDDRSDQM@5ĠMDBDRR@QHN@FFHTMFDQDKDQDRHRSDMYD1up 1CNVMD1.
(KCHLDMRHNM@LDMSNCH1up 1 1CNVM CHODMCDC@KKHUDKKNDR@SSNCDKK@SDMRHNMDCH@KHLDMS@YHNMDDC@KKDQDRHRSDMYDCHKHMD@
5@KNQHRS@MC@QC
1upŰ1CNVMŰNGLR
 Ű •6
1ŰNGLR
 Ű •6
1endŰNGLR
 Ű •6
(KLDSNCNCHCDSDQLHM@YHNMDĠHMSDQ@SSHUN
(KOQNBDRRNĠPTDKKNCHUDQHjB@QDRDBNMPTDRSHU@KNQHRS@MC@QCHKKHUDKKNCHSDMRHNMD4@KK@jMDCDKK@KHMD@RHBNKKNB@MDKK@E@RBH@
OQDUHRS@lŰL5 #HUDQR@LDMSD ODQQ@FFHTMFDQDPTDRS@E@RBH@RHOTŁFHNB@QDRTHU@KNQH1TOD1CNVMSQ@D
+DNODQ@YHNMHUDMFNMNQHODSTSDjMBGġMNMRHNSSHDMDTM@SDMRHNMDBNMENQLD

Limitazioni
In una rete RS485 si deve tenere conto di 2 limitazioni
Il numero massimo di apparecchi La distanza massima dal bus
4M SQ@RLDSSHSNQD 12 CDUD ONSDQ BNLTMHB@QD BNM  +@CHRS@MY@L@RRHL@ODQTM@ONQS@S@L@WjMN@ŰJACR
TMHSĐCHB@QHBN@KL@RRHLN4+Ű4MHSXNE+N@CR ĠCHŰL
OO@QDBBGHN 5@KNQDHM4+ -TLDQNCH@OO@QDBBGH Lunghezza del cavo (m)
ODQNSSDMDQD4+
10 000
#(1(2   
#(1(2   
#(1(2   
#(1(2    1 000

#(1(2-  
".4-3(2$BH  
".4-3(2$   100
".4-3(2$  
".4-3(2$  
B@SDB@HS

".4-3(2$   10
".4-3(2$   10 000 100 000 1 000 000 Velocità (bit/s)

/DQB@QHBGHNKSQD4+ R@QĐMDBDRR@QHNTSHKHYY@QDTMQHODSHSNQD .KSQD PTDRS@ UDKNBHSĐ  R@QĐ MDBDRR@QHN TSHKHYY@QD TM


ripetitore.

SOCOMEC Catalogo Generale 2012-2013 545


Reti di comunicazione

Il protocollo PROFIBUS
Presentazione
!@R@SNRTTMOQHMBHOHNCHRB@LAHNBHBKHBNSQ@L@RSDQDRK@UD HKOQNSNBNKKN/1.%(!42ODQLDSSDTM@BNLTMHB@YHNMDLTKSH
L@RSDQDLTKSH RK@UDRTKKNRSDRRNATR (KLDSNCNTSHKHYY@SNHMPTDRSNB@RNĠPTDKKNCDKFDSSNMDHKOQHLNL@RSDQONRRHDCDHK
FDSSNMD DRDFTDK@BNLTMHB@YHNMDBNMFKHRK@UDBGDUTNKDDCĐHKFDSSNMD@KL@RSDQRDFTDMSDBGDQHOQNCTBDKNRSDRRNRBGDL@

Anello logico a gettone tra master

Master (posti attivi complessi)

P R O F I B U S
B@SDBAHSB@S

Interrogazione degli slave (posti passivi semplici)

File GSD
(K OQNSNBNKKN Ġ A@R@SN RT CDKKD S@ADKKD CH CH@KNFN CH HMFQDRRH D CH TRBHSD  +@ CDRBQHYHNMD CH PTDRSD S@ADKKD  @MBGD BGH@L@SD
LNCTKH RHE@SQ@LHSDTMjKD&2#ENQMHSNC@NFMHRK@UD/1.%(!42 +DHRSQTYHNMHODQKeTRNCDKLNCTKN/QNjATR BNLOKDS@SDC@
PTDRSNjKD&2# CDRBQHUNMNHKETMYHNM@LDMSNCDKKNRK@UDQHRODSSN@PTDRSNOQNSNBNKKN

Le diverse varianti

/1.%(!42#/
/1.%(!42/ Comando di assi su /1.%(R@ED
"NRSQTSSNQD
/QNBDRR /1.%(!42SQ@RLHRRHNMD 4MHUDQR@KD
/QNCNSSH2NBNLDB

/QNjKH@OOKHB@SHUHBNLDCDH /QNjKH@OOKHB@SHUHBNLDCDH /QNjKH@OOKHB@SHUHBNLDCDH /QNjKH@OOKHB@SHUHBNLDCDH


RHRSDLHCHHCDMSHjB@YHNMD @OO@QDBBGH@STQD/ /1.%(CQHUD /1.%(R@ED

/HKD#/ /HKD#/ /HKD#/ /HKD#/


#/ 5@5 #/ 5 #/ 5 #/ 5@5

12
12 ,!/ 12
,!/

"NLDNFMHOQNSNBNKKNCHBNLTMHB@YHNMDHMO@QSHBNK@QDODQHATRCHB@LON /1.%(!42ĠA@R@SNRTKLNCDKKNCDFKHRSQ@SH.2(
CDRBQHSSHOQDBDCDMSDLDMSD /DQQHRONMCDQD@KKDCHUDQRD@OOKHB@YHNMH PT@SSQNU@QH@MSHCDSSD@OOKHB@SHUDRNMNRS@SDQD@KHYY@SD 
NFMTM@BNMK@RT@RODBHjBHSĐ
(OQNCNSSHCDKK@F@LL@2.".,$"G@MMNTM@BDQSHjB@YHNMD/1.%(!42#/5
/DQBHŁ ĠONRRHAHKDBNKKDF@QDPTDRSHOQNCNSSH@CTMATR/1.%(!42#/

546 Catalogo Generale 2012-2013 SOCOMEC


Reti di comunicazione

Il protocollo PROFIBUS (seguito)


Il bus per il protocollo PROFIBUS
+NRSQ@SNCDKLNCDKKN.2(@RRHBTQ@K@SQ@RLHRRHNMDjRHB@CDHC@SH #DjMHRBDPTHMCHKDB@Q@SSDQHRSHBGDDKDSSQHBGDDLDBB@MHBGD
SHONCHBNCHjB@YHNMDDHMSDQE@BBH@MNQL@KHYY@S@12

/1.%(!42RODBHjB@CHUDQRDUDQRHNMHCHRSQ@SHfjRHBHtRDBNMCNKDSDBMHBGDCHSQ@RLHRRHNMDBNMENQLD@KKDMNQLDHMSDQM@YHNM@KH
($"D($"
+DCHUDQRDUDQRHNMHRNMNKDRDFTDMSH
SQ@RLHRRHNMD12
SQ@RLHRRHNMD,!/
SQ@RLHRRHNMD12 (2
SQ@RLHRRHNMDjAQ@NSSHB@

2.".,$"TSHKHYY@HKBNKKDF@LDMSN12BNMKDB@Q@SSDQHRSHBGDRDFTDMSH
SQ@RLHRRHNMDMTLDQHB@CHEEDQDMYH@KD
kTRRNC@ ĐJAHSRR
RNOONQSNBNRSHSTHSNC@TM@BNOOH@@SSNQBHFKH@S@RBGDQL@S@
SHONKNFH@KHMD@QDRDMY@RSDKK@BNMDRSQDLHSĐCHATR
OTMSHBNKKDF@AHKHBNMONRRHAHKHSĐCH@FFHTMFDQDCDHQHODSHSNQH

/DQC@QDRHBTQDYY@@KK@SQ@RLHRRHNMD ĠENQSDLDMSDBNMRHFKH@SNKTSHKHYYNCHTMB@UNMNQL@KHYY@SN/1.%(!42
#HUDQRHQHEDQHLDMSHRNMNOQNONRSHRTKRHSNRDFTDMSDGSSOVVV OQNBDMSDB BNLOQNCTBSRB@AKDHMCDW OGO

SOCOMEC Catalogo Generale 2012-2013 547


Misura elettrica

Dispositivo ferromagnetico

 ENQL@SNC@CTDCHRONRHSHUHTMNjRRN K@KSQNLNAHKDDRNKHC@KDBNMK@FNHMCHB@SNQD ONRSH@KKHMSDQMNCHTM@ANAHM@


Ì
@KHLDMS@S@C@KK@BNQQDMSDC@LHRTQ@QD
(KCHRONRHSHUNEDQQNL@FMDSHBNKDFFDHKU@KNQDDEjB@BDCDKRDFM@KD@KSDQM@SNKHMkTDMY@CDKK@ENQL@CNMC@ĠSQ@RBTQ@AHKD 
2HOTŁ@MBGDTSHKHYY@QDRTKRDFM@KDBNMSHMTN L@@RB@OHSNCDKK@BK@RRDCHOQDBHRHNMD 
/DQK@RT@RDLOKHBHSĐĠTMNRSQTLDMSNO@QSHBNK@QLDMSDHMCHB@SNODQK@LHRTQ@CDKKDBNQQDMSH@KSDQM@SDCDHPT@CQHHMA@RR@
SDMRHNMD

Dispositivo a bobina mobile

+@BNQQDMSDCHLHRTQ@ODQBNQQDTMSDK@HNLNAHKDANAHM@SN ONRS@MDKB@LONL@FMDSHBNCHTML@FMDSDODQL@MDMSD 
2NSSNK@YHNMDCDKKDENQYDDKDSSQNL@FMDSHBGDDRDQBHS@SDRTCHDRRN HKSDK@HNQTNS@RDBNMCNTM@KDFFDKHMD@QD
"@Q@SSDQHYY@SNC@TMA@RRNBNMRTLN PTDRSNĠKNRSQTLDMSNCHLHRTQ@ODQDBBDKKDMY@CDHRDFM@KHBNMSHMTHCHU@KNQD
QHCNSSN

Dispositivo a bobina mobile da raddrizzatore

$RRDMCNTM@OO@QDBBGHN@BNQQDMSDBNMSHMT@ONK@QHYY@SN BNMK@FFHTMS@CHTMQ@CCQHYY@SNQD@CHNCHHKF@KU@MNLDSQN@
SDK@HNLNAHKDBNMRDMSDK@LHRTQ@CHFQ@MCDYYD@KSDQM@SD

Posizione d’utilizzo
&KHHMCHB@SNQH1.3$7D#(-RNMNS@Q@SHBNMHKPT@CQ@MSDHMONRHYHNMDUDQSHB@KD
ÌONRRHAHKDTSHKHYY@QKHHM@KSQDONRHYHNMHRDMY@CHLHMTHQMDRDMRHAHKLDMSDK@OQDBHRHNMD  QHBGHDRS@ 
1
2
FKHHMCHB@SNQHONRRNMNDRRDQDS@Q@SHODQHKETMYHNM@LDMSNHMTM@PT@KRH@RH@KSQ@ONRHYHNMD
3 C@RODBHjB@QD@KLNLDMSNCDKKNQCHMD
4
B@SDBAWB@S

1 : _ > 90° 3 : _ < 90°


2 : _ = 90° 4 : _ = 0°

Utilizzo di trasformatori di tensione

Montaggio di 3 TP: Montaggio a "V " di 2 TP : rete 63 kV - TP : 63 kV /


rete 63 kV - TP 63 kV / 100 V / 3 100 V (V (utilizzo: misura di 3 tensioni 2 TP)

5NKSLDSQN  NKSLDSQN
5
5J5 5J5
LHRTQ@CDKK@SDMRHNMD V1 LHRTQ@CDKK@SDMRHNMD
BNMB@SDM@S@@A@RR@ BNMB@SDM@S@@A@RR@
V1 SDMRHNMD HMCHB@YHNMDCDKK@ SDMRHNMD HMCHB@YHNMD
B@SDBAWB@S

SDMRHNMDBNMB@SDM@S@ CDKK@SDMRHNMD
@C@KS@SDMRHNMD BNMB@SDM@S@@C@KS@
tensione
 NKSLĠSQD
5
5 J5
V2 LHRTQ@CDKK@SDMRHNMDCH
E@RD@A@RR@SDMRHNMD 
B@SDBAWB@S

HMCHB@YHNMDCDKK@SDMRHNMD
BNMB@SDM@S@@C@KS@
tensione

548 Catalogo Generale 2012-2013 SOCOMEC


Misura elettrica

Convertitore di potenza
Esempio
3@Q@STQ@CHTMBNMUDQSHSNQDCHONSDMY@@SSHU@3( 45 QDSDSQHE@RD BNR  3@Q@STQ@CHA@RD
/BNMUDQSHSNQD4(BNR  5W WW 6PTHMCHBNM3(C@ /6W J6
TRBHS@BNMUDQSHSNQDL L CDKB@QHBN

3@Q@STQ@ODQCHROK@XCHFHS@KD QDKĠCHRNFKH@ N&3"RHOTŁS@Q@QDTMCHROK@XCHFHS@KDODQUHRT@KHYY@QD J6@L PTHMCH


MNMĠMDBDRR@QHNLNCHjB@QDK@S@Q@STQ@CDKBNMUDQSHSNQD
3@Q@STQ@ODQHMCHB@SNQD@C@FNRB@K@TR@S@C@@J6B@KHAQ@SN@L @ENMCNRB@K@K@OO@QDBBGHN@RRNBH@SNMNMĠ
QDFNK@AHKD K@S@Q@STQ@CDKBNMUDQSHSNQDU@DEEDSST@S@MDKLNCNRDFTDMSD
J6 W66ODQL 10 13,16
/BNMUDQSHSNQD 5
15
 J6 0

B@SDBAWB@S
 6 J6 L

kW
6J6L
 J6 WL  L
(TRBHS@BNMUDQSHSNQD
J6

Classe di precisione
4M@OO@QDBBGHNCHLHRTQ@@M@KNFHBNĠB@Q@SSDQHYY@SNC@TMHMCHBDCHBK@RRDNBK@RRDCHOQDBHRHNMD "GDQ@OOQDRDMS@KDQQNQD
L@RRHLNDROQDRRNHMODQBDMSNCDKU@KNQDCHENMCNRB@K@ 

Esempio: un amperometro con 50 divisioni, classe 1,5


L’errore sarà di 1,5 0,75 divisioni0,75 divisioni
100
- ossia per un amperometro de 20 A : 20 / 50 x 0,75 = 0,3 A
- ossia per un amperometro de 400 A : 400 / 50 x 0,75 = 6 A

Un apparecchio numerico NCHFHS@KDOTŁHMCHB@QDTMU@KNQDCHŸCHFHSCDKKTKSHL@BHEQ@CDKMTLDQNUHRT@KHYY@SN NKSQD@KK@


OQDBHRHNMDQD@KDCDFKHDKDLDMSHBNRSHSTSHUHCDKK@OO@QDBBGHN

Esempio:un indicatore a 3 cifre (999 punti), con precisione dello 0,5 %, collegato a un TA 400/5 A, visualizzazione 400 A.
- (a) errore intrinseco 400 x 0,5 ossia ± 2 A
100
- (b) errore di visualizzazione 1 cifra, ossia ± 1 A
- valori estremi di lettura: (a) + (b) = ± 3 A (a carico nominale).

Un trasformatore di corrente 3 B@Q@SSDQHYY@SNC@KK@RT@BK@RRDCHOQDBHRHNMD


0TDRSNDQQNQDU@QH@HMETMYHNMDCDKB@QHBNMDKLNCNRDFTDMSD
$QQNQDŸCD(n
+HUDKKNCHB@QHBN  (n  (n  (n In  (n (n (n
"K@RRD         
1 2,0 1,50 1,0
   
5 5 5 5
/  
5P10 5 5
Esempio: i TA 5P5 sono usati per misurare la corrente dei circuiti dei motori e assicurano una precisione di ± 5 % a 5 In.

Consumo dei cavi in rame

 DQ CDjMHQD K@ ONSDMY@ CDK 3  N CDK BNMUDQSHSNQD C@


/
IHM W W+HML
RBDFKHDQD  RH CDUD BNMRHCDQ@QD HK BNMRTLN CDH B@UH ODQ /DQCHSDHM5 
S (in mmW
F@Q@MSHQD HK ATNM ETMYHNM@LDMSN CDKK@ B@SDM@ CH LHRTQ@
+CHRS@MY@RDLOKHBDSQ@HK3 DKHMCHB@SNQD
Perdite nei cavi in VA(1) - Per TA 5 A Perdite nei cavi in VA(1) - Per TA 1 A
+HML +HML
             
S (mm S (mm
                               
2,5 0,36 0,71 1,79 3,57 7,14 17,9 35,7 2,5 0,01 0,03 0,07 0,14 0,29 0,71 1,43
                  -            
6,0 0,15 0,30 0,74 1,49 2,98 7,44 14,9 6,0 - - 0,03 0,06 0,12 0,30 0,60
                - -          
(1) Si tiene conto solo della componente attiva delle perdite..

SOCOMEC Catalogo Generale 2012-2013 549


Misura elettrica

Trasformatore sommatore
(3 RNLL@SNQHBNMRDMSNMNCH@CCHYHNM@QDHU@KNQHDEjB@BHCHOHŔBNQQDMSH@KSDQM@SDCHTM@E@RDS@KHBNQQDMSHONRRNMN@UDQD
diversi  CHEEġQDMSR
4M3 RNLL@SNQDĠCDjMHSNBNM
HKMTLDQNCH3 C@BNKKDF@QDSTSSHBNMKNRSDRRNQ@OONQSNCHSQ@RENQL@YHNMD
K@ONSDMY@MNLHM@KDCHTSHKHYYN
Esempio :3 circuiti da controllare per un’uscita su un registratore
TI1 1000/5 A TI sommatore (4,0 VA) e un indicatore:
(a) Bilancio della potenza da fornire con il TA sommatore:
(amperometro + registratore + perdita circuito di misura)
TI2 1000/5 A
P’ = 1,5 VA + 7,0 VA + 1,5 VA = 10,0 VA,
B@SDBAHSB@S

A (b) Bilancio della potenza da fornire con i TA:


TI3 1000/5 A
P = P’ +consumo proprio del TA sommatore
Registratore (7,0 VA) + amperometro (1,5 VA) P = 10,0 VA + 4,0 VA = 14,0 VA ; ossia P / 3 per ogni TI.

TA saturabili
( 3  R@STQ@AHKH @RRHBTQ@MN K@KHLDMS@YHNMD CDH QDKĠ SDQLHBH CH A@RR@ ONSDMY@  OQNSDFFDMCNKH C@KKD RNUQ@BNQQDMSH CNUTSD @H
EQDPTDMSH@UUH@LDMSHCDHLNSNQHH3 R@STQ@AHKHDRHRSNMNRNKNHMTRBHS@C@ 

2.".,$"CHRSHMFTDCTDSHOHCH3 R@STQ@AHKH
3 BNMR@STQ@YHNMD@O@QSHQDC@(nODQ@UUH@LDMSHMNQL@KHODQDR ONLOD
3 BNMR@STQ@YHNMD@O@QSHQDC@ (nODQ@UUH@LDMSHHLODFM@SHUHODQDR UDMSHK@SNQHRDMY@QDFHRSQH

Adattamento dei rapporti di trasformazione


/DQBNQQDMSHMNLHM@KHHMEDQHNQH@H RHONRRNMNTSHKHYY@QD3 @B@UHO@RR@MSHBNMBNQQDMSDOQHL@QH@OHŔDKDU@S@@KONRSNCDH
3 @OQHL@QHN@UUNKSNPTDRSN@UUHDMDE@BDMCNO@RR@QDOHŔUNKSDK@KHMD@OQHL@QH@@SSQ@UDQRNHK3 
.KSQD@KKDBNMNLH@ PTDRSNLDSNCNODQLDSSDCH@C@SS@QDHCHUDQRHQ@OONQSHCHSQ@RENQL@YHNMDL@MSDMDMCNKNRSDRRNQDMCHLDMSN
DBK@RRDCHOQDBHRHNMDCDKKDLHRTQD
"NQQDMSDCDKOQHL@QHNC@LHRTQ@QD -TLDQNCHO@RR@FFH
 
Circuito primario
 
 
 
Circuito secondario
50 / 5 A
B@SDBAHSB@S

Esempio: corrente del primario del TA 50 A.

550 Catalogo Generale 2012-2013 SOCOMEC


Protezione digitale delle reti

Generalità
Il DIRIS di protezione, oltre alle funzioni di misura, conteggio, monitoraggio degli allarmi e comunicazione, assicura una
funzione di protezione contro le sovracorrenti. Per assicurare una tale funzione, il DIRIS dispone di un modulo che consente
di regolare una curva di sgancio.
La corrente I0 è calcolata come la somma vettoriale delle tre correnti di fase I1, I2, I3 o misurata direttamente sul quarto
ingresso di corrente. Il quarto ingresso può essere collegato al neutro tramite un trasformatore di corrente o collegato a un
TOROIDE omopolare per la misura delle correnti di fuga in corrispondenza della terra.
La soglia si stabilisce scegliendo una curva a tempo dipendente (SIT, VIT, EIT o UIT), o una curva a tempo indipendente DT.
Tutte le misure delle correnti sono effettuate in TRMS.
+@OQNSDYHNMDC@KKDBNQQDMSHCHFT@RSNĠ@RRHBTQ@S@BNMHKBNMEQNMSNSQ@KDBNQQDMSHLHRTQ@SDDK@BTQU@CHOQNSDYHNMDOQDCDjMHS@

Funzioni di protezione
Il DIRIS di protezione assicura la protezione dei circuiti
Protezione magnetica su I1, I2, I3, In : I >> codice ANSI : 50 elettrici: Deve essere obbligatoriamente associato a un
dispositivo di apertura che garantisca l’apertura nei tempi
Protezione termica su I1, I2, I3, In : I> codice ANSI : 51 convenzionali (vedere pagina 506).

Protezione magnetica codice ANSI :


I0 >>
sulla componente omopolare I0 : 50 N
Protezione termica codice ANSI :
I0 >
sulla componente omopolare I0 : 51 N
Protezione di massima
Idir codice ANSI : 67
corrente direzionale:
catec 046 b 1 it cat

Selettività logica codice ANSI : 68

Protezione contro il ritorno di potenza > rP codice ANSI : 37


Schema del sistema di apertura.

Curve di protezione a tempo dipendente


Codice ANSI 50 fasi 50 N Terra - secondo la norma IEC 60255-3 e BS 142. Queste curve sono generalmente utilizzate per la
programmazione della soglia bassa (sovraccarico).
/DQOQNFQ@LL@QDK@RNFKH@A@RR@ NBBNQQDRBDFKHDQDTM@BTQU@ CDjMHQDTM@RNFKH@(RHMODQBDMSNDTMSDLON3s corrispondente al
tempo di apertura per un guasto pari a 10 Is.
La soglia Is è il valore della corrente per la quale non avviene lo sgancio. Lo sgancio interviene dopo uno sbalzo di corrente superiore
a 1,1 Is e al termine della temporizzazione Ts.
Le curve, le soglie e le temporizzazioni sono identiche per le correnti di fase e la corrente I0 o del neutro In.

Relè di protezione
In caso di superamento della soglia, e al termine della temporizzazione, un relè RT si chiude per un guasto di fase. Questo
comando di chiusura del relè può essere bloccato nel caso in cui il dispositivo d’interruzione sia un interruttore I0 o del neutro In,
@KjMDCHQHRODSS@QMDK@B@O@BHSĐCH@ODQSTQ@ 0TDRSNKHLHSDĠjRR@SN@(n. Il relè RT va resettato con il tasto "R" della tastiera.

Rappresentazione delle curve Equazione delle curve

47,13 x 10-3
Curva a tempo inverso (SIT): t = Ts x
(I / Is)0,02 - 1
Curva a tempo molto inverso 9
(VIT):
t = Ts x
(I / Is) - 1
Curva a tempo estremamente 99
inverso (EIT):
t = Ts x
(I / Is)2 - 1
Curva a tempo ultra inverso 315,23
(UIT):
t = Ts x
(I / Is)2,5 - 1
catec 046 b 1 it cat

 @BTQU@g4(3uOTŁDRRDQDQHBNMjFTQ@S@OTMSNODQOTMSN
+
dall’utilizzatore tramite il collegamento RS485.

"TQU@BNMkFTQ@AHKD

SOCOMEC Catalogo Generale 2012-2013 551


Protezione digitale delle reti

Protezione del neutro t (s)

La protezione del neutro si ottiene con la traslazione della


curva di protezione delle fasi:
- i tempi Ts sono identici
- KDBNQQDMSHRNMNCHUHRDC@TMBNDEjBHDMSD*-

Ιs, Ts

catec 158 b 1 x cat


ΙN Ι Ι / Ιs

Protezione "guasto a terra "


0TDRS@OQNSDYHNMDĠBNMjFTQ@S@@KKNRSDRRNLNCNCDKKDBNQQDMSHCHE@RD
La protezione “guasto a terra” è una protezione contro le correnti di guasto di terra di valore rilevante. Essa non costituisce
una protezione per le persone (contatti diretti o indiretti) ma una prevenzione contro l’incendio.

Curva di protezione a tempo indipendente


Codice ANSI 50 fasi 50 N Terra – secondo la norma IEC 60255-3 e BS 142. Questa curva è usata
t (s)
per la programmazione della soglia alta (corto circuito). Essa può anche servire alla programmazione
della soglia bassa se la curva a tempo dipendente non è stata considerata. Per programmare la o le
RNFKHDHMCHODMCDMSH NBBNQQDRBDFKHDQDK@BTQU@@SDLONHMCHODMCDMSD#3 CDjMHQDTM@RNFKH@DTM@
temporizzazione.
Tempo indipendente (DT) con:
catec 134 a 1 x cat

Ts 0,1 In < Is < 15 In


0,02s < Ts < 30 s
Ι / Ιs
0 Ιs 0,02s < Ts < 300 s
con In = corrente nominale

Protezione contro il ritorno di potenza


Codice ANSI 37
È la rilevazione di una soglia minima di potenza attiva negativa sulle 3 fasi associata ad una temporizzazione.
Per far ciò, bisogna programmare una soglia in valore assoluto compresa tra il 5 % e il 110 % di Sn, e una temporizzazione
compresa tra 1 e 60 sec.
"ĠK@QHKDU@YHNMDCHTMLHMHLNCHONSDMY@@OODM@KDRDFTDMSHBNMCHYHNMHRNMNCDjMHSD
- P < 0 e IPI > 10 % di Q, cioè un angolo compreso tra 96° e 264°,
- U > 70 % di Un (tensione nominale) sulle 3 fasi,
- I > In / 20 sulle 3 fasi (ossia 250 mA se In = 5 A e 50 mA se In = 1 A),
- P > rP (soglia programmata in valore assoluto).

Scelta del TA
La classe minima raccomandata del TA di protezione è 5P 10 (precisione del 5 % a 10 In).

Scelta della potenza del TA in VA


La classe del TA (5P 10, 10P 10…) è garantita per un carico massimo dato in VA.
Il DIRIS rappresenta un carico di 1,5 VA al quale bisogna aggiungere le perdite dovute ai cavi di collegamento.
Esempio :
Corrente nominale: 275 A
La scelta si porta su un TA 300 A/1 A P
Il carico massimo di questo TA è di 4 VA per esempio.
Il TA è collegato con un cavo di 2 x 2,5 mm2 di lunghezza 10 m.
Perdita in VA del cavo (vedere pagina 549) : 3,57 VA.
Carico totale: 1,5 VA (DIRIS) + 3,57 VA = 5,07 VA.
(K 3  MNM ğ @C@SSN N AHRNFM@ CHLHMTHQD K@ KTMFGDYY@ CDK B@UN N @TLDMS@QD K@ RT@ RDYHNMD N O@RR@QD @C TM 3  HK BTH B@QHBN @LLHRRHAHKD ğ
superiore a 5,07 VA.

552 Catalogo Generale 2012-2013 SOCOMEC


Protezione differenziale

Generalità
Una corrente di guasto a terra è una corrente che si chiude
verso a terra a causa di un guasto d’isolamento (Id). Una
BNQQDMSDCHETF@UDQRNSDQQ@ĠTM@BNQQDMSDBGDkTHRBDC@KKD

B@SDBAWB@S
Id If
parti attive dell’impianto verso terra, senza alcun guasto
d’isolamento (If).

4M#HRONRHSHUN@BNQQDMSD#HEEDQDMYH@KD1DRHCT@##1CDjMHSNC@KK@MNQL@($"ĠCDRSHM@SN@QHKDU@QDKDBNQQDMSHCHETF@
NCHFT@RSNBGDRHUDQHjB@MNFDMDQ@KLDMSD@U@KKDCDKKNQNOTMSNCHMRS@KK@YHNMD 
I tipi principali di dispositivi differenziali sono:
- gli interruttori di manovra differenziali,
- gli interruttori automatici differenziali,
- i relè differenziali non integrati nell’apparecchio di apertura.

2.".,$" BNRSQTSSNQDRODBH@KHYY@SN OQNONMDTM@F@LL@BNLOKDS@CHQDKĠCHEEDQDMYH@KH HMFQ@CNCH@C@SS@QRH@NFMHONRRHAHKD


esigenza.
I relè differenziali hanno due scopi:
- interrompere l’impianto quando sono associati a un apparecchio di apertura a sgancio automatico,
- segnalare una corrente di fuga o di guasto quando sono utilizzati come relè di segnalazione.

Segnalare
Segnalare una corrente di fuga o di guasto a terra che resta però a un livello tale da autorizzare un’azione di manutenzione
preventiva.
La segnalazione differenziale è costituita:
- da un toroide che circonda i conduttori attivi del circuito da monitorare, che individua la corrente residua quando la somma
delle correnti nelle linee non è più nulla,
C@TMCHRONRHSHUNCH@M@KHRHDCHLHRTQ@CDKK@BNQQDMSDCHEEDQDMYH@KDBGD SQ@LHSDHRTNH+$#C@KK@QLD HRTNHQDKĠCHTRBHS@NK@
sua uscita digitale, avvisa gli operatori.
KBTMD@OOKHB@YHNMHONRRNMNQHBGHDCDQDDMSQ@LADKDETMYHNMH @OQHQDDRDFM@K@QD BNMSDLONQ@MD@LDMSD

Interrompere l’impianto
Una protezione differenziale è costituita in questo caso:
- da un toroide che circonda i conduttori attivi del circuito
da proteggere, che individua la corrente residua quando
la somma delle correnti nelle linee non è più nulla,
- da un dispositivo di analisi e di misura della corrente
differenziale che lancia il segnale d’allarme,
B@SDBAWB@S

RD - da un dispositivo di apertura dell’alimentazione azionato


dal relè d’allarme.

Quando si presenta un pericolo (scarica elettrica, incendio, esplosione, guasto di una macchina, ecc.), l’apertura automatica
dell’alimentazione assicura una o più funzioni seguenti:
- la protezione dai contatti indiretti,
- la limitazione delle correnti di fuga,
- la protezione supplementare dai contatti diretti,
- la salvaguardia delle attrezzature o della produzione,
- ecc.
I relè differenziali possono essere associati, a certe condizioni, a contattori, interruttori automatici o interruttori e interruttori
BNMETRHAHKHBNMANAHM@CHRF@MBHNCDKK@F@LL@2(#$1, 3D%42., 3CDKK@2.".,$"

SOCOMEC Catalogo Generale 2012-2013 553


Protezione differenziale

'HƂQL]LRQL
"NQQDMSDCHEEDQDMYH@KD(¸M Tempo di apertura
 @ BNQQDMSD CHEEDQDMYH@KD  HMCHB@S@ BNM (·M  Ġ HK U@KNQD
+  @MNQL@($"OQNONMDHRDFTDMSHU@KNQHOQDEDQDMYH@KH
+
massimo di corrente differenziale che provoca il di durata massima di apertura, espressa in secondi, per
funzionamento del dispositivo di rilevazione. Il suo valore i dispositivi differenziali destinati alla protezione dalle
DROQHLD BNLTMDLDMSD K@ RDMRHAHKHSĐ N K@ QDFNK@YHNMD scariche elettriche contro i contatti indiretti:
del DDR o Dispositivo a corrente Differenziale Residua 5@KNQDCTQ@S@CH@ODQSTQ@
DRDLOHN ##1  L   4M ##1 OTŁ  C@K OTMSN CH UHRS@ "K@RRD "NQQDMSDMNLHM@KD(M 
  5 " (·M (·M (·M
delle norme dei prodotti differenziali, scattare a partire da s s s
TMU@KNQDO@QH@LDSĐCDKK@BNQQDMSDCHEEDQDMYH@KDHLONRS@S@ 3A qualsiasi valore 2    
3B RNKN®     
&KH @OO@QDBBGH 2.".,$"  FQ@YHD @KK@ LHRTQ@ HM 1,2 
ONRRNMNSNKKDQ@QDBNQQDMSHBGDFHTMFNMN@KHMBK@RRD  @ BK@RRD 3! SHDMD BNMSN CDKK@RRNBH@YHNMD CH TM QDKĠ
+
"CDKK@BNQQDMSDCHEEDQDMYH@KDQDRHCT@ 0TDRS@OQDBHRHNMD differenziale con un apparecchio di apertura separato
consente correnti di fuga superiori per uno stesso livello da esso. Per la protezione dai contatti indiretti, la norma
di protezione, permettendo in questo modo una migliore CHMRS@KK@YHNMD($"@LLDSSDTMSDLONCH@ODQSTQ@
RDKDSSHUHSĐ O@QH @K L@RRHLN @  R ODQ TM BHQBTHSN CH CHRSQHATYHNMD 
(U@KNQHCHBNQQDMSD(·MRNMNBK@RRHjB@SHRDBNMCNSQDBK@RRH senza tenere conto della tensione di contatto se si ritiene
CHRDMRHAHKHSĐ MDBDRR@QH@ TM@ RDKDSSHUHSĐ  (M CHRSQHATYHNMD SDQLHM@KD  H
2DMRHAHKHSĐ 1DFNK@YHNMH(·M dispositivi differenziali utilizzati per la protezione delle
Bassa  persone devono essere di tipo istantaneo.
2DMRHAHKHSĐ 

3A
,DCH@ 1A
2DMRHAHKHSĐ L
L
L
KS@RDMRHAHKHSĐ ­L

Classi dei relè differenziali


+@MNQL@($"CDjMHRBDSQDBK@RRHCTRNODQH##1HMETMYHNMDCDKSHONCHQDSD

"K@RRHCDHQDKĠ
2HLANKN $RDLOHNCHBNQQDMSDCHFT@RSN
differenziali

I
L’apparecchio assicura lo scatto in presenza di correnti differenziali residue, alternate
"K@RRD " AC
t
sinusoidali.

L’apparecchio assicura lo scatto in presenza di correnti differenziali residue, alternate


I
sinusoidali o di correnti differenziali residue continue a impulsi, la cui componente
3HON
t BNMSHMT@RH@HMEDQHNQD@L HMTMHMSDQU@KKNCHSDLONCH@KLDMN¦@KK@EQDPTDMY@
assegnata.

L’apparecchio assicura lo scatto in presenza di correnti differenziali identiche a quelle


degli apparecchi di classe A, ma anche per correnti differenziali provenienti da circuiti
I
raddrizzatori:
3HON! - semplice semionda con carico capacitivo che produce una corrente continua
t - trifase a semplice o doppia semionda
- monofase a doppia semionda
CHRONRHSHUHBGDB@QHB@MNTM@A@SSDQH@CH@BBTLTK@SNQH

554 Catalogo Generale 2012-2013 SOCOMEC


Protezione differenziale

'HƂQL]LRQL VHJXLWR
Compatibilità elettromagnetica (CEM)
I DDR scattano talvolta per ragioni diverse dalla presenza di un guasto d’isolamento. Le cause possono essere diverse:
SDLONQ@KH  L@MNUQ@ CH @OO@QDBBGH @C @KS@ SDMRHNMD  BNQQDMSH CH BNQSN BHQBTHSN  @UUH@LDMSN CH LNSNQH  @BBDMRHNMD CH STAH
kTNQDRBDMSH BGHTRTQDRTB@QHBGHB@O@BHSHUH B@LOHDKDSSQNL@FMDSHBH RB@QHBGDDKDSSQNRS@SHBGD

( ##1 BGD NEEQNMN TM@ RTEjBHDMSD HLLTMHSĐ C@ S@KH


ODQSTQA@YHNMHRNMNBNMSQ@RRDFM@SHBNMHKRHLANKN

2DBNMCNKDMNQLD($" H##1CDUNMNDRRDQDRBDKSHHML@MHDQ@S@KDC@KHLHS@QDHQHRBGHCHRB@SSHHMSDLODRSHUHCNUTSH
@KKD ODQSTQA@YHNMH "$,  /DQBHŁ  H OQNCNSSH CDKK@ F@LL@ 1$282 2.".,$" OQDRDMS@MN TMHLLTMHSĐ QHMENQY@S@ BNMSQN KD
ODQSTQA@YHNMH

+D @KHLDMS@YHNMH @TRHKH@QHD CDH QDKĠ CHEEDQDMYH@KH 2.".,$" 


ENQSDLDMSDjKSQ@SD DUHS@MNFKHRB@SSHHMSDLODRSHUHNKDCHRSQTYHNMH
dei dispositivi in caso di sovratensioni originate da fulmini o
L@MNUQD@C@KS@SDMRHNMDjFTQ@@j@MBN

B@SDBAWB@S
Il principio della misura per campionatura digitale del
segnale differenziale e la scelta dei materiali dei toroidi
@RRHBTQ@MNTM@ATNM@SDMTS@CDHQDKĠCHEEDQDMYH@KHHMB@RNCH
passaggio di una corrente transitoria, prodotta in occasione
CDKK@BGHTRTQ@CHBHQBTHSHENQSDLDMSDB@O@BHSHUH%HF @NCH
un innesco in caso di perforazione del dielettrico in seguito
@TM@RNUQ@SDMRHNMD%HF A

B@SDBAWB@S
Fig. a. Fig.b.

Applicazioni
Protezione di un impianto
Selettività totale (selettività verticale)
+@RDKDSSHUHSĐG@KNRBNONCHDKHLHM@QDK@BNQQDMSDCHFT@RSNRNKNMDKK@O@QSDCDKKHLOH@MSNHMBTHRHSQNU@HKFT@RSN  EjMBGġBHŁ
@UUDMF@ NBBNQQDBGDRH@MNUDQHjB@SDDMSQ@LAHKDCTDBNMCHYHNMHRDFTDMSH
1. Il tempo di funzionamento del DDR a valle(tfBjF CDUDDRRDQDHMEDQHNQD@KSDLONCHMNMETMYHNM@LDMSNCDKCHRONRHSHUN
a monte (tnf A). Una semplice soluzione per rispettare questa condizione consiste nell’utilizzo di DDR di classe S (ritardo
QDFNK@AHKD (KQHS@QCNCDK##1@LNMSDCNUQĐDRRDQDRTODQHNQD@KQHS@QCNCDK##1@U@KKD%HF 
2. +@RDMRHAHKHSĐCDK##1@U@KKD(·M!CDUDDRRDQDHMEDQHNQD@KK@LDSĐCDKK@RDMRHAHKHSĐCDK##1@LNMSD(·M UDCDQD%HF D

ritardo = 200 ms

ritardo = 50 ms
ritardo = 50 ms

non ritardo non ritardo


B@SDBBHSB@S

B@SDB@WB@S

Fig.1. Fig.2.

SOCOMEC Catalogo Generale 2012-2013 555


Protezione differenziale

$SSOLFD]LRQH VHJXLWR
Protezione di un impianto (seguito)
Selettività orizzontale
(M TM@ QDSD CH CHRSQHATYHNMD CH SHON 33  MNM Ġ NAAKHF@SNQHN
ONQQD TM CHRONRHSHUN CHEEDQDMYH@KD FDMDQ@KD (·M @ LNMSD
delle singole partenze protette da un DDR, a patto che
KHMRHDLD CDKKHLOH@MSN jMN @H LNQRDSSH @ LNMSD CH PTDRSH
B@SDBAWB@S

TKSHLHRNCCHRjKDCHRONRHYHNMHQDK@SHUD@KK@BK@RRD((N@AAH@
previsto un isolamento supplementare al momento
dell’installazione.

Protezione dei motori


4MFT@RSNCHRNK@LDMSNOQDRDMSDMDKK@UUNKFHLDMSNCHTMLNSNQDOQNCTQQĐDEEDSSHBK@RRHjB@AHKHHMCTDKHUDKKH
- distruzione dell’avvolgimento: il motore può essere riparato,
- distruzione del circuito magnetico: il motore è distrutto.
+HMRS@KK@YHNMDCHTMCHRONRHSHUNCHEEDQDMYH@KDBGDKHLHS@K@BNQQDMSDCHFT@RSN@U@KNQHHMEDQHNQH@KCH(MHLODCHRBDK@ODQENQ@YHNMD
CDHBHQBTHSHL@FMDSHBHDOQNSDFFDHKLNSNQD #@SNBGD@KBTMHFQNRRHLNSNQHONRRNMNOQDRDMS@QDTMNRPTHKHAQHNCDKKDBNQQDMSHCH
fase o correnti di fuga in fase di avviamento, a certe condizioni è ammessa l’eventuale neutralizzazione temporanea del relè
differenziale in questa fase.

Corrente di fuga delle apparecchiature


 KH@OO@QDBBGHCHDK@ANQ@YHNMDCDKKDHMENQL@YHNMH RDBNMCN
&
KDMNQLD$-D($" ONRRNMNDRRDQDENMSHCHBNQQDMSD utente
CHETF@@B@TR@CDHO@QSHBNK@QHCHRONRHSHUHCHjKSQ@FFHN@CDRRH
associati.
2NMN @LLDRRD BNQQDMSH CH ETF@ B@O@BHSHUD CH   L  ODQ
B@SDBBHSB@S

filtro
BHQBTHSHBNMOQDRDCHBNQQDMSDDCDK@BDQSDBNMCHYHNMHODQ
HBHQBTHSHCHHMRS@KK@YHNMHjRRD
+@ MNQL@ $-  ODQ KD SSQDYY@STQD $KDSSQNMHBGD $$
utilizzate negli impianti di potenza ammette correnti di fuga Collegamento dei CPI (caso generale).
L@RRHLDCH L  "DCHL #"ODQTM@RHMFNK@$$
In caso di superamento di tali valori, occorre adottare ulteriori
accorgimenti quali, per esempio, il raddoppio del conduttore
di protezione, l’apertura dell’alimentazione in caso di rottura
CDK/$ KHMRS@KK@YHNMDCHTMSQ@RENQL@SNQDCHHRNK@LDMSN DBB

Effetto di "simpatia"
Un guasto d’isolamento di valore rilevante che interessa
Apertura per simpatia
una singola partenza può tuttavia richiudersi per effetto
CDKKDB@O@BHSĐCHETF@RTTM@KSQ@O@QSDMY@DOQNUNB@QDKN
scatto di quest’ultima senza che ci sia stato alcun degrado
dell’isolamento del circuito interessato.
Questo fenomeno è particolarmente frequente sulle
O@QSDMYDB@Q@SSDQHYY@SDC@B@O@BHSĐCHETF@ONSDMYH@KLDMSD
rilevanti o se il guasto si presenta su una linea molto lunga.
B@SDBAHSB@S

GUASTO

Una soluzione per limitare questo effetto è la temporizzazione degli


apparecchi differenziali.

556 Catalogo Generale 2012-2013 SOCOMEC


Protezione differenziale

$SSOLFD]LRQH VHJXLWR
Protezione contro gli incendi
(KO@Q@FQ@EN  CDKK@MNQLD($"OQDUDCNMNKHLOHDFNCH##1BNM(·M­L OODQOQNSDFFDQDHKNB@KHBGD
presentano rischi d’incendio.

Posizione a rischio di esplosione


 NMRBGDL@33N3-K@MNQL@($"RSHOTK@TM@OQNSDYHNMDCDKKDB@M@KHYY@YHNMHBNM##1L MDHKNB@KH@QHRBGHNCH
"
DROKNRHNMDCHSHON!$

Pannelli a riscaldamento
 KHDKDLDMSH@QHRB@KC@LDMSNCDUNMNDRRDQDOQNSDSSHBNM##1BNM(CMNL HML@MHDQ@C@DUHS@QDK@CHRSQTYHNMDCDH
&
QHUDRSHLDMSHLDS@KKHBH($"

Sorveglianza delle correnti differenziali


Sistemi di localizzazione dei guasti residuali
La resistenza di isolamento è un fattore importante, per non dire determinante, per il funzionamento e la sicurezza di utilizzo
CHTMHMRS@KK@YHNMDDKDSSQHB@ 1@OOQDRDMS@ HMDEEDSSH TM@OQHNQHSĐ@RRNKTS@MDKKDLHRTQDCHRHBTQDYY@Q@BBNL@MC@SDMDKK@LAHSN
DKDSSQHBN  #HUDQRH RSTCH G@MMN CHLNRSQ@SN BGD BHQB@   CDH FT@RSH CH HRNK@LDMSN RNMN FT@RSH @ KTMFN SDQLHMD  RNKS@MSN
HK   CDH FT@RSH RH QHRNKUNMN Q@OHC@LDMSD  ( CHRONRHSHUH CH RHBTQDYY@ RNKHS@LDMSD TSHKHYY@SH  BNLD FKH HMSDQQTSSNQH @TSNL@SHBH
CHEEDQDMYH@KH  OQDMCNMN HM BNMRHCDQ@YHNMD RNKN PTDRSN    @KKNQBGġ MDRRTM@ LHRTQ@ OQDUDMSHU@ Ġ OQDR@ ODQ H FT@RSH BGD
evolvono lentamente.

+DB@TRDCHCDSDQHNQ@LDMSNCDKKHUDKKNCHRNK@LDMSNRNMNE@SSNQHBNLDKTLHCHSĐ KHMUDBBGH@LDMSN KNRONQBN FKHDEEDSSHBKHL@SHBH


+DKDMBN CDKKD BNMRDFTDMYD ONSDMYH@KH CDH FT@RSH CHRNK@LDMSN Ġ LNKSN KTMFN D KD KNQN FQ@UHSĐ CHUDQRD  ONRRNMN DRRDQD
semplicemente fastidiose, ma anche pericolose:
- interruzione intempestiva dell’impianto, interruzione del processo di produzione importante,
- comandi erronei dopo diversi guasti d’isolamento. L’apparizione simultanea di due guasti d’isolamento può simulare il
RDFM@KDCHTMCHRONRHSHUNCHBNL@MCN (/+"OQNFQ@LL@AHKHNHQDKĠRNMN@CDRDLOHNLNKSNRDMRHAHKHDQHRONMCNMN@BNQQDMSH
@MBGDLNKSNA@RRD
QHRBGHNCHHMBDMCHNCNUTSN@CHRRHO@YHNMHCHONSDMY@CNONFT@RSHCHRNK@LDMSNENQSDLDMSDQDRHRSHUHTM@CHRRHO@YHNMDCH6
@RDFTHSNCDKFT@RSNĠTMU@KNQDFHĐBNMRHCDQ@SNBNLDODQHBNKNRNBGDOTŁONQS@QD@QHRBGHCHHMBDMCHN
- ricerca lunga e faticosa del guasto d’isolamento, in particolare quando esso è composto da diversi guasti minori,
KD BNQQDMSH CHEEDQDMYH@KH A@RRD  ODQ BNKO@ CH FT@RSH CHRNK@LDMSN CH ENQSD HLODCDMY@  MNM RNMN QHKDU@SD  -D QHRTKS@ TM@
diminuzione progressiva della resistenza d’isolamento.

In ogni caso, i guasti d’isolamento provocano costi. Alcune ricerche hanno dimostrato che la frequenza dei guasti è crescente
SQ@K@RNQFDMSDCH@KHLDMS@YHNMD K@QDSDCHCHRSQHATYHNMDOQHMBHO@KDDKDCHRSQHATYHNMHRDBNMC@QHD jMN@KKDTSDMYDBNMMDRRD
$BBN ODQBGġ KD MNQLD @SST@KH DRHFNMN TM BNMSQNKKN QDFNK@QD CDKK@ QDRHRSDMY@ CHRNK@LDMSN  /DQŁ PTDRSH BNMSQNKKH QDFNK@QH
rimangono sporadici e non escludono per niente l’apparizione eventuale di guasti.
+DQD@KHYY@YHNMHLNCDQMDHMSDFQ@MNHKBNMBDSSNCHL@MTSDMYHNMDOH@MHjB@S@DOQDUDMSHU@ $RRNMDBDRRHS@CHTM@RNQUDFKH@MY@
HMSDKKHFDMSD D ODQL@MDMSD CDK KHUDKKN CHRNK@LDMSN  "NRSHSTHRBD KTMHBN LNCN OQDUDMSHUN CH OQNSDYHNMD BNMSQN H FT@RSH
d’isolamento.

(K RHRSDL@ CH QHBDQB@ CH BNQQDMSH CHEEDQDMYH@KH #+1#  Ġ RS@SN BNMBDOHSN ODQ PTDRSN RBNON  4SHKHYY@SH BNLD CHRONRHSHUH CH
RDFM@K@YHNMD l D MNM CH HMSDQQTYHNMD l ODQ RHRSDLH 3-2 D 33 QDSD BNKKDF@S@ @ SDQQ@  BNLOKDS@MN H CHRONRHSHUH BK@RRHBH CH
protezione contro le correnti differenziali.
(KRHRSDL@#+1#RNQUDFKH@HML@MHDQ@RDKDSSHU@KDCHUDQRDO@QSDMYDCHTM@QDSD +@RNFKH@C@KK@QLDCDKK@BNQQDMSDCHEEDQDMYH@KD
ĠBNMjFTQ@AHKDHMCHUHCT@KLDMSDODQNFMHO@QSDMY@ (MNKSQD KTSDMSDOTŁBNMjFTQ@QDTMRNFKH@CHRDFM@K@YHNMDOQD @KK@QLD (K
RHRSDL@RDFM@K@HLLDCH@S@LDMSDPT@KRH@RHRTODQ@LDMSNCDKU@KNQDOQD QDFNK@SN 3@KHCHRONRHSHUHODQLDSSNMN
- la manutenzione preventiva tramite rivelazione rapida (simultanea su 12 partenze per scatola) dei guasti di qualsiasi origine
LHRTQ@CDKKDBNQQDMSHCHSHON "  D!
- una segnalazione senza interruzione: nessun interruzione dei processi,
- la riduzione dei costi tramite una localizzazione rapida dei guasti,
KHMENQL@YHNMDDKTSHKHYY@YHNMDBDMSQ@KHYY@SDSQ@LHSDBNLTMHB@YHNMD/QNjATR#/ ,NCATR 3"/(/UH@O@RRCDCHB@S@
TMDRSDMRHNMDHMETMYHNMDCDKKDDUNKTYHNMHCDKUNRSQNHLOH@MSNjMN@O@QSDMYD

SOCOMEC Catalogo Generale 2012-2013 557


Protezione differenziale

,QVWDOOD]LRQH
Ogni impianto presenta una corrente di fuga a terra dovuta essenzialmente alle fughe capacitive dei conduttori e ai condensatori
CHjKSQNCDFKH@YHNM@LDMSHNODQK@BNLO@SHAHKHSĐDKDSSQNL@FMDSHB@"$, ODQDRDLOHNCDFKH@OO@QDBBGHCHBK@RRD(
+@ RNLL@ CH PTDRSD BNQQDMSH CH ETF@ OTŁ E@QD RB@SS@QD @KBTMH ##1 CH DKDU@S@ RDMRHAHKHSĐ  +N RB@SSN Ġ ONRRHAHKD @ O@QSHQD C@
(·M(·MW ODQFKH@OO@QDBBGH2.".,$"1$282,D/ RDMY@BGDKHMBNKTLHSĐCDKKDODQRNMDRH@BNLOQNLDRR@
Le correnti di fuga possono essere limitate con:
- l’utilizzo di apparecchi di classe II
- trasformatori di separazione
- limitazione del numero di utilizzatori protetti da uno stesso DDR.

Miglioramento della funzionalità dei DDR


Installazione all’origine dell’impianto TT Aumento dell’immunità di un toroide dalle
KKNQHFHMD CDKKHMRS@KK@YHNMD 33 D RNKN HM PTDRSN B@RN  Ġ perturbazioni con:
ONRRHAHKDRNRSHSTHQDHKSNQNHCDCHQHKDU@LDMSNONRSNHMSNQMN@H - la disposizione simmetrica dei conduttori di fase intorno
conduttori attivi con un toroide unico, posto sul conduttore al conduttore di neutro,
che collega il neutro del trasformatore ad alta, media e - l’utilizzo di un toroide di diametro pari ad almeno 2 volte il
A@RR@SDMRHNMD@KK@SDQQ@ 0TDRSNRBGDL@CHBNKKDF@LDMSN CH@LDSQNCDKBDQBGHNENQL@SNC@HBNMCTSSNQH#®C
ODQLDSSD CH @TLDMS@QD KHLLTMHSĐ C@KKD ODQSTQA@YHNMH D - l’eventuale aggiunta di un cilindro magnetico di altezza
presenta inoltre il vantaggio di essere più economica. pari ad almeno 2D.

Trasformatore in Apparechio con bobina di sgancio


alta, media e bassa tensione (SIDERMAT o FUSOMAT) 1 toroide (D)
N
2 3 diametro d(1)
dell’eventuale cilindro
magnetico

h ≥ 2D

cilindro magnetico
(se necessario)

Toroide Relè toroide


Rd diffrenziale
B@SDBAHSB@S

B@SDBCHSB@S

L(2) conduttori attivi


Corrente di guasto

(1) d = il centraggio dei cavi in un toroide evita la saturazione locale


del toroide stesso. Un toroide saturo causa scatti intempestivi.
(2) L = distanza tra il toroide e la curva dei cavi.

Indicazione delle condizioni di test dei dispositivi differenziali


.BBNQQD OQDUDCDQD TM@ L@QB@STQ@ @FFHTMSHU@ BGD HMCHBGH @KKTSHKHYY@SNQD K@ MDBDRRHSĐ CH DEEDSST@QD QDFNK@QLDMSD HK SDRS RH
Q@BBNL@MC@TM@ODQHNCHBHSĐSQ@HDHLDRH

Scelta del dispositivo differenziale in funzione della natura della protezione da assicurare
La norma IEC 60364 raccomanda una scelta seconda la natura della protezione da assicurare:
OQNSDYHNMDBNMSQNHBNMS@SSHHMCHQDSSHRDMRHAHKHSĐC@RBDFKHDQDHMETMYHNMDCDKKDSDMRHNMHCHBNMS@SSH@LLHRRHAHKH
OQNSDYHNMDBNLOKDLDMS@QDBNMSQNHBNMS@SSHCHQDSSH(·ML 
OQNSDYHNMDBNMSQNHQHRBGHCHHMBDMCHN(·ML 

Scelta del dispositivo differenziale in regime IT


La norma IEC 60364
/DQDUHS@QDRF@MBHHMSDLODRSHUHCDH##1CHOQNSDYHNMDBNMSQNHBNMS@SSHHMCHQDSSH ODQH##1CHLDCH@RDMRHAHKHSĐ HKU@KNQDCDKK@
BNQQDMSDCHEEDQDMYH@KDQDRHCT@@RRDFM@S@CDKK@OO@QDBBGHN(·MCDUDDRRDQDRTODQHNQD@KCNOOHNCDKU@KNQDCDKK@BNQQDMSDCH
fuga (If) che circola durante un primo guasto ,İQ![,I

558 Catalogo Generale 2012-2013 SOCOMEC


Protezione differenziale

,QVWDOOD]LRQH VHJXLWR
Scelta del dispositivo differenziale secondo i principi dell’alimentazione ausiliaria
2DBNMCNK@MNQL@($" HKKHUDKKNCHBNLODSDMY@CDFKHTSHKHYY@SNQHDK@CDRSHM@YHNMDCDKKHLOH@MSNCDUNMNNQHDMS@QDK@
scelta dei dispositivi di protezione differenziali secondo il tipo di funzionamento legato al principio d’alimentazione.

2BDKS@ONRRHAHKDHMETMYHNMDCDKSHONC?HMRS@KK@YHNMD
-@STQ@CDKCHRONRHSHUNCHEEDQDMYH@KD Personale 3DRS@SDDUDQHjB@SDC@ODQRNM@KD
inesperto (BA1) @KLDMNDRODQSN! 
A fonte ausiliaria indipendente dalla rete -.- SI

$IXQ]LRQDPHQWRLQGLSHQGHQWHGDOODWHQVLRQHGLUHWH SI SI
A funzionamento dipendente dalla tensione di rete o da qualsiasi fonte
-.- SI
ausiliaria a sicurezza positiva
$IXQ]LRQDPHQWRGLSHQGHQWHGDOODWHQVLRQHGLUHWHSULYRGLVLFXUH]]D SI
NON
SRVLWLYD VDOYRFLUFXLWL3&$
A funzionamento dipendente dalla tensione di una fonte ausiliaria priva di 2(R@KUNBHQBTHSH/" D
-.-
sicurezza positiva egnalazione di guasti di fonte ausiliaria.
Nota: un trasformatore collegato alla rete non costituisce una fonte ausiliaria indipendente dalla rete.

Caratteristiche di un dispositivo differenziale a fonte ausiliaria


,NMHSNQ@FFHNHMCHODMCDMSDC@KK@SDMRHNMDCDKBHQBTHSNRNQUDFKH@SN
 C@SSN@KKDQDSHBNMkTSST@YHNMHMNSDUNKHDQ@OHCD
,NMHSNQ@FFHNHMCHODMCDMSDC@KK@BNQQDMSDCHB@QHBNOHBBGHMNMDPTHKHAQ@SHCHBNQQDMSH @BBNOOH@LDMSNCHB@QHBGHHMCTSSHUH
,HFKHNQDHLLTMHSĐC@KKNRB@SSNHMB@RNCHFT@RSHSQ@MRHSNQHSDLONCHMSDFQ@YHNMDMDKKNQCHMDCDHMR LDMSQDTM@OO@QDBBGHN
corrente propria rischia di scattare in alcuni ms).

Precauzioni per l’installazione di toroidi su cavi armati


"@UN@QL@SNHRNK@QDDKDSSQHB@LDMSDK@QL@STQ@CHQ@BBNQCNDBNKKDF@QK@@KK@SDQQ@
N 1 2 3 N 12 3
PE

PE

Treccia
B@SDBAHSB@S

PE

Cavo schermato Cavo 3P+N+T

Scelta della classe dei differenziali in funzione dei carichi


Gli impianti sono dotati in misura sempre maggiore di
dispositivi raddrizzatori (diodi, tiristori, ecc.). Le correnti verso trasportabile collegamento fisso
dell’EE alla rete
terra a valle di tali dispositivi generano una componente
BNMSHMT@BGDOTŁCDRDMRHAHKHYY@QDH##1
Gli apparecchi differenziali devono essere di classe adatta ≥ 4 kVA
potenza
> 4 kVA
@HB@QHBGHUDCHB@OHSNKNCDKK@CDjMHYHNMDCDKKDBK@RRH
+@ MNQL@ $-  OQDRBQHUD HK RDFTDMSD CH@FQ@LL@ 
BGD CDjMHRBD KD DRHFDMYD HMRNQFDMSH HM NBB@RHNMD no in grado di
generare guasti in DC
CDKKTSHKHYYNCHTM$$CHDSQNTMCHRONRHSHUNCHEEDQDMYH@KD$$ o raddrizzati
equipaggiamento elettronico). si
&KH$$SQ@RONQS@AHKHK@BTHONSDMY@@OO@QDMSDCHMFQDRRNMNM
etichetta
DBBDCDHJ5 CDUNMNDRRDQDBNLO@SHAHKHODQOQNFDSSNBNM di avviso
i DDR di tipo A (protezione contro i contatti diretti e indiretti).
&KH$$BGDQHRBGH@MNCHFDMDQ@QDTM@BNLONMDMSDBNMSHMT@CDKK@ DDR tipo A no no DDR tipo B
corrente di guasto, con il pericolo di ostacolare il funzionamento compatibile compatibile
CDKKDOQNSDYHNMHCHEEDQDMYH@KH CDUNMNDRRDQDNAAKHF@SNQH@LDMSD si si
accompagnati da un’etichetta di avvertimento.
utilizzare un’altra
0T@MCN H ##1 MNM RNMN BNLO@SHAHKH BNM FKH $$ C@ misura di protezione
proteggere, occorre adottare altre misure di protezione,
B@SDBAHSB@S

PT@KHODQDRDLOHNRDO@Q@QDK$$C@KRTN@LAHDMSDSQ@LHSD
utilizzare un DDR utilizzare un DDR
HRNK@LDMSNCNOOHNNQHMENQY@SN NHRNK@QDK$$C@KK@QDSDODQ di tipo A di tipo B
mezzo di un trasformatore, ecc.

SOCOMEC Catalogo Generale 2012-2013 559


Protezione differenziale

,QVWDOOD]LRQH VHJXLWR
Scelta della classe dei differenziali in funzione dei carichi (seguito)
L1
+@MNQL@$-  ONQONMDTM@RBDKS@CDKK@BK@RRDCH##1HMETMYHNMDCDKKDKDSSQNMHB@HMSDQM@CDKQHBDUHSNQD
L1

"K@RRDQHBGHDRS@ ,NMS@FFHN "NQQDMCNCHQDSDMNQL@KD "NQQDMCNG@K@3DQQ@CHCHEDSSN


,NMNE@RD
L
1 ®
t t
N
PE

,NMNE@RDBNMLHQ@FFHN

L
2 B
t t
N
PE

,NMNE@RD@RSDKK@SQHE@RD

L1
3 B L2
t t
L3
N
PE

Ponte raddrizzatore a doppia alternanza

 ® L
N t t

PE

Ponte raddrizzatore misto a doppia


alternanza
 ® L
N t t

PE

Ponte raddrizzatore misto a doppia


alternanza tra fasi

 B L1
L2 t t
N
PE

Ponte raddrizzatore trifase

L1
 B L2 t t
L2

PE

Dimmer a comando di fase


L
8 ® "
t t
N
PE

#HLLDQ@BNL@MCNODQSQDMNCNLAQ@

L
 ® "
t t
N
PE

560 Catalogo Generale 2012-2013 SOCOMEC


Protezione differenziale

,QVWDOOD]LRQH VHJXLWR
Carichi "industriali"
 KH@OO@QDBBGHOHŔCHEETRHRNMNCHBK@RRD " K@QD@KSĐCDFKHHLOH@MSHHMCTRSQH@KHFHTRSHjB@KTRNCH@OO@QDBBGHBGDRH@MN@KLDMN
&
di classe A.

Carichi di tipo variatori di velocità


 @SNBGDHB@QHBGHCHPTDRSNSHONRNMNLNKSNHMRS@AHKH HQDKĠCHBK@RRD! HMCHODMCDMSHC@KK@SDMRHNMDDC@KK@BNQQDMSD R@Q@MMN
#
@MBNQ@OHŔRODBHjB@LDMSD@C@SSH@OQDUDMHQDHQHRBGHCH@YHNM@LDMSNHMSDLODRSHUN

Raggruppamento delle utenze in funzione del tipo di carico


Gli impianti devono raggruppare i tipi d’apparecchi che provocano guasti identici.
I carichi eventualmente capaci di generare componenti continue non dovranno essere collegati a valle dei dispositivi destinati
alla protezione dei carichi che generano, in caso di guasto, solo componenti alternate o a impulsi raddrizzati.

Segnalazione o preallarme di una fuga o di un guasto


 DFKHHLOH@MSHHMBTHK@BNMSHMTHSĐCHETMYHNM@LDMSNĠHLODQ@SHU@DK@RHBTQDYY@CHADMHDODQRNMDĠO@QSHBNK@QLDMSDDRONRS@
-
i guasti d’isolamento costituiscono un rischio serio al quale occorre dedicare la massima attenzione.

Questa funzione di segnalazione può essere garantita in due fasi:


1.K@ODQSTQ@@TSNL@SHB@CDKK@KHLDMS@YHNMDODQNAAKHFGHCHOQNSDYHNMDOQNSDYHNMDC@HBNMS@SSHCHQDSSHDHMCHQDSSHNKHLHS@YHNMDCDKK@
corrente di fuga) è assicurata da dispositivi differenziali, la funzione di segnalazione può essere fornita dai relè di preallarme
HMBNQONQ@SHHMBDQSHQDKĠCHEEDQDMYH@KH 0TDRSHOQNCNSSHBNMOQD@KK@QLDQHRONMCNMN@KK@Q@BBNL@MC@YHNMDCDKd   BGD
richiede la limitazione della somma delle correnti di fuga presunte a un terzo della corrente di funzionamento.
2.K@ODQSTQ@@TSNL@SHB@CDKK@KHLDMS@YHNMDODQNAAKHFGHCHOQNSDYHNMDOQNSDYHNMDC@HBNMS@SSHCHQDSSHDHMCHQDSSHNKHLHS@YHNMD
della corrente di fuga) è assicurata da altri dispositivi, quali per esempio i dispositivi di protezione dalle sovracorrenti. Il
contatto d’allarme dei relè può in tal caso essere utilizzato unicamente per segnalare una corrente differenziale.

+@RDFM@K@YHNMDOQDUDMSHU@CDHFT@RSHCHRNK@LDMSNOQNCTBDHMjMHSDONRRHAHKHSĐMDKKNSSHLHYY@YHNMDCHTMHLOH@MSNDKDSSQHBN
@MSHBHO@QDTM@QHO@Q@YHNMDCHTML@BBGHM@QHNOQHL@BGDHKOQNBDRRNRH@AKNBB@SNODQTMFT@RSN
KNB@KHYY@QDFT@RSHCHRNK@LDMSNHMQDFHLDCHMDTSQN3- 2
- prevenire i rischi d’incendio, di esplosione, ecc.,
- anticipare il funzionamento di un apparecchio di protezione contro le sovracorrenti ed evitare in questo modo la sostituzione
CDKETRHAHKDNKHMUDBBGH@LDMSNCDKKHMSDQQTSSNQD@TSNL@SHBN
- avere il controllo sulle correnti di fuga, riducendo in tal modo le correnti omopolari nei circuiti di protezione e la generazione
CHB@LOHDKDSSQNL@FMDSHBHO@QSHBNK@QLDMSDODQSTQA@SHUH
- ecc.

SOCOMEC Catalogo Generale 2012-2013 561


Controllori Permanenti d’Isolamento

Generalità
Introduzione
Le norme IEC 60364 impongono l’utilizzo di un Controllore Permanente d’Isolamento (CPI) in regime IT:
“si deve prevedere un controllore permanente dell’isolamento che segnali la comparsa di un primo guasto in una parte attiva
in corrispondenza della massa o della terra; esso deve azionare un segnale sonoro o un segnale visivo”.
Questi CPI devono rispettare la norma CEI NF EN 61557-8.
SOCOMEC offre un’ampia scelta di CPI tramite la gamma ISOM.
I CPI devono avere dei principi di misura scelti in funzione della natura dei circuiti da sorvegliare :
- quelli che utilizzano una corrente di misura continua in impianti a correnti alternate soltanto (nessuna presenza di raddrizzatori
che rischierebbe di creare una componente continua in caso di guasto a valle),
- quelli che utilizzano una corrente di misura alternata in impianti a correnti alternate e continue (presenza di raddrizzatori
senza isolamento galvanico a monte).
KBTMH"/(2.".,$"HMSDFQ@MNTMCHRONRHSHUNCHLHRTQ@ ,/CDSSN@CHLOTKRHBNCHjB@SH BGDNEEQDTM@RNQUDFKH@MY@HM
ogni caso possibile e in particolare per impianti dove le utenze generano delle componenti che possono inibire i segnali di
misura dei CPI. Queste utenze sono ad esempio i variatori di velocità, o qualsiasi altra apparecchiatura con un’alimentazione
elettronica di potenza.

Principio di funzionamento
Nella maggior parte dei casi i CPI immettono una corrente
di misura nel circuito formato dai conduttori attivi e la terra
(Fig. 1). Un aumento della corrente di misura denuncia un
calo dell’isolamento del circuito. La corrente di misura è
confrontata con la soglia di allarme dei CPI.
Il buon funzionamento dei CPI della gamma ISOM non im

richiede una corrente di misura elevata. Charge

L’impedenza di 1 k1 tradizionalmente aggiunta tra il CPI


circuito da monitorare e la terra (neutro a impedenza) è R isolement
catec 064 b 1 it cat

praticamente inutile con i CPI SOCOMEC.

im : courant de mesure

%HF ŭLHRTQ@CDKK@QDRHRSDMY@CHRNK@LDMSNCHTMHLOH@MSNBNMTM"/(

Regolazioni
La norma propone una soglia di pre allarme regolata a 50% dell’isolamento dell’impianto e una soglia di allarme di almeno
1 k1.
+@RBDKS@CHRNFKHDCHRNK@LDMSNOHŔDKDU@SDRHFMHjB@ODQŁTM@LHFKHNQDFDRSHNMDCDKK@BNMSHMTHSĐCHRDQUHYHN
Questa scelta di regolazioni più adatte permette:
- di anticipare la ricerca di guasti a partire da diverse decine di k1 e di garantire una migliore gestione in prevenzione dei guasti,
- di limitare la circolazione delle correnti di fuga che possono provocare lo sgancio di differenziali ad alta sensibilità.

In occasione dell’installazione di un CPI in un impianto, occorre tenere in conto che questo apparecchio misurerà l’isolamento
complessivo dell’impianto, ossia la somma delle resistenze di fuga individuale di ciascuna partenza.

1 = 1 + 1 + 1 1 1 1M®0,5 M1


Re R1 R2 Rn
.RRDQU@YHNMDHK"/(OTŀHMCHB@QDTMB@KNCHQDRHRSDMY@CHRNK@LDMSN
RDMY@BGDUHRH@TMUDQNFT@RSNODQDRDLOHNCNUTS@@KK@OQDRDMY@CH Re
TLHCHSďCNONTMETNQHRDQUHYHNOQNKTMF@SN +@UUH@LDMSNCDKKHLOH@MSN CPI
ODQLDSSDQďCHE@QQHR@KHQDHKKHUDKKNCHRNK@LDMSN
R3 Rn
R1
catec 165 c 1 x cat

M R2

562 Catalogo Generale 2012-2013 SOCOMEC


Controllori Permanenti d’Isolamento

'HƂQL]LRQL
Rete isolata Resistenza d’isolamento dell’impianto elettrico
Una rete isolata si caratterizza per: La resistenza d’isolamento è il livello d’isolamento
- un unico utilizzatore o utilizzatore dello stesso tipo CDKKHLOH@MSNQHRODSSN@KK@SDQQ@ #DUDDRRDQDQDFNK@QLDMSD
(motori, illuminazione di sicurezza, ecc.) misurato dagli enti di controllo e deve essere superiore ai
- un circuito poco esteso (piccola capacità di fuga) e ben valori della norma IEC 60364.
KNB@KHYY@SNNEjBHM@ AKNBBNNODQ@SNQHN DBB 
Tabella A: valori minimi della resistenza d’isolamento
TMBHQBTHSNADMCDjMHSNRNKNB@QHBGH "N#"
(IEC 60364) fuori tensione
Tensione nominale Tensione di prova Resistanza
del circuito corrente continua d’isolamento
Rete globale (V) (V) (m1)
Una rete globale presenta invece una notevole varietà di TBTS e TBTP 250 ® 
utilizzatori e di raddrizzatori (presenza di correnti alternate ­Ű5 500 ® 
e continue). La rete è spesso una rete estesa (elevata Ű5 1 000 ® 
capacità di fuga).
Isolamento degli utilizzatori

Guasto asimmetrico (rete DC) 1E,NSNQDŰ ,1


1EŰW,1 secondo la norma per il prodotto.
4MFT@RSN@RHLLDSQHBNHMkTHRBDRTTM@RNK@ONK@QHSĐCDKK@QDSD

Capacità di fuga di un conduttore


rispetto alla terra
Quando due conduttori sono sottoposti a una differenza di
potenziale (tensione), essi presentano un effetto capacitivo
tra loro, che dipende dalla loro forma geometrica (lunghezza,
Rf.
forma), dall’isolante (aria, PVC, ecc.) e dalla distanza che li
catec 066 b 1 it cat

CPI
separa.
0TDRS@OQNOQHDSĐjRHB@OQNUNB@HKENQL@QRHCHTM@BNQQDMSDCH
fuga capacitiva tra i conduttori di una rete e la terra. Questa
corrente è tanto più grande quanto più la rete è estesa.

Guasto simmetrico (rete DC)


 MFT@RSNRHLLDSQHBNHMkTHRBDRTKKDCTDONK@QHSĐCDKK@QDSD 
4
Questo tipo di guasto si sviluppa spesso in un circuito nel
quale le rispettive lunghezze dei conduttori + e – sono
simili.
Le norme IEC 61557-8 e EN 61557-8 impongono dalla
CPT CPT CPT
jMD CDK  BGD H BHQBTHSH #" RH@MN LNMHSNQ@SH C@ "/( CPI
CNT
catec 065 b 1 it cat

capaci di individuare i guasti simmetrici.

"@O@BHSďCHETF@@KK@SDQQ@CHTM@QDSD@KSDQM@S@

Capacità massima di fuga


Rf.+
È la somma della capacità di fuga in corrispondenza della
catec 067 b 1 it cat

CPI Rf.-
terra di una rete e della capacità dei condensatori installati
nei materiali elettronici, informatici, ecc
La capacità massima di fuga è un parametro importante per
K@RBDKS@CHTM"/( #@MNS@QDBGDK@B@O@BHSĐFKNA@KDCHETF@
ĠMNSDUNKLDMSD@TLDMS@S@C@HjKSQH"$
catec 164 b 1 it cat

CPI CPT CPT CPT

SOCOMEC Catalogo Generale 2012-2013 563


Controllori Permanenti d’Isolamento

&DVLGLXWLOL]]R
Locali destinati ad uso medicale CPI HL
Questi locali hanno bisogno di disposizioni particolarmente rigorose, legate alla continuità di utilizzo della rete elettrica e alla
protezione dei pazienti e degli utilizzatori delle apparecchiature mediche.

La norma NF C 15211
Questa norma descrive le prescrizioni destinate ad assicurare la sicurezza elettrica delle persone nei locali ad uso medicale,
tenendo conto dei rischi particolari dovuti alle attività effettuate e delle raccomandazioni relative all’alimentazione elettrico di
questi locali.
Applicabilità
Le disposizioni di questa norma sono applicabili per le realizzazioni di cui la data del permesso di costruzione è posteriore
al 31 gennaio 2007.

Lo schema IT medicale
+@MNQL@CDjMHRBDK@LDRR@HMNODQ@CHKHUDKKHCHBQHSHBHSĐCH@KBTMD@SSHUHSĐLDCHB@KH BNMlODQBNQNKK@QHNlK@BK@RRHjB@CDHKNB@KH
CDCHB@SHHMFQTOON D (MRDFTHSN@KK@RBDKS@CDKQDRONMR@AHKDCHBK@RRHjB@QD@KBTMHKNB@KHMDKFQTOON K@CHRSQHATYHNMD
elettrica sarà realizzata secondo le regole del regime IT.
Locali direttamente concernati
Sala di intervento,
Posto di rianimazione,
Imaging di assistenza.

Le conseguenze dello schema IT medicale


Utilizzo di un trasformatore d’isolamento conforme alla norma NF EN 61558-2-15 con una potenza limitata a 10kVA massimo.
#HRNKHSNCHSHONLNMNE@RD5 " K@RT@SDMRHNMDBNMB@SDM@S@MNMCDUDRTODQ@QD5HMB@RNCHRDBNMC@QHNSQHE@RD
I trasformatori ISOM TRM QD@KHYY@MN PTDRS@ RDO@Q@YHNMD SQ@ K@ QDSD CH CHRSQHATYHNMD FDMDQ@KD CDKKDCHjBHN NRODC@KHDQN D
la distribuzione elettrica dedicata ai locali dove la sicurezza del paziente non deve essere compromessa in caso di guasto
d’isolamento.
Utilizzo di un CPI specialmente previsto con le caratteristiche seguenti:
<resistenza internaAC*ŰJ1
 SDMRHNMDCHLHRTQ@­Ű5#"
 BNQQDMSDCHLHRTQ@­ŰŰL
- adattamento del principio di misura alla natura delle utenze, particolarmente in caso di presenza di componenti continue
(carichi elettronici),
<regolazioni delCPI 150 k1
 $ O@QSHBNK@QLDMSD HLONQS@MSD CH RBDFKHDQD CDH "/( ETMYHNM@MCN RDBNMCN HK OQHMBHOHN CH LHRTQ@ @C HLOTKRH BNCHjB@SH  $RRH
garantiscono una misura ottimale, specialmente nelle sale di intervento di solito sprovviste di trasformatore a separazione
galvanica.
Sorveglianza obbligatoria dei sovraccarichi e degli aumenti di temperatura del trasformatore.
Il CPI ISOM HL integra degli ingressi corrente e temperatura permettendo di segnalare – così come l’allarme collegata ad
una diminuzione d’isolamento – un sovraccarico e un surriscaldamento del trasformatore d’isolamento. Le informazioni
sono disponibili sul bus RS485 in uscita del CPI.
Obbligazione di avvertire il personale medicale con un allarme sonoro e visuale, e di portare questo allarme in un posto
sorvegliato permanentemente.
I rinvii d’allarme ISOM RA permettono di recuperare le informazioni date dal CPI HL (guasto d’isolamento, sovraccarico e
surriscaldamento trasformatore) e di portare queste informazioni in modo chiaro e leggibile a livello della sala d’intervento.
Possono anche essere portati alla sala tecnica di sorveglianza (comunicazione tramite bus RS485).

Altre soluzioni associate


In regime IT, la norma IEC 60364 raccomanda fortemente l’associazione di un sistema di localizzazione del guasto al CPI.
Questa logica si applica anche al regime IT medicale, concetto accentuato visto l’urgenza e il contesto critico delle sale ad
uso medicale e degli interventi che vi sono effettuati.
Il sistema di localizzazione del guasto ISOM DLD associato ad un iniettore dedicato allo schema IT medicale ISOM INJ con
corrente misurata limitata a 1 mA garantiscono una localizzazione rapida della partenza in stato di guasto.
SOCOMEC propone anche la fornitura di armadi dedicati alla distribuzione elettrica nei locali ad uso medicale.
L’offerta comprende l’analisi completa, la realizzazione, la fornitura dei componenti principali (trasformatori, inverter, sistemi
CHBNLLTS@YHNMD @OO@QDBBGHCHLHRTQ@ CHOQNSDYHNMDDB@RRDSSDjMN@KK@LDRR@HMRDQUHYHNDK@ENQL@YHNMD@RRNBH@S@

564 Catalogo Generale 2012-2013 SOCOMEC


Controllori Permanenti d’Isolamento

&DVLGLXWLOL]]R VHJXLWR
Controllo dell’isolamento dei motori non alimentati (esempio: CPI SP 003)
Il controllo dell’isolamento dei motori non alimentati costituisce
una misura preventiva quando le esigenze di sicurezza e di
disponibilità dei materiali presentano un carattere obbligatorio:
M
- cicli critici nei processi industriali Masse

- motori strategici o grandi motori.


In un impianto detto di sicurezza, un CPI deve
obbligatoriamente (secondo le norme IEC) assicurare la

B@SDBAHSB@S
sorveglianza dell’isolamento del materiale seguente: CPI

- equipaggiamenti di sicurezza: motori di pompa contro gli


incendii,
- impianti di aspirazione del fumo. /QHMBHOHNCHLNMS@FFHNHK"/(ğETNQHBHQBTHSNPT@MCNHKLNSNQDğ@KHLDMS@SN
Regolazione del CPI di monitoraggio del motore non alimentato
Il CPI deve segnalare un allarme quando la resistenza d’isolamento scende a un valore inferiore a 1M1.
Il motore non deve più essere utilizzato quando la resistenza d’isolamento è inferiore a 300 k1, in questo caso la seconda
RNFKH@CDK"/(CHSHON2/OTŁ@RRHBTQ@QDHKRDYHNM@LDMSNCHOQDUDMYHNMDODQDUHS@QDCH@UUH@QDTMLNSNQDHMRS@SNCHFT@RSN
I CPI di tipo SP sono appositamente studiati per il controllo dell’isolamento fuori tensione e sono anche un mezzo di localizzazione rapida
delle correnti di fuga, grazie alla funzione di memorizzazione (esempi: motori di scambi, gru portuali a processo rapido). In questo caso
K@RDBNMC@RNFKH@CDK"/(CHSHON2/OTŁ@RRHBTQ@QDKHMSDQQTYHNMDOQDUDMSHU@ODQDUHS@QDK@UUH@LDMSNCHTMLNSNQDHMRHST@YHNMDCHFT@RSN

Sorveglianza di impianti particolari


Negli impianti a rischio di esplosione (BE3), seconda la norma IEC 60364, è ammesso di utilizzare un CPI per sorvegliare
KHRNK@LDMSNCDHBHQBTHSHCHRHBTQDYY@@KHLDMS@SHSQ@LHSDB@UHCHSHON"1 0TDRS@RNQUDFKH@MY@OTŁDRRDQDQD@KHYY@S@RNSSNN
fuori tensione.
In un cantiere con schema IT secondo il § 704.312.2, la sorveglianza dell’isolamento tramite CPI è un obbligo.
Per assicurare la protezione contro le correnti di guasto dei dispositi di riscaldamento, l’impedenza del CPI con le
B@Q@SSDQHRSHBGDCDH##1CDUNMNDRRDQDRBDKSDODQ@RRHBTQ@QDKHMSDQQTYHNMDCNONHKOQHLNFT@RSNRDBNMCNHKd  

Monitoraggio dei variatori di velocità


Il monitoraggio dei variatori di velocità deve tenere conto delle basse frequenze generate da questi ultimi.
2NK@LDMSDH"/(DHCHRONRHSHUHCHQHBDQB@BGDRDFTNMNHOQHMBHOHCHLHRTQ@BGDTSHKHYY@MNRDFM@KHBNCHjB@SHNCHUDQRHC@PTDKKH
FDMDQ@SHC@HU@QH@SNQHONRRNMNF@Q@MSHQDTMETMYHNM@LDMSNBNQQDSSND@EjC@AHKDMDKSDLON

Gruppi elettrogeni mobili


La protezione dei circuiti alimentati da gruppi generatori
LNAHKH Ġ RODRRN CH CHEjBHKD QD@KHYY@YHNMD  RH@ ODQ GE
l’impossibilità di realizzare una presa di terra (gruppi
portatili, soccorso d’urgenza, ecc.), sia per l’impossibilità
di considerare valida la messa a terra (impossibilità di
misurare la resistenza, ecc.).
CPI
catec 071 c 1 f cat

2ODRRN PTDRS@ OQNSDYHNMD Ġ @RRHBTQ@S@ C@H ##1 C@ 


mA che presentano lo svantaggio di scatti intempestivi
UDCDQDO@FHM@. Nei casi in cui la continuità di utilizzo
ĠUHMBNK@MSDODQQ@FHNMHCHRHBTQDYY@ RHOTŁQHBNQQDQD@KKTRN
%HF TSHKHYYNCHTM"/(HMTMBHQBTHSN@KHLDMS@SNC@TMFQTOONDKDSSQNFDMN
di un CPI (Fig. 1).
La massa del gruppo non è collegata al punto medio del generatore, ma alla rete formata dalle masse intercollegate degli
@OO@QDBBGH (K"/(RHEQ@OONMDSQ@PTDRS@L@RR@DTM@E@RD 0TDRSNCHRONRHSHUNRNCCHRE@K@QSHBNKNCDKCDBQDSNCDK
sulla separazione dei circuiti e del capitolo 413.2.3 della norma IEC 60364. Gli apparecchi classici possono essere adatti, a
patto che la loro installazione si adegui ai vincoli ambientali (vibrazioni, tropicalizzazione, resistenza agli idrocarburi, ecc.).
Monitoraggio delle partenze con forti disturbi con DLD
Basse frequenze
(Kd CDKK@MNQL@-%"Q@BBNL@MC@ENQSDLDMSDKTSHKHYYNCH#+#HML@MHDQ@S@KDC@KNB@KHYY@QDHKFT@RSNHLHMHLHYY@QD
BNRį HK SDLON CDCHB@SN @KK@ RT@ QHBDQB@  +@ MNQL@ C@ BNMRHCDQ@QD C@ BNMRHCDQ@QD Ġ K@ $-    ( #+# 2.".,$"
#+#Ű   RNMN BNLO@SHAHKH @ PTDRS@ MNQL@  /QDUDCNMN TM CHRONRHSHUN CH RHMBQNMHYY@YHNMD SQ@LHSD ATR 12 BGD
permette una localizzazione rapida, anche su reti fortemente disturbate. La localizzazione dei guasti in questo tipo di circuiti
è controllata con la sincronizzazione delle immissioni della corrente di ricerca e delle analisi da parte dei localizzatori.
Alte frequenze
Il localizzatore centrale dispone di una funzione di convalida delle misure ripetendo a richiesta i cicli di analisi.
Forti correnti omopolari
(SNQNHCH#+#RNMNCNS@SH@KKNQHFHMDCHCHNCHKHUDKK@SNQHBGDBNMSQNKK@MNKDDUDMST@KHRNUQ@SDMRHNMHRTKBHQBTHSNRDBNMC@QHN

SOCOMEC Catalogo Generale 2012-2013 565


Controllori Permanenti d’Isolamento

&DVLGLXWLOL]]R VHJXLWR
Reti alimentate da UPS
I sistemi di alimentazione statica senza interruzioni (UPS)
Réseau continu
richiedono una parte del circuito in "corrente continua".
Esiste l’obbligo (UTE C 15402) di raggruppare l’impianto
alimentato in corrente continua in un unico locale, per
assicurare la protezione con l’equipotenzialità delle masse.
Nei casi in cui non sia possibile rispettare questa norma, Chargeur Onduleur

catec 068 b 1 it cat


occorre installare un CPI di controllo dell’isolamento
dell’impianto alimentato in corrente continua.
Batterie

Altri criteri generali per l’installazione degli UPS a U<


Fare in modo di non avere mai contemporaneamente due
CPI che controllino reti galvanicamente intercollegate (in
particolare durante le fasi di BY-PASS).

BY-PASS
Provvedere all’installazione di CPI adatti alla rete
controllata.

U<
 "/(BGDOTŀBNMSQNKK@QDBHQBTHSH@BNLONMDMSHBNMSHMTDDFQ@MCH b
B@O@BHSďCHETF@ CP1 CP3
 "/(BGDOTŀBNMSQNKK@QDBHQBTHSH#"BNMFT@RSHRHLLDSQHBH CP2
catec 166 b 1 it cat

 "/( BGD OTŀ BNMSQNKK@QD BHQBTHSH " MNS@ @ D A  CHRONRHSHUH
CH RDQUHYHN BGD DUHS@MN K@ LDRR@ HM O@Q@KKDKN CH "/( RT QDSH MNM
1 2 3
HRNK@SDF@KU@MHB@LDMSD

Controllo dei circuiti di comando e segnalazione


Generalmente alimentati da trasformatori di separazione,
questi circuiti devono impedire gli scatti intempestivi dei
circuiti di potenza. Una soluzione classica, proposta
dalle norme e dai regolamenti, è rappresentata dalla
realizzazione di una distribuzione in schema TN (punto
comune del secondario a terra). Un’altra disposizione
che soddisfa questi requisiti è di non collegare a terra il
secondario e contemporaneamente installare un CPI.
Questa soluzione previene i rischi di shuntaggio dei
dispositivi di comando per guasto d’isolamento. Tale
catec 068 b 1 it cat

If

FT@RSNOTŁDRRDQDHME@SSHBNMSDLONQ@MD@LDMSDRTEjBHDMSD
CPI
a comandare gli attuatori e troppo debole per fare scattare
la protezione contro le sovratensioni.

Questi rischi sono più gravi nelle attrezzature nuove per due ragioni principali:
- le deboli tensioni d’uso non favoriscono la protezione dai guasti
- le soglie di funzionamento degli ausiliari di comando tendono ad arrivare a poche decine di mA (microrelè, PLC, accoppiatori
ottici, ecc.).
Rispetto alla soluzione della messa a terra, l’uso di una rete isolata associata a un CPI presenta il doppio vantaggio di non
scattare al primo guasto e di assicurare un controllo preventivo dell’invecchiamento del gruppo.

Regolazione del CPI


( RHRSDLH CH QHBDQB@ CDH FT@RSH SHON #+#  D ONQS@SHKH
Zm = U
#+#  ODQLDSSNMN CH DEEDSST@QD K@ KNB@KHYY@YHNMD
ir
preventiva dei guasti d’isolamento senza cambiare lo
4 3DMRHNMDC@KHLDMS@YHNMDL@RRHL@CDKBHQBTHSNCHBNL@MCN stato dei dispositivi di comando o di funzionamento,
HQ "NQQDMSDCHQHB@CTS@CDKQDKğOHœOHBBNKN grazie a una corrente di ricerca limitata a 1 mA.
9L (LODCDMY@CHQDFNK@YHNMDCDK"/(

566 Catalogo Generale 2012-2013 SOCOMEC


Controllori Permanenti d’Isolamento

&ROOHJDPHQWRGHL&3,
Caso generale Collegamento e protezione dei circuiti di misura
dei CPI
Il collegamento di un CPI viene di solito realizzato tra il punto
neutro del trasformatore situato all’origine dell’impianto IT
e la terra.
L’installazione va completata con un dispositivo di allarme Alim Alim
auxiliaire auxiliaire
e una protezione dalle sovratensioni (se il primario del
trasformatore è in alta o media tensione). CPI CPI

catec 167 b 1 it cat

catec 168 b 1 it cat


L’impiego dei CPI ISOM non richiede un’impedenza da 1 k1
in parallelo UDCDQDOQHMBHOHNCHETMYHNM@LDMSN@O@FHM@

 HF ŭ"NKKDF@LDMSNCDK"/(
%  HF "NKKDF@LDMSNCDK"/(
%
CNONKHMSDQQTSSNQDFDMDQ@KD OQHL@CDKKHMSDQQTSSNQDFDMDQ@KD

La protezione dai corto circuiti non è obbligatoria secondo il testo


attuale della IEC 60364 per evitare il rischio di mancata misura,
Alarme
ma suppone un’installazione appropriata per evitare i rischi di
CPI corto circuiti (i conduttori non devono passare sugli spigoli vivi
catec 072 b 1 it cat

delle barre e l’isolamento deve essere sovradimensionato).


L’autosorveglianza del collegamento con la rete, di serie
nella maggior parte dei CPI SOCOMEC, rende inutile la
disposizione precedente.
L’inserimento del CPI prima dell’interruttore di
Alimentazione con più trasformatori in parallelo
sezionamento dei trasformatori evita l’installazione di un
L’utilizzo di un CPI comune a due sorgenti non è più dispositivo di antiparallelo dei CPI a condizione che i due
ammesso secondo le norme IEC. SQ@RENQL@SNQHMNMK@UNQHMNHMO@Q@KKDKN%HF Ű
E’ quindi necessario di installare un CPI per sorgente e di L’inserimento del CPI dopo l’interruttore di sezionamento
UDQHjB@QDBGDRH@MNŭHMSDQAKNBB@SHŭDKDSSQHB@LDMSD del trasformatore permette la misura preventiva senza
I CPI SOCOMEC presentano in questo modo degli l’alimentazione di rete (il segnale di misura è presente sulle fasi
HMFQDRRHTRBHSDDNCDHATRRDBNMCNLNCDKKNHML@MHDQ@ RDMY@K@MDBDRRHSĐCDKKHMRDQYHNMDCDKSQ@RENQL@SNQD%HF Ű
tale da inibire uno o l’altro dei CPI in questo modo di
funzionamento. Accessibilità del neutro
In questo caso, il CPI è inserito tra il punto neutro del
CPI CPI
trasformatore e la più vicina presa di terra delle masse o, in
sua assenza, la presa di terra del neutro.
catec 076 d 1 it cat

CPI Utilisateur
Controllo di una rete non alimentata
catec 073 c 1 it cat

4SHKHYYNCHTMMDTSQN@QSHjBH@KD

"NKKDF@LDMSNCDH"/(SDQQ@MNM@BBDRRHAHKD

Questo tipo di collegamento evita anche l’installazione di


protezioni sul conduttore di misura del CPI (data la scarsa
probabilità di sovracorrenti di corto circuito).
Neutre artificiel
Allacciamento dell’alimentazione secondaria
Certi CPI sono dotati di alimentazione secondaria, che permette
catec 075 b 1 it cat

CPI loro di restare insensibili alle variazioni di tensione. Gli ingressi


dell’alimentazione secondaria devono essere protetti:
Phase

Neutre Neutre
catec 073 c 1 it cat

CPI CPI

SOCOMEC Catalogo Generale 2012-2013 567


Limitatore di sovratensione

Generalità
Il limitatore di sovratensione (L.S.) è conforme agli articoli 5 e 34 del decreto del 14.11.88. Serve a scaricare a terra le
sovratensioni e le correnti di guasto.

Protezione da sovratensione
Il dispositivo limitatore assicura la scarica a terra delle sovratensioni giunte dalla rete in alta tensione.
Gli sganci accidentali tra la rete AT e BT rischiano di portare il potenziale dell’installazione BT ad un valore pericoloso rispetto
a terra.
In caso di rivelazione di questo tipo di guasto, il limitatore di sovratensioni cortocircuita in maniera irreversibile il neutro e la
terra, permettendo, in questo, modo di proteggere la rete in media e bassa tensione. Dopo il funzionamento come limitatore
di sovracorrente, occorre cambiare il dispositivo, in particolare nello schema IT, per consentire al controllore dell’isolamento
di riprendere correttamente la sorveglianza.

Induttanza di limitazione della corrente


Anche se i limitatori possono sopportare delle correnti di guasto 40 kA / 0,2 s, è sempre preferibile, negli impianti di potenza
importante, limitare a 10 o 15 kA la corrente per tenere conto dell’eventualità di un 2° guasto sulla serie di sbarre, in questo
caso la corrente di corto-circuito fase-neutro potrebbe superare 20 kA. Questa limitazione è realizzata tramite induttanze
RODBHjBGD

Livello effettivo di protezione assicurato da un limitatore di sovratensione

Limitatore collegato tra neutro e terra Limitatore collegato tra fase e terra
Tensione nominale Livello di tensione Tensione nominale del Livello effettivo Tensione nominale Livello effettivo
dell’ impianto (V) ammissibile U0 + 1200 (V) limitatore (V) di protezione (V) del limitatore (V) di protezione (V)
127/220 1330 250 880 250 970
230/400 1430 440 1330 (*) (*)
400/690 1600 440 1500 (*) (*)
580/1000 1780 440 1680 (*) (*)
(*) I limitatori di tensione normalizzati non permettono la protezione sotto tensione

Tensioni nominali d’innescamento a frequenza industriale

Tensione nominale del limitatore (V) Tensione nominale di non innescamento (V) Tensione nominale d’innescamento al 100 % (V)
250 400 750
440 700 1100

I valori di tensioni nominali d’innescamento dei limitatori di sovratensione sono conformi alla norma IEC 60364.

Collegamento del dispositivo limitatore


Il terminale di terra deve essere collegato sia: Con più trasformatori in parallelo, occorre prevedere un
- all’insieme interconnesso delle masse e degli elementi dispositivo limitatore per ogni trasformatore. Per gli impianti
conduttori dell’impianto, a neutro non accessibile, provvedere a collegare tutti i
- a una presa di terra distante di valore adeguato. dispositivi limitatori alla stessa fase.

L1 L1
BT BT
catec 019 d 1 it cat - isom 324 c 1 cat

1 1
N L2 N L2 HT T1 2 HT T1 2
Lilmitatore 3 3
L3 L3 di
sovratensione Limitatore
Induttanza di
HT T2 HT sovratensione T2
catec 022 c 1 it cat

Limitatore di sovratensione Limitatore di sovratensione

Un solo trasformatore - neutro accessibile HT T0 HT T0


catec 020 c 1 it cat

L1 L1
catec 021 d 1 it cat - isom 325 c 1 cat

L2 L2 Masse Masse

L3 L3

Induttanza «n» trasformatori in parallelo - «n» trasformatori in parallelo -


Limitatore di Limitatore di neutro accessibile. neutro non accessibile.
sovratensione sovratensione

Un solo trasformatore - neutro non accessibile

568 Catalogo Generale 2012-2013 SOCOMEC


Gli scaricatori

Protezione contro le sovratensioni transitorie


La buona qualità dell’alimentazione in bassa tensione di un impianto industriale o terziario è vitale poiché è comune all’insieme
degli apparecchi.
4MDR@LDFKNA@KDCDHEDMNLDMHCHCHRSTQANĠPTHMCHDRSQDL@LDMSDHLONQS@MSDODQK@EjC@AHKHSĐFDMDQ@KDCDKKHLOH@MSN
Tra l’insieme dei fenomeni che possono disturbare il buon funzionamento degli apparecchi collegati alla rete, il problema
delle “sovratensioni” deve essere considerato, perché è all’origine di effetti secondari particolarmente penalizzanti, anche
distruttori.
Così come le sovratensioni dovute ai fulmini, le sovratensioni industriali sono una realtà.
Una protezione sistematica contro le sovratensioni è quindi raccomandata per qualsiasi tipo d’installazione elettrica, prova
ne siano le numerose distruzioni o guasti ricorrenti inesplicati di materiali elettrici.

Obblighi d’utilizzo e fragilità delle apparecchiature


La necessità di assicurare una protezione sistematica si spiega grazie ai seguenti fattori:
- fragilità crescente delle apparecchiature,
- proliferazione delle apparecchiature sensibili,
- tolleranza minima alle interruzioni di servizio,
- costi di fuori esercizio proibitivi,
- sensibilizzazione maggiore delle compagnie di assicurazione sui fenomeni di sovratensione.

Effetti sui componenti elettronici


La curva qui sotto mostra la diminuzione crescente della Distruzione (parziale o totale):
robustezza delle apparecchiature dovuta all’evoluzione - delle metallizzazioni dei componenti,
CDKKDSDBMNKNFHDHMBNMRDFTDMY@ HOQNAKDLHCH@EjC@AHKHSĐ - dei triac / tiristori,
ai disturbi transitori vanno solo aumentando. - dei circuiti integrati sensibili (MOSFET).
Ws
Disturbi di funzionamento: blocco di programmi, errori di
100 trasmissione, fermo della produzione.
101 Invecchiamento accelerato o distruzione differita:
102 riduzione importante della durata di vita dei componenti.
Relè
103 Tubo
104

105

106 Transistore

107 Circuite integrato


108
catec 172 b 1 it cat

109

1850 1875 1900 1910 1920 1930 1940 1950 1960 1970 1980 1990 2000 anni

Potenza ammissibile in funzione delle tecnologie.

Sovratensioni transitorie
Gli scaricatori SURGYS® sono dei dispositivi destinati ad assicurare la protezione delle apparecchiature e degli impianti,
limitando le sovratensioni di tipo “transitorie”.
Una sovratensione transitoria è un aumento della tensione, di solito considerevole (numerosi kV) e di durata breve (da qualche
microsecondo a qualche millisecondo), rispetto alla tensione nominale di una rete o di un circuito elettrico.

SOCOMEC Catalogo Generale 2012-2013 569


Gli scaricatori

Protezione contro le sovratensioni transitorie (seguito)


Onde normalizzate

Corrente (kA) Corrente (kA) Corrente (kA)


Ampiezza
catec 173 c 1 it cat

Tempo Tempo Tempo

Onde di corrente : Onde di corrente : Onde di tensione :

#DkMHYHNMDCDKKDNMCDCHSDMRHNMDNCHBNQQDMSDSQ@MRHSNQHD

Le sovratensioni transitorie nelle reti a bassa tensione e circuiti a bassa corrente (reti di comunicazione, anello di corrente,
KHMDDSDKDENMHBGDRNMNCNUTSD@CHUDQRHDUDMSHDONRRNMNDRRDQDBK@RRHjB@SDOQHMBHO@KLDMSDRDBNMCNCTDSHOH
- sovratensioni industriali (o assimilate e legate all’attività umana),
- sovratensioni di fulmine.

Sovratensioni industriali transitorie


Sempre più numerose nelle reti attuali, queste sovratensioni industriali transitorie si dividono in:
- sovratensioni di manovra e di commutazione,
- sovratensioni d’interazione tra reti.

Origini delle sovratensioni di manovra


Alcune sovratensioni sono dovute ad azioni intenzionali Volts
sulla rete di potenza, come le manovre di un carico o > 1000 V
di una capacità oppure sono legate a funzionamenti
automatici come:
- apertura / chiusura di circuito tramite apparecchi di
manovra,
- fasi di funzionamento (avviamento, stop bruschi, 325 V
accensione di apparecchi di illuminazione…),
- sovratensioni di commutazione elettronica (elettronica di
potenza).
Altre sovratensioni sono dovute ad eventi non intenzionali
catec 174 c 1 it cat

Temps
come guasti dell’impianto, e la loro eliminazione tramite ~ 1 ms

l’apertura inopinata dei dispositivi di protezione (dispositivi


differenziali, fusibili e altri apparecchi di protezione contro
le sovracorrenti). Sovratensione dopo la fusione di un fusibile.

570 Catalogo Generale 2012-2013 SOCOMEC


Gli scaricatori

Sovratensioni dovute a fulmini

Impatto su Impatto diretto


linea aerea

Accoppiamento
via irraggiamento

Risalite Ng ≤ 2,5
Apparecchio

catec 176 b 1 x cat


da terra
catec 175 b 1 it cat

sollecitato Ng < 2,5

Densità di fulminazione Ng.


Le sovratensioni di origine atmosferica provengono da sorgenti non controllate e la loro gravità nel punto di utilizzo è funzione
di numerosi parametri determinati dal punto d’impatto del fulmine e della struttura delle reti.

L’impatto di un fulmine su una struttura crea delle distruzioni spettacolari, però molto localizzate. La protezione contro
l’impatto diretto del fulmine è assicurata tramite dispositivi “parafulmini” e non è spiegata in questo documento.
Un impatto di fulmine genera delle sovratensioni che si propagano tramite tutti i tipi di canalizzazioni elettriche (reti d’energia,
collegamenti telefonici, bus di comunicazione…), di canalizzazioni metalliche o di elementi conduttori di lunghezza importante.
Le conseguenze dei fulmini, ossia delle sovratensioni provocate sugli impianti e apparecchiature, possono essere percepibili
in un raggio di 10 km.
0TDRSDRNUQ@SDMRHNMHONRRNMNDRRDQDBK@RRHjB@SDRDBNMCNHKKNQNOTMSNCHHLO@SSNETKLHMHCHQDSSH UHBHMHNKNMS@MH /DQHETKLHMH
CHQDSSH KDRNUQ@SDMRHNMHRNMNCNUTSD@KkTRRNCDKK@BNQQDMSDCHETKLHMDMDKK@RSQTSSTQ@D@KKDRTDOQDRDCHSDQQ@ /DQHETKLHMH
UHBHMH KDRNUQ@SDMRHNMHRNMNBQD@SDMDHBHQBTHSHDHMO@QSDBNKKDF@SD@KK@TLDMSNCDKONSDMYH@KDCHSDQQ@CNUTS@@KkTRRNCDKK@
corrente di fulmine.
/DQHETKLHMHKNMS@MH KDRNUQ@SDMRHNMHRNMNKHLHS@SD@PTDKKDBQD@SDMDHBHQBTHSH +@OQDRDMY@CDKKDRNUQ@SDMRHNMHCNUTSD@ETKLHMHD
le loro caratteristiche sono di natura statica e diversi dati sono ancora incogniti.

Tutte le regioni non sono ugualmente esposte e esiste di solito per ogni paese una mappa che indica la densità di fulminazione
(Ng = numero annuale d’impatti di fulmini a terra per km2, NK = livello ceraunico, Ng = Nk / 10).
In Italia, il numero di fulmini che colpiscono annualmente il suolo è compreso tra 1 e 2 milioni. La metà di essi toccano
direttamente il suolo ed hanno un’ampiezza inferiore a 30 kA, e meno del 5 % di loro sorpassano i 100 kA.

Protezione contro gli effetti diretti dei fulmini


La protezione passa per i tentativi di gestire il punto di impatto attirando il fulmine su uno o più punti precisi (i parafulmini)
lontani degli impianti da proteggere, che scaricano le correnti di picco verso terra.
#HUDQRDSDBMNKNFHDCHO@Q@ETKLHMHRNMNCHRONMHAHKHDONRRNMNDRRDQD@ROHM@ F@AAH@@L@FKH@ @jKHRSDRH NOOTQD@CHRONRHSHUH
ad innesco. La presenza di parafulmini su un impianto aumenta il rischio e l’ampiezza delle correnti di picco nella rete di
terra. L’installazione di scaricatori è quindi necessaria per evitare di aumentare i danni sull’impianto e sulle apparecchiature.

Protezione contro gli effetti indiretti tramite scaricatori


Gli scaricatori SURGYS®, proteggono contro le sovratensioni transitorie ed assicurano anche la protezione contro gli effetti
indiretti dei fulmini.

Conclusione
Indipendentemente dalle considerazioni statistiche sui fulmini e dalle raccomandazioni corrispondenti alle norme di
installazione in evoluzione, la protezione contro le sovratensioni tramite scaricatori si impone oggi sistematicamente per
ogni tipo di attività, industriale o terziaria. In queste ultime, gli apparecchi elettrici e elettronici sono strategici e di valore
RHFMHjB@SHUN DMNMSQ@RBTQ@AHKHBNLDKNONRRNMNDRRDQD@KBTMHDPTHO@FFH@LDMSHCNLDRSHBH

SOCOMEC Catalogo Generale 2012-2013 571


Gli scaricatori

Principali regolamenti e norme (lista non esaustiva)


Premessa
Il presente manuale tecnico non si sostituisce mai ai regolamenti e alle norme in vigore, ai quali invece si riferisce in tutti i casi.

Regolamenti o raccomandazioni che impongono l'installazione di una protezione contro gli effetti dei fulmini
Obbligo assoluto
(LOH@MSH"K@RRHjB@SHODQK@/QNSDYHNMDCDKKe LAHDMSD("/$RTANQCHM@SH@C@TSNQHYY@YHNMDCDKHADQ@CDKŰFDMM@HNDK@
RT@BHQBNK@QDCe@OOKHB@YHNMDCDKŰ@OQHKDQDK@SHU@@KK@OQNSDYHNMDBNMSQNHETKLHMHCH@KBTMHHLOH@MSHBK@RRHjB@SH
-TNUHCDONRHSHCHBNMBHLHRNKHCHRDLOKHBH@A@RDCHMHSQ@SHCDKHADQ@CDKŰFDMM@HN
"DMSQHCHRLHRS@LDMSNQHjTSHCNLDRSHBH OQDRLHRS@SH QHjTSHHMCTRSQH@KHD BNLLDQBH@KH @RRHLHK@SHCDKHADQ@#//1   CDK
FDMM@HN
(LOH@MSHRODBH@KHYY@SHCHHMBDMDQHLDMSNDHLOH@MSHCHBNHMBDMDQHLDMSNCH@KBTMHQHjTSHHMCTRSQH@KHRODBH@KHCDKHADQ@CDKŰNSSNAQD
(LOH@MSHCHQDEQHFDQ@YHNMDBGDTSHKHYY@MN@LLNMH@B@BNLDQDEQHFDQ@MSDCDKHADQ@CDKŰKTFKHN
(LOH@MSH-TBKD@QHCH!@RD(-!CDKHADQ@CDKŰCHBDLAQD
2HKNRDHLOH@MSHCHRSNBB@FFHNCHBDQD@KH RDLDMSH OQNCNSSH@KHLDMS@QHN@KSQHOQNCNSSHNQF@MHBHBGDKHADQ@MNONKUDQHHMj@LL@AHKHCDKHADQ@CDK
ŰFHTFMN
+TNFGHCHBTKSNB@LO@MHKH SNQQHDLHM@QDSHCDKHADQ@CDKŰRDSSDLAQD
$CHjBHCHFQ@MCD@KSDYY@(&'CDKHADQ@CDKŰMNUDLAQDDCDKŰNSSNAQD
2S@AHKHLDMSHOHQNSDBMHBHCDBQDSNCDKŰRDSSDLAQD
'NSDK QHRSNQ@MSHCe@KS@PTNS@CDKHADQ@CDKŰNSSNAQD
* Questa delibera cita chiaramente gli obblighi da rispettare e le azioni da intraprendere :
- procedere ad un'analisi di rischio fulmini per identificare le attrezzature e gli impianti dei quali è necessario assicurare la protezione,
- realizzare di conseguenza uno studio tecnico,
- proteggere l'impianto in conformità con lo studio,
- procedere alle verifiche delle protezioni contro i fulmini messe in opera,
- nel frattempo il tutto deve essere qualificato da un organismo competente nel settore.

Luoghi per i quali sono consigliate le disposizioni di protezione


Teatri di tipo multiplex
Strutture metalliche aperte al pubblico in zone turistiche
1@CTMHCHPT@KRH@RHSHON@KKe@QH@@ODQS@ BGDNROHS@MNTMOTAAKHBNHLONQS@MSDDBGDRHRUNKFNMNHMOHŔFHNQM@SD
"@RDCHQHONRNBHQBNK@QHCDKŰFDMM@HNDCDK¦KTFKHN
(MRS@KK@YHNMHLHKHS@QHU@QHDMNQL@,(+23# ODQDRDLOHN
#DONRHSHCHL@SDQH@KHBNLATRSHAHKH SNRRHBHNDROKNRHUHBHQBNK@QDCDKŰEDAAQ@HNDCDKHADQ@SHONM¦ŰSDQ
(LOH@MSHCHDRSQ@YHNMDCDKKeNKHNQDFNK@LDMSNCDKŰFHTFMN
(MCTRSQHDODSQNKHEDQDFTHC@&$2(/
(MCTRSQHDBGHLHBGDCNBTLDMSN4("CDKFHTFMNŰ

572 Catalogo Generale 2012-2013 SOCOMEC


Gli scaricatori

Principali regolamenti e norme (lista non esaustiva) (seguito)


Norme relative agli scaricatori
Norme di installazione
Fino al 2002, l’utilizzo degli scaricatori per la protezione dei materiali connessi alla rete di bassa tensione non era obbligatorio,
potevano essere esposte solo alcune raccomandazioni.

-NQL@-%"CHBDLAQDŮ
2DYHNMD g2NUQ@SDMRHNMHCHNQHFHMD@SLNREDQHB@NCNUTSD@L@MNUQDu 0TDRS@RDYHNMDCDjMHRBDHKHUDKKHCeNAAKHFNDCH
utilizzo degli scaricatori.
2DYHNMD    g/QNSDYHNMD BNMSQN KD RNUQ@SDMRHNMH CH NQHFHMD @SLNREDQHB@ 2B@QHB@SNQDu  2DYHNMD RHLHKD @KK@ RDYHNMD
4-443, ma applicabile agli immobili residenziali.
Sezione 5-534 : « Dispositivi di protezione contro i problemi elettrici » : contiene le regole generali di selezione e di attivazione
degli scaricatori di Bassa Tensione.

Manuale di utilizzo UTE C 15443


0TDRSNL@MT@KDENQMHRBDCDKKDHMENQL@YHNMHOHŔBNLOKDSDODQK@RBDKS@DKe@SSHU@YHNMDCDFKHRB@QHB@SNQHDHMSQNCTBDTMLDSNCN
di valutazione di rischio che permette di determinare un livello di raccomandazione per gli scaricatori. Questo manuale
contiene anche una sezione sugli scaricatori per le reti di comunicazione.

&THC@ODQFKHHLOH@MSHENSNUNKS@HBH43$"
0TDRS@FTHC@OQDBHR@ @KCHKĐCDKK@-%" KDBNMCHYHNMHCHOQNSDYHNMDDCeHMS@KK@YHNMDCDHFDMDQ@SNQHENSNUNKS@HBH
Inoltre sono precisati anche dei consigli pratici per la scelta e la messa in opera dei prodotti Scaricatore.

Obblighi e consigli d'uso degli scaricatori


+DRDYHNMH D  CDKK@-%"CDjMHRBNMNKDRHST@YHNMHMDKKDPT@KHĠNAAKHF@SNQHNKeTSHKHYYNCDFKHRB@QHB@SNQH
 +HLOH@MSN Ġ CNS@SN CH O@Q@ETKLHMH O@Q@ETKLHMH NAAKHF@SNQHN @KKeHMHYHN CDKKeHMRS@KK@YHNMD  #DUD DRRDQD CH SHON  BNM TM@
corrente IimpCH ŰJ LHMHLN
2 - L’impianto è alimentato da una rete di Bassa Tensione aerea e il livello ceraunico locale Nk è superiore a 25 (o Ng superiore
@ O@Q@ETKLHMHNAAKHF@SNQHN@KKeHMHYHNCDKKeHMRS@KK@YHNMD #DUDDRRDQDCHSHONBNMTM@BNQQDMSD(nCHŰJ LHMHLN
3 - L’impianto è alimentato da una rete di Bassa Tensione aerea e il livello ceraunico locale Nk è inferiore a 25 (o Ng inferiore
@ 2B@QHB@SNQDMNMNAAKHF@SNQHN
 +HLOH@MSNĠ@KHLDMS@SNC@TM@QDSDCH!@RR@3DMRHNMDRNSSDQQ@MDN2B@QHB@SNQDMNMNAAKHF@SNQHN

(*) Tuttavia la norma precisa che: «…una protezione contro le sovratensioni può essere necessaria nelle situazioni in cui i livelli di affidabilità o di rischio
attesi sono più elevati. »

Sezioni 443 e 534 della NF C 15100


Si basano sui seguenti concetti:
FKHRB@QHB@SNQHCDUNMNDRRDQDHMRS@KK@SH@QDFNK@Ce@QSD #DUNMNDRRDQDBNNQCHM@SHSQ@KNQNDBNMFKH@OO@QDBBGHCHOQNSDYHNMD
CDKKeHLOH@MSN
FKHRB@QHB@SNQHCDUNMNDRRDQDBNMENQLH@KK@-%$-Ű @KjMDCHF@Q@MSHQDTMBHBKNCHUHS@RDMY@QHRBGHODQFKHHLOH@MSH
e le persone.

In caso di impianti industriali complessi o di impianti particolarmente esposti a rischi di folgorazione, è possibile imporre delle
misure complementari.
&KHHLOH@MSHBK@RRHjB@SH RNSSNLDRRH@C@TSNQHYY@YHNMD("/$MDKKe@LAHSNCDKK@CDKHADQ@CDKŰFDMM@HNDCDKK@BHQBNK@QD
Ce@OOKHB@YHNMDCDKŰ@OQHKD CDUNMNDRRDQDNFFDSSNCHTMNRSTCHNOQDKHLHM@QDCDKQHRBGHNETKLHMH

Estratti della guida UTE C 15443


0TDRS@FTHC@43$"RODBHjB@KDQDFNKDBGDODQLDSSNMNK@RBDKS@DKeHMRS@KK@YHNMDCDFKHRB@QHB@SNQH

Premessa
« Gli apparecchi elettrici dotati di componenti elettronici oggigiorno sono largamente utilizzati sia negli impianti industriali terziari
sia in quelli domestici. Inoltre, un gran numero di questi apparecchi rimangono in stato di veglia permanente assicurando
delle funzioni di controllo o di sicurezza. La tenuta ridotta di questi apparecchi alle sovratensioni ha reso più importante la
OQNSDYHNMDCDFKHHLOH@MSHDKDSSQHBH@A@RR@SDMRHNMDD HMO@QSHBNK@QLNCN KeTSHKHYYNCDFKHRB@QHB@SNQHODQK@OQNSDYHNMDBNMSQNKD
sovratensioni provocate dai fulmini e trasmesse attraverso la rete elettrica. »

SOCOMEC Catalogo Generale 2012-2013 573


Gli scaricatori

Tecnologia
Lo scaricatore: terminologia
(K SDQLHMD fRB@QHB@SNQDt @MBGD RD Ġ U@FN  CDjMHRBD KHMRHDLD CDH CHRONRHSHUH CH OQNSDYHNMD CDKKD @OO@QDBBGH@STQD BNMSQN KD
sovratensioni transitorie, che hanno per origine fulmini o perturbazioni della rete (sovratensioni di manovra).
&KHRB@QHB@SNQHRNMN@C@SSH@HCHUDQRHSHOHCHQDSH@jKHHMHMSDQ@YHNMDBNMFKHHLOH@MSH
- reti di energia,
- linee e reti di telecomunicazione,
- reti informatiche,
- radiocomunicazioni.

 KBTMDCDkMHYHNMH Principio di funzionamento e ruolo degli


scaricatori
Corrente residua
Corrente fornita dalla rete di energia elettrica e scorre nello

nsione
scaricatore dopo la scarica. Concerne solo gli scaricatori

Sovrate
avendo una corrente residua (ad esempio, gli scaricatori
con spinterometro a aria o a gas). Verso le apparecchiature da proteggere

Corrente di fuga Up
In Livello di apparecchiature
Corrente elettrica che, nelle condizioni normali, scorre a Corrente di protezione da proteggere
scarica nominale
terra o negli elementi conduttori. G7
0G
7 0

Scaricatore BT

Sovratensione temporanea (UT


5@KNQD DEjB@BD L@RRHLN @BBDSS@AHKD C@KKN RB@QHB@SNQD « Dispositivo di protezione contro le perturbazioni
catec 177 b it cat

di origine atmosferica e di manovra »


e corrispondente ad una sovratensione a frequenza Ruolo: limitare le sovratensioni transitorie di origine
industriale dovuta a guasti sulla rete BT. “fulmini” e industriali ad un livello accettabile.

Livello di protezione (UP


Tensione di cresta ai morsetti dello scaricatore nelle
condizioni normali di funzionamento. Questa caratteristica Tecnologie degli scaricatori
di protezione dello scaricatore deve essere inferiore alla
tensione di tenuta agli shock delle apparecchiature da /DQ QHRONMCDQD HM LNCN DEjB@BD @FKH NAAKHFGH HLONRSH C@
proteggere. queste diverse reti, diverse tecnologie di scaricatori sono
disponibili.
Tensione massima in circuito aperto (Uoc Così, gli scaricatori possono comportare diversi
componenti interni:
Tensione massima dell’onda combinata accettabile - gli spinterometri,
(max = 20 kV / soltanto scaricatore di tipo 3). - i varistori,
- i diodi di tipo Zener.
Tenuta ai corto-circuiti (di solito Icc Questi elementi hanno per scopo di limitare rapidamente le
Corrente massima di corto-circuito sopportabile dallo tensioni arrivando ai morsetti: questa funzione è ottenuta
scaricatore. ODQLNCHjB@UDKNBDCDKK@KNQNHLODCDMY@@CTM@RNFKH@CH
tensione determinata.
Corrente di scarica nominale (In
5@KNQD CH BQDRS@ CH TM@ BNQQDMSD CH ENQL@ CNMC@   
scorrendo nello scaricatore. Questa corrente può scorrere Spinterometro Varistore Diodo di tipo Zener
diverse volte senza danneggiarlo. Questa caratteristica è Ad innesco
A limitazione
un criterio di scelta per gli scaricatori di tipo 2. A limitazione
B@SDBAHSB@S

Corrente di choc (limp


Di solito di forma 10 / 350, per il quale sono testati gli Funzionamento dei componenti «scaricatore».
scaricatori di tipo 1.
Due atteggiamenti sono possibili :
Corrente di scarica massima (Imax - Ad innesco: il componente passa dallo stato di
5@KNQD CH BQDRS@ CH TM@ BNQQDMSD CH ENQL@ CNMC@    impedenza molto elevata al quasi corto-circuito, è il caso
RBNQQDMCNMDKKNRB@QHB@SNQDCHSHONRDMY@LNCHjB@CDKKD degli spinterometri,
sue caratteristiche e senza assicurare necessariamente -A limitazione (clipping): dopo una soglia di tensione
il livello di protezione Up e quindi la protezione delle determinata, il componente passando in bassa
apparecchiature da proteggere. Questo valore è una impedenza, limita la tensione ai suoi morsetti (varistori e
conseguenza della scelta di In ed è data nel datasheet diodi di tipo Zener).
tecnico del costruttore.

574 Catalogo Generale 2012-2013 SOCOMEC


Gli scaricatori

Tecnologia (seguito)
Principali tecnologie
Queste famiglie hanno diverse varianti e sono suscettibili ad essere associate tra di loro per dare delle performance ottimizzate.
Qui sotto, la descrizione delle principali tecnologie (o delle associazioni di tecnologie) utilizzate.

Spinterometro a aria Spinterometro incapsulato Spinterometro a gas Varistore

Dispositivo costituito, di solito, di due Spinterometro ad aria Spinterometro in una Componente non lineare (resistenza
elettrodi situate frontalmente e tra le dove lo spegnimento della scatola ermetica, riempita variabile in funzione della tensione)
quali si crea un innesco (seguito da corrente residua si effettua di un mix di gas raro sotto a base di ossido di zinco (ZnO) che
una corrente residua) quando una RDMY@DROTKRHNMDCHF@RŰ pressione controllata. permette di limitare la tensione ai
sovratensione raggiunge un certo ciò che si fa, di solito, a Questo componente è di suoi morsetti: questo funzionamento
valore. Su delle reti di energia, per sfavore della capacità di solito utilizzato e ben adatto in livellaggio permette di evitare
interrompere rapidamente la corrente apertura della corrente alla protezione delle reti di la corrente residua, ciò che rende
QDRHCT@ HKOQHMBHOHNCHRNEjNCDKK@QBN residua. telecomunicazione. Questo questo elemento molto adatto alla
è utilizzato, che ha per conseguenza elemento è particolarmente protezione delle reti di energia (Alta
jM@KDTMDROTKRN UDQRNKDRSDQMN CHF@R caratterizzato dalla sua Tensione e Bassa Tensione).
B@KCHŰPTDRSN@SSDFFH@LDMSNMDBDRRHS@ corrente di fuga molto
un utilizzo particolare. bassa.

Varistore con meccanismo termico di


Spinterometror / Varistore Diodo di tipo Zener Spinterometro / Diodo di tipo Zener
apertura

Varistore equipaggiato da un Associazione in serie di Diodo di tipo Zener Associazione in parallelo di


meccanismo ausiliario con lo scopo componenti, concepita (limitazione di tensione) spinterometro(i) a gas e di diodo(i)
di scollegare il componente della rete per sfruttare i vantaggi dotata di una struttura di tipo Zener; che permette di
in caso surriscaldamento eccessivo: delle due tecnologie: particolare per ottimizzare sfruttare la capacità di scorrimento
questo atteggiamento è indispensabile niente corrente di fuga e il suo atteggiamento dello spinterometro e del tempo
ODQF@Q@MSHQDTM@jMDTSHKHYYNBNMSQNKK@S@ bassa Up (spinterometro) in livellamento delle di risposta rapido del diodo. Una
dei varistori collegati alla rete elettrica. e niente corrente residua sovratensioni transitorie. tale associazione necessita un
(varistore). Questo componente è elemento di scollegamento in serie
caratterizzato da un tempo in modo tale che la coordinazione
di risposta particolarmente di funzionamento dei componenti di
basso. protezione sia assicurata.

Tecnologie della gamma SURGYS®

Tipo Varistore Spinterometro a gas Diodo di tipo Zener


G140-F q
G40-FE ÷ ÷
G70 q
D40 ÷
E10 q
RS-2 ÷ ÷
mA-2 q q
TEL-2 ÷ ÷
COAX q

SOCOMEC Catalogo Generale 2012-2013 575


Gli scaricatori

Costituzione interna
Meccanismo di apertura Telesegnalazione
Conformemente alle norme “Scaricatore BT”, gli scaricatori La maggior parte degli scaricatori SURGYS® è
SURGYS® sono equipaggiati di sicurezze termiche interne equipaggiata di un contatto di “telesegnalazione”. Questa
che scollegheranno la funzione protezione della rete funzione, che autorizza il controllo a distanza dello stato
in caso di funzionamento anormale (surriscaldamento dello scaricatore, è particolarmente interessante nel caso
dovuto a un superamento delle caratteristiche del CHOQNCNSSHCHEjBHKLDMSD@BBDRRHAHKHNRDMY@RNQUDFKH@MY@
prodotto). In questo caso, l’utente sarà avvisato del guasto Il sistema è costituto di un contatto ausiliario tipo
tramite la visualizzazione del colore rosso dell’indicatore in HMUDQSHSNQD@YHNM@SNHMB@RNCHLNCHjB@CHRS@SNCDKLNCTKN
parte anteriore del modulo difettoso, che verrà sostituito. di protezione.
In più, per sopportare i guasti di tipo corrente di corto- +TSDMSDOTŁBNRįUDQHjB@QDBNMSHMT@LDMSD
circuito o sovratensioni transitorie, gli scaricatori devono - il buon funzionamento degli scaricatori,
imperativamente essere collegati alla rete bassa tensione - la presenza dei moduli sganciabili,
SQ@LHSD LDBB@MHRLH CH @ODQSTQ@ DRSDQMH D RODBHjBH @FKH K@jMDTSHKHYYNRBNKKDF@LDMSNCDFKHRB@QHB@SNQH
scaricatori. Questa funzione “telesegnalazione” permette quindidi
Questo scollegamento esterno è effettuato tramite scegliere un sistema di segnalazione (indicatore di
fusibili SOCOMEC adatti e indicati nelle pagine prodotti funzionamento o di guasto), adatto alla sua installazione
corrispondenti di questo catalogo. tramite diversi mezzi come led, buzzer, automatismi,
Il montaggio dei fusibili in interruttori SOCOMEC adatti trasmissioni.
migliora la sicurezza e facilita, in uso, alcuni interventi
come ad esempio misure d’isolamento.

Principali caratteristiche degli scaricatori


#DkMHYHNMDCDHB@Q@SSDQHRSHBGD 5DQHkB@CH4c
( OQHMBHO@KH O@Q@LDSQH CDjMHSH C@KKD MNQLD g RB@QHB@SNQH u Secondo la norma NF C 15100 sezione 534, la tensione
permettono all’utente di determinare le performance e massima di funzionamento Uc dello scaricatore connesso
l’utilizzo dello scaricatore: in modo comune deve essere selezionata nel modo
- tensione massima di regime permanente (Uc): tensione seguente:
massima accettabile dallo scaricatore, - in regime TT o TN: UcŰ W4n,
- corrente nominale di scarica (In): corrente ad impulso - in regime IT : UcŰ5W4n.
CHENQL@ƅRBGDOTŁDRRDQDRNOONQS@S@UNKSD 
senza danno, dallo scaricatore durante la prova di Gli scaricatori SURGYS® essendo compatibili con tutti i
funzionamento, regimi di neutro, la loro tensione Uc in modo comune è di
- corrente massima di scarica (Imax): corrente ad impulso 440 VAC.
CHENQL@ƅRBGDOTŁDRRDQDRNOONQS@S@TM@UNKS@ 
senza danno, dallo scaricatore di tipo 2,
- corrente di shock (Iimp): corrente ad impulso di forma
ƅRBGDOTŁDRRDQDRNOONQS@S@TM@UNKS@ RDMY@ 5DQHkB@CH4p, In, Imax et Iimp
danno, dallo scaricatore di tipo 1,
Il livello di protezione Up deve essere scelto il più basso
- livello di protezione (Up): tensione che caratterizza
possibile, rispettando sempre la tensione Uc imposta.
KDEjB@BH@ CDKKN RB@QHB@SNQD  0TDRSN U@KNQD Ġ RTODQHNQD
Le correnti di scarica In, Imax e Iimp sono scelte in funzione
alla tensione residua (Ures) che nasce ai morsetti dello
del rischio: vedere guida alla scelta del catalogo scaricatori
scaricatore durante il passaggio della corrente nominale
SURGYS®.
di scarica (In),
- corrente di corto-circuito interna ammissibile (Icc): valore
L@RRHLN CH BNQQDMSD  'Y BGD OTŁ SQ@MRHS@QD MDKKN
scaricatore durante un guasto di esso.

Questi diversi parametri permettono quindi di


dimensionare lo scaricatore rispetto alla rette sulla quale
sarà connesso (Uc e Icc), rispetto allo rischio (In e Imax)
D HMjMD  QHRODSSN @KKDEjB@BH@ CDRHCDQ@S@ D  N SHON CH
apparecchiature da proteggere (Up).

576 Catalogo Generale 2012-2013 SOCOMEC


Gli scaricatori

Scelta e implementazione degli scaricatori di testa


Tipi di scaricatori Bassa Tensione
&KHRB@QHB@SNQHRNMNCDjMHSHC@KK@MNQL@-%$- HMSHOHCHOQNCNSSH BNQQHRONMCDMSH@CDKKDBK@RRHCHOQNUD 0TDRSDRNKKDBHS@YHNMH
RODBHjBGDCHODMCNMNDRRDMYH@KLDMSDC@KK@KNB@KHYY@YHNMDCDKKNRB@QHB@SNQDMDKKHMRS@KK@YHNMDDC@KKDBNMCHYHNMHDRSDQMD

Scaricatori di tipo 1 2B@QHB@SNQHCHSHON


Questi dispositivi sono concepiti per essere utilizzati Destinati ad essere installati a monte dell’impianto,
su impianti dove il rischio “Fulmini” è molto importante, generalmente al livello del QGBT, su siti dove il rischio
particolarmente in caso di presenza di parafulmine sul sito. di impatto diretto è considerato come inesistente, gli
La norma NF EN 61643-11 impone che questi scaricatori RB@QHB@SNQH f/QHL@QHt CH SHON  OQNSDFFNMN KHMRHDLD
siano sottomessi alle prove di Classe 1, caratterizzate da dell’installazione. Questi scaricatori sono sottomessi alle
HLLDRRHNMH CH NMCD CH BNQQDMSD CH SHON    ƅR (imp), OQNUDHMNMC@CHBNQQDMSDƅR(max e In). Se i materiali da
rappresentativi della corrente di fulmine generata durante proteggere si trovano lontano dell’origine dell’installazione,
un impatto diretto. Questi scaricatori dovranno essere degli scaricatori di tipo 2 dovranno essere installati a
particolarmente potenti per scaricare questa onda molto prossimità di essi (vedere paragrafo «Coordinazione tra
energetica. scaricatori di testa e di distribuzione», pagina 780).

Scaricatori a monte dell’impianto BT


Apparecchio
Gli scaricatori della gamma SURGYS® si dividono in sensibile
scaricatori di testa e scaricatori di distribuzione.
Gli scaricatori di testa proteggono l’insieme di
un’installazione BT scaricando la maggior parte delle Protezione Protezione
di testa di distribuzione
correnti che creano sovratensioni direttamente verso terra.
B@SDBAHSB@S

Gli scaricatori di distribuzione assicurano la protezione


delle apparecchiature scaricando l’energia rimanente
verso terra.

Scelta dello scaricatore di testa


In ogni caso, gli scaricatori di testa sono da installare Scaricatori di testa
immediatamente a valle dell’apparecchio generale di Esempi di installazione tipici
SURGYS®
comando.
Le correnti di scarica che questi scaricatori devono /QDRDMY@CHO@Q@ETKLHMD
Siti esposti (altitudine…)
evacuare in caso di sovratensioni possono essere molto Lago
HLONQS@MSH D K@ KNQN RBDKS@ RH E@ CH RNKHSN UDQHjB@MCN BGD Linee a tensione molto elevata Tipo 1 SURGYS G140F
queste correnti (In, Imax, Iimp) sono adatte alle valutazioni $CHjBHBNMRSQTSSTQDLDS@KKHBGD
dei rischi teorici eseguiti, ad esempio, da alcuni studi di estese, o a prossimità di camini
o con dei elementi a punta
progettazione specializzati.
La tabella di selezione seguente da delle indicazioni /QDRDMY@CHO@Q@ETKLHMDD
pratiche permettendo di selezionare direttamente lo QGBT di lunghezza < 2 m e
Tipo 1 SURGYS G40-FE
scaricatore di testa, tenendo conto delle performance dei equipaggiato di apparecchiature
sensibili
SURGYS®.
Ingresso sotterraneo
Sito non esposto Tipo 2 SURGYS G70
Sovratensioni di manovra

Lay-out degli scaricatori di testa di installazione


Edificio B
Gli scaricatori di testa sono disposti: linea
Edificio A QGBT
@KKHUDKKNCHTM0&!3jF  aerea
@KKHUDKKNCDKPT@CQNDKDSSQHBNFDMDQ@KDCDKKDCHjBHN HMB@RN
Scaricatore
di linea aerea esposta ai fulmini. di testa
Scaricatore
di testa
Edificio C

Scaricatore
di distribuzione
catec 210 b it cat

Linea non aerea

%HF ŭRBDKS@CHRB@QHB@SNQDCHSDRS@NCHCHRSQHATYHNMD

SOCOMEC Catalogo Generale 2012-2013 577


Gli scaricatori

Scelta e implementazione degli scaricatori di testa (seguito)


Presenza di parafulmini e scaricatori di testa
La presenza di parafulmini (struttura destinata a captare il fulmine e a scaricare la sua corrente tramite una strada privilegiata
verso terra), sopra o in prossimità di un’installazione, contribuisce ad aumentare l’ampiezza delle correnti ad impulsi: in caso
di impatto diretto sul parafulmine, il potenziale della terra vede un aumento molto importante e una parte della corrente del
fulmine sarà derivata nella rete BT, tramite lo scaricatore.
Così, l’utilizzo simultaneo di scaricatori di tipo 1 con parafulmini è obbligatorio in riferimento alla norma NF C 15100. Il
BNKKDF@LDMSN@KK@QDSDĠC@OQDUDCDQDSQ@LHSDTMBNMCTSSNQDCHRDYHNMDLHMHL@ŰLL2.

Coordinamento con l’AGCP


+ OO@QDBBGHN&DMDQ@KDCH"NL@MCNDCH/QNSDYHNMD &"/CDKKHLOH@MSNHMSDQQTSSNQDFDMDQ@KDĠRDLOQDLDRRN@LNMSD
dello scaricatore. Deve essere coordinato con lo scaricatore per limitare sganci intempestivi durante il funzionamento di esso.
In regime TT, le misure di miglioramento passano essenzialmente tramite la scelta del dispositivo differenziale generale di
SHON2RDKDSSHUNBGDODQLDSSDCHRB@QHB@QDOHŔCHJ HMNMC@ƅRRDMY@RF@MBHN
/DQ DUHS@QD HK C@MMDFFH@LDMSN CDKKN RB@QHB@SNQD  RH CDUD OQHUHKDFH@QD K@ BNMSHMTHSĐ CH RDQUHYHN CDKKHLOH@MSN  H D  OQNU@QD CH
@RRHBTQ@QDK@RDKDSSHUHSĐSQ@K &"/DHKCHRONRHSHUNCH@ODQSTQ@CDKKNRB@QHB@SNQD
Nota: la protezione del punto « neutro » eventuale è da prevedere. La rivelazione della fusione del fusibile del neutro non deve per forza comandare l’apertura
delle fasi corrispondenti perché nel caso specifico di uno scaricatore, il “carico” è equilibrato e non rischia di generare una sovratensione funzionale in
caso di sparizione del neutro..

Qualità dei collegamenti degli scaricatori


U1
La qualità di collegamento dello scaricatore alla rete
Ġ DRRDMYH@KD ODQ F@Q@MSHQD KDEjB@BH@ CDKK@ ETMYHNMD CH D UD
protezione.
Durante la scarica della corrente, l’insieme del ramo
U2
parallelo sul quale è collegato lo scaricatore è sollecitato: U Apparecchiature

la tensione residua (U) ai morsetti dell’apparecchio da


proteggere sarà uguale alla somma della tensione residua P Up
B@SDBAHSB@S

dello scaricatore (Up) + la caduta di tensione (U1 + U2


+ U3) nei conduttori di collegamento più la caduta di
U3
tensione (Ud) nel dispositivo di apertura associato.
Tensioni ai morsetti delle apparecchiature.

Sezioni di collegamento
I conduttori di terra degli scaricatori devono avere una sezione minima di 4 mm2 secondo la norma IEC 60364. In pratica, la
stessa sezione è richiesta per i conduttori di collegamento alla rete.

Regola dei 50 cm Lay-out degli scaricatori di testa


/DQ CHLHMTHQD K@ SDMRHNMD 4  R@QĐ TSHKD QHCTQQD @K LHMHLN
le lunghezze dei conduttori di collegamento, il valore
consigliato di (L1 + L2 + L3) è di 0.50 m massimo.

QGBT nuovo Regola dei 50 cm

QGBT adattabile Rialzare la barretta di terra


Lunghezza totale
dei conduttori
≤ 0,50 m
catec 211 b it cat
B@SDBAHSB@S

Verso rete
di massa
Barretta principale QGBT non adattabile Cassetta esterna
di terra

Distanza SURGYS® / TGBT. Lay-out secondo le condizioni di installazione.

578 Catalogo Generale 2012-2013 SOCOMEC


Gli scaricatori

Protezione delle apparecchiature e scaricatori di distribuzione


Protezione delle apparecchiature e scelta dello
scaricatore
/DQ @RRHBTQ@QD TM@ OQNSDYHNMD DEjB@BD CDFKH @OO@QDBBGH
contro le sovratensioni, uno scaricatore SURGYS® di Apparecchiature
PF Up da proteggere
distribuzione deve essere installato il più vicino possibile
delle apparecchiature da proteggere.

catec 212 b it cat


Gli scaricatori di distribuzione installati vicini delle
apparecchiature devono avere un livello di protezione
legato alla tenuta ai shock del materiale da proteggere:
Up dello scaricatore < tensione di tenuta agli shock
dell’apparecchio da proteggere *.
* Sotto riserva di un’installazione corretta (vedere pagina precedente).

Rigidità dielettrica delle apparecchiature


(CHUDQRHSHOHCHL@SDQH@KHRNMNBK@RRHjB@SHHMPT@SSQNB@SDFNQHD "NQQHRONMCNMN@PT@SSQNKHUDKKHCHSDMTS@@FKHRGNBJCHRNUQ@SDMRHNMD
accettabile dalle apparecchiature.

Esempi di apparecchi con una tenuta agli shock


molto elevata elevata normale ridotta
Reti apparecchi di
trifasi apparecchi
contatori tariffari distribuzione: interruttori, apparecchi con circuiti
elettro-domestici
apparecchi di telemisura magnetotermici elettronici
utensili portativi
materiali industriali
Tensione nominale
Tensione di tenuta agli shock (kV)
dell’installazione (V)
230 / 440 6 4 2,5 1,5
  6 4 2,5

Modo comune e modo differenziale


Modo comune
• Modo comune
Le sovratensioni sono create tra ogni conduttore attivo e la F
massa. Le correnti vanno nella stessa direzione tra le due Perturbazione
Apparecchiatura
Uc
linee e tornano a terra tramite il collegamento di messa a N sensibile

terra (F / T, N / T).
Le sovratensioni in modo comune sono pericolose a
causa del rischio di guasto dielettrico.

• Modo differenziale
Modo differenziale
F
Le sovratensioni sono create tra i conduttori attivi (F / N, Perturbazione
Apparecchiatura
Uc sensibile
F / F). La corrente, via la fase, attraversa l’apparecchio e N
catec 213 b it cat

torna tramite il neutro.


Queste sovratensioni sono particolarmente pericolose per
gli apparecchi elettronici.

Protezione in modo comune


Di solito, gli scaricatori si collegano tra conduttori attivi (fasi e neutro) e la barretta generale di terra del quadro elettrico o il
BNMCTSSNQDFDMDQ@KDCHOQNSDYHNMD/$
Gli scaricatori di distribuzione SURGYS® D40 e E10 assicurano la protezione in modo comune delle apparecchiature.
Questo modo di protezione conviene di solito per gli schemi di collegamento a terra seguenti:
- rete TNC,
-rete IT a masse collegate.

SOCOMEC Catalogo Generale 2012-2013 579


Gli scaricatori

Protezione delle apparecchiature e scaricatori di distribuzione (seguito)


Protezione in modo differenziale
/DQ OQNSDFFDQD BNMSQN KD RNUQ@SDMRHNMH HM LNCN CHEEDQDMYH@KD  NUUDQN BGD ONRRNMN BQD@QRH SQ@ E@RH D MDTSQN  CTD RNMN KD
soluzioni possibili :
- utilizzare gli scaricatori unipolari supplementari a quelli utilizzati per il modo comune e collegarli tra ogni fase e il neutro,
- utilizzare degli scaricatori dotati di una protezione in modo differenziale integrata come i SURGYS® tipo D40 MC / MD o
E10 MC / MD.

Questo modo di protezione è specialmente raccomandato nei seguenti casi :


Rete TT
ONRRNMNBQD@QRHCDKKDRNUQ@SDMRHNMHHMLNCNCHEEDQDMYH@KD@B@TR@CDKKeDUDMST@KD@RHLLDSQH@SQ@KDOQDRDCHSDQQ@CDKMDTSQNDKD
LHRTQD!3HMO@QSHBNK@QD MDKB@RNHMBTHK@QDRHRSDMY@CDKK@OQDR@CHSDQQ@CDKKeTSDMSDRH@DKDU@S@ŰŰNGLQHRODSSN@KK@OQDR@
di terra del punto neutro.
Rete TNS
possono crearsi delle sovratensioni in modo differenziale a causa della lunghezza del cablaggio tra il trasformatore e la testa
CDKKeHLOH@MSN!3

Coordinazione tra scaricatori di testa e di distribuzione


/DQE@QRįBGDNFMHRB@QHB@SNQDF@Q@MSHRB@K@RT@QHRODSSHU@ETMYHNMDCHRL@KSHLDMSN KNRB@QHB@SNQDCHSDRS@DU@BT@K@L@FFHNQ
O@QSDCDKKeDMDQFH@LDMSQDKNRB@QHB@SNQDCHCHRSQHATYHNMD@RRHBTQ@HKKHUDKK@FFHNHMSDMRHNMDHKOHŔUHBHMNONRRHAHKD@KKe@OO@QDBBGH@STQ@
da proteggere.
0TDRS@BNNQCHM@YHNMDĠONRRHAHKDRNKNRDK@QHO@QSHYHNMDCeDMDQFH@SQ@HCTDRB@QHB@SNQHĠBNMSQNKK@S@SQ@LHSDTMeHLODCDMY@ 
0TDRS@HLODCDMY@OTŁDRRDQD@RRHBTQ@S@RH@C@LCHB@M@KHYY@YHNMD RH@C@TMeHMCTSS@MY@CH@BBNOOH@LDMSN+ODQKD
distanze inferiori.

Distanza scaricatore e attrezzatura


La lunghezza del conduttore tra lo scaricatore e il materiale
C@ OQNSDFFDQD HMkTHRBD RTKKeDEjB@BH@ CH OQNSDYHNMD  (M L > 30 m di cavi
effetti, una lunghezza troppo importante può generare Apparecchio
sensibile
CDKKD NRBHKK@YHNMH QHkDRRHNMH CDKKeNMC@ CH RNUQ@SDMRHNMD
incidentale) e di conseguenza, nel peggiore dei casi, sarà Scaricatore Scaricatore
necessario raddoppiare il livello di protezione Up sui bordi di distribuzione di distribuzione
da aggiungere
del materiale da proteggere.
catec 214 b it cat

si raccomanda quindi di mantenere una lunghezza


HMEDQHNQD @ Ű L SQ@ RB@QHB@SNQD D L@SDQH@KD N CH QHBNQQDQD
alla coordinazione degli scaricatori (vedere paragrafo
« Coordinazione tra scaricatori »). Caso di un apparecchio distanziato.

580 Catalogo Generale 2012-2013 SOCOMEC


Gli scaricatori

Regole e scelta degli scaricatori


Come per gli accessi di bassa tensione, gli ingressi a « basse correnti » (Telecom, linee modem, trasmissioni di dati, reti
informatiche, loop di corrente…) di alcune apparecchiature sono estremamente sensibili alle sovratensioni transitorie. La
suscettibilità molto elevata dei materiali connessi a una linea a « bassa corrente » è dovuta alla combinazione dei due fenomeni :
- resistenza allo « stiramento » dei circuiti nettamente più debole di quella dei circuiti a bassa tensione,
RNUQ@SDMRHNMDRTOOKDLDMS@QDSQ@BHQBTHSH@A@RRDBNQQDMSHDBHQBTHSH@A@RR@SDMRHNMD RODBH@KLDMSD@B@TR@CDKKe@BBNOOH@LDMSN
KjMDCHF@Q@MSHQDTMe@EjC@AHKHSĐCHETMYHNM@LDMSNCDHRHRSDLH NKSQD@KKe@BBDRRNDMDQFH@ ĠPTHMCHENMC@LDMS@KDOQNSDFFDQD
anche questo tipo di connessioni.

Norme scaricatori a basse correnti


Norma « Prodotto »
-NQL@-%$- PTDRSNCNBTLDMSNCDjMHRBDCDHBNKK@TCHC@@OOKHB@QD@FKHRB@QHB@SNQH@A@RRDBNQQDMSH
( O@Q@LDSQH SDRS@SH RNMN RHLHKH @ PTDKKH CDFKH RB@QHB@SNQH !3  @C DRBKTRHNMD CDH BNKK@TCH SHOHBH CDKKD QDSH !3 Ű 'Y BNQQDMSD
di cortocircuiti, sovratensioni temporanee…). Sono invece richiesti dei test supplementari sulla qualità di trasmissione
(attenuazione…).

Norma « Selezione e Installazione »


Norma IEC 61643-22: informazione sulla tecnologia degli scaricatori per basse correnti, sui metodi di selezione e i consigli
CeHMRS@KK@YHNMD

Gli scaricatori SURGYS® per basse correnti


SOCOMECOQNONMDTM@F@LL@CHRB@QHB@SNQHODQBNKKDF@QDK@A@RR@BNQQDMSD@KENQL@SNLNCTK@QDODQTMeHLOKDLDMS@YHNMD
RDLOKHjB@S@CDFKH@QL@CHMNQL@KHYY@SH +@ETMYHNMDRB@QHB@SNQDuĠQHLNUHAHKD@KjMDCHNSSHLHYY@QDK@L@MTSDMYHNMDDHKBNMSQNKKN
Gli schemi utilizzati negli scaricatori SURGYS®ODQKHMDDCHA@RR@BNQQDMSDRHA@R@MNRTKKe@RRNBH@YHNMDCHROHMSDQNLDSQH@F@R
tripolari e di diodi di pilotaggio rapidi, il che permette di ottenere le seguenti caratteristiche :
BNQQDMSDCHRB@QHBNMNLHM@KDRDMY@CHRSQTYHNMDHMNMC@§RŰŰJ
- tempo di risposta della protezione < 1 ns,
SDMRHNMDQDRHCT@@C@SS@S@@KK@SDMTS@CDKKe@OO@QDBBGHN
- continuità di servizio,
- sicurezza di funzionamento mediante messa in cortocircuito in caso di guasto permanente.

&Q@YHD@KKeHMMDRBNRHLTKS@MDNCDHSQDDKDSSQNCH KTSHKHYYNRHRSDL@SHBNCHROHMSDQNLDSQH@F@RSQHONK@QH@RRHBTQ@TM@OQNSDYHNMD
ottimizzata.
+eHMRHDLD CH PTDRSD B@Q@SSDQHRSHBGD Ġ HMCHRODMR@AHKD ODQ NSSDMDQD TMe@EjC@AHKHSĐ NSSHL@KD CDKKe@OO@QDBBGHN OQNSDSSN 
indipendentemente dal disturbo momentaneo.

Valutazione del rischio


Non è obbligatoria la messa in funzione degli scaricatori sui collegamenti a basse correnti, anche se il rischio è maggiore.
Quindi è necessario stimare il rischio analizzando qualche semplice parametro :

Utilizzo degli scaricatori SURGYS®


Q@BBNL@MC@S@ opzionali
Collegamenti telecom
Distribuzione aerea sotterranea
Storico « momentaneo » >1 0
Apparecchi @KHLDMS@SN'Y non alimentato
Importanza dell'apparecchio vitale secondario
Trasmissione dei dati
Distribuzione esterno interna
Storico « momentaneo » >1 0
Lunghezza linea ŰL < 30 m
Ambiente elettromagnetico denso debole
(LONQS@MY@CDKKe@OO@QDBBGHN vitale secondario
* Raccomandata se l'impianto risponde almeno a uno di questi criteri.

SOCOMEC Catalogo Generale 2012-2013 581


Gli scaricatori

Lay-out e manutenzione
Installazione
Localizzazione
/DQNSSHLHYY@QDKDEjB@BH@CDKK@OQNSDYHNMD FKHRB@QHB@SNQHCDUNMNDRRDQDONRHYHNM@SHBNQQDSS@LDMSDRNMNPTHMCHCHRONRSH
- nel caso di una linea esterna: all’ingresso dell’installazione, ovvero al livello del ripartitore o della scatola di collegamento di
ingresso, per derivare le correnti ad impulsi il più velocemente possibile,
- nel caso di collegamenti pericolosi: a prossimità immediata degli apparecchi da proteggere (esempio: nella cassetta di
collegamento dell’apparecchio).

In ogni caso, l’apparecchio protetto deve essere vicino allo scaricatore (lunghezza di conduttore “scaricatore / apparecchio”
inferiore a 30 m). Se questa regola non può essere rispettata, occorrerà installare una protezione “secondaria” in vicinanza
dell’apparecchio (coordinamento di scaricatori).

Edificio B
Edificio A Edificio B
Apparecchio
– 1 S1 1 Apparecchio sensibile
+ 2 RS 2
0 sensibile
Edificio A
S
1 S2 1 –
2 RS 2
+
catec 203 b it cat

catec 204 b it cat

"NKKDF@LDMSN12@kKHBNMkKN5 "NKKDF@LDMSN12@kKH

Collegamento alla rete delle masse


La lunghezza di collegamento dello scaricatore alla rete delle masse dell’installazione deve essere la più corta possibile
HMEDQHNQD@BLODQKHLHS@QDKDB@CTSDCHSDMRHNMD@CCHYHNM@KHBGDODM@KHYYDQDAADQNKDEjB@BH@CHOQNSDYHNMD +@RDYHNMDCH
questo conduttore deve essere di 2,5 mm2 minimo.

Cavi
Gli scaricatori per reti a bassi correnti SURGYS® non necessitano di nessuna manutenzione o sostituzione sistematica ;
sono progettati per sopportare delle onde di shock importanti senza distruzione e di maniera ripetitiva. Nessuna circolazione
in parallelo nella stessa bocchetta allo scopo di limitare gli accoppiamenti.

Manutenzione
Gli scaricatori per reti a bassi correnti SURGYS® non necessitano di nessuna manutenzione o sostituzione sistematica; sono
progettati per sopportare delle onde di shock importanti senza distruzione e di maniera ripetitiva.

Fine utilizzo
Tuttavia, una distruzione può intervenire in caso di superamento delle caratteristiche dello scaricatore. La messa fuori servizio
di sicurezza interviene nei casi seguenti:
- contatto prolungato con una linea di energia,
- shock di “fulmine” eccezionalmente violento.

(MPTDRSNB@RN KNRB@QHB@SNQDRHLDSSDHMBNQSN BHQBTHSNCDjMHSHU@LDMSD OQNSDFFDMCNBNRįKD@OO@QDBBGH@STQDSQ@LHSDLDRR@


a terra) e indicando la sua distruzione funzionale (interruzione di linea): l’utente dovrà allora procedere alla sostituzione del
modulo sganciabile dello scaricatore SURGYS®.
(MOQ@SHB@ K@jMDTSHKHYYNCHTMNRB@QHB@SNQD3$+RTTM@KHMD@SDKDENMHB@RHSQ@CTBDODQKTSDMSDC@TMSDKDENMNBGDRDLAQ@
sempre occupato.
L’utente (Telecom) vedrà la messa a terra della linea e ne informerà l’abbonato.

582 Catalogo Generale 2012-2013 SOCOMEC


Cassette

Effetti termici
Potenza dissipata dagli apparecchi
5DMFNMNENQMHSDKDONSDMYDMNLHM@KHODQK@BNQQDMSD(SGB@KHAQNMNLHM@KDMDKK@S@ADKK@PTHRNSSN
Per la corrente d’uso dell’apparecchio si avrà:
P ONSDMY@CHRRHO@S@HM6
Ie 2
/Ű/NW [ Ith ] PNONSDMY@MNLHM@KDCHRRHO@S@HM6UDCHS@ADKK@HMA@RRN
Ie : corrente d’uso dell’apparecchio.
Ith: calibro dell’apparecchio.

Caratteristiche termiche
Determinazione dell’innalzamento della Determinazione del ventilatore
temperatura In caso di ventilazione forzata, la portata d’aria D necessaria è:
/6
·3¦*
*W2L2
#L3GŰ W [ ·3I *W2 ]
P : potenza dissipata all’interno della cassetta (apparecchiatura, ( UDMSHK@SNQH RNMN OQNONRSH BNLD @BBDRRNQH MDKK@ F@LL@
collegamenti, cavi, ecc.).
" #182
·3HMM@KY@LDMSNCDKK@SDLODQ@STQ@HM§*
S : superficie libera della cassetta (non si tiene conto delle superfici contro Determinazione della resistenza di riscaldamento
i muri o altri ostacoli).
*BNDEEHBHDMSDCHRB@LAHNSDQLHBN  Essa è richiesta quando occorre evitare la condensa
*ŭŭ6L2§"ODQKDB@RRDSSDHMONKHDRSDQD  @KKHMSDQMNCDKK@QL@CHN +@ONSDMY@/BCDKK@QDRHRSDMY@Ġ
*ŭ ŭ6L2§"ODQKDB@RRDSSDLDS@KKHBGD
data da:
Quando l’armadio o la cassetta sono muniti di feritoie per la ventilazione,
@OOKHB@QDK@MNQL@($"ODQHKB@KBNKN NOOTQDBNMRTKS@QBH
/B6Ű·3W*W2 /
Determinazione dello scambiatore aria/aria:
UDCDQDO@FHM@
Determinazione del climatizzatore: UDCDQDO@FHM@
Potenze dissipate in W/polo per l’apparecchiatura
"@KHAQH  32                      
2(1". -   - 2   3   3 4                   
SIRCO VM 0,9 1,3 - 1,2 2,1 3,1 5,7 3,3 5,8 - - - - - - - - - - - - - -
2(#$1 - -  -   -   - 3,4 - -      32 -    - - - - -
SIDERMAT - - - - - - - - - 8,2 - 15,6 - 45 66,4 - 80 113 - - - - -
%42$1!+."  "# -    -    23    -  -    -  - - - - - -
FUSOMAT - - - - - - - - - 30,3 - 50 - 83,5 - - 222 - - - - - -

Esempio: 4M@QL@CHNBNLOQDMCDTMHMSDQQTSSNQDFDMDQ@KD%42$1!+."W DOHœO@QSDMYD +@BNQQDMSDMNLHM@KDğCH


/NSDMY@CHRRHO@S@@ S@ADKK@HMA@RRN Wŭŭ6
/NSDMY@CHRRHO@S@@ 

[ ]  2
W ŭ6

+@ONSDMY@SNS@KDMDKK@QL@CHN@OO@QDBBGH@STQD B@UH DBB Q@FFHTMFDH6 #HLDMRHNMH@QL@CHN'ŭŭLL /ŭŭLL +ŭŭLL
+@QL@CHNğONRSNSQ@@KSQHCTD@QL@CHDBNMSQNHKLTQN +@RTODQkBHDKHADQ@R@Qď2L2ŭW @U@MS
ŭ W G@TSŭ ŭL2

Innalzamento della temperatura dentro l’armadio:


ŭ6
·3 ŭ§"
 W ŭL2
"NMTM@SDLODQ@STQ@@LAHDMSDCH§" RHNSSHDMD3ŭŭ§"
ŭŭ§"ŭŭ§"
/DQKHLHS@QRH@TM@SDLODQ@STQ@L@RRHL@CH§"·3ŭŭ§" NBBNQQDTM@UDMSHK@YHNMDCHONQS@S@

#ŭ W
[ 

 W  ]  ŭL G 

Cassette in poliestere
+D B@RRDSSD RNMN TSHKHYY@AHKH MDFKH HLOH@MSH @ODQSH D @BBDRRHAHKH @K OTAAKHBN  +NQCHM@MY@ LHMHRSDQH@KD CDK  HLONMD
B@RRDSSD@TSNDRSHMFTDMSHSDMTS@@C@KLDMN¦"@KjKNHMB@MCDRBDMSDRDBNMCN($"
3HONCHB@RRDSS@ ".,!($23$1 ,(-(/.+ , 7(/.+
coperchio trasparente coperchio opaco
3DMTS@@KjKNHMB@MCDRBDMSD ۦ" ۦ" ۦ" ۦ"

SOCOMEC Catalogo Generale 2012-2013 583


Cassette

Effeti termici (seguito)


Protezione dagli effetti termici (secondo la norma IEC 60364)
+DSDLODQ@STQDCDHL@SDQH@KHDKDSSQHBHRNMNKHLHS@SD@HU@KNQHCDKK@S@ADKK@RDFTDMSD
/@QSHH@BBDRRHAHKH Materiali 3¦L@RRHL@
Metallici 
#HRONRHSHUHCHBNL@MCNL@MT@KD
Non Metallici 
Metallici 
/NRRHAHKHSĐCHSNBB@QKDL@MNMCHSDMDQKDHML@MN
Non Metallici 
Metallici 
#@MNMSNBB@QDMDKKDMNQL@KDNODQ@YHNH
Non Metallici 

Calcolo termico delle cassette


Ipotesi Potenza necessaria per mantenere la temperatura
nella cassetta
@#DjMHQD K@ SDLODQ@STQ@ HMSDQM@ L@RRHL@ MDKK@QL@CHN
HLONRS@C@KBNLONMDMSDOHŔRDMRHAHKD
A#DjMHQD K@ SDLODQ@STQ@ HMSDQM@ L@RRHL@ CDKK@LAHDMSD /M6Ű/C *W2W3HL@W 3@L@W
@KKDRSDQMNCDKK@QL@CHN
B#DjMHQDKDCHLDMRHNMHCDKPT@CQN *ŭ ŭ6L2§" per una cassetta in lamiera verniciata
CNUD 3H¦" 3DLODQ@STQ@HMSDQM@ *ŭŭ6L2§" ODQTM@B@RRDSS@HMONKHDRSDQD
 3@¦" 3DLODQ@STQ@@LAHDMSD *ŭ ŭ6L2§" ODQTM@B@RRDSS@HM@BBH@HNHMNW
  + /LŰ KSDYY@ +@QFGDYY@ /QNENMCHSĐ *ŭŭ6L2§" ODQTM@B@RRDSS@HM@KKTLHMHN
/M6ONSDMY@MDBDRR@QH@

Potenza dissipata dai componenti Scelta del modo di regolazione


Apparecchiature SOCOMEC a) Ventilazione
5DCDQD H CDSS@FKH CDKKD ONSDMYD CHRRHO@SD @KK@ BNQQDMSD  BDFKHDQD TM UDMSHK@SNQD CH ONQS@S@ HLLDCH@S@LDMSD
2
MNLHM@KDUDCDQDO@FHM@ RTODQHNQD@KU@KNQDB@KBNK@SN
Ie 2  W/M
/CŰ/MNLW [ Ith ] /NQS@S@L3G
3HL@W 3@L@W
Pnom6/NSDMY@MNLHM@KD -NS@RNKTYHNMDC@BNMRHCDQ@QDRNKNRD3HL@W 3@L@Wŭŭ§"
/C6/NSDMY@CHRRHO@S@@KK@BNQQDMSDCTRN
Ie "NQQDMSDC?TRN
(SG "NQQDMSDMNLHM@KD b) Scambiatore aria/aria
 BDFKHDQD TMN RB@LAH@SNQD CH ONSDMY@ RODBHjB@
2
HLLDCH@S@LDMSDRTODQHNQD@KU@KNQDB@KBNK@SN
2TODQkBHDCHRB@LAHNBNQQDSS@
Pn
/NS RODBHjB@6¦*
@#DjMHQDHKE@SSNQDCHBNQQDYHNMD*METMYHNMDCDKK@LNC@KHSĐ 3HL@W 3@L@W
CHLNMS@FFHN
-NS@RNKTYHNMDC@BNMRHCDQ@QDRNKNRD3HL@W 3@L@Wŭŭ§"

c) Climatizzatore
 BDFKHDQD TM BKHL@SHYY@SNQD CH ONSDMY@ EQHFNQHEDQ@
2
HLLDCH@S@LDMSD RTODQHNQD @KK@ ONSDMY@ MDBDRR@QH@
/M
Kn = 1 Kn = 0,87 Kn = 0,94 Kn = 0,81

d) Resistenza di riscaldamento
 BDFKHDQD TM@ QDRHRSDMY@ CH QHRB@KC@LDMSN CH ONSDMY@
2
HLLDCH@S@LDMSDRTODQHNQD@KU@KNQDB@KBNK@SN
B@SDBBWB@S

/B6Ű:3HL@W 3@L@WW*W2< /M

Kn = 0,88 Kn = 0,75 Kn = 0,68

A2TODQjBHDBNQQDSS@

2Ű*M W'W+
Ű/
Ű W+W/

584 Catalogo Generale 2012-2013 SOCOMEC


Cassette

Scelta della climatizzazione


+DBTQUDPTHRNSSNCDSDQLHM@MNK@RBDKS@CDKBKHL@SHYY@SNQD@O@QSHQDC@KK@SDLODQ@STQ@LHQ@S@MDKK@QL@CHN CDKK@SDLODQ@STQ@
@LAHDMSDDCDKK@ONSDMY@MDBDRR@QH@UDCDQDB@KBNKNO@FHM@

3DLODQ@STQ@CDRHCDQ@S@MDKK@QL@CHNŮ٧" 3DLODQ@STQ@CDRHCDQ@S@MDKK@QL@CHNŮ٧"

Références Riferimenti
2500 3000

51992270 2500
2000
51991270
51992270
2000 51991270
Puissance (W)

Potenza (W)
1500
51991200
1500 51991200
51991140
1000 51991140
51992140
1000 51992140

500
51992050 500 51992050
51991050 51991050
51992030 51992030
0 51991030 51991030
0
B@SDBAHSB@S

B@SDBAHSB@S
20 25 30 35 40 45 50 55 20 25 30 35 40 45 50 55

Température ambiante °C Temperatura ambiente °C

3DLODQ@STQ@CDRHCDQ@S@MDKK@QL@CHNŮ٧" 3DLODQ@STQ@CDRHCDQ@S@MDKK@QL@CHNŮ٧"

Riferimenti Riferimenti
3500 3500

3000 3000

2500 2500 51991270


51991270 51992270
Potenza (W)

Potenza (W)

51992270
2000 2000
51991200
51991200
1500 1500
51991140 51991140
51992140 51992140
1000 1000

500 500 51991050


51992030 51992050
51991030 51992030
0 0 51991030
B@SDBAHSB@S

B@SDBAHSB@S

20 25 30 35 40 45 50 55 20 25 30 35 40 45 50 55

Temperatura ambiente °C Temperatura ambiente °C

3DLODQ@STQ@CDRHCDQ@S@MDKK@QL@CHNŮ٧"

Riferimenti Montaggio sul tetto

4000 Montaggio frontale

3500

3000 Esempio
51992270
51991270 3DLODQ@STQ@HMSDQM@L@W3HL@W ŭ§"
2500
Potenza (W)

3DLODQ@STQ@@LAHDMSDL@W3@L@W ŭ§"
2000 51991200 /NSDMY@MDBDRR@QH@/M ŭ6
1500 51991140
51992240
1000
51991050
500 51992050
51992030
0 51991030
B@SDBAHSB@S

20 25 30 35 40 45 50 55

Temperatura ambiente °C

SOCOMEC Catalogo Generale 2012-2013 585


Barre di distribuzione

Scelta del materiale delle barre

7DEHOOD$FRVWDQWLĺVLFKHGHOUDPHHGHOOpDOOXPLQLR
Rame Alluminio
Norme EN 1652 / NFA 51-100 HN 63 J 60, CNET 3072-1, qualità 6101T5
Tipo ETP-H12 (EN 1652) Cu A1 (NFA 51-100) /HJD$O0J6LVWDJQDWDbģP
Densità 8890 kg/m3 2700 kg/m3
&RHIðFLHQWHGLGLODWD]LRQHOLQHDUH 17 x 10-6SHUĢ& [-3PPP 23 x 10-6SHUĢ& [-3PPP
Resistenza minima alla rottura 250 N / mm2 150 N / mm2
5HVLVWLYLW¿DĢ& ħP:PP2P ħP:PP2P
Modulo d’elasticità 120000 N / mm2 67000 N / mm2

Determinazione di Icc di cresta in funzione della IccDEkB@BD


7DEHOOD%6HFRQGRQRUPD,(&
5@KNQHDEjB@BHCDKK@BNQQDMSDCHBNQSNBHQBTHSN n Icc cresta = n x Icc eff
(­J 1,5
N$,ħN$ 1,7
J (­J 2
N$,ħN$ 2,1
50 kA < I 2,2

Effetto termico del corto circuito


+@BNQQDMSDCHBNQSNBHQBTHSNOQNUNB@TMQHRB@KC@LDMSNCDKKDA@QQD +@SDLODQ@STQ@jM@KDCDKK@A@QQ@CDUDDRRDQDHMEDQHNQD@
160 °C per non deteriorare il supporto della barra. Il vincolo termico deve essere tale che:
Icc BNQQDMSDCHBNQSNBHQBTHSNDEkB@BDHM
(Icc)2WS­*E2 S2 t: durata del corto circuito (generalmente uguale al tempo di
interruzione del dispositivo di protezione).
S: sezione della barra in mm2.
KE B  NDEkBHDMSDENQMHSNC@KK@S@ADKK@"HMETMYHNMDCDKK@SDLODQ@STQ@
Tf della barra in funzionamento normale (prima del corto
circuito).

7DEHOOD&
Tf 40 50 60 70 80 90 100 110 120 130
*E 89,2 84,7 80,1 75,4 70 65,5 60,2 54,6 48,5 41,7

Effetti elettrochimici
Per evitare eccessivi riscaldamenti dovuti ad effetti elettrochimici (corrosione), occorre evitare di collegare conduttori con
potenziali elettrochimici superiori a 300 mV (vedere tabella D).
Tabella D
Argento Rame Alluminio Stagno Acciaio Ottone Nickel
Argento si si no no no si si
5DPH si si no si no si si
Alluminio no no si si si no no
Stagno no si si si si si no
Acciaio no no si si si no no
Ottone si si no si no si si
Nickel si si no no no si si

Esempio: non si potrà collegare direttamente una barra di alluminio a una barra di rame. Occorrerà, per esempio, interporre una barra di
alluminio stagnata:
- Alluminio/Stagno SI
- Stagno / Rame SI

586 Catalogo Generale 2012-2013 SOCOMEC