Sei sulla pagina 1di 124

E721

< (1) F
BUS 2EASY
< (2)

< OPEN A -
< GND
< OPEN B / CLOSE / SAFE
+

R
A
C

R O1
RADIO XF

R
2

E
FC
FC

IO

O
< STOP / SAFE

W
I

R
D

O
R
A

P
R

< FSW OP SETUP


< GND
< FSW CL
< +24

USB
BATTERY
RELEASE
Y
R
)

R
F

OUT
-L

E
S

S
E IN

TO
R M

K
K
K
T
-N

N
T EC

C
T
T RI

C
C
(P A

- +
A

LO
LA

LO
LO
M

R
P

M
B
<

<

<

<

<

<

<
<
<
INDICE
1 AVVERTENZE ................................................................................................................................................... 2

ITALIANO
2 LAYOUT E COMPONENTI ................................................................................................................................. 2
2.1 DESCRIZIONE COMPONENTI ..................................................................................................................................... 3
2.2 DESCRIZIONE MORSETTIERA J13 ............................................................................................................................... 3
3 CARATTERISTICHE TECNICHE........................................................................................................................... 3
4 COLLEGAMENTI ELETTRICI .............................................................................................................................. 4
4.1 FOTOCELLULE A BUS-2EASY ....................................................................................................................................... 5
4.1.1 INDIRIZZAMENTO FOTOCELLULE BUS-2EASY .................................................................................................................5
4.1.2 MEMORIZZAZIONE ACCESSORI BUS-2EASY ..................................................................................................................5
4.2 FOTOCELLULE TRADIZIONALI ..................................................................................................................................... 6
4.3 COLLEGAMENTI INGRESSO SAFE ................................................................................................................. 7
5 PROGRAMMAZIONE ...................................................................................................................................... 8
5.1 PROGRAMMAZIONE 1° LIVELLO ............................................................................................................................... 8
5.2 PROGRAMMAZIONE 2° LIVELLO .............................................................................................................................. 10
6 MEMORIZZAZIONE CODIFICA RADIO .......................................................................................................... 12
6.1 MEMORIZZAZIONE DEI RADIOCOMANDI DS ........................................................................................................... 12
6.2 MEMORIZZAZIONE DEI RADIOCOMANDI SLH ........................................................................................................ 13
6.3 MEMORIZZAZIONE DEI RADIOCOMANDI LC/RC (SOLO PER ALCUNI MERCATI) ...................................................... 13
6.3.1 MEMORIZZAZIONE REMOTA RADIOCOMANDI LC/RC ................................................................................................13
6.4 PROCEDURA DI CANCELLAZIONE DEI RADIOCOMANDI ........................................................................................ 13
7 MESSA IN FUNZIONE .................................................................................................................................... 14
7.1 VERIFICA DEI LEDS .................................................................................................................................................... 14
7.2 FUNZIONAMENTO A BATTERIA ................................................................................................................... 14
7.3 POSIZIONAMENTO DEI FINECORSA ........................................................................................................................ 15
7.4 CONFIGURAZIONI MASTER/SLAVE ........................................................................................................................... 16
7.4.1 CABLAGGI MASTER/SLAVE.......................................................................................................................................... 16
7.4.2 PROCEDURA DI SETUP MASTER/SLAVE ........................................................................................................................ 16
7.5 SETUP ....................................................................................................................................................................... 17
8 PROVA DELL’AUTOMAZIONE ......................................................................................................................... 17
9 SEGNALAZIONE ALLARMI ED ERRORI ............................................................................................................ 17
9.1 ALLARMI .................................................................................................................................................................. 17
9.2 ERRORI ................................................................................................................................................................... 17
10 LOGICHE DI FUNZIONAMENTO .................................................................................................................. 18

DICHIARAZIONE CE DI CONFORMITÁ
Fabbricante: )$$&6S$
Indirizzo: 9LD&DODUL=ROD3UHGRVD%2/2*1$,7$/,$
Dichiara che: /·DSSDUHFFKLDWXUDHOHWWURQLFD(

 ‡qFRQIRUPHDLUHTXLVLWLHVVHQ]LDOLGLVLFXUH]]DGHOOHVHJXHQWLGLUHWWLYH&((

  &('LUHWWLYD%DVVD7HQVLRQH
  &('LUHWWLYD&RPSDWLELOLWj(OHWWURPDJQHWLFD

  1RWDDJJLXQWLYD
   4XHVWRSURGRWWRqVWDWRVRWWRSRVWRDWHVWLQXQDFRQILJXUD]LRQHWLSLFD
   RPRJHQHD WXWWLSURGRWWLGLFRVWUX]LRQH)$$&6S$ 

%RORJQD
      /·$PPLQLVWUDWRUH'HOHJDWR
      $0DUFHOODQ
AVVERTENZE
‡$WWHQ]LRQHËLPSRUWDQWHSHUODVLFXUH]]DGHOOHSHUVRQHVHJXLUHDWWHQWDPHQWHWXWWDO·LVWUX]LRQH
‡8QDHUUDWDLQVWDOOD]LRQHRXQHUUDWRXVRGHOSURGRWWRSXzSRUWDUHDJUDYLGDQQLDOOHSHUVRQH
‡/HJJHUHDWWHQWDPHQWHOHLVWUX]LRQLSULPDGLLQL]LDUHO·LQVWDOOD]LRQHGHOSURGRWWRHFRQVHUYDUOHSHUULIHULPHQWLIXWXUL
‡ ,O VLPEROR    HYLGHQ]LD OH QRWH LPSRUWDQWL SHU OD VLFXUH]]D GHOOH SHUVRQH H O·LQWHJULWj
GHOO·DXWRPD]LRQH
‡,OVLPEROR ULFKLDPDO·DWWHQ]LRQHVXOOHQRWHULJXDUGDQWLOHFDUDWWHULVWLFKHRGLOIXQ]LRQDPHQWRGHO
SURGRWWR
E721 1 532014 - Rev. D
E721
ITALIANO

1 AVVERTENZE
Prima di effettuare qualsiasi tipo di intervento sull’apparecchiatura elettronica (collegamenti,
manutenzione) togliere sempre l’alimentazione elettrica.

Prevedere a monte dell’impianto un interruttore magnetotermico differenziale con adeguata soglia


di intervento.

Collegare il cavo di terra all’apposito morsetto.

Separare sempre i cavi di alimentazione da quelli di comando


e di sicurezza (pulsante, ricevente, fotocellule, ecc.). Per evitare
qualsiasi disturbo elettrico utilizzare guaine separate o cavo
schermato (con schermo collegato a massa).

2 LAYOUT E COMPONENTI

/ SAFE
/ SAFE

SENSORE
FINECORSA

)LJ

E721 2 532014 - Rev. D


2.1 DESCRIZIONE COMPONENTI 3 CARATTERISTICHE TECNICHE
/&' ',63/$<',6(*1$/$=,21((352*5$00$=,21( Alimentazione 9(56,21(99a+]
9(56,21(99a+]

ITALIANO
6: 38/6$17(352*5$00$=,21(´F” Potenza assorbita :
6: 38/6$17(352*5$00$=,21(´-” da rete stand-by
Carico max. $
6: 38/6$17(352*5$00$=,21(´+” per motore
6: 38/6$17(',´SETUP” Alimentazione 9
accessori
/HGV /('',&21752//267$72,1*5(66,
Corrente max 9 PD[P$
- &211(7725($/,0(17$=,21(35,0$5,$ accessori %86($6<PD[P$
- &211(7725(35,0$5,275$6)250$725( Temperatura  ƒ&
ambiente
- &211(7725(6(&21'$5,275$6)250$725( Carico lampeg- 9 :
- &211(7725(%$77(5,((0(5*(1=$ $&&(6625,2 giatore
Carico uscita 9 P$ (2)
- &211(7725(02725(
Fusibili di ) 7$9a
- &211(7725(86&,7$/$03(**,$725((24 V= - 15W) protezione
&211(7725(%/2&&202725((&217$7726%/2&&2 Logiche di 6HPLDXWRPDWLFD6HPLDXWRPDWLFD
-
02725( funzionamento ´SDVVRSDVVR´$XWRPDWLFD$XWRPDWLFD
´SDVVRSDVVR”$XWRPDWLFDFRQIXQ]LRQH
- &211(7725(86&,7$287
WLPHU$XWRPDWLFD6LFXUH]]H$XWRPDWLFD
- &211(7725(86%3(5&2//(*$0(1723& 6LFXUH]]H´SDVVRSDVVR´$XWRPDWLFDFRQ
LQYHUVLRQHLQSDXVD6HPLDXWRPDWLFD´E”
- &211(7725(&2//(*$0(172',6326,7,9,%86($6<
/RJLFDPLVWD´E&”8RPRSUHVHQWH
- &211(7725(,1*5(66,,10256(77,(5$ Tempo di lavoro 3URJUDPPDELOH GDDPLQ
&211(7725(02'8/25,&(9(17(5$',2 Tempo di pausa 3URJUDPPDELOH GDDPLQ
-
3(5201,'(& OPEN A / OPEN B
/&' ',63/$<',6(*1$/$=,21((352*5$00$=,21( Forza motore 3URJUDPPDELOHVXOLYHOOL
Velocità motore 3URJUDPPDELOHVXOLYHOOL
) )86,%,/(3527(=,21(
apertura-chiusura
2.2 DESCRIZIONE MORSETTIERA J13 Ingressi/Uscite in $OLPHQWDWRUH%DWWHULD0RWRUH0RGXOR
connettore ;)%DWWHULHVEORFFRHOHWWULFREORF
N° INGRESSO DESCRIZIONE
FRPRWRUH%ORFFR0RWRUH86%
1 23(1$ 'LVSRVLWLYRFRQFRQWDWWR
N.AFKH Ingressi/Uscite in %86($6<23(1$23(1%&/26(6$)(
SURYRFDO·DSHUWXUDWRWDOH morsettiera 67236$)(*1')RWRFHOOXOH$SHUWXUDH
GHOFDQFHOOR &KLXVXUD9 $OLPHQWD]LRQHGLUHWH
2-6 *1' 1HJDWLYRDOLPHQWD]LRQH /DPSHJJLDQWH6EORFFRHOHWWULFREORFFR
DFFHVVRUL PRWRUH287
3  23(1% 'LVSRVLWLYRFRQFRQWDWWR
'()$8/7 N.A.FKHSURYRFDO·DSHUWXUD
SDU]LDOHGHOFDQFHOOR
CLOSE 'LVSRVLWLYRFRQFRQWDWWR
N.A.FKHSURYRFDOD (1) Le tipologie di utilizzo degli ingressi 3 e
FKLXVXUDGHOFDQFHOOR 4 sono impostabili attraverso la configu-
6$)( 'LVSRVLWLYRFRQFRQWDWWR razione dei relativi parametri al 2° livello
N.C.FKHSURYRFD di programmazione (parametro Ob e SP).
O·LQYHUVLRQHLPPHGLDWDH Per l’esatta descrizione sul funzionamento
FRPSOHWDGHOFDQFHOOR dell’automazione in relazione alle logiche
4  6723 'LVSRVLWLYRFRQFRQWDWWR selezionate, fare riferimento alle tabelle
'()$8/7 N.C.FKHSURYRFDO·DUUHVWR che si trovano in fondo a questo manuale
GHOFDQFHOOR (Par. 10 - LOGICHE DI FUNZIONAMENTO).Per
6$)( 'LVSRVLWLYRFRQFRQWDWWR quanto riguarda i cablaggi da effettuare
N.C.FKHSURYRFD utilizzando questi ingressi configurati come
O·LQYHUVLRQHLPPHGLDWDH
FRPSOHWDGHOFDQFHOOR SAFE, fare riferimento agli schemi indicati
in Fig.13 e Fig. 14
5 )6:23 'LVSRVLWLYRFRQFRQWDWWR
N.C.FKHSURYRFD
O·LQYHUVLRQHGHOPRWR (2) Il carico dell’uscita deve ritenersi già
GXUDQWHO·DSHUWXUDGHO
FDQFHOOR incluso nella corrente max disponibile per
gli accessori
7 )6:&/ 'LVSRVLWLYRFRQFRQWDWWR
N.C. FKHSURYRFD
O·LQYHUVLRQHGHOPRWR
GXUDQWHODFKLXVXUDGHO
FDQFHOOR
8 9  3RVLWLYRDOLPHQWD]LRQH
DFFHVVRUL

E721 3 532014 - Rev. D


4 COLLEGAMENTI ELETTRICI
I cablaggi indicati in Fig. 2 fanno riferimento agli ingressi della scheda con configurazione di DEFAULT.
ITALIANO

/ SAFE
/ SAFE

3HULOFROOHJDPHQWRGHOOH
IRWRFHOOXOHHGHLGLVSRVL
WLYLGLVLFXUH]]DULIHULUVLDO
SDUDJUDIR

230 V ~
115 V ~
=

CONTATTO
SBLOCCO MOTORE
(Blocca il motore quan-
do si aziona la maniglia
= di sblocco motore)
)LJ

E721
E721 E721
E721

C720
C 72 C721
C 721
)LJ

$ )RWRFHOOXOHFRQLQWHUYHQWRLQ&+,8685$
% )RWRFHOOXOHFRQLQWHUYHQWRLQ$3(5785$
& )RWRFHOOXOHFRQLQWHUYHQWRLQ$3(5785$H&+,8685$

)LJ

E721 4 532014 - Rev. D


3ULPDGLFROOHJDUHOHIRWRFHOOXOHqRSSRUWXQRVFHJOLHUQH Tab. 1 - Indirizzamento fotocellule BUS-2EASY
LOWLSRGLIXQ]LRQDPHQWRLQEDVHDOOD]RQDGLPRYLPHQWR

ITALIANO
FKHGHYRQRSURWHJJHUH 'LS 'LS 'LS 'LS 5LI 7LSRORJLD
Sicurezze in chiusura: LQWHUYHQJRQR VROWDQWR GXUDQWH LO
2)) 2)) 2)) 2))
PRYLPHQWRGLFKLXVXUDGHOO·DXWRPD]LRQHTXLQGLVRQR
DGDWWHDSURWHJJHUHOD]RQDGLFKLXVXUDGDOULVFKLRGL 2)) 2)) 2)) 21
LPSDWWR 2)) 2)) 21 2))
Sicurezze in apertura: LQWHUYHQJRQRVROWDQWRGXUDQWHLO % $3(5785$
2)) 2)) 21 21 Max 6 coppie
PRYLPHQWRGLDSHUWXUDGHOO·DXWRPD]LRQHTXLQGLVRQR
DGDWWHDSURWHJJHUHOD]RQDGLDSHUWXUDGDOULVFKLRGL 2)) 21 21 2))
LPSDWWR
Sicurezze in apertura/chiusura: LQWHUYHQJRQRVLDGXUDQWH 2)) 21 21 21
LOPRYLPHQWRGLDSHUWXUDHFKLXVXUDGHOO·DXWRPD]LRQH 21 2)) 2)) 2))
TXLQGLVRQRDGDWWHDSURWHJJHUHWXWWDOD]RQDGLPR
21 2)) 2)) 21
YLPHQWD]LRQHGDOULVFKLRGLLPSDWWR
21 2)) 21 2))
4.1 FOTOCELLULE A BUS-2EASY &+,8685$
21 2)) 21 21 $ Max 7 coppie
4XHVWD VFKHGD q SURYYLVWD GL FLUFXLWR %86($6< FKH
FRQVHQWHGLFROOHJDUHIDFLOPHQWHXQHOHYDWRQXPHURGL 21 21 2)) 2))
GLVSRVLWLYL%86($6<DXVLOLDULDOODVLFXUH]]D DGHVILQRD 21 21 2)) 21
FRSSLHGLIRWRFHOOXOH RSSRUWXQDPHQWHSURJUDPPDWL
XWLOL]]DQGRVRODPHQWHGXHFDYLVHQ]DSRODULWj 21 21 21 2))
3ULPDGLFROOHJDUHOHIRWRFHOOXOHqRSSRUWXQRVFHJOLHUQH 2)) 21 2)) 2)) $3(5785$H
LOWLSRGLIXQ]LRQDPHQWR )LJ LQEDVHDOOD]RQDGLPRYL & &+,8685$
2)) 21 2)) 21 Max 2 coppie
PHQWRFKHGHYRQRSURWHJJHUHHSRVL]LRQDUHLGLSVZLWFK
VLDVXOWUDVPHWWLWRUHHVLDVXOULFHYLWRUH YHGL)LJ FRPH 21 21 21 21  ,038/6223(1
GD7DE
4.1.2 MEMORIZZAZIONE ACCESSORI BUS-2EASY
)LJ DL1  $OOLQHD ,QTXDOVLDVLPRPHQWRqSRVVLELOHDJJLXQJHUHIRWRFHOOXOH
PHQWR H DFFHVVRUL %86($6< DOO·LPSLDQWR VHPSOLFHPHQWH VH
DL2  6WDWR JXHQGRODVHJXHQWHSURFHGXUD
%86($6<$OL  ,QVWDOODUHHSURJUDPPDUHJOLDFFHVVRULFRQO·LQGLUL]]R
RX TX PHQWD]LRQH GHVLGHUDWR YHGLSDU 
DL2 DS1  'LS  7RJOLHUHDOLPHQWD]LRQHDOODVFKHGD
DL1
VZLWFKHVSHUOD  &ROOHJDUHLGXHFDYLGHJOLJOLDFFHVVRUL%86($6<DOOD
PRUVHWWLHUDURVVD- SRODULWjLQGLIIHUHQWH 
ON ON
DS1 DS1
1 2 3 4 1 2 3 4
SURJUDPPD
DL2 ]LRQH  $OLPHQWDUHODVFKHGD
BUS BUS BUS BUS  3UHPHUHUDSLGDPHQWHXQDYROWDLOSXOVDQWH6(783 6: 
SHU HVHJXLUH O·LVFUL]LRQH GHJOL DFFHVVRUL 9HULILFDUH LO
RX - TX IXQ]LRQDPHQWRGHLGLVSRVLWLYLD%86($6<LQVWDOODWL
 /DVFKHGDKDPHPRUL]]DWRJOLDFFHVVRUL%86($6<
6HJXLUHOHLQGLFD]LRQHGHOODWDEHOODVHJXHQWHSHUFRQWUROODUH
4.1.1 INDIRIZZAMENTO FOTOCELLULE BUS-2EASY LOEXRQRVWDWRGHOFROOHJDPHQWR%86($6<
È importante dare sia al trasmettitore che
La stessa procedura va eseguita su una
al ricevitore lo stesso indirizzo.
centrale MASTER anche per l’acquisizione
di una centrale SLAVE collegata al BUS-
Accertarsi che non vi siano due o più cop-
2EASY con collegamento POLARIZZATO.
pie di fotocellule con lo stesso indirizzo.
Tab. 2 - Descrizione led BUS-2EASY
Se non si utilizza alcun accessorio BUS- 1RUPDOHDWWLYLWj OHGDFFHVRDQFKHLQDV
2EASY, lasciare libero il connettore BUS- Acceso
VHQ]DGLIRWRFHOOXOH 1HVVXQDIRWRFHOOXOD
2EASY (J12 - fig. 1). fisso
LVFULWWDLPSHJQDWD
Lampeg-
$OPHQRXQDIRWRFHOOXODLVFULWWDLPSHJQDWD
giante
RQRQDOOLQHDWD
lento
Spento
(flash ogni /LQHD%86($6<LQFRUWRFLUFXLWR
2,5 sec.)
/LQHD%86($6<GLVDWWLYDWD QRQIRUQLVFH
DOLPHQWD]LRQH
Spento
)XQ]LRQDPHQWRDEDWWHULD
&HQWUDOHSURJUDPPDWDFRPH6/$9(
E721 5 532014 - Rev. D
4.2 FOTOCELLULE TRADIZIONALI &ROOHJDPHQWRGLXQDFRSSLDGLIRWRFHOOXOHLQFKLXVXUD
HXQDLQDSHUWXUD
&ROOHJDPHQWRFRSSLDGLIRWRFHOOXOHLQFKLXVXUD
ITALIANO

FRQVLFXUH]]D)$,/6$)(attivata
Impostare nel secondo livello di programmazione
o1 = 01

OUT

Altre sicurezze

OUT
OUT

&ROOHJDPHQWRFRSSLDGLIRWRFHOOXOHLQFKLXVXUD )LJ
FRQVLFXUH]]D)$,/6$)(H6723disattivata
&ROOHJDPHQWRGLGXHFRSSLHGLIRWRFHOOXOHLQFKLXVXUD

Altre sicurezze

)LJ

Nel caso non si utilizzi la sicurezza FAIL-


SAFE occorre collegare l’alimentazione dei
trasmettitori ai morsetti 6 e 8 di J13.

Utilizzando la sicurezza FAIL-SAFE collegare


l’alimentazione dei trasmettitori all’OUT
dopo averla impostata opportunamente )LJ
(vedi programmazione di 2° livello e Fig. 6).
&ROOHJDPHQWRGLXQDFRSSLDGLIRWRFHOOXOHLQFKLXVXUD
Utilizzando la sicurezza FAIL-SAFE anche gli
ingressi di sicurezza non utilizzati andranno HGXQDLQDSHUWXUDFKLXVXUD
ponticellati col negativo di OUT (vedi Fig. 6).

&ROOHJDPHQWRXQDFRSSLDGLIRWRFHOOXOHLQDSHUWXUD

Altre sicurezze

)LJ )LJ

E721 6 532014 - Rev. D


&ROOHJDPHQWRGLXQDFRSSLDGLIRWRFHOOXOHLQFKLXVXUD &ROOHJDPHQWRGLQHVVXQGLVSRVLWLYRGLVLFXUH]]DHVWRS
XQDLQDSHUWXUDHGXQDLQDSHUWXUDFKLXVXUD

ITALIANO
)LJ

)LJ

4.3 COLLEGAMENTI INGRESSO SAFE


Nel caso venga attivata la sicurezza Fail Safe (parametro configurabile nel 2° livello di programmazione),
il negativo da utilizzare per la gestione dell’ingresso SAFE dovrà essere il - OUT (vedi Fig. 13).

&ROOHJDPHQWRGLXQDVLFXUH]]D DOWUHVLFXUH]]H DOO·LQJUHVVR6$)(FRQIXQ]LRQHFAIL SAFE attivata

,PSRVWDQGRƒOLYHOORo 1=01 )$,/6$)($77,9$72 ,PSRVWDQGRƒOLYHOORo 1=01 )$,/6$)($77,9$72


SP=01 ,1*5(662
ƒOLYHOOR 6,&85(==$&267$ Ob=02 ,1*5(662
ƒOLYHOOR 6,&85(==$&267$

Altre sicurezze
Altre sicurezze
OPEN A OPEN A
GND GND
OPEN B / CLOSE - OUT SAFE / OPEN B / CLOSE
- OUT SAFE / STOP STOP
FSW OP FSW OP
GND GND
FSW CL FSW CL
+24V +24V )LJ
Nel caso venga disattivata la sicurezza Fail Safe (parametro configurabile nel 2° livello di programmazio-
ne), il negativo da utilizzare per la gestione dell’ingresso SAFE dovrà essere il -  (vedi Fig. 14).

&ROOHJDPHQWRGLXQDVLFXUH]]D DOWUHVLFXUH]]H DOO·LQJUHVVR6$)(FRQIXQ]LRQHFAIL SAFE disattivata

,PSRVWDQGRƒOLYHOORo 1=00 )$,/6$)(',6$77,9$72 ,PSRVWDQGRƒOLYHOORo 1=00 )$,/6$)(',6$77,9$72


ƒOLYHOOR SP=01 ,1*5(662 6,&85(==$&267$ ƒOLYHOOR Ob=02 ,1*5(662 6,&85(==$&267$

Altre sicurezze
OPEN A
Altre sicurezze OPEN A
GND
OPEN B / CLOSE GND
SAFE / STOP - SAFE / OPEN B / CLOSE
- FSW OP STOP
GND FSW OP
FSW CL GND
+24V FSW CL
+24V )LJ

Nel caso non vengano utilizzati dispositivi con contatto N.C. (Altre sicurezze) l’ingresso SAFE divrà essere
ponticellato al -OUT con FAIL SAFE attivato o al GND con FAIL SAFE disattivato.
E721 7 532014 - Rev. D
5 PROGRAMMAZIONE La modifica dei parametri di program-
mazione diventa efficace appena viene
3HUSURJUDPPDUHLOIXQ]LRQDPHQWRGHOO·DXWRPD]LRQHqQH
eseguita, mentre la memorizzazione
FHVVDULRDFFHGHUHDOODPRGDOLWj´352*5$00$=,21(”
ITALIANO

definitiva avviene solo all’uscita dalla


/DSURJUDPPD]LRQHVLGLYLGHLQGXHSDUWLƒ/,9(//2ƒ programmazione ed al ritorno alla visualiz-
/,9(//2 zazione dello stato degli ingessi. Se si toglie
Normalmente sul display è visualizzato alimentazione all’apparecchiatura prima
lo stato dell’automazione. Premendo il del ritorno alla visualizzazione dello stato
pulsante F oppure premendo contempo- degli ingressi, tutte le variazioni effettuate
raneamente F e + si ha accesso rispettiva- verranno perse.
mente alla programmazione di 1° o di 2°
livello. Durante il funzionamento a batteria È possibile ritornare alla visualizzazione del-
il display è spento. Premere brevemente il lo stato degli ingressi, e memorizzare tutti i
tasto + per visualizzare lo stato dell’auto- parametri modificati fino a quel momento,
mazione. da qualsiasi punto della programmazione
di 1° e 2° livello premendo contemporane-
Per ripristinare le impostazioni di default è amente i tasti F e -.
sufficiente ricaricare il default desiderato
nel primo passaggio della programmazio- All’accensione della scheda sul display
ne di 1° livello. LCD1 apparirà per qualche secondo la
versione software della scheda a due cifre
5.1 PROGRAMMAZIONE 1° LIVELLO separate dal punto decimale.
3HUDFFHGHUHDOODSURJUDPPD]LRQHGLƒOLYHOORRFFRUUHSUHPHUHLOSXOVDQWHF
‡ 3UHPHQGRLOWDVWRF HPDQWHQHQGRORSUHPXWR VXOGLVSOD\DSSDUHLOQRPHGHOODIXQ]LRQH
‡ 5LODVFLDQGRLOSXOVDQWHLOGLVSOD\YLVXDOL]]DLOYDORUHGHOODIXQ]LRQHFKHSXzHVVHUHPRGLILFDWRFRQLWDVWLH
‡ 3UHPHQGRQXRYDPHQWHF HPDQWHQHQGRORSUHPXWR LOGLVSOD\PRVWUDLOQRPHGHOODIXQ]LRQHVXFFHVVLYDHFF
‡ $UULYDWLDOO·XOWLPDIXQ]LRQHODSUHVVLRQHGHOSXOVDQWHFSURYRFDO·XVFLWDGDOODSURJUDPPD]LRQHHLOVDOYDWDJJLRGHL
SDUDPHWUL,OGLVSOD\ULSUHQGHDYLVXDOL]]DUHORVWDWRGHOO·DXWRPD]LRQH
PROGRAMMAZIONE 1° LIVELLO

Display Funzione Default 1


DEFAULT:
dF 1 &RQILJXUDLSDUDPHWULFRQYDORULGL'()$8/7
1
CU 6HULODVFLDQGRLOSXOVDQWHFDSSDUHLOYDORUH CU VLJQLILFDFKHqVWDWDVHOH]LRQDWDOD
FRQILJXUD]LRQHVWDQGDUGPRGLILFDWDWUDPLWHSXOVDQWLHGLVSOD\6HVLYXROHPDQWHQHUH
WDOHSURJUDPPD]LRQHSUHPHUHQXRYDPHQWHLOSXOVDQWHF DOWULPHQWLSUHPHUHH
VHOH]LRQDUHLOGHIDXOW1 
CONFIGURAZIONE MASTER/SLAVE:
Ct M A  &RQILJXUDODVFKHGDLQPRGDOLWjMASTER MA
SL &RQILJXUDODVFKHGDLQPRGDOLWjSLAVE
Configurando la scheda in modalità SLAVE non verranno visualizzati i parametri
LO-PA-Pb-Ph-Op (per funzionamento Master/Slave vedi Par. 7.4)
LOGICHE DI FUNZIONAMENTO:
LO E 6HPLDXWRPDWLFD E
EP 6HPLDXWRPDWLFD´3DVVRDSDVVR”
A $XWRPDWLFD
A1 $XWRPDWLFD
AP $XWRPDWLFD´3DVVRDSDVVR”
At $XWRPDWLFDFRQIXQ]LRQHWLPHU
S $XWRPDWLFD´6LFXUH]]H”
SP $XWRPDWLFD´6LFXUH]]H3DVVRDSDVVR”
SA $XWRPDWLFDFRQLQYHUVLRQHLQSDXVD
b 6HPLDXWRPDWLFD´E”
bC  0LVWD $3DGLPSXOVR&+DGXRPRSUHVHQWH
C 8RPRSUHVHQWH
Parametro non visualizzato in modalità SLAVE
TEMPO DI PAUSA A:
PA ,OWHPSRGLSDXVDDIURQWHGLXQFRPDQGRGLDSHUWXUDTOTALE+DHIIHWWRVRODPHQWHVHq 20
VWDWDVHOH]LRQDWDXQDORJLFDDXWRPDWLFD5HJRODELOHGDDVHFDSDVVLGLXQVHFRQGR
,QVHJXLWRODYLVXDOL]]D]LRQHFDPELDLQPLQXWLHGHFLQHGLVHFRQGL VHSDUDWLGDXQSXQWR HLO
WHPSRVLUHJRODDSDVVLGLVHFRQGLILQRDOYDORUHPDVVLPRGL 9.5 PLQXWL
(6VHLOGLVSOD\LQGLFD2.5 LOWHPSRGLSDXVDFRUULVSRQGHDPLQHVHF
Parametro non visualizzato in modalità SLAVE
E721 8 532014 - Rev. D
Display Funzione Default 1
TEMPO DI PAUSA B:
Pb 20

ITALIANO
,OWHPSRGLSDXVDDIURQWHGLXQFRPDQGRGLDSHUWXUDPARZIALE+DHIIHWWRVRODPHQWHVHq
VWDWDVHOH]LRQDWDXQDORJLFDDXWRPDWLFD5HJRODELOHGDDVHFDSDVVLGLXQVHFRQGR
,QVHJXLWRODYLVXDOL]]D]LRQHFDPELDLQPLQXWLHGHFLQHGLVHFRQGL VHSDUDWLGDXQSXQWR HLO
WHPSRVLUHJRODDSDVVLGLVHFRQGLILQRDOYDORUHPDVVLPRGL 9.5 PLQXWL
(6VHLOGLVSOD\LQGLFD2.5 LOWHPSRGLSDXVDFRUULVSRQGHDPLQHVHF
Parametro non visualizzato in modalità SLAVE
FORZA MOTORE:
FO 5HJRODLOOLYHOORGLIRU]DGHOPRWRUH
50
 01  IRU]DPLQLPD
 50  IRU]DPDVVLPD
Variando il valore della forza è consigliabile eseguire un nuovo SETUP (vedi
par. 7.3)
VELOCITÀ APERTURA:
So 5HJRODVXOLYHOOLODYHORFLWjGLDSHUWXUDGHOPRWRUH
08
 01 YHORFLWjPLQLPD
 10 YHORFLWjPDVVLPD
Variando il valore della velocità è consigliabile eseguire un nuovo SETUP
(vedi par. 7.3)
VELOCITÀ CHIUSURA:
Sc 5HJRODVXOLYHOOLODYHORFLWjGLFKLXVXUDGHOPRWRUH
08
 01 YHORFLWjPLQLPD
 10 YHORFLWjPDVVLPD
Variando il valore della velocità è consigliabile eseguire un nuovo SETUP
(vedi par. 7.3)
RALLENTAMENTO IN APERTURA:
ro 5HJRODORVSD]LRGLUDOOHQWDPHQWRFRPHSHUFHQWXDOHGHOODFRUVDWRWDOHGHOFDQFHOOR5H
20
JRODELOHGD5  FRQYHORFLWj 10  FRQYHORFLWjIUDH 15  FRQYHORFLWj! D99 
DSDVVLGL

 5-10-15 UDOOHQWDPHQWRPLQLPR
 99  UDOOHQWDPHQWRPDVVLPR
RALLENTAMENTO IN CHIUSURA:
rc 5HJRODORVSD]LRGLUDOOHQWDPHQWRFRPHSHUFHQWXDOHGHOODFRUVDWRWDOHGHOFDQFHOOR5H
20
JRODELOHGD5  FRQYHORFLWj 10  FRQYHORFLWjIUDH 15  FRQYHORFLWj! D99 
DSDVVLGL

 5-10-15  UDOOHQWDPHQWRPLQLPR
 99  UDOOHQWDPHQWRPDVVLPR
VELOCITÀ IN RALLENTAMENTO:
Sr 5HJRODODYHORFLWjGHOFDQFHOORGXUDQWHLOUDOOHQWDPHQWR
0
 0 YHORFLWj%$66$
 1 YHORFLWj$/7$
STATO DELL’AUTOMAZIONE:
St 8VFLWDGDOODSURJUDPPD]LRQHPHPRUL]]D]LRQHGHLGDWLHULWRUQRDOODYLVXDOL]]D]LRQHGHOORVWDWRGHOO·DX
WRPD]LRQH

00  &+,862 07 )$,/6$)(LQFRUVR
01 $3(572 08 YHULILFDGLVSRVLWLYL%86($6<LQFRUVR
02  )HUPRSRL´$35(” 09 3UHODPSHJJLRSRL´$35(”
03  )HUPRSRL´&+,8'(” 10 3UHODPSHJJLRSRL´&+,8'(”
04 ,Q´3$86$” 11 $3(572LQ$SHUWXUD3DU]LDOH
05 ,QIDVHGLDSHUWXUD 12 ,Q3$86$$SHUWXUD3DU]LDOH
06 ,QIDVHGLFKLXVXUD

E721 9 532014 - Rev. D


5.2 PROGRAMMAZIONE 2° LIVELLO
3HUDFFHGHUHDOOD352*5$00$=,21(ƒ/,9(//2SUHPHUHLOSXOVDQWHFHPDQWHQHQGRORSUHPXWRSUHPHUHLOSXOVDQWH+
‡ ULODVFLDQGRDQFKHLOSXOVDQWHFLOGLVSOD\YLVXDOL]]DLOYDORUHGHOODIXQ]LRQHFKHSXzHVVHUHPRGLILFDWRFRQLWDVWL+H-
ITALIANO

‡ SUHPHQGRLOWDVWRF HPDQWHQHQGRORSUHPXWR LOGLVSOD\PRVWUDLOQRPHGHOODIXQ]LRQHVXFFHVVLYDULODVFLDQGROR


YLHQHYLVXDOL]]DWRLOYDORUHFKHSXzHVVHUHPRGLILFDWRFRQLWDVWL+H-
‡ DUULYDWLDOO·XOWLPDIXQ]LRQHODSUHVVLRQHGHOSXOVDQWHFSURYRFDO·XVFLWDGDOODSURJUDPPD]LRQHHGLOGLVSOD\ULSUHQGH
DYLVXDOL]]DUHORVWDWRGHOO·DXWRPD]LRQH

PROGRAMMAZIONE 2° LIVELLO

Display Funzione Default 1


FORZA MASSIMA ALLO SPUNTO:
bo ,OPRWRUHODYRUDDIRU]DPDVVLPD LJQRUDQGRLOOLYHOORGLIRU]DVHOH]LRQDWD GXUDQWHORVSXQWR
no
GHOODPRYLPHQWD]LRQH
 Y  DWWLYR
 no  HVFOXVR
PRELAMPEGGIO:
PF 3HUPHWWHGLVHOH]LRQDUHWLSLGLSUHODPSHJJLRGHOODGXUDWDSDULDVHF
no
no  QHVVXQSUHODPSHJJLR
OC  SUHODPSHJJLRSULPDGLRJQLPRYLPHQWD]LRQH
CL  SUHODPSHJJLRSULPDGLXQDPRYLPHQWD]LRQHGLFKLXVXUD
OP  SUHODPSHJJLRSULPDGLXQDPRYLPHQWD]LRQHLQDSHUWXUD
PA  SUHODPSHJJLRVRORDILQHSDXVD
TEMPO DI PRELAMPEGGIO (visibile solo se è stato selezionato un prelampeggio al menù
tP precedente): 03
5HJRODLOWHPSRGLSUHODPSHJJLRGD 1 D10 VHFDSDVVLGLVHFRQGR
 01 SUHODPSHJJLRPLQLPR
10 SUHODPSHJJLRPDVVLPR
FOTOCELLULE IN CHIUSURA:
Ph $WWLYDUHODIXQ]LRQHVHVLGHVLGHUDFKHOHIRWRFHOOXOHGLFKLXVXUDEORFFKLQRLOPRYLPHQWRH
no
ORLQYHUWDQRDOGLVLPSHJQR1RUPDOPHQWHFRQTXHVWDIXQ]LRQHHVFOXVDO·LQWHUYHQWRGHOOH
IRWRFHOOXOHLQFKLXVXUDGHWHUPLQDXQDLQYHUVLRQHLPPHGLDWDGHOFDQFHOOR
Y  LQYHUVLRQHDOGLVLPSHJQR
n o  LQYHUVLRQHLPPHGLDWDLQDSHUWXUD
Parametro non visualizzato in modalità SLAVE
FOTOCELLULE IN APERTURA:
oP $WWLYDUHODIXQ]LRQHVHVLGHVLGHUDFKHOHIRWRFHOOXOHGLDSHUWXUDEORFFKLQRLOPRYLPHQWRH
no
LQYHUWDQRLQFKLXVXUD1RUPDOPHQWHFRQTXHVWDIXQ]LRQHHVFOXVDO·LQWHUYHQWRGHOOHIRWR
FHOOXOHLQDSHUWXUDGHWHUPLQDODULSUHVDGHOPRWRDOORURGLVLPSHJQR
Y  LQYHUVLRQHLPPHGLDWDLQFKLXVXUD
no ULSUHVDGHOPRWRDOGLVLPSHJQR
Parametro non visualizzato in modalità SLAVE
FUNZIONE ADMAP:
Ad 3HUPHWWHGLDWWLYDUHLOIXQ]LRQDPHQWRVHFRQGRODQRUPDWLYDIUDQFHVH1)3
no
Y  DWWLYR
n o  HVFOXVR
ENCODER:
EC /·HQFRGHU´YLUWXDOH´SUHVHQWHVXOODVFKHGDIXQ]LRQDFRPHGLVSRVLWLYRDQWLVFKLDFFLDPHQWRH 02
JHVWLVFHLSXQWLGLLQL]LRUDOOHQWDPHQWRHDSHUWXUDSDU]LDOH
1HOFDVRLOFDQFHOORGXUDQWHODIDVHGLDSHUWXUDRFKLXVXUDXUWLFRQWURXQRVWDFRORO·HQFRGHU
´YLUWXDOH´SURYRFDO·LQYHUVLRQHGHOPRWR,OVHFRQGRRVWDFRORULOHYDWRQHOODVWHVVDGLUH]LRQH
SURYRFDO·DUUHVWRGHOPRWRUH,QHQWUDPELLFDVLYLHQHVHJQDODWRXQDOODUPH YHGLSDUDOODUPL
2FFRUUHUHJRODUHODVHQVLELOLWjGHOO·HQFRGHU´YLUWXDOH´YDULDQGRLOWHPSRFKHODVFKHGDDW
WHQGHSULPDGLFRPDQGDUHO·LQYHUVLRQHGHOPRWRGDXQPLQLPRGL 0 VHFDGXQPDVVLPR
GL10 VHFDVWHSGLXQVHFRQGR
00 PDVVLPDVHQVLELOLWj
 10 PLQLPDVHQVLELOLWj

E721 10 532014 - Rev. D


Display Funzione Default 1
APERTURA PARZIALE:
PO 50

ITALIANO
(·SRVVLELOHUHJRODUHO·DPSLH]]DGHOO·DSHUWXUDSDU]LDOHGHOO·DQWDFRPHSHUFHQWXDOHGHOODFRUVD
WRWDOHGHOFDQFHOOR
5HJRODELOHGDDDSDVVLGL
 00  QHVVXQDDSHUWXUDSDU]LDOH
 01  DSHUWXUDSDU]LDOHPLQLPD
 99  DSHUWXUDSDU]LDOHPDVVLPD
TEMPO LAVORO (time-out):
t (·RSSRUWXQRLPSRVWDUHXQYDORUHVXSHULRUHDOWHPSRQHFHVVDULRDOFDQFHOORSHUDSULUHH 2.0
FKLXGHUHFRPSOHWDPHQWH
5HJRODELOHGD 0 D 59 VHFDSDVVLGLVHFRQGR,QVHJXLWRODYLVXDOL]]D]LRQHFDPELDLQ
PLQXWLHGHFLQHGLVHFRQGL VHSDUDWLGDXQSXQWR HLOWHPSRVLUHJRODDSDVVLGLVHFRQGL
ILQRDOYDORUHPDVVLPRGL9.5 PLQXWL
(6VHLOGLVSOD\LQGLFD2.5 LOWHPSRGLSDXVDFRUULVSRQGHDPLQHVHF
In caso di impianto con configurazione MASTER/SLAVE sarà necessario impostare
un TEMPO LAVORO sulla centrale MASTER che tenga conto dei tempi di
movimentazione di entrambe le ante.
OUT 1:
o1 &RQVHQWHGLLPSRVWDUHO·XVFLWD287 RSHQFROOHFWRU1$ DWWLYDLQXQDGHOOHVHJXHQWLIXQ]LRQL 00
00 6HPSUHDWWLYD IRUQLVFHWHQVLRQH9 FRQDVVRUELPHQWRPDVVLPRGLP$
01 )$,/6$)( 9HULILFDLOFRUUHWWRIXQ]LRQDPHQWRGHOOHIRWRFHOOXOHWUDGL]LRQDOLFROOHJDWH
02 /$03$'$63,$ VSHQWDGDFKLXVRDFFHVDLQDSHUWXUDHDSHUWRSDXVDODPSHJJLDQWHLQFKLXVXUD
03 /8&(',&257(6,$ YHGLIXQ]LRQHVXFFHVVLYD
04 $//$50(IXQ]LRQDPHQWRD%$77(5,$
05 FDQFHOOR$3(572RGLQ3$86$
06 FDQFHOOR&+,862
07 FDQFHOORLQ029,0(172
08 FDQFHOORLQ$3(5785$
09 FDQFHOORLQ&+,8685$
1 0  VLFXUH]]D$77,9$
1 1  XVFLWDWHPSRUL]]DWDDWWLYDELOHGDOVHFRQGRFDQDOHUDGLR YHGLIXQ]LRQHVXFFHVVLYD
1 2  XVFLWDDWWLYDELOHGDOVHFRQGRFDQDOHUDGLR IXQ]LRQHSDVVRSDVVR
TEMPORIZZAZIONE OUT 1 (visibile solo se al passo precedente è stata selezionata la voce
t1 03 o 11 ): 02
&RQVHQWHGLUHJRODUHODWHPSRUL]]D]LRQHGHOO·XVFLWD287QHOFDVRVLDVWDWDVHOH]LRQDWDXQD
IXQ]LRQHDWHPSR FRPHDGHV03 R 11 GD 1 D99 PLQXWLDSDVVLGLPLQXWR
OPEN B / CLOSE/SICUREZZA COSTA:
Ob ËSRVVLELOHVHOH]LRQDUHO·XVRGHOO·LQJUHVVR23(1%FRPHDSHUWXUDSDU]LDOHFRPDQGRGL&/26(
00
R6,&85(==$&267$
00 23(1%
01 &/26(
02 6,&85(==$&267$ FRQWDWWR1&
Nel caso si selezioni una logica di funzionamento che prevede l’utilizzo del co-
mando di CLOSE (logica b, bC, C) questa funzione sarà preimpostata a 01 e
non sarà possibile modificarla.
STOP / SICUREZZA COSTA:
SP ËSRVVLELOHVHOH]LRQDUHO·XVRGHOO·LQJUHVVR6723FRPH6723R6,&85(==$&267$
00
00 6723
01 6,&85(==$&267$ FRQWDWWR1&
INVERSIONE PARZIALE:
IP ËSRVVLELOHVHOH]LRQDUHODWLSRORJLDGLLQYHUVLRQH FRPSOHWDRSDU]LDOH DVHJXLWRGLXQRVWDFROR no
RDVHJXLWRGLLQWHUYHQWRGHOODFRVWDVHQVLELOH
Y $WWLYD]LRQHLQYHUVLRQHSDU]LDOH$VHJXLWRGLRVWDFRORRDWWLYD]LRQHFRVWDVHQVLELOH
O·DQWDLQYHUWHODPRYLPHQWD]LRQHSHUXQWHPSRGLFLUFD”SHUSRLIHUPDUVL
no 'LVDWWLYD]LRQHLQYHUVLRQHSDU]LDOH$VHJXLWRGLRVWDFRORRDWWLYD]LRQHFRVWDVHQVLELOHO·DQWD
LQYHUWHFRPSOHWDPHQWHODPRYLPHQWD]LRQHSRUWDQGRVLLQSRVL]LRQHGLDSHUWRRFKLXVR
BLOCCO MOTORE:
Lc ËSRVVLELOHVHOH]LRQDUHO·XWLOL]]RGHOEORFFRPRWRUHGXUDQWHLOIXQ]LRQDPHQWRDEDWWHULD Y
Y LOEORFFRPRWRUHFRQWLQXDDIXQ]LRQDUHUHJRODUPHQWHDQFKHGXUDQWHLOIXQ]LRQD
PHQWRDEDWWHULD
n o TXDQGRVLSDVVDDOIXQ]LRQDPHQWRDEDWWHULDLOEORFFRPRWRUHULPDQHVHPSUH
DSHUWR
E721 11 532014 - Rev. D
Display Funzione Default 1
RICHIESTA ASSISTENZA - CONTACICLI (abbinata alle due funzioni successive):
AS no
ITALIANO

Y DOUDJJLXQJLPHQWRGHOQXPHURGLFLFOLLPSRVWDELOHFRQOHIXQ]LRQLVXFFHVVLYH nc H
nd HIIHWWXDXQSUHODPSHJJLRGLVHF ROWUHDTXHOORHYHQWXDOPHQWHJLjLPSRVWDWR
FRQODIXQ]LRQHPF SULPDGLRJQLPRYLPHQWD]LRQH
no OHIXQ]LRQLVXFFHVVLYHnc Hnd LQGLFDQRTXDQWLFLFOLKDHIIHWWXDWRO·LPSLDQWRILQRDG
XQPDVVLPRYLVXDOL]]DELOHGL99Ü990
6HLOQXPHURGLFLFOLHVHJXLWRqPDJJLRUHGLÜOHGXHIXQ]LRQLVXFFHV-
sive nc e nd visualizzeranno rispettivamente 99 e 99.
4XHVWDIXQ]LRQHSXzHVVHUHXWLOHSHULPSRVWDUHLQWHUYHQWLGLPDQXWHQ]LRQHSURJUDPPDWDR
SHUYHULILFDUHLFLFOLGLODYRURHVHJXLWL
PROGRAMMAZIONE CICLI (MIGLIAIA):
nc 6HAS  Y LOGLVSOD\LQGLFDLOQXPHURGLPLJOLDLDGLFLFOLGRSRLOTXDOHVLULFKLHGHO·DVVLVWHQ]D
00
LPSRVWDELOHGD0 D99 
6H AS   no LOGLVSOD\LQGLFDLOQXPHURGLPLJOLDLDGLFLFOLHVHJXLWL,OYDORUHYLVXDOL]]DWRVL
DJJLRUQDFRQLOVXVVHJXLUVLGHLFLFOLLQWHUDJHQGRFRQLOYDORUHGLnd 
Se AS = no premendo i tasti + e - per 5 sec. viene azzerato il contacicli.
PROGRAMMAZIONE CICLI (DECINE):
nd 6HAS  Y LOGLVSOD\LQGLFDLOQXPHURGLGHFLQHGLFLFOLGRSRLOTXDOHVLULFKLHGHO·DVVLVWHQ]D
00
LPSRVWDELOHGD0 D99 
6HAS  no LOGLVSOD\LQGLFDLOQXPHURGLGHFLQHGLFLFOLHVHJXLWL,OYDORUHYLVXDOL]]DWRVLDJ
JLRUQDFRQLOVXVVHJXLUVLGHLFLFOLLQWHUDJHQGRFRQLOYDORUHGLnc 
(VHPSLRVHO·LPSLDQWRKDHVHJXLWRÜYHUUjYLVXDOL]]DWR nc = 11 e
nd = 21
STATO DELL’AUTOMAZIONE:
St 8VFLWDGDOODSURJUDPPD]LRQHPHPRUL]]D]LRQHGHLGDWLHULWRUQRDOODYLVXDOL]]D]LRQHGHOORVWDWRGHOO·DXWRPD]LRQH
00  &+,862 07 )$,/6$)(LQFRUVR
01 $3(572 08 YHULILFDGLVSRVLWLYL%86($6<LQFRUVR
02  )HUPRSRL´$35(” 09 3UHODPSHJJLRSRL´$35(”
03  )HUPRSRL´&+,8'(” 10 3UHODPSHJJLRSRL´&+,8'(”
04 ,Q´3$86$” 11 $3(572LQ$SHUWXUD3DU]LDOH
05 ,QIDVHGLDSHUWXUD 12 ,Q3$86$$SHUWXUD3DU]LDOH
06 ,QIDVHGLFKLXVXUD

6 MEMORIZZAZIONE CODIFICA RADIO 6.1 MEMORIZZAZIONE DEI RADIOCOMANDI DS


/·DSSDUHFFKLDWXUDHOHW E’ possibile memorizzare max. 256 codici
WURQLFDqSURYYLVWDGLXQ )LJ divisi fra OPEN A e OPEN B/CLOSE.
VLVWHPD GL GHFRGLILFD
'6 6/+ /&5&  ELFD  6XOUDGLRFRPDQGR'6VFHJOLHUHODFRPELQD]LRQH21
QDOHLQWHJUDWRFKLDPD 2))GHVLGHUDWDGHLGLSVZLWFKHV
WR 201,'(& 4XHVWR   7HQHUHSUHPXWRLOSXOVDQWH+ 6: R- 6: HSRL
VLVWHPD SHUPHWWH GL SUHPHUH LO SXOVDQWH 6(783 6:  SHU PHPRUL]]DUH
PHPRUL]]DUH WUDPLWH ULVSHWWLYDPHQWH O·DSHUWXUD WRWDOH 23(1 $  R TXHOOD
XQ PRGXOR ULFHYHQWH SDU]LDOH 23(1%&/26( ,OOHGFRUULVSRQGHQWHLQL]LHUj
DJJLXQWLYR )LJ  ULI   H UDGLRFRPDQGL GHOOD VWHVVD DODPSHJJLDUHOHQWDPHQWHSHUVHF
IUHTXHQ]D VLD O·DSHUWXUD WRWDOH 23(1 $  VLD O·DSHUWXUD  5LODVFLDUHHQWUDPELLSXOVDQWH
SDU]LDOH 23(1% GHOO·DXWRPD]LRQH  (QWURTXHVWLVHFSUHPHUHLOSXOVDQWHGHVLGHUDWRVXO
Le 3 tipologie di codifica radio (DS, SLH, LC/ UDGLRFRPDQGR
RC) possono coesistere contemporanea-  ,OOHGFRUULVSRQGHQWHVLDFFHQGHUjILVVRSHUVHFRQGR
mente sui due canali. E’ possibile inserire SHUSRLVSHJQHUVLLQGLFDQGRO·DYYHQXWDPHPRUL]]D
fino a 256 codici radio suddivisi fra OPEN ]LRQH
A e OPEN B.  3HUDJJLXQJHUHDOWULFRGLFLGLIIHUHQWLGDTXHOORDSSHQD
Per utilizzare diversi sistemi di codifica sullo PHPRUL]]DWRULSHWHUHODSURFHGXUDGDOSXQWR
stesso canale occorre terminare l’appren-  3HU XWLOL]]DUH UDGLRFRPDQGL FRQ OR VWHVVR FRGLFH q
dimento di ciascun sistema e successiva- QHFHVVDULRFRSLDUHODVWHVVDFRPELQD]LRQH212))
mente ripetere la procedura per l’altro. VXJOLDOWULUDGLRFRPDQGLVHQ]DGRYHUPRGLILFDUHQXOOD
Non collegare alcun dispositivo radio su VXOODVFKHGDGLFRQWUROOR
apparecchiature configurate come SLAVE.

E721 12 532014 - Rev. D


6.2 MEMORIZZAZIONE DEI RADIOCOMANDI SLH 6.3 MEMORIZZAZIONE DEI RADIOCOMANDI LC/RC
E’ possibile memorizzare max. 256 codici, E’ possibile memorizzare max. 256 codici,

ITALIANO
divisi fra OPEN A ed OPEN B/CLOSE. divisi fra OPEN A ed OPEN B/CLOSE.

Utilizzare i telecomandi LC/RC solo con


 6XO UDGLRFRPDQGR 6/+ SUHPHUH H WHQHUH SUHPXWL L modulo ricevente a 433 MHz.
SXOVDQWL3H3FRQWHPSRUDQHDPHQWH
 ,OOHGGHOUDGLRFRPDQGRLQL]LHUjDODPSHJJLDUH  7HQHUHSUHPXWRLOSXOVDQWH+ 6: R- 6: HSRL
SUHPHUH LO SXOVDQWH 6(783 6:  SHU PHPRUL]]DUH
 /DVFLDUHHQWUDPELLSXOVDQWL
ULVSHWWLYDPHQWH O·DSHUWXUD WRWDOH 23(1 $  R TXHOOD
 7HQHUHSUHPXWRLOSXOVDQWH+ 6: R- 6: HSRL SDU]LDOH 23(1%&/26( ,OOHGFRUULVSRQGHQWHLQL]LHUj
SUHPHUH LO SXOVDQWH 6(783 6:  SHU PHPRUL]]DUH DODPSHJJLDUHOHQWDPHQWHSHUVHF
ULVSHWWLYDPHQWH O·DSHUWXUD WRWDOH 23(1 $  R TXHOOD
 5LODVFLDUHLOSXOVDQWH
SDU]LDOH 23(1%&/26( ,OOHGFRUULVSRQGHQWHLQL]LHUj
DODPSHJJLDUHOHQWDPHQWHSHUVHF  (QWURTXHVWLVHFSUHPHUHLOSXOVDQWHGHVLGHUDWRVXO
WHOHFRPDQGR/&5&
 5LODVFLDUHHQWUDPELLSXOVDQWL
 ,OOHGVLDFFHQGHUjDOXFHILVVDSHUVHFRQGRLQGL
 (QWURTXHVWLVHFPHQWUHLOOHGGHOUDGLRFRPDQGRVWD
FDQGRO·DYYHQXWDPHPRUL]]D]LRQHSHUSRLULSUHQGHUH
DQFRUD ODPSHJJLDQGR SUHPHUH H WHQHUH SUHPXWR
DODPSHJJLDUHSHUDOWULVHFGXUDQWHLTXDOLVLSXz
LO SXOVDQWH GHVLGHUDWR VXO UDGLRFRPDQGR LO OHG GHO
PHPRUL]]DUHXQDOWURUDGLRFRPDQGR
UDGLRFRPDQGRVLDFFHQGHUjDOXFHILVVD 
 7HUPLQDWL L  VHF LO OHG VL VSHJQH LQGLFDQGR OD ILQH
 ,O OHG VXOOD VFKHGD VL DFFHQGHUj D OXFH ILVVD SHU 
GHOODSURFHGXUD
VHFRQGR SHU SRL VSHJQHUVL LQGLFDQGR O·DYYHQXWD
PHPRUL]]D]LRQH 6.3.1 MEMORIZZAZIONE REMOTA RADIOCOMANDI LC/RC
 5LODVFLDUHLOSXOVDQWHGHOUDGLRFRPDQGR
 3UHPHUHSHUYROWHLQEUHYHVXFFHVVLRQHLOSXOVDQWH &RQ UDGLRFRPDQGL /&5& VL SRVVRQR PHPRUL]]DUH DOWUL
GHOUDGLRFRPDQGRPHPRUL]]DWR UDGLRFRPDQGL LQ PRGR UHPRWR FLRq VHQ]D LQWHUYHQLUH
GLUHWWDPHQWHVXOODVFKHGDXWLOL]]DQGRXQUDGLRFRPDQGR
L’automazione effettuerà una apertura. SUHFHGHQWHPHQWHPHPRUL]]DWR
Accertarsi che l’automazione sia libera da  3URFXUDUVLXQUDGLRFRPDQGRJLjPHPRUL]]DWRVXXQR
ogni ostacolo creato da persone o cose. GHLFDQDOL 23(1$R23(1%&/26( 
3HU DELOLWDUH DOWUL UDGLRFRPDQGL FRQ OR VWHVVR FRGLFH  3UHPHUHHWHQHUHSUHPXWLLSXOVDQWL3H3FRQWHP
LPSLDQWR q QHFHVVDULR WUDVIHULUH LO FRGLFH LPSLDQWR GHO SRUDQHDPHQWHILQRDTXDQGRHQWUDPELLOHGODPSHJ
SXOVDQWHGHOUDGLRFRPDQGRPHPRUL]]DWRDOSXOVDQWHFRU JHUDQQROHQWDPHQWHSHUVHF
ULVSRQGHQWHGHLUDGLRFRPDQGLGDDJJLXQJHUHVHJXHQGR  (QWUR  VHF SUHPHUH LO SXOVDQWH SUHFHGHQWHPHQWH
ODVHJXHQWHSURFHGXUD PHPRUL]]DWRGHOUDGLRFRPDQGRSHUDWWLYDUHODIDVH
D 6XO UDGLRFRPDQGR PHPRUL]]DWR SUHPHUH H GLDSSUHQGLPHQWRVXOFDQDOHVHOH]LRQDWR
WHQHUH SUHPXWL L SXOVDQWL 3 H 3 FRQWHPSRUD  ,OOHGVXOODVFKHGDFRUULVSRQGHQWHDOFDQDOHLQDSSUHQ
QHDPHQWH GLPHQWRODPSHJJLDSHUVHFHQWURLTXDOLVLGHYH
E ,OOHGGHOUDGLRFRPDQGRLQL]LHUjDODPSHJJLDUH WUDVPHWWHUHLOFRGLFHGLXQDOWURUDGLRFRPDQGR
F /DVFLDUHHQWUDPELLSXOVDQWL  ,OOHGVLDFFHQGHDOXFHILVVDSHUVHFLQGLFDQGR
G 3UHPHUH LO SXOVDQWH PHPRUL]]DWR H WHQHUOR SUH O·DYYHQXWD PHPRUL]]D]LRQH SHU SRL ULSUHQGHUH D
PXWR LOOHGGHOUDGLRFRPDQGRVLDFFHQGHUjD ODPSHJJLDUH SHU  VHF GXUDQWH L TXDOL VL SRVVRQR
OXFHILVVD  PHPRUL]]DUHDOWULUDGLRFRPDQGLHGLQILQHVSHJQHUVL
H $YYLFLQDUH L UDGLRFRPDQGL SUHPHUH H WHQHUH 6.4 PROCEDURA DI CANCELLAZIONE DEI RADIOCOMANDI
SUHPXWRLOSXOVDQWHFRUULVSRQGHQWHGHOUDGLRFR
PDQGRGDDJJLXQJHUHULODVFLDQGRORVRORGRSR
LOGRSSLRODPSHJJLRGHOOHGGHOUDGLRFRPDQGR 3HUFDQFHOODUHTUTTILFRGLFLGHLUDGLRFRPDQGLLQVHULWLq
FKHLQGLFDO·DYYHQXWDPHPRUL]]D]LRQH VXIILFLHQWHWHQHUSUHPXWLLQVLHPHLGXHSXOVDQWL+ 6: H-
I 3UHPHUHSHUYROWHLOSXOVDQWHGHOUDGLRFRPDQGR 6: SRLSUHPHUHSHUXQVHFRQGRLOSXOVDQWH6(783 6: 
PHPRUL]]DWRLQEUHYHVXFFHVVLRQH HPDQWHQHUHSUHPXWLLSULPLGXHSXOVDQWLSHUVHF
‡ ,  OHGV 5$',2 H 5$',2 ODPSHJJHUDQQR YHORFH
L’automazione effettuerà una apertura.
PHQWHSHULVHF
Accertarsi che l’automazione sia libera da
ogni ostacolo creato da persone o cose. ‡ ,OHGVVLDFFHQGHUDQQRDOXFHILVVDSHUVHFSHU
SRLVSHJQHUVL FDQFHOOD]LRQHHIIHWWXDWD 
‡ 5LODVFLDUHHQWUDPELLSXOVDQWL
Questa operazione NON è reversibile. Si
cancelleranno tutti i codici dei radiocoman-
di memorizzati sia come OPEN A che come
OPEN B/CLOSE.

E721 13 532014 - Rev. D


7 MESSA IN FUNZIONE
7.1 VERIFICA DEI LEDS
ITALIANO

'RSRDYHUHVHJXLWRWXWWLLFROOHJDPHQWLHGDOLPHQWDWRODVFKHGDYHULILFDUHFRQODWDEHOODVRWWRVWDQWHORVWDWRGHLOHGV
LQUHOD]LRQHDOORVWDWRGHJOLLQJUHVVL LQILJODFRQGL]LRQHGLDXWRPD]LRQHFKLXVDDULSRVR 
7DOL /(' LQGLFDQR OR VWDWR GHJOL LQJUHVVL GHOOD VFKHGD H VRQR GL LPSRUWDQ]D ULOHYDQWH DL ILQL GHOOD PRYLPHQWD]LRQH
GHOO·DXWRPDWLVPR
1RWDUHFKH  LED ACCESO FRQWDWWRFKLXVR  LED SPENTO FRQWDWWRDSHUWR

< (1) F
BUS 2EASY
< (2)
< OPEN A -
< GND
< OPEN B / CLOSE < SAFE
+

R
A
C

1
RADIO XF

R
2
IO

E
FC
FC

IO

O
< STOP / SAFE

W
R
D

O
R
A

P
R
< FSW OP

R
SETUP
< GND
< FSW CL
< +24

USB

BATTERY
RELEASE
Y
R
)

R
F

OUT
-L

E
S

S
E IN

TO
R M

K
K
K
T
-N

N
T EC

C
T
T RI

C
C
(P A

- +
A

LO
LA

LO
LO
M

R
P

M
B
<

<

<

<

<

<

<
<
<

)LJ

,OHG)&$H)&&UDSSUHVHQWDQRLFRQWDWWL1&'HOILQH Gli ingressi STOP (SAFE), FSW CL, FSW OP, OPEN
FRUVDLQWHJUDWRVXOODVFKHGDFKHVHLPSHJQDWLVLDSURQR B configurato come SAFE sono ingressi di
VSHJQHQGRGLFRQVHJXHQ]DLOOHGUHODWLYR sicurezza con contatto N.C. (Normalmente
Chiuso) e quindi i led corrispondenti devono
essere ACCESI in condizione di automatismo
)&$ a riposo, si spegneranno all’impegno del
$XWRPD]LRQH&+,86$
)&&  )&&LPSHJQDWR dispositivo connesso.
Gli ingressi OPEN A, OPEN B/CLOSE sono
)&$  )&$LPSHJQDWR ingressi con contatto N.A. (Normalmente
$XWRPD]LRQH$3(57$ Aperto) e quindi i led corrispondenti devono
)&&
essere SPENTI in condizione di automatismo
a riposo, si accenderanno all’impegno del
Tab. 3 - Descrizione led POWER dispositivo connesso.
In caso di apparecchiatura programmata
Acceso fisso $OLPHQWD]LRQHGLUHWHSUHVHQWH come SLAVE i led corrispondenti alla morset-
tiera J13 dovranno essere spenti.
Lampeggiante $OLPHQWD]LRQHDEDWWHULD Led ERROR lampeggiante indica allarme
in corso (situazione non pregiudicante il
Spento 6FKHGDVSHQWD funzionamento del cancello)
Led ERROR acceso fisso indica errore in
corso (situazione che blocca il funziona-
7.2 FUNZIONAMENTO A BATTERIA mento fino alla eliminazione della causa
dell’errore)
ATTENZIONE
3HURWWLPL]]DUHLFRQVXPLHVDOYDJXDUGDUQHODFDULFDGXUDQWHLOIXQ]LRQDPHQWRDEDWWHULDDGDXWRPD]LRQHIHUPDH
VLVWHPDLQVWDQGE\LOGLVSOD\/&'LOOHG%86HDV\HLOHG)&&H)&$ULVXOWDQRVSHQWLPHQWUHLOOHG32:(5ODPSHJJLD
,QTXHVWDIDVHqFRPXQTXHSRVVLELOHYLVXDOL]]DUHORVWDWRGHOO·DXWRPD]LRQH3HUIDUORqVXIILFLHQWHSUHPHUHEUHYHPHQWH
LOWDVWR+SUHVHQWHVXOODVFKHGD6XFFHVVLYDPHQWHDTXHVWDEUHYHSUHVVLRQHLOGLVSOD\/&'PRVWUDSHUFLUFDVHFRQGL
ORVWDWRGHOO·DXWRPD]LRQHSHUSRLVSHJQHUVLQXRYDPHQWH'XUDQWHXQDQRUPDOHPRYLPHQWD]LRQHLQYHFHWXWWLLOHG
GLGLDJQRVWLFDHOHVHJQDOD]LRQLGLVWDWRGHOGLVSOD\ULWRUQDQRFRHUHQWLFRQORVWDWRGHOO·DXWRPD]LRQH YHGL)LJ 

E721 14 532014 - Rev. D


7.3 POSIZIONAMENTO DEI FINECORSA
Per un corretto posizionamento dei magneti di finecorsa è necessario che la centrale di comando

ITALIANO
sia installata e collegata correttamente con tutti gli accessori di comando e sicurezza .
/·RSHUDWRUHqGRWDWRGLXQVHQVRUHPDJQHWLFRGLILQHFRUVDLQWHJUDWRGLUHWWDPHQWHVXOODVFKHGDHOHWWURQLFDGLFRPDQGR
/·DUUHVWRGHOFDQFHOORLQDSHUWXUDRLQFKLXVXUDDYYLHQHQHOPRPHQWRLQFXLLOPDJQHWHSRODUL]]DWRILVVDWRQHOODSDUWH
VXSHULRUHGHOODFUHPDJOLHUDDWWLYDLOVHQVRUH
 9HULILFDUHFKHO·RSHUDWRUHVLDVWDWRSUHGLVSRVWRSHULOIXQ]LRQDPHQWRPDQXDOHFRPHGD
LVWUX]LRQLGHOO·RSHUDWRUH
 3RUWDUHPDQXDOPHQWHLOFDQFHOORLQSRVL]LRQHG·aperturaODVFLDQGRPPGDOO·DUUHVWR
PHFFDQLFRGLILQHFRUVD YHGL)LJ 
 )DUVFRUUHUHVXOODFUHPDJOLHUDLOPDJQHWHFROTONDOQHOODGLUH]LRQHGHOPRWRUH$SSHQD

A
C

R O1

2
FC
FC

IO
LOOHGUHODWLYRDOILQHFRUVD)&$SUHVHQWHVXOODVFKHGDVLVSHJQHILVVDUORFRQOHDSSRVLWH

I
D

R
A

A
YLWL

E
R
 3RUWDUHPDQXDOPHQWHLOFDQFHOORLQSRVL]LRQHGLchiusuraODVFLDQGRPPGDOO·DUUHVWR
PHFFDQLFRGLILQHFRUVD
 )DU VFRUUHUH VXOOD FUHPDJOLHUD LO PDJQHWH FRO QUADRATO QHOOD GLUH]LRQH GHO PRWRUH
$SSHQDLOOHGUHODWLYRDOILQHFRUVD)&&SUHVHQWHVXOODVFKHGDVLVSHJQHILVVDUORFRQOH
DSSRVLWHYLWL

A
C

R O1

2
FC
FC

IO
 &RQWUROODUHFKHDILQHPDQRYUDVLDLQDSHUWXUDFKHLQFKLXVXUDLOOHGGHOULVSHWWLYRILQHFRUVD

I
D

R
A

E
VLVSHQJDFRUUHWWDPHQWHHQHOFDVRDSSRUWDUHOHRSSRUWXQHPRGLILFKHDOODSRVL]LRQHGHL

R
PDJQHWLGLILQHFRUVD
Per evitare danneggiamenti dell’operatore e/o interruzioni del funzionamento
dell’automazione è necessario lasciare circa 40 mm dagli arresti meccanici
di finecorsa.

Per un corretto fun-


zionamento dell’o-
peratore il magnete
raffigurante il TONDO
deve essere utilizzato
come finecorsa di
APERTURA e il magne-
te con il QUADRATO
deve essere utilizzato
come finecorsa di
CHIUSURA
(VEDI FIG. 17)
In caso di impianto
con configurazione
MASTER/SLAVE i ma-
gneti dei finecorsa
dovranno essere in-
stallati come in Fig.
18.

)LJ

MASTER/SLAVE

)LJ

E721 15 532014 - Rev. D


7.4 CONFIGURAZIONI MASTER / SLAVE
(·SRVVLELOHQHOFDVRVLDQHFHVVDULRUHDOL]]DUHXQLPSLDQWRFRQDQWHFRQWUDSSRVWHGDD]LRQDUHFRQWHPSRUDQHDPHQWH
ITALIANO

SHUO·DSHUWXUDHODFKLXVXUDGHOYDUFRFROOHJDUHHFRQILJXUDUHGXHDSSDUHFFKLDWXUH(LQPRGDOLWj0DVWHU6ODYH
/·DSSDUHFFKLDWXUD0$67(5 SDUDPHWURC t GHOSULPROLYHOORGLSURJUDPPD]LRQHFRQILJXUDWRFRPHM A GRYUjDYHUH
WXWWLLFROOHJDPHQWLQHFHVVDULDOFRUUHWWRIXQ]LRQDPHQWRGHOO·LPSLDQWR IRWRFHOOXOHVLFXUH]]HUDGLRLPSXOVLGLDSHUWXUD
ODPSHJJLDQWH PHQWUHO·DSSDUHFFKLDWXUD6/$9( SDUDPHWURC t GHOSULPROLYHOORGLSURJUDPPD]LRQHFRQILJXUDWRFRPH
S L QRQGRYUjDYHUHQHVVXQWLSRGLFDEODJJLRQHOODPRUVHWWLHUD-GDWRFKHYHQJRQRLJQRUDWLFRPSOHWDPHQWH
JOLLQJUHVVLSUHVHQWL/HGXHDSSDUHFFKLDWXUHFRPXQLFKHUDQQRWUDGLORURDWWUDYHUVRLO%86($6<WUDPLWHXQFDEODJJLR
DGXHSROLPOLARIZZATOVXOODPRUVHWWLHUD-
/·DSSDUHFFKLDWXUD0$67(5FRQWUROOHUjFRPSOHWDPHQWHO·DSSDUHFFKLDWXUD6/$9(WUDPLWHLO%86($6<HJHVWLUjWXWWHOH
PRYLPHQWD]LRQLHLWHPSLGLHQWUDPEHOHDQWH

Evitare qualsiasi tipo di collegamento e cablaggio sulla morsettiera J13 della centrale SLAVE

Il collegamento BUS tra le due schede dovrà essere POLARIZZATO rispettando la sequenza dei
poli della morsettiera J12 (POLO (1) - POLO (2)) - (vedi Fig. 19).

Configurando una centrale come SLAVE vengono forzati i valori di alcuni parametri di program-
mazione non più visualizzati nel menù (LO-PA-Pb-Ph-Op). RIportando la scheda in modalità
MASTER questi valori, forzati precedentemente, vengono mantenuti all’interno della programma-
zione.
7.4.1 CABLAGGI MASTER/SLAVE

(1) (1)
BUS 2 EASY BUS 2 EASY
(2) (2)
1RQHIIHWWXDUHDOFXQ
FROOHJDPHQWRD
TXHVWDPRUVHWWLHUD

E721 MASTER E721 SLAVE


)LJ

7.4.2 PROCEDURA DI SETUP MASTER/SLAVE

La richiesta di SETUP tramite il lampeggio della sigla S0 sul display può presentarsi sia sulla cen-
trale MASTER che sulla centrale SLAVE. Nel secondo caso sulla centrale MASTER comparirà un
errore 91 . In ogni caso l’avvio di una procedura di SETUP potrà essere effettuato solamente dalla
centrale MASTER.

3HUHVHJXLUHLO6(783LQXQLPSLDQWR0$67(56/$9(VHJXLUHLSDVVDJJLVHJXHQWL

 6EORFFDUHHQWUDPEHOHDQWHSRUWDUOHDPHWjGHOODFRUVDHULEORFFDUOH YHGLSURFHGXUDQ3DU6(783


 7HQHUHSUHPXWRLOSXOVDQWH6(783GHOODVFKHGD0$67(5ILQFKqLOFDQFHOOR0$67(5LQL]LDLOPRYLPHQWR
 ,OFDQFHOOR0$67(5DTXHVWRSXQWRHIIHWWXDXQDSURFHGXUDFRPSOHWDGL6(783 YHGL3DU6(783
 8QDYROWDWHUPLQDWRFRUUHWWDPHQWHLO6(783GHOODVFKHGD0$67(5LQL]LDODSURFHGXUDFRPSOHWDGL6(783GHOOD
VFKHGD6/$9( YHGL3DU6(783 
 7HUPLQDWDDQFKHTXHVWDSURFHGXUDOD0$67(5YHULILFDODSRVL]LRQHGHOO·DQWD6/$9(HODSRUWDQHOODVWHVVDSRVL]LRQH
DSHUWRRFKLXVR GHOO·DQWD0$67(5
 3URFHGXUDFRPSOHWDWD

In caso di errore o non completamento della procedura di SETUP sopra descritta sarà necessario
ripeterla completamente partendo dal punto n.1.

E721 16 532014 - Rev. D


7.5 SETUP 9 SEGNALAZIONE ALLARMI ED ERRORI
Alimentando la scheda se non è mai 1HO FDVR VL YHULILFKLQR allarmi FRQGL]LRQL QRQ SUHJLXGL
FDQWHLOIXQ]LRQDPHQWRGHOFDQFHOOR Rerrori FRQGL]LRQL

ITALIANO
stato eseguito un SETUP, o se la scheda lo
richiede, sul display lampeggia la sigla FKHKDQQREORFFDWRLOIXQ]LRQDPHQWRGHOFDQFHOOR VXO
S0 assieme al led SETUP ad indicare che GLVSOD\qSRVVLELOHYHGHUHLOQXPHURUHODWLYRDOODFRQGL
è necessario eseguire il SETUP. ]LRQHLQHVVHUH
Le segnalazioni di ALLARME o ERRORE spa-
Per il buon esito della procedura di SETUP
riranno al ciclo successivo solo se verrà
verificare accuratamente la corretta pola-
rimossa la causa scatenante.
rità dei finecorsa magnetici come descritto
il paragrafo precedente. 9.1 ALLARMI
3HUHVHJXLUHLO6(783VHJXLUHLSDVVDJJLVHJXHQWL Quando si verifica un ALLARME il led ERROR
inizia a lampeggiare e premendo contem-
1. Portare il cancello a metà della corsa (molto im-
poraneamente i tasti + e - sul display verrà
portante per la riuscita del SETUP) e verificare che visualizzato il numero relativo all’anomalia
entrambi i led FCA e FCC siano accesi. In caso con- in corso.
trario la scheda segnalerà errore 12 (vedi tab. 5)
,Q 7DE  VRQR LQGLFDWL WXWWL JOL DOODUPL YLVXDOL]]DELOL D GL
 7HQHUSUHPXWRLOSXOVDQWH6(783 6: ILQFKpLOFDQFHOOR
VSOD\
LQL]LDLOPRYLPHQWRUDOOHQWDWRIHUPDQGRVLDOUDJJLXQ
JLPHQWR GHO ILQHFRUVD 6H LO ILQHFRUVD UDJJLXQWR q Tab. 4 - Allarmi
TXHOORGLFKLXVXUD FROQUADRATO O·DSSDUHFFKLDWXUD 22 &RUUHQWH02725(OLPLWDWD
PHPRUL]]HUj TXHO SXQWR FRPH DUUHVWR LQ chiusura
YLFHYHUVD VH LO ILQHFRUVD q TXHOOR GL DSHUWXUD FRQ 24 8VFLWD/$03LQFRUWRFLUFXLWR
TONDO O·DSSDUHFFKLDWXUDPHPRUL]]HUjTXHOSXQWR 27 5LOHYD]LRQHRVWDFROR YLVLELOHSHUVHF
FRPHDUUHVWRLQapertura,QTXHVWDIDVHVXOGLVSOD\ 0HPRULDFRGLFLUDGLR;)PRGXOHSLHQD YLVL
ODPSHJJLDS 1
30 ELOHSHUVHF
 ,O FDQFHOOR LQL]LD DXWRPDWLFDPHQWH LO PRYLPHQWR 40 5LFKLHVWD$VVLVWHQ]D
UDOOHQWDWRQHOODGLUH]LRQHRSSRVWDIHUPDQGRVLDOUDJ
JLXQJLPHQWRGHOILQHFRUVD6HLOILQHFRUVDUDJJLXQWR
46 5LSULVWLQRIRU]DWRSURJUDPPD]LRQHGHIDXOW

VDUjTXHOORGLDSHUWXUD FROTONDO O·DSSDUHFFKLDWXUD 9.2 ERRORI


PHPRUL]]HUj TXHO SXQWR FRPH DUUHVWR LQ apertura
YLFHYHUVDVHLOILQHFRUVDVDUjTXHOORGLFKLXVXUD FRQ Quando si verifica un ERRORE il led DL20 si
QUADRATO  O·DSSDUHFFKLDWXUD PHPRUL]]HUj TXHO accende a luce fissa e premendo contem-
poraneamente i tasti + e - sul display verrà
SXQWR FRPH DUUHVWR LQ chiusura ,Q TXHVWD IDVH VXO
visualizzato il numero relativo all’anomalia
GLVSOD\ODPSHJJLDS 3 in corso.
 $VHFRQGDGHOO·XOWLPRILQHFRUVDUDJJLXQWRO·DSSDUHF
,Q7DEVRQRLQGLFDWLWXWWLJOLHUURULYLVXDOL]]DELOLDGLVSOD\
FKLDWXUDVLSRUUjQHOORVWDWRGLFKLXVR 0 0 RGLDSHUWR
0 1 1HOVHFRQGRFDVRGDUHXQLPSXOVRGL23(1SHU Tab. 5 - Errori
IDUFKLXGHUHLOFDQFHOOR 01 6FKHGDJXDVWD
03 0RWRUHJXDVWR
%ORFFRPRWRUHEORFFDWRFKLXVR FRQWUROODUHLO
8 PROVA DELL’AUTOMAZIONE 06 EORFFRPRWRUHHGHYHQWXDOPHQWHVRVWLWXLUOR
$OWHUPLQHGHOO·LQVWDOOD]LRQHHSURJUDPPD]LRQHFRQWUROODUH &DQFHOORWURSSRSHVDQWHRDWWULWLHOHYDWL SUR
LOFRUUHWWRIXQ]LRQDPHQWRGHOO·LPSLDQWR9HULILFDUHVRSUDWWXW 07 YDUHDGDXPHQWDUHODIRU]DPRWRUH
WRLOFRUUHWWRLQWHUYHQWRGHLGLVSRVLWLYLGLVLFXUH]]DHYHULILFDUH (UURUHGLVSRVLWLYR%86($6< HVVWHVVRLQGLUL]]R
FKHO·LPSLDQWRVRGGLVILOHYLJHQWLQRUPHGLVLFXUH]]D 08 VXGXHFRSSLHGLIRWRFHOOXOHYHULILFDUHLQGLUL]]L
RIcordiamo che nel secondo livello di pro- 10 (QWUDPELILQHFRUVDFRQODVWHVVDSRODULWj
grammazione è disponibile il parametro di 12 )LQHFRUVDLPSHJQDWRDLQL]LR6(783
configurazione dell’encoder (parametro
EC ). Questo encoder “virtuale”presente 15 7LPHRXWHVDXULWR
sulla scheda funziona come dispositivo 1HVVXQDFRPXQLFD]LRQHFRQODFHQWUDOH
antischiacciamento. Nel caso il cancello,
90 6/$9(FHQWUDOH6/$9(PDQFDQWH
durante la fase di apertura o chiusura, urti 91 (UURUHVXOODFHQWUDOH6/$9(
contro ad un ostacolo, l’encoder “virtuale”
provocherà l’inversione della movimen- 92 (UURUHVXOODFHQWUDOH6/$9(
tazione. Alla movimentazione successiva Gli errori 9 0 9 1 e 9 2 sono visualizzati
nella stessa direzione, un ostacolo nella solo su E721 configurate come MASTER e
stessa posizione provocherà l’arresto del in particolare il 9 1 e il 9 2 indicano errori
motore. E’ fondamentale configurare presenti sulla centrale SLAVE. E’ consiglia-
correttamente questo parametro per to in caso di vizualizzazione di tali errori
regolare la giusta sensibilità dell’encoder verificare sulla centrale SLAVE il tipo di
“virtuale” agli eventuali ostacoli durante il errore visualizzato sul display per risolver-
moto. lo e ripristinare il corretto funzionamento
dell’impianto.
E721 17 532014 - Rev. D
10 LOGICHE DI FUNZIONAMENTO
Tra parentesi gli effetti sugli altri ingressi a impulso Il comando SAFE se attivato durante la movimenta-
ITALIANO

attivo zione dell’anta ne provoca l’inversione immediata


Il comando CLOSE è attivabile sull’ingresso OPEN e totale. Ad automazione ferma se mantenuto
B dal 2° liv. di programmazione attivo ne impedisce la movimentazione
LOGICA “E” ,038/6,
STATO AUTOMAZIONE OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP

CHIUSO DSUHLOFDQFHOOR DSUHLOFDQFHOORSDU]LDO QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR


PHQWH 23(1LQLELWR 23(1LQLELWR 23(1LQLELWR

EORFFDHDOGLVLPSHJQR
IN APERTURA EORFFDLOIXQ]LRQDPHQWR  EORFFDLOIXQ]LRQDPHQWR ULFKLXGHLOFDQFHOOR EORFFDLOIXQ]LRQDPHQWR YHGLSURJƒOLY QHVVXQHIIHWWR DSUH 23(1EORFFD
PHPRUL]]D&/26(

APERTO ULFKLXGHLOFDQFHOOR  ULFKLXGHLOFDQFHOOR ULFKLXGHLOFDQFHOOR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR


23(1&/26(LQLELWL &/26(LQLELWR 23(1&/26(LQLELWL

IN CHIUSURA ULDSUHLOFDQFHOOR ULDSUHLOFDQFHOOR QHVVXQHIIHWWR EORFFDLOIXQ]LRQDPHQWR QHVVXQHIIHWWR LQYHUWHLQDSHUWXUD YHGL EORFFDHDOGLVLPSHJQR


DSUH 23(1EORFFD
SURJƒOLY  PHPRUL]]D&/26(

BLOCCATO FKLXGHLOFDQFHOOR FKLXGHLOFDQFHOOR FKLXGHLOFDQFHOOR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR 23(1EORF


23(1&/26(LQLELWL 23(1LQLELWR &/26(LQLELWR FDPHPRUL]]D&/26(

LOGICA “EP” ,038/6,


STATO AUTOMAZIONE OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP

CHIUSO DSUHLOFDQFHOOR DSUHLOFDQFHOORSDU]LDO QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR


PHQWH 23(1LQLELWR 23(1LQLELWR 23(1LQLELWR

EORFFDHDOGLVLPSHJQR
IN APERTURA EORFFDLOIXQ]LRQDPHQWR  EORFFDLOIXQ]LRQDPHQWR ULFKLXGHLOFDQFHOOR EORFFDLOIXQ]LRQDPHQWR YHGLSURJƒOLY QHVVXQHIIHWWR DSUH 23(1EORFFD
PHPRUL]]D&/26(

APERTO ULFKLXGHLOFDQFHOOR  ULFKLXGHLOFDQFHOOR ULFKLXGHLOFDQFHOOR QHVVXQHIIHWWR QHVVXQHIIHWWR 1HVVXQHIIHWWR QHVVXQHIIHWWR


23(1&/26(LQLELWL &/26(LQLELWR 23(1&/26(LQLELWL

IN CHIUSURA EORFFDLOIXQ]LRQDPHQWR EORFFDLOIXQ]LRQDPHQWR QHVVXQHIIHWWR EORFFDLOIXQ]LRQDPHQWR QHVVXQHIIHWWR LQYHUWHLQDSHUWXUD YHGL EORFFDHDOGLVLPSHJQR


DSUH 23(1EORFFD
SURJƒOLY  PHPRUL]]D&/26(
ULSUHQGHLOPRWRLQVHQVR ULSUHQGHLOPRWRLQVHQVR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR 23(1EORF
BLOCCATO LQYHUVR'RSR6723FKLXGH LQYHUVR'RSR6723FKLXGH FKLXGHLOFDQFHOOR 23(1&/26(LQLELWL 23(1LQLELWR &/26(LQLELWR FDPHPRUL]]D&/26(
VHPSUH VHPSUH
LOGICA “A” ,038/6,
STATO AUTOMAZIONE OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP

DSUHHULFKLXGHGRSRLO DSUHLOFDQFHOORSDU]LDO QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR


CHIUSO WHPSRSDXVD PHQWHHFKLXGHGRSRLO QHVVXQHIIHWWR 23(1LQLELWR 23(1LQLELWR QHVVXQHIIHWWR 23(1LQLELWR
WHPSRSDXVD%
EORFFDHDOGLVLPSHJQR
IN APERTURA QHVVXQHIIHWWR  QHVVXQHIIHWWR ULFKLXGHLOFDQFHOOR EORFFDLOIXQ]LRQDPHQWR YHGLSURJƒOLY QHVVXQHIIHWWR DSUH
PHPRUL]]D&/26(

APERTO IN PAUSA ULFDULFDLOWHPSRSDXVD  ULFDULFDLOWHPSRSDXVD% ULFKLXGHLOFDQFHOOR EORFFDLOIXQ]LRQDPHQWR QHVVXQHIIHWWR ULFDULFDLOWHPSRSDXVD ULFDULFDLOWHPSRSDXVD


&/26(LQLELWR &/26(LQLELWR

IN CHIUSURA ULDSUHLOFDQFHOOR ULDSUHLOFDQFHOOR QHVVXQHIIHWWR EORFFDLOIXQ]LRQDPHQWR QHVVXQHIIHWWR LQYHUWHLQDSHUWXUD YHGL EORFFDHDOGLVLPSHJQR


DSUH
SURJƒOLY  PHPRUL]]D&/26(

BLOCCATO FKLXGHLOFDQFHOOR FKLXGHLOFDQFHOOR FKLXGHLOFDQFHOOR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR


23(1&/26(LQLELWL 23(1LQLELWR &/26(LQLELWR 23(1&/26(LQLELWL

LOGICA “A1” ,038/6,


STATO AUTOMAZIONE OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP

DSUHHULFKLXGHGRSRLO DSUHLOFDQFHOORSDU]LDO QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR


CHIUSO WHPSRSDXVD PHQWHHFKLXGHGRSRLO QHVVXQHIIHWWR 23(1LQLELWR 23(1LQLELWR QHVVXQHIIHWWR 23(1LQLELWR
WHPSRSDXVD%

FRQWLQXDDGDSULUHH EORFFDHDOGLVLPSHJQR
IN APERTURA QHVVXQHIIHWWR  QHVVXQHIIHWWR ULFKLXGHLOFDQFHOOR EORFFDLOIXQ]LRQDPHQWR YHGLSURJƒOLY
ULFKLXGHVXELWR DSUH
PHPRUL]]D&/26(

APERTO IN PAUSA ULFDULFDLOWHPSRSDXVD  ULFDULFDLOWHPSRSDXVD% ULFKLXGHLOFDQFHOOR EORFFDLOIXQ]LRQDPHQWR QHVVXQHIIHWWR EORFFDHDOGLVLPSHJQR ULFDULFDLOWHPSRSDXVD


FKLXGHVXELWR &/26(LQLELWR

IN CHIUSURA ULDSUHLOFDQFHOOR ULDSUHLOFDQFHOOR QHVVXQHIIHWWR EORFFDLOIXQ]LRQDPHQWR QHVVXQHIIHWWR LQYHUWHLQDSHUWXUD YHGL EORFFDHDOGLVLPSHJQR


DSUH
SURJƒOLY  PHPRUL]]D&/26(

BLOCCATO FKLXGHLOFDQFHOOR FKLXGHLOFDQFHOOR FKLXGHLOFDQFHOOR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR


23(1&/26(LQLELWL 23(1LQLELWR &/26(LQLELWR 23(1&/26(LQLELWL
 'XUDQWHLOFLFORGLDSHUWXUDSDU]LDOHXQLPSXOVRGL23(1$SURYRFDO·DSHUWXUDWRWDOH
E721 18 532014 - Rev. D
LOGICA “AP” ,038/6,
STATO AUTOMAZIONE OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP
DSUHLOFDQFHOORSDU]LDO

ITALIANO
CHIUSO DSUHHULFKLXGHGRSRLO PHQWHHFKL XGHGRSRLO QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR
WHPSRSDXVD WHPSRSDXVD% 23(1LQLELWR 23(1LQLELWR 23(1LQLELWR

EORFFDHDOGLVLPSHJQR
IN APERTURA EORFFDLOIXQ]LRQDPHQWR  EORFFDLOIXQ]LRQDPHQWR ULFKLXGHLOFDQFHOOR EORFFDLOIXQ]LRQDPHQWR YHGLSURJƒOLY QHVVXQHIIHWWR DSUH 23(1EORFFD
PHPRUL]]D&/26(

APERTO IN PAUSA EORFFDLOIXQ]LRQDPHQWR  EORFFDLOIXQ]LRQDPHQWR ULFKLXGHLOFDQFHOOR EORFFDLOIXQ]LRQDPHQWR QHVVXQHIIHWWR ULFDULFDLOWHPSRSDXVD ULFDULFDLOWHPSRSDXVD


&/26(LQLELWR &/26(LQLELWR

IN CHIUSURA ULDSUHLOFDQFHOOR ULDSUHLOFDQFHOOR QHVVXQHIIHWWR EORFFDLOIXQ]LRQDPHQWR QHVVXQHIIHWWR LQYHUWHLQDSHUWXUD YHGL EORDSUH 23(1EO
FFDHDOGLVLPSHJQR
RFFD
SURJƒOLY  PHPRUL]]D&/26(

BLOCCATO FKLXGHLOFDQFHOOR FKLXGHLOFDQFHOOR FKLXGHLOFDQFHOOR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR


23(1&/26(LQLELWL 23(1LQLELWR &/26(LQLELWR 23(1&/26(LQLELWL

LOGICA “At” (2) IMPULSI


STATO AUTOMAZIONE OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP
DSUHLOFDQFHOORSDU]LDO
DSUHHULFKLXGHGRSRLO PHQWHHFKL QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR
CHIUSO WHPSRSDXVD XGHGRSRLO QHVVXQHIIHWWR 23(1LQLELWR 23(1LQLELWR QHVVXQHIIHWWR 23(1LQLELWR
WHPSRSDXVD%
EORFFDHDOGLVLPSHJQR
IN APERTURA QHVVXQHIIHWWR  QHVVXQHIIHWWR ULFKLXGHLOFDQFHOOR EORFFDLOIXQ]LRQDPHQWR LQYHUWHLQFKLXVXUD QHVVXQHIIHWWR DSUH
PHPRUL]]D&/26(

APERTO IN PAUSA ULFDULFDLOWHPSRSDXVD  ULFDULFDLOWHPSRSDXVD ULFKLXGHLOFDQFHOOR EORFFDLOIXQ]LRQDPHQWR QHVVXQHIIHWWR ULFDULFDLOWHPSRSDXVD ULFDULFDLOWHPSRSDXVD


&/26(LQLELWR &/26(LQLELWR

IN CHIUSURA ULDSUHLOFDQFHOOR ULDSUHLOFDQFHOOR QHVVXQHIIHWWR EORFFDLOIXQ]LRQDPHQWR QHVVXQHIIHWWR LQYHUWHLQDSHUWXUD YHGL EORFFDHDOGLVLPSHJQR


DSUH
SURJƒOLY  PHPRUL]]D&/26(

BLOCCATO FKLXGHLOFDQFHOOR FKLXGHLOFDQFHOOR FKLXGHLOFDQFHOOR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR


23(1&/26(LQLELWL 23(1LQLELWR &/26(LQLELWR 23(1&/26(LQLELWL

LOGICA “S” ,038/6,


STATO AUTOMAZIONE OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP
DSUHLOFDQFHOORSDU]LDO
DSUHHULFKLXGHGRSRLO PHQWHHFKL QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR
CHIUSO WHPSRSDXVD XGHGRSRLO QHVVXQHIIHWWR 23(1LQLELWR 23(1LQLELWR QHVVXQHIIHWWR 23(1LQLELWR
WHPSRSDXVD%

FRQWLQXDDGDSULUHH EORFFDHDOGLVLPSHJQR
IN APERTURA LQYHUWHLQFKLXVXUD  LQYHUWHLQFKLXVXUD ULFKLXGHLOFDQFHOOR EORFFDLOIXQ]LRQDPHQWR YHGLSURJƒOLY ULFKLXGHVXELWR DSUH
PHPRUL]]D&/26(

APERTO IN PAUSA ULFKLXGHLOFDQFHOOR  ULFKLXGHLOFDQFHOOR ULFKLXGHLOFDQFHOOR EORFFDLOIXQ]LRQDPHQWR QHVVXQHIIHWWR EORFFDHDOGLVLPSHJQR EORFFDHDOGLVLPSHJQR


FKLXGHVXELWR FKLXGH

LQYHUWHLQDSHUWXUD YHGL EORFFDHDOGLVLPSHJQR


IN CHIUSURA ULDSUHLOFDQFHOOR ULDSUHLOFDQFHOOR QHVVXQHIIHWWR EORFFDLOIXQ]LRQDPHQWR QHVVXQHIIHWWR SURJƒOLY HDOWHUPLQH DSUHHDOWHUPLQHFKLXGH
FKLXGHVXELWR VXELWR

BLOCCATO FKLXGHLOFDQFHOOR FKLXGHLOFDQFHOOR FKLXGHLOFDQFHOOR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR


23(1&/26(LQLELWL 23(1LQLELWR &/26(LQLELWR 23(1&/26(LQLELWL

LOGICA “SP” ,038/6,


STATO AUTOMAZIONE OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP
DSUHLOFDQFHOORSDU]LDO
DSUHHULFKLXGHGRSRLO PHQWHHFKL QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR
CHIUSO WHPSRSDXVD XGHGRSRLO QHVVXQHIIHWWR 23(1LQLELWR 23(1LQLELWR QHVVXQHIIHWWR 23(1LQLELWR
WHPSRSDXVD%

FRQWLQXDDGDSULUHH EORFFDHDOGLVLPSHJQRDSUHH
IN APERTURA EORFFDLOIXQ]LRQDPHQWR  EORFFDLOIXQ]LRQDPHQWR ULFKLXGHLOFDQFHOOR EORFFDLOIXQ]LRQDPHQWR YHGLSURJƒOLY ULFKLXGHVXELWR
DOWHUPLQHFKLXGHVXELWR 23(1
EORFFDPHPRUL]]D&/26(

APERTO IN PAUSA ULFKLXGHLOFDQFHOOR  ULFKLXGHLOFDQFHOOR ULFKLXGHLOFDQFHOOR EORFFDLOIXQ]LRQDPHQWR QHVVXQHIIHWWR EORFFDHDOGLVLPSHJQR EORFFDHDOGLVLPSHJQR


FKLXGHVXELWR FKLXGHVXELWR

IN CHIUSURA EORFFDLOIXQ]LRQDPHQWR EORFFDLOIXQ]LRQDPHQWR QHVVXQHIIHWWR EORFFDLOIXQ]LRQDPHQWR QHVVXQHIIHWWR LQYHUWHLQDSHUWXUD YHGL EORFFDHDOGLVLPSHJQR


DSUH
SURJƒOLY PHPRUL]]D&/26(
ULSUHQGHLOPRWRLQVHQVR ULSUHQGHLOPRWRLQVHQVR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR
BLOCCATO LQYHUVR'RSR6723FKLXGH LQYHUVR'RSR6723FKLXGH ULFKLXGHLOFDQFHOOR 23(1&/26(LQLELWL 23(1LQLELWR &/26(LQLELWR 23(1&/26(LQLELWL
VHPSUH VHPSUH

 'XUDQWHLOFLFORGLDSHUWXUDSDU]LDOHXQLPSXOVRGL23(1$SURYRFDO·DSHUWXUDWRWDOH
E721 19 532014 - Rev. D
LOGICA “SA” ,038/6,
STATO AUTOMAZIONE OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP
$SUHLOFDQFHOORSDU]LDO
ITALIANO

CHIUSO DSUHHULFKLXGHGRSRLO PHQWHHFKL XGHGRSRLO QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR


WHPSRSDXVD WHPSRSDXVD% 23(1LQLELWR 23(1LQLELWR 23(1LQLELWR

EORFFDHDOGLVLPSHJQR
IN APERTURA QHVVXQHIIHWWR  QHVVXQHIIHWWR ULFKLXGHLOFDQFHOOR EORFFDLOIXQ]LRQDPHQWR YHGLSURJƒOLY QHVVXQHIIHWWR DSUH
PHPRUL]]D&/26(

APERTO IN PAUSA ULFKLXGHLOFDQFHOOR  ULFKLXGHLOFDQFHOOR ULFKLXGHLOFDQFHOOR EORFFDLOIXQ]LRQDPHQWR QHVVXQHIIHWWR ULFDULFDLOWHPSRSDXVD ULFDULFDLOWHPSRSDXVD


&/26(LQLELWR &/26(LQLELWR

IN CHIUSURA ULDSUHLOFDQFHOOR ULDSUHLOFDQFHOOR QHVVXQHIIHWWR EORFFDLOIXQ]LRQDPHQWR QHVVXQHIIHWWR LQYHUWHLQDSHUWXUD YHGL EORFFDHDOGLVLPSHJQR


DSUH
SURJƒOLY  PHPRUL]]D&/26(

BLOCCATO FKLXGHLOFDQFHOOR FKLXGHLOFDQFHOOR FKLXGHLOFDQFHOOR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR


23(1&/26(LQLELWL 23(1LQLELWR &/26(LQLELWR 23(1&/26(LQLELWL

LOGICA “B” ,038/6,


STATO AUTOMAZIONE OPEN A / CLOSE STOP FSW OP FSW CL FSW CL/OP

CHIUSO DSUHLOFDQFHOOR / QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR


23(1LQLELWR 23(1LQLELWR 23(1LQLELWR

EORFFDHDOGLVLPSHJQR
IN APERTURA QHVVXQHIIHWWR / FKLXGHLOFDQFHOOR EORFFDLOIXQ]LRQDPHQWR YHGLSURJƒOLY QHVVXQHIIHWWR DSUH PHPRUL]]D
23(1&/26(

APERTO QHVVXQHIIHWWR / FKLXGHLOFDQFHOOR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR


23(1&/26(LQLELWL &/26(LQLELWR 23(1&/26(LQLELWL

IN CHIUSURA DSUHLOFDQFHOOR / QHVVXQHIIHWWR EORFFDLOIXQ]LRQDPHQWR QHVVXQHIIHWWR LQYHUWHLQDSHUWXUD YHGL EORFFDHDOGLVLPSHJQR


DSUH PHPRUL]]D
SURJƒOLY  23(1&/26(

BLOCCATO DSUHLOFDQFHOOR / FKLXGHLOFDQFHOOR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR


23(1&/26(LQLELWL 23(1LQLELWR &/26(LQLELWR 23(1&/26(LQLELWL

LOGICA “bC IMPULSI IN APERTURA / COMANDI MANTENUTI IN CHIUSURA IMPULSI


STATO AUTOMAZIONE OPEN A / CLOSE STOP FSW OP FSW CL FSW CL/OP

CHIUSO DSUHLOFDQFHOOR / QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR


23(1LQLELWR 23(1LQLELWR 23(1LQLELWR

EORFFDHDOGLVLPSHJQR
IN APERTURA QHVVXQHIIHWWR / FKLXGHLOFDQFHOOR EORFFDLOIXQ]LRQDPHQWR YHGLSURJƒOLY QHVVXQHIIHWWR DSUH PHPRUL]]D
23(1&/26(

APERTO QHVVXQHIIHWWR / FKLXGHLOFDQFHOOR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR


23(1&/26(LQLELWL &/26(LQLELWR 23(1&/26(LQLELWL

IN CHIUSURA DSUHLOFDQFHOOR / QHVVXQHIIHWWR EORFFDLOIXQ]LRQDPHQWR QHVVXQHIIHWWR LQYHUWHLQDSHUWXUD YHGL EORFFDHDOGLVLPSHJQR


DSUH PHPRUL]]D
SURJƒOLY  23(1&/26(

BLOCCATO DSUHLOFDQFHOOR / FKLXGHLOFDQFHOOR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR


23(1&/26(LQLELWL 23(1LQLELWR &/26(LQLELWR 23(1&/26(LQLELWL

LOGICA “C” COMANDI MANTENUTI IMPULSI


STATO AUTOMAZIONE OPEN A / CLOSE STOP FSW OP FSW CL FSW CL/OP

CHIUSO DSUHLOFDQFHOOR / QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR


23(1LQLELWR 23(1LQLELWR 23(1LQLELWR

IN APERTURA QHVVXQHIIHWWR / FKLXGHLOFDQFHOOR EORFFDLOIXQ]LRQDPHQWR YHGLSURJƒOLY QHVVXQHIIHWWR EORFFDHDOGLVLPSHJQR


YHGLSURJƒOLY

APERTO QHVVXQHIIHWWR / FKLXGHLOFDQFHOOR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR


23(1&/26(LQLELWL &/26(LQLELWR 23(1&/26(LQLELWL

IN CHIUSURA DSUHLOFDQFHOOR / QHVVXQHIIHWWR EORFFDLOIXQ]LRQDPHQWR QHVVXQHIIHWWR EORFFDLOIXQ]LRQDPHQWR EORFFDLOIXQ]LRQDPHQWR

BLOCCATO DSUHLOFDQFHOOR / FKLXGHLOFDQFHOOR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR QHVVXQHIIHWWR


23(1&/26(LQLELWL 23(1LQLELWR &/26(LQLELWR 23(1&/26(LQLELWL
 'XUDQWHLOFLFORGLDSHUWXUDSDU]LDOHXQLPSXOVRGL23(1$SURYRFDO·DSHUWXUDWRWDOH
 $OO·DFFHQVLRQHODVFKHGDYHULILFDJOLLQJUHVVLHVHXQFRPDQGRGL23(1$R%qDWWLYRDSUHO·DQWDRLOFDQFHOORDOWULPHQWLFKLXGH
E721 20 532014 - Rev. D
CONTENTS
1 WARNINGS ..................................................................................................................................................... 2
2 LAYOUT AND COMPONENTS........................................................................................................................... 2
2.1 COMPONENT DESCRIPTION ...................................................................................................................................... 3
2.2 DESCRIPTION OF TERMINAL BLOCK J13 .................................................................................................................... 3
3 TECHNICAL SPECIFICATIONS .......................................................................................................................... 3
4 ELECTRIC CONNECTIONS ............................................................................................................................... 4
4.1 BUS-2EASY PHOTOCELLS ............................................................................................................................................ 5
4.1.1 ADDRESSING BUS-2EASY PHOTOCELLS ..........................................................................................................................5
4.1.2 STORING BUS-2EASY ACCESSORIES .............................................................................................................................5
4.2 TRADITIONAL PHOTOCELLS ....................................................................................................................................... 6
4.3 SAFE INPUT CONNECTIONS ......................................................................................................................... 7

ENGLISH
5 PROGRAMMING ............................................................................................................................................ 8
5.1 1st LEVEL PROGRAMMING ........................................................................................................................................ 8
5.2 2nd LEVEL PROGRAMMING ...................................................................................................................................... 10
6 STORING RADIO CODE ................................................................................................................................ 12
6.1 STORING DS RADIOCONTROLS ............................................................................................................................... 12
6.2 STORING SLH RADIOCONTROLS ............................................................................................................................. 13
6.3 STORING LC/RC RADIOCONTROLS (ONLY FOR SOME MARKETS) ............................................................................ 13
6.3.1 STORING LC/RC RADIOCONTROLS REMOTELY ...........................................................................................................13
6.4 RADIOCONTROLS DELETION PROCEDURE .............................................................................................................. 13
7 OPERATIONAL START-UP ............................................................................................................................... 14
7.1 CHECKING THE LEDS ................................................................................................................................................ 14
7.2 BATTERY OPERATION ............................................................................................................................... 14
7.3 POSITIONING LIMIT SWITCHES ....................................................................................................................................
7.4 MASTER / SLAVE CONFIGURATIONS ......................................................................................................................... 16
7.4.1 MASTER / SLAVE WIRING ............................................................................................................................................ 16
7.4.2 MASTER/SLAVE SETUP PROCEDURE ............................................................................................................................. 16
7.5 SETUP ....................................................................................................................................................................... 17
8 TESTING THE AUTOMATED SYSTEM ........................................................................................................... 17
9 ALARM AND ERROR SIGNALS .................................................................................................................. 17
9.1 ALARMS ................................................................................................................................................................... 17
9.2 ERRORS .................................................................................................................................................................. 17
10 FUNCTION LOGICS .................................................................................................................................... 18

CE DECLARATION OF CONFORMITY
Manufacturer: )$$&6S$
Address: 9LD&DODUL=ROD3UHGRVD%2/2*1$,7$/<
Declares that: &RQWUROERDUG(

 ‡FRQIRUPVWRWKHHVVHQWLDOVDIHW\UHTXLUHPHQWVRIWKHIROORZLQJ((&GLUHFWLYHV
  (&/RZ9ROWDJH'LUHFWLYH
  (&(OHFWURPDJQHWLF&RPSDWLELOLW\'LUHFWLYH

  $GGLWLRQDOQRWH
   7KLVSURGXFWKDVXQGHUJRQHWHVWLQJLQDW\SLFDO
   VWDQGDUGFRQILJXUDWLRQ DOOSURGXFWVEXLOWE\)$$&6S$

%RORJQD
      7KH0DQDJLQJ'LUHFWRU
      $0DUFHOODQ

WARNINGS
‡$WWHQWLRQ7RHQVXUHWKHVDIHW\RISHRSOHLWLVLPSRUWDQWWKDW\RXUHDGDOOWKHIROORZLQJLQVWUXFWLRQV
‡,QFRUUHFWLQVWDOODWLRQRULQFRUUHFWXVHRIWKHSURGXFWFRXOGFDXVHVHULRXVKDUPWRSHRSOH
‡&DUHIXOO\UHDGWKHLQVWUXFWLRQVEHIRUHEHJLQQLQJWRLQVWDOOWKHSURGXFWDQGNHHSIRUIXWXUHUHIHUHQFH
‡7KHV\PERO KLJKOLJKWVQRWHVWKDWDUHLPSRUWDQWIRUSHUVRQDOVDIHW\DQGWKHSURWHFWLRQRIWKHDXWRPDWHG
V\VWHP
‡7KHV\PERO FDOOV\RXUDWWHQWLRQWRQRWHVRQSURGXFWVSHFLILFDWLRQVRURSHUDWLRQ

E721 1 532014 - Rev. D


E721
1 WARNINGS
Before attempting any work on the control board (connections, maintenance), always turn off power.

Install, upstream of the system, a differential thermal breaker with adequate tripping threshold.

Connect the earth lead to the appropriate terminal.

Always separate power cables from control and safety cables


(push-button, receiver, photocells, etc.). To avoid any electric
noise, use separate sheaths or a shielded cable (with earthed
shield).
ENGLISH

2 LAYOUT AND COMPONENTS

/ SAFE
/ SAFE

SENSOR
LIMIT SWITCH

)LJ

E721 2 532014 - Rev. D


2.1 COMPONENT DESCRIPTION 3 TECHNICAL SPECIFICATIONS
/&' 6,*1$//,1*$1'352*5$00,1*',63/$< Power supply 99(56,219a+]
99(56,219a+]

6: 352*5$00,1*386+%87721F Power consumption :


from mains stand-by
6: 352*5$00,1*386+%87721-
Motor max. load $
6: 352*5$00,1*386+%87721+ Accessory 9
6: “SETUP”386+%87721 power supply
Accessory 9 PD[P$
/('V ,1387667$786&21752//(' max. current %86($6<PD[P$
- 0$,132:(56833/<&211(&725 Environmental  ƒ&
- 75$16)250(535,0$5<:,1',1*&211(&725 temperature
Flashing lamp 9 :
- 75$16)250(56(&21'$5<:,1',1*&211(&725 load

ENGLISH
- (0(5*(1&<%$77(5<&211(&725 $&&(6625< Output load 9 P$ (2)
- 02725&211(&725 Protection ) 7$9a
fuses
- )/$6+,1*/$03&211(&725(24 V= - 15W) Function 6HPLDXWRPDWLF6HPLDXWRPDWLF“VWHS“
02725/2&.$1'027255(/($6( logics $XWRPDWLF$XWRPDWLF“VWHS”$XWR
- PDWLFZLWKWLPHUIXQFWLRQ$XWRPDWLF
&217$&7&211(&725
6DIHW\GHYLFHV$XWRPDWLF6DIHW\GHYLFHV
- 287287387&211(&725 “VWHS“$XWRPDWLFZLWKUHYHUVHRQSDXVH
- 86%&211(&725)253&&211(&7,21 6HPLDXWRPDWLF“E”0L[HGORJLF“E&”
'HDGPDQ
- %86($6<'(9,&(&211(&7,21&211(&725
Work time 3URJUDPPDEOH IURPWRPLQ
- ,1387&211(&725,1&211(&725%/2&. Pause time 3URJUDPPDEOH IURPWRPLQ
- 5$',25(&(,9(502'8/(&211(&725)25201,'(& OPEN A / OPEN B
Motor power $GMXVWDEOHRYHUOHYHOV
/&' 6,*1$//,1*$1'352*5$00,1*',63/$<
Opening-closing $GMXVWDEOHRYHUOHYHOV
) 3527(&7,21)86( motor speed
Connector Inputs/ 3RZHUVXSSO\%DWWHU\0RWRU0RGXOH
2.2 DESCRIPTION OF TERMINAL BLOCK J13 Outputs ;)0RWRUORFNHOHFWULFUHOHDVHEDW
WHULHV0RWRU/RFN86%
INPUT No DESCRIPTION
Inputs/Outputs in %86($6<23(1$23(1%&/26(6$)(
1 23(1$ 'HYLFHZLWKN.OFRQWDFW terminal block 67236$)(*1'2SHQLQJDQGFORVLQJ
WKDWFDXVHVWRWDORSHQLQJ SKRWRFHOOV9 0DLQVSRZHUVXSSO\
RIWKHJDWH )ODVKHU(OHFWULFUHOHDVHPRWRUORFN287
2-6 *1' $FFHVVRU\SRZHU Programming VWDQGQGOHYHOZLWKNH\V ) DQG
VXSSO\QHJDWLYH GLVSOD\

3  23(1% 'HYLFHZLWKN.O.FRQWDFW
'()$8/7 WKDWFDXVHVSDUWLDORSHQLQJ (1) The uses of inputs 3 and 4 can be set by
RIWKHJDWH configuring the corresponding parameters
CLOSE 'HYLFHZLWKN.O.FRQWDFW at programming level 2 (parameters Ob
WKDWFORVHVWKHJDWH and SP). For the exact description on how
6$)( 'HYLFHZLWK N.C.FRQWDFW to operate the automated system with the
WKDWFDXVHVWKHLPPHGLDWH chosen logics, please refer to the tables
DQGFRPSOHWHUHYHUVDORI featured at the end of this manual (Par.
WKHJDWH 10 - OPERATION LOGICS. As for the wiring
4  6723 'HYLFHZLWKN.CFRQWDFW required using these SAFE configured
'()$8/7 WKDWKDOWVWKHJDWH inputs, please refer to the diagrams shown
in Fig.13 and Fig. 14
6$)( 'HYLFHZLWK N.C.FRQWDFW
WKDWFDXVHVWKHLPPHGLDWH
DQGFRPSOHWHUHYHUVDORI (2) The output load must be considered
WKHJDWH as already included in the max. current
available for the accessories
5 )6:23 'HYLFHZLWKN.CFRQWDFW
WKDWUHYHUVHVWKHPRWLRQ
GXULQJJDWHRSHQLQJ
7 )6:&/ 'HYLFHZLWKN.CFRQWDFW
WKDWUHYHUVHVWKHPRWLRQ
GXULQJJDWHFORVLQJ
8 9 $FFHVVRU\SRZHUVXSSO\
SRVLWLYH

E721 3 532014 - Rev. D


4 ELECTRIC CONNECTIONS
The wiring shown in Fig. 2 refers to the inputs of the board with DEFAULT configuration.

/ SAFE
/ SAFE
ENGLISH

7RFRQQHFWWKHSKRWRFHOOV
DQGVDIHW\GHYLFHVFRQ
VXOWSDUDJUDSK

230 V ~
115 V ~
=

MOTOR RELEASE
CONTACT
(Locks the motor when
the motor release han-
= dle is operated)
)LJ

E721
E721 E721
E721

C720
C 72 C721
C 721
)LJ

$ 3KRWRFHOOVWKDWRSHUDWHGXULQJ&/26,1*
% 3KRWRFHOOVWKDWRSHUDWHGXULQJ23(1,1*
& 3KRWRFHOOVWKDWRSHUDWHGXULQJ23(1,1*DQG&/26,1*

)LJ

E721 4 532014 - Rev. D


%HIRUHFRQQHFWLQJWKHSKRWRFHOOVLWLVDGYLVDEOHWRVHOHFW Tab. 1 - Addressing BUS-2EASY photocells
WKHW\SHRIRSHUDWLRQRQWKHEDVLVRIWKHDUHDRIPRYHPHQW
WKDWWKH\QHHGWRSURWHFW 'LS 'LS 'LS 'LS 5H 7\SH
Safety devices during closing: RSHUDWHRQO\GXULQJWKH
DXWRPDWHGV\VWHPFORVLQJPRYHPHQWDQGDUHWKHUHIRUH 2)) 2)) 2)) 2))
VXLWDEOHIRUSURWHFWLQJWKHFORVLQJDUHDIURPWKHULVNRI 2)) 2)) 2)) 21
LPSDFW
Safety devices during opening: RSHUDWH RQO\ GXULQJ 2)) 2)) 21 2)) 23(1,1*
% Max. 6 pairs
WKH DXWRPDWHG V\VWHP RSHQLQJ PRYHPHQW DQG DUH 2)) 2)) 21 21
WKHUHIRUHVXLWDEOHIRUSURWHFWLQJWKHRSHQLQJDUHDIURP
2)) 21 21 2))
WKHULVNRILPSDFW
Safety devices during opening/closing:RSHUDWHGXULQJ 2)) 21 21 21
ERWK WKH DXWRPDWHG V\VWHP RSHQLQJ DQG FORVLQJ 21 2)) 2)) 2))
PRYHPHQWV DQG DUH WKHUHIRUH VXLWDEOH IRU SURWHFWLQJ

ENGLISH
WKHHQWLUHPRYHPHQWDUHDIURPWKHULVNRILPSDFW 21 2)) 2)) 21
21 2)) 21 2))
4.1 BUS-2EASY PHOTOCELLS
21 2)) 21 21 $ &/26,1*
7KLVERDUGLVHTXLSSHGZLWKD%86($6<FLUFXLWWKDWFDQ Max. 7 pairs
EHXVHGWRHDVLO\FRQQHFWDKLJKQXPEHURIDX[LOLDU\%86 21 21 2)) 2))
($6<GHYLFHVWRWKHVDIHW\GHYLFH HJXSWRSDLUVRI
SKRWRFHOOV  DSSURSULDWHO\ SURJUDPPHG XVLQJ RQO\ WZR 21 21 2)) 21
FDEOHVZLWKRXWSRODULW\ 21 21 21 2))
%HIRUHFRQQHFWLQJWKHSKRWRFHOOVLWLVDGYLVDEOHWRVHOHFW
2)) 21 2)) 2)) 23(1,1*DQG
WKHW\SHRIRSHUDWLRQ )LJ RQWKHEDVLVRIWKHDUHDRI & &/26,1*
PRYHPHQWWKHFHOOVPXVWSURWHFWDQGWRSRVLWLRQWKHGLS 2)) 21 2)) 21 Max. 2 pairs
VZLWFKHVRQERWKWKHWUDQVPLWWHUDQGUHFHLYHU VHH)LJ  21 21 21 21  23(138/6(
DVLQ7DE
4.1.2 STORING BUS-2EASY ACCESSORIES
DL1  $OLJQ $W DQ\ WLPH LW LV SRVVLEOH WR DGG %86($6< SKRWRFHOOV
)LJ PHQW DQG DFFHVVRULHV WR WKH V\VWHP VLPSO\ E\ IROORZLQJ WKH
DL2  %86 SURFHGXUHEHORZ
($ 6<3RZHU  ,QVWDOO DQG SURJUDPPH WKH DFFHVVRULHV ZLWK WKH
VXSSO\VWDWXV UHTXLUHGDGGUHVV VHHSDU 
RX TX DS1  'LS  &XWRIISRZHUWRWKHERDUG
DL2 V Z L W F K H V  I R U  &RQQHFWERWKFDEOHVRIWKH%86($6<DFFHVVRULHVWR
DL1
WKHUHGWHUPLQDOEORFN- SRODULW\LUUHOHYDQW 
SURJUDPPLQJ
 3RZHUWKHERDUG
ON ON
DS1 DS1
1 2 3 4 1 2 3 4

DL2
 4XLFNO\ SUHVV WKH 6(783 SXVKEXWWRQ 6:  RQFH WR
BUS BUS BUS BUS UHJLVWHUWKHDFFHVVRULHV&KHFNWKHRSHUDWLRQRIWKH
LQVWDOOHG%86($6<GHYLFHV
RX - TX
 7KHERDUGKDVVWRUHGWKH%86($6<DFFHVVRULHV

4.1.1 ADDRESSING BUS-2EASY PHOTOCELLS )ROORZWKHLQVWUXFWLRQVLQWKHIROORZLQJWDEOHWRFKHFNWKDW


WKH%86($6<FRQQHFWLRQVWDWXVLVHIILFLHQW
It is important to give both the transmitter
and the receiver the same address.
The same procedure must be performed on a
Ensure that there are not two or more pho- MASTER unit also when acquiring a SLAVE unit
tocell pairs with the same address. connected to the BUS- 2EASY with POLARISED
connection
If no BUS-2EASY accessory is used, leave the Tab. 2 - Description of BUS-2EASY LED
BUS-2EASY connector (J12 - fig. 1) free.
1RUPDODFWLYLW\ /('RQHYHQZLWKRXWSKR
Fixed ON
WRFHOOV 1RUHJLVWHUHGSKRWRFHOOHQJDJHG
Slow $WOHDVWRQHUHJLVWHUHGSKRWRFHOOHQJDJHG
flasher RUQRWDOLJQHG
Off (flash
every %86($6<OLQHVKRUWFLUFXLWHG
2.5 secs)
%86($6<OLQHGLVDEOHG GRHVQRWVXSSO\
SRZHU
Off
%DWWHU\RSHUDWLRQ
8QLWSURJUDPPHGDVD6/$9(

E721 5 532014 - Rev. D


4.2 TRADITIONAL PHOTOCELLS &RQQHFWLRQRIDSDLURIFORVLQJSKRWRFHOOVDQGD
SDLURIRSHQLQJSKRWRFHOOV
&RQQHFWLRQRISDLURIFORVLQJSKRWRFHOOV
ZLWK)$,/6$)(VDIHW\GHYLFHactivated
Set in second level of programming
o1 = 01

OUT
ENGLISH

Other safety
devices

OUT
OUT

)LJ
&RQQHFWLRQRISDLURIFORVLQJSKRWRFHOOV
ZLWK)$,/6$)(DQG6723VDIHW\GHYLFHdeactivated
&RQQHFWLRQRIWZRSDLUVRIFORVLQJSKRWRFHOOV

Other safety
devices

)LJ

If the FAIL-SAFE safety device is not


used, connect the power supply of the
transmitters to terminals 6 and 8 of J13.
If the FAIL-SAFE safety device is used, connect
the power supply of the transmitters to OUT
after setting it as appropriate (see 2nd )LJ
level programming and Fig. 6).
&RQQHFWLRQRIDSDLURIFORVLQJSKRWRFHOOVDQGDSDLURI
If the FAIL-SAFE safety device is used, even the
unused safety inputs must be connected via a RSHQLQJFORVLQJSKRWRFHOOV
shunt lead to the negative of OUT (see Fig. 6).

&RQQHFWLRQRIDSDLURIRSHQLQJSKRWRFHOOV

Other safety
devices

)LJ )LJ
E721 6 532014 - Rev. D
&RQQHFWLRQRIDSDLURIFORVLQJSKRWRFHOOVDSDLURIRSHQ &RQQHFWLRQRIQRVDIHW\DQGVWRSGHYLFH
LQJSKRWRFHOOVDQGDSDLURIRSHQLQJFORVLQJSKRWRFHOOV

)LJ

ENGLISH
)LJ

4.3 SAFE INPUT CONNECTIONS


If the Fail Safe safety device is enabled (parameter that can be set in programming level 2), the negative
used for managing the SAFE input is - OUT (see Fig. 13).

&RQQHFWLRQRIDVDIHW\GHYLFH RWKHUVDIHW\GHYLFHV WRWKH6$)(LQSXWZLWKWKHFAIL SAFE function enabled


%\VHWWLQJQGOHYHOo 1=01 )$,/6$)((1$%/(' %\VHWWLQJQGOHYHOo 1=01 )$,/6$)((1$%/('
QGOHYHO SP=01 ,1387 6$)(7<('*(6$)(7< QGOHYHO Ob=02 ,1387 6$)(7<('*(6$)(7<
Other safety
Other safety devices
devices OPEN A OPEN A
GND GND
OPEN B / CLOSE - OUT SAFE / OPEN B / CLOSE
- OUT SAFE / STOP STOP
FSW OP FSW OP
GND GND
FSW CL FSW CL
+24V +24V )LJ
If the Fail Safe safety device is disabled (parameter that can be set in programming level 2), the negative
used for managing the SAFE input is -  (see Fig. 14).

&RQQHFWLRQRIDVDIHW\GHYLFH RWKHUVDIHW\GHYLFHV WRWKH6$)(LQSXWZLWKWKHFAIL SAFE function disabled


%\VHWWLQJQGOHYHOo 1=00 )$,/6$)(',6$%/(' %\VHWWLQJQGOHYHOo 1=00 )$,/6$)(',6$%/('
QGOHYHO SP=01 ,1387 6$)(7<('*(6$)(7< QGOHYHO Ob=02 ,1387 6$)(7<('*(6$)(7<
Other safety
Other safety devices
OPEN A
devices OPEN A
GND
OPEN B / CLOSE GND
SAFE / STOP - SAFE / OPEN B / CLOSE
- FSW OP STOP
GND FSW OP
FSW CL GND
+24V FSW CL
+24V )LJ

In case N.C. contact devices are not used (other safety devices) the SAFE input must be jumpered to -OUT
with FAIL SAFE enabled or to GND with FAIL SAFE disabled.
E721 7 532014 - Rev. D
5 PROGRAMMING Changes to the programming parameters
become effective as soon as they are
,WLVQHFHVVDU\WRDFFHVV352*5$00,1*PRGHLQRUGHU
carried out, while final memorisation
WRSURJUDPDXWRPDWHGV\VWHPRSHUDWLRQ occurs only upon exiting programming and
3URJUDPPLQJ LV GLYLGHG LQ WZR SDUWV VW /(9(/ DQG QG returning to the input state display. If the
/(9(/ unit is powered down before returning to
The status of the automated system is the input state display, all changes made
normally shown on the display. When will be lost.
push-button F is pressed or when F and
+ are pressed simultaneously, this gives It is possible to return to the input status
access to 1st or 2nd level programming. display and store all the parameters
During battery operation the display is off. modified to that moment from any point
Briefly press “+” to view the state of the of the 1st and 2nd level programming by
automated system. pressing keys F and - simultaneously.
ENGLISH

To restore the default settings, simply reload


the desired default in the first passage of
When the board is turned on, the software
the 1st level programming.
version of the board with two figures
separated by a decimal point appears on
5.1 1st LEVEL PROGRAMMING the LCD1 display.
7RDFFHVVVWOHYHOSURJUDPPLQJSUHVVSXVKEXWWRQF
‡ 3UHVVF DQGKROGGRZQ WRGLVSOD\WKHIXQFWLRQQDPH
‡ ,I\RXUHOHDVHWKHNH\WKHGLVSOD\VKRZVWKHYDOXHRIWKHIXQFWLRQWKDWFDQEHPRGLILHGZLWKNH\VDQG
‡ ,I\RXSUHVVFDJDLQ DQGKROGLWGRZQ WKHGLVSOD\VKRZVWKHQDPHRIWKHQH[WIXQFWLRQHWF
‡ :KHQ\RXUHDFKWKHODVWIXQFWLRQSUHVVSXVKEXWWRQFWRH[LWWKHSURJUDPDQGVWRUHWKHSDUDPHWHUV7KHGLVSOD\
VKRZVDJDLQWKHVWDWXVRIWKHDXWRPDWHGV\VWHP

1st LEVEL PROGRAMMING

Display Function Default 1


DEFAULT:
dF 1 &RQILJXUHVWKHSDUDPHWHUVZLWK'()$8/7YDOXHV
1
CU ,ISXVKEXWWRQFLVUHOHDVHGWKHYDOXH CU DSSHDUVWKLVPHDQVWKDWWKHVWDQGDUG
PRGLILHGFRQILJXUDWLRQKDVEHHQVHOHFWHGE\PHDQVRISXVKEXWWRQVDQGGLVSOD\,I
\RXZLVKWRPDLQWDLQWKLVSURJUDPPLQJSUHVVSXVKEXWWRQF DJDLQRWKHUZLVHSUHVV
DQGVHOHFWGHIDXOW1 
MASTER/SLAVE CONFIGURATION:
Ct M A  &RQILJXUHVWKHERDUGLQMASTERPRGH MA
SL &RQILJXUHVWKHERDUGLQSLAVEPRGH
Configuring the board in SLAVE mode you will not be able to view the parameters
LO-PA-Pb-Ph-Op (for Master/Slave operation see Par. 7.4)
FUNCTION LOGICS:
LO E 6HPLDXWRPDWLF E
EP 6HPLDXWRPDWLF“6WHS”
A $XWRPDWLF
A1 $XWRPDWLF
AP $XWRPDWLF“6WHS”
At $XWRPDWLFZLWKWLPHUIXQFWLRQ
S $XWRPDWLF“6DIHW\GHYLFHV”
SP $XWRPDWLF6DIHW\'HYLFHV6WHS”
SA $XWRPDWLFZLWKUHYHUVHGXULQJSDXVH
b 6HPLDXWRPDWLF“E”
bC  0L[HG $3SXOVH&+GHDGPDQ 
C 'HDGPDQ
Parameter not displayed in SLAVE mode
PAUSE TIME A:
PA 3DXVHWLPHZLWKDTOTALRSHQLQJFRPPDQG7KLVKDVHIIHFWRQO\LIWKHDXWRPDWLFORJLFZDV 20
VHOHFWHG$GMXVWDEOHIURPWRVHFVLQRQHVHFRQGVWHSV
6XEVHTXHQWO\GLVSOD\FKDQJHVWRPLQXWHVDQGWHQVRIVHFRQGV VHSDUDWHGE\DSRLQW DQG
WLPHLVDGMXVWHGLQVHFRQGVWHSVXSWRWKHPD[LPXPYDOXHRI9.5 PLQXWHV
(JLIWKHGLVSOD\VKRZV2.5 SDXVHWLPHLVPLQDQGVHFV
Parameter not displayed in SLAVE mode
E721 8 532014 - Rev. D
Display Function Default 1
PAUSE TIME B:
Pb 3DXVHWLPHZLWKDPARTIALRSHQLQJFRPPDQG7KLVKDVHIIHFWRQO\LIWKHDXWRPDWLFORJLFZDV
20
VHOHFWHG$GMXVWDEOHIURPWRVHFVLQRQHVHFRQGVWHSV
6XEVHTXHQWO\GLVSOD\FKDQJHVWRPLQXWHVDQGWHQVRIVHFRQGV VHSDUDWHGE\DSRLQW DQG
WLPHLVDGMXVWHGLQVHFRQGVWHSVXSWRWKHPD[LPXPYDOXHRI9.5 PLQXWHV
(JLIWKHGLVSOD\VKRZV2.5 SDXVHWLPHLVPLQDQGVHFV
Parameter not displayed in SLAVE mode
MOTOR POWER:
FO $GMXVWVWKHPRWRUSRZHUOHYHO
50
 01  PLQLPXPSRZHU

ENGLISH
 50  PD[LPXPSRZHU
When the power value has been changed, it is advisable to perform a new
SETUP (see par. 7.3)
OPENING SPEED:
So $GMXVWVWKHPRWRURSHQLQJVSHHGWROHYHOV
08
 01 PLQLPXPVSHHG
 10 PD[LPXPVSHHG
When the speed value has been changed, it is advisable to perform a new
SETUP (see par. 7.3)
CLOSING SPEED:
Sc $GMXVWVWKHPRWRUFORVLQJVSHHGWROHYHOV
08
 01 PLQLPXPVSHHG
 10 PD[LPXPVSHHG
When the speed value has been changed, it is advisable to perform a new
SETUP (see par. 7.3)
SLOWING DURING OPENING
ro $GMXVWVWKHVORZLQJVSDFHDVDSHUFHQWDJHRIWKHWRWDOJDWHWUDYHO$GMXVWDEOHIURP5  ZLWK
20
VSHHG 10  ZLWKVSHHGEHWZHHQDQG 15  ZLWKVSHHG! WR99 LQVWHSV

 5-10-15 PLQLPXPVORZLQJ
 99  PD[LPXPVORZLQJ
SLOWING DURING CLOSING:
rc $GMXVWVWKHVORZLQJVSDFHDVDSHUFHQWDJHRIWKHWRWDOJDWHWUDYHO$GMXVWDEOHIURP5  ZLWK
20
VSHHG 10  ZLWKVSHHGEHWZHHQDQG 15  ZLWKVSHHG! WR99 LQVWHSV

 5-10-15 PLQLPXPVORZLQJ
 99  PD[LPXPVORZLQJ
SPEED DURING SLOWING:
Sr $GMXVWVJDWHVSHHGGXULQJVORZLQJ
0
 0 /2:VSHHG
 1 +,*+VSHHG
STATUS OF AUTOMATED SYSTEM:
St ([LWIURPSURJUDPPLQJGDWDVWRUDJHDQGUHWXUQWRJDWHVWDWXVGLVSOD\

00  &/26(' 07 )$,/6$)(LQSURJUHVV
01 23(1 08 %86($6<GHYLFHFKHFNLQSURJUHVV
02  6WRSWKHQ“23(1” 09 3UHIODVKLQJWKHQ“23(1”
03  6WRSWKHQ“&/26(” 10 3UHIODVKLQJWKHQ“&/26(”
04 ,Q“3$86(” 11 23(1LQ3DUWLDO2SHQLQJ
05 'XULQJRSHQLQJVWDJH 12 LQ3$86(3DUWLDO2SHQLQJ
06 'XULQJFORVLQJVWDJH

E721 9 532014 - Rev. D


5.2 2nd LEVEL PROGRAMMING
7RDFFHVV1'/(9(/352*5$00,1*SUHVVSXVKEXWWRQFDQGKROGGRZQZKLOHSUHVVLQJSXVKEXWWRQ+
‡ LI\RXDOVRUHOHDVHSXVKEXWWRQFWKHGLVSOD\VKRZVWKHYDOXHRIWKHIXQFWLRQWKDWFDQEHPRGLILHGZLWKNH\V+DQG-
‡ LI\RXSUHVVNH\F DQGKROGGRZQ WKHGLVSOD\VKRZVWKHQDPHRIWKHQH[WIXQFWLRQ,I\RXUHOHDVHLWWKHYDOXH
WKDWFDQEHPRGLILHGZLWKNH\V+DQG-LVGLVSOD\HG
‡ ZKHQ\RXUHDFKWKHODVWIXQFWLRQSUHVVFWRH[LWSURJUDPPLQJDQGWKHGLVSOD\UHVXPHVVKRZLQJWKHDXWRPDWHG
V\VWHPVWDWXV

2nd LEVEL PROGRAMMING

Display Function Default 1


MAXIMUM TAKE-OFF POWER:
bo 7KHPRWRUZRUNVDWPD[LPXPSRZHU LJQRULQJWKHVHOHFWHGSRZHUOHYHO GXULQJWKHPRYHPHQW
no
ENGLISH

WDNHRII

 Y  DFWLYH
 no  H[FOXGHG
PREFLASHING:
PF $OORZVW\SHVRISUHIODVKLQJWREHVHOHFWHGZLWKDGXUDWLRQHTXDOWRVHFV
no
no  QRSUHIODVKLQJ
OC  SUHIODVKLQJEHIRUHHDFKPRYHPHQW
CL  SUHIODVKLQJEHIRUHDFORVLQJPRYHPHQW
OP  SUHIODVKLQJEHIRUHDQRSHQLQJPRYHPHQW
PA  SUHIODVKLQJRQO\DWHQGRISDXVH
PREFLASHING TIME (visible only if preflashing is selected in the previous menu):
tP $GMXVWVSUHIODVKLQJWLPHIURP 1 WR10 VHFLQVHFRQGVWHSV
03
 01 PLQLPXPSUHIODVKLQJ
10 PD[LPXPSUHIODVKLQJ
CLOSING PHOTOCELLS:
Ph $FWLYDWHWKHIXQFWLRQLI\RXZDQWWKHFORVLQJSKRWRFHOOVWRORFNPRYHPHQWDQGUHYHUVHLWRQ
no
GLVHQJDJHPHQW1RUPDOO\RSHUDWLRQRIWKHFORVLQJSKRWRFHOOVLPPHGLDWHO\SXWVWKHJDWH
LQWRUHYHUVHZKHQWKLVIXQFWLRQLVRII
Y  UHYHUVDORQGLVHQJDJHPHQW
no LPPHGLDWHUHYHUVDOWRRSHQLQJ
Parameter not displayed in SLAVE mode
OPENING PHOTOCELLS:
oP $FWLYDWHWKHIXQFWLRQLI\RXZDQWWKHRSHQLQJSKRWRFHOOVWRORFNPRYHPHQWDQGUHYHUVHLW
no
GXULQJFORVLQJ1RUPDOO\ZLWKWKLVIXQFWLRQRIIRSHUDWLRQRIWKHRSHQLQJSKRWRFHOOVGHWHUPLQHV
WKHUHVXPSWLRQRIPRYHPHQWRQWKHLUGLVHQJDJHPHQW
no LPPHGLDWHUHYHUVDOWRFORVLQJ
no UHVXPSWLRQRIPRWLRQRQGLVHQJDJHPHQW
Parameter not displayed in SLAVE mode
ADMAP FUNCTION
Ad 3HUPLWVDFWLYDWLRQRIRSHUDWLRQLQDFFRUGDQFHZLWK)UHQFKVWDQGDUG1)3
no
Y  DFWLYH
no H[FOXGHG
ENCODER:
EC 7KHYLUWXDOHQFRGHURQWKHERDUGRSHUDWHVDVDQDQWLFUXVKLQJGHYLFHDQGPDQDJHVWKH
02
VORZLQJDQGSDUWLDORSHQLQJVWDUWSRLQWV
,IWKHJDWHVWULNHVDQREVWDFOHGXULQJWKHRSHQLQJRUFORVLQJVWDJHWKHYLUWXDOHQFRGHUFDXVHV
UHYHUVDORIWKHPRWLRQ7KHVHFRQGREVWDFOHGHWHFWHGLQWKHVDPHGLUHFWLRQFDXVHVWKHPRWRU
WRVWRS$QDODUPLVVLJQDOOHGLQERWKFDVHV VHHVHFWLRQRQDODUPV 
,WLVQHFHVVDU\WRDGMXVWWKHVHQVLWLYLW\RIWKHYLUWXDOHQFRGHUE\YDU\LQJWKHWLPHWKDWWKH
ERDUGZDLWVIRUEHIRUHFRQWUROOLQJUHYHUVDORIPRWLRQIURPDPLQLPXPRI0 VHFWRDPD[LPXP
RI10 VHFLQRQHVHFRQGVWHSV
00 PD[LPXPVHQVLWLYLW\
 10 PLQLPXPVHQVLWLYLW\
E721 10 532014 - Rev. D
Display Function Default 1
PARTIAL OPENING:
PO ,WLVSRVVLEOHWRDGMXVWWKHZLGWKRIWKHSDUWLDOOHDIRSHQLQJDVDSHUFHQWDJHRIWKHWRWDOJDWH
50
WUDYHO
$GMXVWDEOHIURPWRLQVWHSV
 00  QRSDUWLDORSHQLQJ
 01  PLQLPXPSDUWLDORSHQLQJ
 99  PD[LPXPSDUWLDORSHQLQJ
TIME-OUT
t ,WLVDGYLVDEOHWRVHWDYDOXHKLJKHUWKDQWKHWLPHWDNHQE\WKHJDWHWRRSHQRUFORVHIXOO\
2.0
$GMXVWDEOHIURP 0 WR59 VHFLQVHFRQGVWHSV6XEVHTXHQWO\GLVSOD\FKDQJHVWRPLQXWHV
DQGWHQVRIVHFRQGV VHSDUDWHGE\DSRLQW DQGWLPHLVDGMXVWHGLQVHFRQGVWHSVXSWR

ENGLISH
WKHPD[LPXPYDOXHRI9.5 PLQXWHV
(JLIWKHGLVSOD\VKRZV2.5 SDXVHWLPHLVPLQDQGVHFV
When using a system with MASTER/SLAVE configuration you must set a WORK TIME
on the MASTER unit that takes into account the movement time of both leaves.
OUT 1:
o1 $OORZVRXWSXW287 RSHQFROOHFWRU12 WREHDFWLYDWHGLQRQHRIWKHIROORZLQJIXQFWLRQV
00
00 $OZD\VHQDEOHG VXSSOLHV9YROWDJH ZLWKDPD[DEVRUSWLRQRIP$
01 )$,/6$)( PRQLWRUVWKHFRUUHFWRSHUDWLRQRIWKHFRQQHFWHGWUDGLWLRQDOSKRWRFHOOV
02 :$51,1*/,*+7 RIIZKHQFORVHGRQGXULQJRSHQLQJDQGRSHQSDXVHIODVKLQJGXULQJFORVLQJ
03 &2857(6</,*+7 VHHQH[WIXQFWLRQ
04 $/$50%$77(5<RSHUDWLRQ
05 JDWH23(1RU3$86('
06 JDWH&/26('
07 JDWHLQ027,21
08 JDWH23(1,1*
09 JDWH&/26,1*
1 0  $&7,9(VDIHW\
1 1  WLPHGRXWSXWWKDWFDQEHDFWLYDWHGE\VHFRQGUDGLRFKDQQHO VHHQH[WIXQFWLRQ
1 2  RXWSXWWKDWFDQEHDFWLYDWHGE\VHFRQGUDGLRFKDQQHO VWHSIXQFWLRQ
t1 TIMING OF OUT 1 (only if option 03 or 11 is selected at the previous step):
&DQ EH XVHG WR DGMXVW WLPLQJ RI RXWSXW 287 LI D WLPHG IXQFWLRQ ZDV VHOHFWHG
02
HJ03 RU 11 IURP1 WR99 PLQXWHVLQPLQXWHVWHSV
OPEN B / CLOSE / EDGE SAFETY DEVICE:
Ob ,WLVSRVVLEOHWRVHOHFWWKHXVHRI23(1%LQSXWDVSDUWLDORSHQLQJ&/26(FRPPDQGRU('*( 00
6$)(7<'(9,&(
00 23(1%
01 &/26(
02 6$)(7<('*(6$)(7< 1&FRQWDFW
If you select a function logic that involves the use of the CLOSE command (logic b,
bC, C) this function will be preset to 01 and it will not be possible to change it.
STOP / EDGE SAFETY DEVICE
SP ,WLVSRVVLEOHWRVHOHFWWKHXVHRI6723LQSXWDV6723RU('*(6$)(7<'(9,&( 00
00 6723
01 6$)(7<('*(6$)(7< 1&FRQWDFW
PARTIAL REVERSE:
IP ,WLVSRVVLEOHWRVHWWKHUHYHUVHW\SH FRPSOHWHRUSDUWLDO ZKHQDQREVWDFOHLVHQFRXQWHUHG no
RUZKHQDVDIHW\HGJHLVWULJJHUHG
Y 3DUWLDOUHYHUVHDFWLYDWLRQ:KHQDQREVWDFOHLVHQFRXQWHUHGRUZKHQDVDIHW\HGJH
LVWULJJHUHGWKHOHDIUHYHUVHVPRYHPHQWIRUDSSUR[LPDWHO\”DQGZLOOWKHQVWRS
no 3DUWLDOUHYHUVHGHDFWLYDWLRQ:KHQDQREVWDFOHLVHQFRXQWHUHGRUZKHQDOHDIVDIHW\
HGJHLVWULJJHUHGLWFRPSOHWHO\UHYHUVHVPRYHPHQWDQGZLOOSODFHLWVHOILQRSHQRU
FORVHGSRVLWLRQ
MOTOR LOCK:
Lc ,WLVSRVVLEOHWRVHOHFWWKHXVHRIWKHPRWRUORFNGXULQJEDWWHU\RSHUDWLRQ Y
Y WKHPRWRUORFNFRQWLQXHVWRRSHUDWHUHJXODUO\HYHQGXULQJEDWWHU\RSHUDWLRQ
no ZKHQWKHV\VWHPVZLWFKHVWREDWWHU\RSHUDWLRQWKHPRWRUORFNUHPDLQVRSHQ

E721 11 532014 - Rev. D


Display Function Default 1
SERVICE REQUEST - CYCLE COUNTER (combined with the two successive functions):
AS Y ZKHQWKHVHWQXPEHURIF\FOHVLVUHDFKHGZLWKVXFFHVVLYHIXQFWLRQVnc DQGnd WKH
no
V\VWHPFDUULHVRXWDQVHFSUHIODVKLQJVHTXHQFH LQDGGLWLRQWRWKHVHTXHQFHDOUHDG\
VHWXVLQJWKHPF IXQFWLRQ EHIRUHHDFKPRYHPHQW
no VXFFHVVLYHIXQFWLRQVnc DQGnd LQGLFDWHKRZPDQ\F\FOHVWKHV\VWHPKDVSHUIRUPHG
XSWRWKHPD[LPXPSRVVLEOHGLVSOD\RI99.990
If the number of cycles is higher than 99.990, the two successive functions
nc and nd will show 99 and 99 respectively.
7KLVIXQFWLRQPD\EHXVHIXOIRUVHWWLQJSURJUDPPHGPDLQWHQDQFHRSHUDWLRQVRUIRUFKHFNLQJ
ZRUNF\FOHVSHUIRUPHG
CYCLE PROGRAMMING (THOUSANDS):
nc 00
ENGLISH

,I AS   Y WKHGLVSOD\LQGLFDWHVWKHQXPEHURIWKRXVDQGVRIF\FOHVDIWHUZKLFKVHUYLFHLV
UHTXLUHG PD\EHVHWIURP0 WR99 
,IAS  no WKHGLVSOD\LQGLFDWHVWKHQXPEHURIWKRXVDQGVRIF\FOHVSHUIRUPHG7KHYDOXH
GLVSOD\HGLVXSGDWHGZLWKWKHVHTXHQFHRIF\FOHVLQWHUDFWLQJZLWKWKHYDOXHRInd 
If AS = no press keys + and - for 5 sec. to zero the cycle counter.
CYCLE PROGRAMMING (TENS):
nd ,IAS  Y WKHGLVSOD\LQGLFDWHVWKHQXPEHURIWHQVRIF\FOHVDIWHUZKLFKVHUYLFHLVUHTXLUHG
00
PD\EHVHWIURP0 WR99 
,IAS  no WKHGLVSOD\LQGLFDWHVWKHQXPEHURIWHQVRIF\FOHVSHUIRUPHG7KHYDOXHGLVSOD\HG
LVXSGDWHGZLWKWKHVHTXHQFHRIF\FOHVLQWHUDFWLQJZLWKWKHYDOXHRInc 
Example: if the system has performed 11.218, it will display nc = 11 and
nd = 21
STATUS OF AUTOMATED SYSTEM:
St ([LWIURPSURJUDPPLQJGDWDVWRUDJHDQGUHWXUQWRJDWHVWDWXVGLVSOD\
00  &/26(' 07 )$,/6$)(LQSURJUHVV
01 23(1 08 %86($6<GHYLFHFKHFNLQSURJUHVV
02  6WRSWKHQ“23(1” 09 3UHIODVKLQJWKHQ“23(1”
03  6WRSWKHQ“&/26(” 10 3UHIODVKLQJWKHQ“&/26(”
04 ,Q“3$86(” 11 23(1LQ3DUWLDO2SHQLQJ
05 'XULQJRSHQLQJVWDJH 12 LQ3$86(3DUWLDO2SHQLQJ
06 'XULQJFORVLQJVWDJH

6 STORING RADIO CODE 6.1 STORING DS RADIOCONTROLS


7KH FRQWURO ERDUG LV )LJ It is possible to store a maximum of 256
HTXLSSHG ZLWK DQ LQ codes divided between OPEN A and OPEN
WHJUDWHG GXDO FKDQQHO B/CLOSE.
GHFRGLQJ V\VWHP '6
6/+ /&5&  NQRZQ DV   2QWKH'6UDGLRFRQWUROVHOHFWWKHUHTXLUHG212))
201,'(& 7KLV V\VWHP FRPELQDWLRQRIWKHGLSVZLWFKHV
FDQ XVH DQ DGGLWLRQDO  3UHVVDQGKROGGRZQSXVKEXWWRQ+ 6: RU- 6: 
UHFHLYLQJ PRGXOH )LJ DQGWKHQSUHVVWKH6(783SXVKEXWWRQ 6: WRVWRUH
UHI DQGUDGLRFRQWUROVRIWKHVDPHIUHTXHQF\WRVWRUH WRWDO RSHQLQJ 23(1 $  RU SDUWLDO RSHQLQJ 23(1 %
ERWKWRWDORSHQLQJ 23(1$ DQGSDUWLDORSHQLQJ 23(1%  &/26( UHVSHFWLYHO\7KHFRUUHVSRQGLQJ/('ZLOOEHJLQ
RIWKHDXWRPDWHGV\VWHP WRIODVKVORZO\IRUVHFV
 5HOHDVHERWKSXVKEXWWRQV
The 3 types of radio coding (DS, SLH, LC/
RC) can co-exist at the same time on the  :LWKLQWKLVVHFRQGSHULRGSUHVVWKHUHTXLUHGSXVK
two channels. It is possible to enter up to EXWWRQRQWKHUDGLRFRQWURO
256 radio codes subdivided between OPEN  7KHFRUUHVSRQGLQJ/('ZLOOFRPHRQZLWKDIL[HGOLJKW
A and OPEN B. IRUVHFRQGDQGWKHQJRRIIWRLQGLFDWHWKHVHWWLQJ
To use the different coding systems on the KDVEHHQVWRUHG
same channel, finish the learning process  7RDGGRWKHUFRGHVRWKHUWKDQWKHRQH\RXKDYHUH
for each system and then repeat the pro- FHQWO\VWRUHGUHSHDWWKHSURFHGXUHIURPSRLQW
cedure for another..
Do not connect any radio devices on
SLAVE-configured equipment

E721 12 532014 - Rev. D


 7R XVH UDGLRFRQWUROV ZLWK WKH VDPH FRGH FRS\ WKH 6.3 STORING LC/RC RADIOCONTROLS
212)) FRPELQDWLRQ WR WKH RWKHU UDGLRFRQWUROV
ZLWKRXWWKHQHHGWRFKDQJHDQ\WKLQJRQWKHFRQWURO It is possible to store a maximum of
ERDUG 256 codes divided between OPEN A and
OPEN B/CLOSE.
6.2 STORING SLH RADIOCONTROLS
Use the LC/RC remote controls only with a
It is possible to store a maximum of 433 MHz receiving module.
256 codes divided between OPEN A and
OPEN B/CLOSE.  3UHVVDQGKROGGRZQSXVKEXWWRQ+ 6: RU- 6: 
DQGWKHQSUHVVWKH6(783SXVKEXWWRQ 6: WRVWRUH
 2QWKH6/+UDGLRFRQWUROSUHVVDQGKROGGRZQ3DQG WRWDO RSHQLQJ 23(1 $  RU SDUWLDO RSHQLQJ 23(1 %
3VLPXOWDQHRXVO\ &/26( UHVSHFWLYHO\7KHFRUUHVSRQGLQJ/('ZLOOEHJLQ
 7KHUDGLRFRQWURO/('ZLOOEHJLQWRIODVK WRIODVKVORZO\IRUVHFV
 5HOHDVHERWKSXVKEXWWRQV  5HOHDVHWKHSXVKEXWWRQ

ENGLISH
 3UHVVDQGKROGGRZQSXVKEXWWRQ+ 6: RU- 6:   :LWKLQWKLVVHFRQGSHULRGSUHVVWKHUHTXLUHGSXVK
DQGWKHQSUHVVWKH6(783SXVKEXWWRQ 6: WRVWRUH EXWWRQRQWKH/&5&UHPRWHFRQWURO
WRWDO RSHQLQJ 23(1 $  RU SDUWLDO RSHQLQJ 23(1 %  7KH/('ZLOOFRPHRQZLWKDIL[HGOLJKWIRUVHFRQG
&/26( UHVSHFWLYHO\7KHFRUUHVSRQGLQJ/('ZLOOEHJLQ LQGLFDWLQJ WKDW WKH XQLW KDV EHHQ VWRUHG DQG WKHQ
WRIODVKVORZO\IRUVHFV UHVXPH IODVKLQJ IRU DQ DGGLWLRQDO  VHFRQGV GXULQJ
 5HOHDVHERWKSXVKEXWWRQV ZKLFKWLPHDQRWKHUUDGLRFRQWUROPD\EHVWRUHG
 :LWKLQWKLVVHFSHULRGZKLOHWKHUDGLRFRQWURO/('LVVWLOO  2QFH WKH  VHFRQGV DUH XS WKH /(' ZLOO JR RII WR
IODVKLQJSUHVVDQGKROGGRZQWKHUHTXLUHGSXVKEXWWRQ LQGLFDWHWKDWWKHSURFHGXUHLVFRPSOHWH
RQWKHUDGLRFRQWURO WKHUDGLRFRQWURO/('ZLOOFRPHRQ
ZLWKDIL[HGOLJKW  6.3.1 STORING LC/RC RADIOCONTROLS REMOTELY
 7KHFRUUHVSRQGLQJ/('ZLOOFRPHRQZLWKDIL[HGOLJKW :LWK /&5& UDGLRFRQWUROV RWKHU UDGLRFRQWUROV PD\ EH
IRUVHFRQGVDQGWKHQJRRIIWRLQGLFDWHWKHVHWWLQJ VWRUHGLQUHPRWHPRGHLHZLWKRXWRSHUDWLQJGLUHFWO\RQ
KDVEHHQVWRUHG WKHERDUGXVLQJDSUHYLRXVO\VWRUHGUDGLRFRQWURO
 5HOHDVHWKHUDGLRFRQWUROSXVKEXWWRQ  2EWDLQ D UDGLRFRQWURO DOUHDG\ VWRUHG RQ RQH RI LWV
FKDQQHOV 23(1$RU23(1%&/26( 
 3UHVVWKHVWRUHGUDGLRFRQWUROSXVKEXWWRQWZLFHLQTXLFN
VXFFHVVLRQ  3UHVVDQGKROGGRZQSXVKEXWWRQV3DQG3VLPXOWD
QHRXVO\XQWLOERWK/('VIODVKVORZO\IRUVHFV
The automated system will carry out an  :LWKLQVHFRQGVSXVKWKHSUHYLRXVO\VWRUHGUDGLRFRQ
opening control. Ensure the automated WUROSXVKEXWWRQWRDFWLYDWHWKHOHDUQLQJVWDJHRQWKH
device is free of any obstacle by people VHOHFWHGFKDQQHO
or things.
 7KH/('RQWKHERDUGFRUUHVSRQGLQJWRWKHFKDQQHO
7RHQDEOHRWKHUUDGLRFRQWUROVZLWKWKHVDPHV\VWHPFRGH EHLQJVWRUHGIODVKHVIRUVHFRQGVZLWKLQZKLFKWLPH
WUDQVIHUWKHV\VWHPFRGHRIWKHVWRUHGUDGLRFRQWUROSXVK WKHFRGHRIDQRWKHUUDGLRFRQWUROPXVWEHVHQW
EXWWRQWRWKHFRUUHVSRQGLQJSXVKEXWWRQRIWKHUDGLRFRQ  7KH/('ZLOOFRPHRQZLWKDIL[HGOLJKWIRUVHFRQG
WUROVWREHDGGHGIROORZLQJWKHSURFHGXUHEHORZ LQGLFDWLQJ WKDW WKH XQLW KDV EHHQ VWRUHG DQG WKHQ
D 2QWKHVWRUHGUDGLRFRQWUROSUHVVDQGKROGGRZQ UHVXPH IODVKLQJ IRU DQ DGGLWLRQDO  VHFRQGV GXULQJ
3DQG3VLPXOWDQHRXVO\ ZKLFK WLPH RWKHU UDGLRFRQWUROV PD\ EH VWRUHG DQG
E 7KHUDGLRFRQWURO/('ZLOOEHJLQWRIODVK WKHQLWZLOOJRRII
F 5HOHDVHERWKSXVKEXWWRQV
6.4 RADIOCONTROLS DELETION PROCEDURE
G 3UHVVWKHVWRUHGSXVKEXWWRQDQGKROGGRZQ WKH
7R GHOHWH ALL WKH FRGHV RI WKH UDGLRFRQWUROV HQWHUHG
UDGLRFRQWURO/('ZLOOFRPHRQZLWKDIL[HGOLJKW 
VLPSO\SUHVVGRZQWRJHWKHUWKHWZRSXVKEXWWRQV+ 6: 
H %ULQJWKHUDGLRFRQWUROVFORVHUWRRQHDQRWKHUSUHVV DQG- 6: WKHQSUHVVWKH6(783SXVKEXWWRQ 6: IRU
DQGKROGGRZQWKHFRUUHVSRQGLQJSXVKEXWWRQRI VHFRQGDQGKROGWKHILUVWWZRSXVKEXWWRQVSUHVVHGIRU
WKHUDGLRFRQWUROWREHDGGHGUHOHDVLQJRQO\RQFH VHFV
WKH/('RQWKHUDGLRFRQWUROKDVLVVXHGDGRXEOH ‡ 7KH  /('V 5$',2 DQG 5$',2 ZLOO IODVK TXLFNO\ IRU
IODVKWRLQGLFDWHWKDWLWKDVEHHQVWRUHG VHFV
I 3UHVVWKHVWRUHGUDGLRFRQWUROSXVKEXWWRQWZLFHLQ ‡ 7KH/('VZLOOFRPHRQZLWKDIL[HGOLJKWIRUVHFRQGV
TXLFNVXFFHVVLRQ DQGWKHQJRRII GHOHWLRQFDUULHGRXW 
The automated system will carry out an ‡ 5HOHDVHERWKSXVKEXWWRQV
opening control. Ensure the automated
device is free of any obstacle by people This operation is NOT reversible. All the codes
or things. of the radiocontrols stored as OPEN A and
as OPEN B/CLOSE will be deleted.

E721 13 532014 - Rev. D


7 OPERATIONAL START-UP
7.1 CHECKING THE LEDS
$IWHUPDNLQJDOOWKHFRQQHFWLRQVDQGSRZHULQJWKHERDUGFKHFNWKHVWDWXVRIWKH/('VDJDLQVWWKHVWDWXVRIWKHLQSXWV
LQWKHIROORZLQJWDEOH LQ)LJWKHFRQGLWLRQZKHUHWKHDXWRPDWHGV\VWHPLVFORVHGLQVWDQGE\ 
7KHVH/('VLQGLFDWHWKHVWDWXVRIWKHERDUGLQSXWVDQGDUHRIFRQVLGHUDEOHLPSRUWDQFHWRDXWRPDWHGV\VWHPPRYHPHQW
1RWHWKDW  LED ON FRQWDFWFORVHG  LED OFF FRQWDFWRSHQ

< (1) F
BUS 2EASY
< (2)
ENGLISH

< OPEN A -
< GND
< OPEN B / CLOSE < SAFE
+

R
A
C

1
RADIO XF

R
2
IO

E
FC
FC

IO

O
< STOP / SAFE

W
R
D

O
R
A

P
R
< FSW OP

R
SETUP
< GND
< FSW CL
< +24

USB

BATTERY
RELEASE
Y
R
)

R
F

OUT
-L

E
S

S
E IN

TO
R M

K
K
K
T
-N

N
T EC

C
T
T RI

C
C
(P A

- +
A

LO
LA

LO
LO
M

R
P

M
B
<

<

<

<

<

<

<
<
<

)LJ

/HGV)&$DQG)&&UHSUHVHQWWKH1&FRQWDFWVRIWKHOLPLW The STOP (SAFE), FSW CL, FSW OP, OPEN B inputs
VZLWFKEXLOWLQWRWKHERDUGWKDWRSHQZKHQHQJDJHGDQG configured as SAFE are safety inputs with N.C.
WXUQRIIWKHDVVRFLDWHG/(' (Normally Closed) contact and therefore the
corresponding LEDs must be ON when the
automated system is at rest, and off when
$XWRPDWHG V\VWHP )&$ the connected device is used.
&/26(' )&&  )&&HQJDJHG
The OPEN A, OPEN B/CLOSE inputs are inputs
$XWRPDWHG V\VWHP )&$  )&$HQJDJHG with N.O. (Normally Open) contact and
23(1 therefore the corresponding LEDs must be
)&&
OFF when the automated system is at rest,
and on when the connected device is used.
Tab. 3 - Description of POWER LED
When using equipment programmed as
Fixed ON 0DLQVSRZHUHG SLAVE the LEDs corresponding to terminal
board J13 must be off.
Flashing %DWWHU\SRZHUHG
ERROR LED flashing indicates alarm in
progress (situation does not impair gate
Off %RDUGRII operation)
ERROR LED on with a fixed light indicates
an error in progress (situation that locks
operation until the cause of the error has
7.2 BATTERY OPERATION been removed)
ATTENTION
7RRSWLPLVHHQHUJ\FRQVXPSWLRQDQGSURWHFWWKHFKDUJHGXULQJEDWWHU\RSHUDWLRQZKHQWKHDXWRPDWHGV\VWHPLV
VWRSSHGDQGWKHV\VWHPLVRQVWDQGE\WKH/&'GLVSOD\WKH%86HDV\/('DQGWKH)&&DQG)&$/('ZLOOEHRII
ZKLOHWKH32:(5/('IODVKHV
,QWKLVSKDVHLWLVLQDQ\FDVHSRVVLEOHWRYLHZWKHVWDWHRIWKHDXWRPDWHGV\VWHP7RGRWKLVLWLVVXIILFLHQWWREULHIO\SUHVV
“”RQWKHERDUG)ROORZLQJEULHISUHVVXUHWKH/&'GLVSOD\VKRZVWKHVWDWHRIWKHDXWRPDWHGV\VWHPIRUDSSUR[LPDWHO\
VHFRQGVWRWKHQJRRIIDJDLQ,QVWHDGGXULQJQRUPDORSHUDWLRQDOOWKHGLDJQRVWLF/('VDQGWKHGLVSOD\VWDWHVLJQDOV
EHFRPHFRQVLVWHQWZLWKWKHVWDWHRIWKHDXWRPDWHGV\VWHP VHH)LJ 
E721 14 532014 - Rev. D
7.3 POSITIONING LIMIT SWITCHES
To ensure correct positioning of the limit switch magnets, the control unit must be installed and
correctly connected with all control and safety accessories.

7KHRSHUDWRULVHTXLSSHGZLWKDPDJQHWLFOLPLWVZLWFKVHQVRUEXLOWGLUHFWO\LQWRWKHHOHFWURQLFFRQWUROERDUG
7KHJDWHLVVWRSSHGGXULQJRSHQLQJRUFORVLQJZKHQWKHSRODULVHGPDJQHWVHFXUHGWRWKHXSSHUSDUWRIWKHUDFN
DFWLYDWHVWKHVHQVRU
 &KHFNWKDWWKHRSHUDWRULVVHWIRUPDQXDORSHUDWLQJPRGHDVGHVFULEHGLQWKHLQVWUXFWLRQV
IRUWKHRSHUDWRU
 0RYHWKHJDWHWRopeningSRVLWLRQPDQXDOO\OHDYLQJPPIURPWKHOLPLWVZLWFKPH
FKDQLFDOVWRS VHH)LJ 

A
C

R O1

2
FC
FC

IO
 6OLGHWKHPDJQHWZLWKWKHCIRCLERQWKHUDFNLQWKHGLUHFWLRQRIWKHPRWRU$VVRRQDV

I
D

ENGLISH
A

E
R
WKH/('IRUWKH)&$OLPLWVZLWFKRQWKHERDUGJRHVRIIVHFXUHZLWKWKHDSSURSULDWHVFUHZV
 0RYHWKHJDWHWRclosingSRVLWLRQPDQXDOO\OHDYLQJPPIURPWKHOLPLWVZLWFKPH
FKDQLFDOVWRS
 6OLGHWKHPDJQHWZLWKWKHSQUARERQWKHUDFNLQWKHGLUHFWLRQRIWKHPRWRU$VVRRQDV
WKH/('IRUWKH)&&OLPLWVZLWFKRQWKHERDUGJRHVRIIVHFXUHZLWKWKHDSSURSULDWHVFUHZV
 &KHFNWKDWWKHUHOHYDQWOLPLWVZLWFK/('JRHVRIIFRUUHFWO\DWWKHHQGRIWKHRSHQLQJDQG

A
C

R O1

2
FC
FC

IO
I
FORVLQJPRYHPHQWDQGPDNHWKHQHFHVVDU\FKDQJHVWRWKHSRVLWLRQRIWKHOLPLWVZLWFK

R
A

E
R
PDJQHWSRVLWLRQLIQHFHVVDU\
To avoid damage to the operator and/or interruptions in the operation of the
automated system, approximately 40 mm must be left from the mechanical
limit switch stops.

For correct opera-


tion of the opera-
tor, the magnet with
the CIRCLE must be
used as an OPEN-
ING limit switch and
the magnet with the
SQUARE must be used
as a CLOSING limit
switch.
(SEE FIG. 17)
When using a system
with MASTER/SLAVE
configuration, the
limit switch magnets
must be installed as
shown in Fig. 18.

)LJ

MASTER/SLAVE

)LJ

E721 15 532014 - Rev. D


7.4 MASTER / SLAVE CONFIGURATIONS
6KRXOG\RXQHHGWREXLOGDV\VWHPZLWKRSSRVLQJOHDYHVWKDWPXVWEHDFWLYDWHGVLPXOWDQHRXVO\
IRURSHQLQJDQGFORVLQJWKHJDWH\RXPXVWFRQQHFWDQGFRQILJXUHWZR(GHYLFHVLQ0DVWHU6ODYHPRGH
7KH0$67(5HTXLSPHQW SDUDPHWHUC t RIWKHILUVWSURJUDPPLQJOHYHOFRQILJXUHGDVM A  PXVWKDYHDOOWKHQHFHVVDU\
FRQQHFWLRQV IRU FRUUHFW RSHUDWLRQ RI WKH V\VWHP SKRWRFHOOV VDIHW\ VZLWFKHV UDGLR RSHQLQJ SXOVHV IODVKLQJ OLJKW 
ZKLOHWKH6/$9(HTXLSPHQW SDUDPHWHUC t RIWKHILUVWSURJUDPPLQJOHYHOFRQILJXUHGDVS L PXVWQRWEHZLUHGZLWK
WHUPLQDOERDUG-DVDOOWKHLQSXWVSUHVHQWDUHFRPSOHWHO\LJQRUHG7KHWZRGHYLFHVZLOOFRPPXQLFDWHZLWKHDFK
RWKHUWKURXJK%86($6<XVLQJWZRSROHPOLARISEDZLULQJRQWKH-WHUPLQDOERDUG
7KH0$67(5GHYLFHZLOOFRPSOHWHO\FRQWUROWKH6/$9(GHYLFHWKURXJK%86($6<DQGZLOOPDQDJHDOOWKHPRYHPHQWV
DQGWLPHRIERWKOHDYHV
ENGLISH

Avoid any type of connection and wiring to terminal board J13 of the SLAVE unit.

The BUS connection between the two boards must be POLARISED following the sequence of the
poles of the J12 terminal board (POLE (1) - POLE (2)) - (see Fig. 19).

When a unit is configured as a SLAVE, this will force the values of some programming parameters
no longer displayed in the menu (LO-PA-Pb-Ph-Op). By placing the board in MASTER mode
again, the previously forced values are stored in the program.

7.4.1 MASTER / SLAVE WIRING

(1) (1)
BUS 2 EASY BUS 2 EASY
(2) (2)

'RQRWFRQQHFW
DQ\WKLQJWRWKLV
WHUPLQDOERDUG

E721 MASTER E721 SLAVE


)LJ

7.4.2 MASTER/SLAVE SETUP PROCEDURE

The SETUP request signalled by the flashing S0 on the display can occur both on the MASTER unit
and on the SLAVE unit. In the latter case, the MASTER unit will display an error 91 . In any case, the
SETUP procedure can only be started from the MASTER unit.

7R6(783D0$67(56/$9(V\VWHPIROORZWKHVWHSVEHORZ

 5HOHDVHERWKOHDYHVSODFHWKHPLQWKHPLGGOHRIWUDYHODQGORFNDJDLQ VHHSURFHGXUHQR3DU6(783


 .HHSSUHVVHGWKH6(783EXWWRQRQWKH0$67(5ERDUGXQWLOWKH0$67(5JDWHEHJLQVWRPRYH
 $WWKLVSRLQWWKH0$67(5JDWHZLOOSHUIRUPDFRPSOHWH6(783SURFHGXUH VHH3DU6(783
 2QFH\RXKDYHFRUUHFWO\FRPSOHWHGWKH6(783RIWKH0$67(5ERDUGWKHFRPSOHWH6(783SURFHGXUHRIWKH6/$9(
ERDUGEHJLQV VHH3DU6(783 
 2QFHWKLVSURFHGXUHKDVDOVREHHQFRPSOHWHGWKH0$67(5FKHFNVWKHSRVLWLRQRIWKH6/$9(OHDIDQGSODFHVLWLQ
WKHVDPHSRVLWLRQ RSHQRUFORVHG DVWKH0$67(5OHDI
 3URFHGXUHFRPSOHWHG

In case of error or non-completion of the above-mentioned SETUP procedure, you must repeat it
completely starting from point no.1.

E721 16 532014 - Rev. D


7.4 SETUP 9 ALARM AND ERROR SIGNALS
When the board is powered when no SETUP ,IalarmsRFFXU FRQGLWLRQVWKDWGRQRWLPSDLUWKHRSHUD
has ever been carried out, or if the board WLRQRIWKHJDWH RUerrors FRQGLWLRQVWKDWORFNWKHJDWH
requires it, the code S0 will flash on the RSHUDWLRQ  WKH GLVSOD\ VKRZV D QXPEHU UHODWLQJ WR WKH
display together with the SETUP LED to in- FXUUHQWFRQGLWLRQ
dicate that SETUP must be carried out. The ALARM or ERROR signals disappear at
the next cycle only if the triggering cause
To ensure the effective outcome of the is removed.
SETUP procedure, carefully check the cor-
rect polarity of the magnetic limit switches 9.1 ALARMS
as described in the previous paragraph. When an ALARM occurs, the ERROR LED
3URFHHGDVIROORZVWRFDUU\RXWWKH6(783 begins to flash and a number relating to
the current fault appears on the display
1. Place the gate at half its travel (very important for a when the + and - keys are pressed.

ENGLISH
successful SETUP) and check that both the FCA and 7DELQGLFDWHVDOOWKHDODUPVWKDWPD\EHVKRZQRQWKH
FCC LEDs are on. Otherwise, the board will signal GLVSOD\
error 12 (see tab. 5)
 3UHVVDQGKROGWKH6(783 6: SXVKEXWWRQXQWLOWKH Tab. 4 - Alarms
JDWHEHJLQVWRPRYHVORZO\DQGVWRSVZKHQLWUHDFKHV
WKHOLPLWVZLWFK,IWKHOLPLWVZLWFKUHDFKHGLVWKHFORVLQJ 22 /LPLWHG02725FXUUHQW
VZLWFK ZLWKWKHSQUARE WKHGHYLFHVWRUHVWKDWSRLQW 24 /$03RXWSXWVKRUWFLUFXLWHG
DVWKHclosingVWRSFRQYHUVHO\LIWKHOLPLWVZLWFKLVWKH
RSHQLQJ VZLWFK ZLWK WKH CIRCLE  WKH GHYLFH VWRUHV
27 2EVWDFOHGHWHFWLRQ YLVLEOHIRUVHFV
;)UDGLRFRGHPHPRU\PRGXOHIXOO YLVLEOH
WKDWSRLQWDVWKHopeningVWRS'XULQJWKDWVWDJHS 1 30 IRUVHFV
IODVKHVRQWKHGLVSOD\
 7KHJDWHDXWRPDWLFDOO\EHJLQVWRPRYHVORZO\LQWKH 40 6HUYLFHUHTXHVW
RSSRVLWHGLUHFWLRQDQGWKHQVWRSVZKHQLWUHDFKHVWKH 46 )RUFHGGHIDXOWSURJUDPPLQJUHVHW
OLPLWVZLWFK,IWKHOLPLWVZLWFKUHDFKHGLVWKHRSHQLQJ
VZLWFK ZLWKWKHSQUARE WKHGHYLFHVWRUHVWKDWSRLQW
9.2 ERRORS
DVWKHopeningVWRSFRQYHUVHO\LIWKHOLPLWVZLWFKLV When an ERROR occurs, LED DL20 comes
WKHFORVLQJVZLWFK ZLWKWKHSQUARE WKHGHYLFHVWRUHV on with a fixed light and a number relating
WKDW SRLQW DV WKH closing VWRS 'XULQJ WKDW VWDJH to the current fault appears on the display
S 3 IODVKHVRQWKHGLVSOD\ when the + and - keys are pressed.
 $FFRUGLQJ WR WKH ILQDO OLPLW VZLWFK UHDFKHG WKH GH 7DELQGLFDWHVDOOWKHHUURUVWKDWPD\EHVKRZQRQWKH
YLFHWDNHVXSDVWDWXVRIFORVHG 0 0 RURSHQ 0 1  GLVSOD\
,QWKHVHFRQGFDVHLVVXHDQ23(1SXOVHWRFORVHWKH
JDWH Tab. 5 - Errors
01 %RDUGIDXOW\
03 0RWRUIDXOW\
8 TESTING THE AUTOMATED SYSTEM 0RWRUORFNORFNHGFORVHG FKHFNWKHPRWRU
$IWHULQVWDOODWLRQDQGSURJUDPPLQJFKHFNWKHV\VWHPLV 06 ORFNDQGUHSODFHLIQHFHVVDU\
RSHUDWLQJFRUUHFWO\$ERYHDOOFKHFNWKDWWKHVDIHW\GH *DWHWRRKHDY\RUWRRPXFKIULFWLRQ WU\WR
YLFHVRSHUDWHFRUUHFWO\DQGHQVXUHWKDWWKHFXUUHQWVDIHW\ 07 LQFUHDVHPRWRUSRZHU
UHJXODWLRQVDUHPHW %86($6<GHYLFHHUURU HJVDPHDGGUHVV
08 RQWZRSKRWRFHOOSDLUVFKHFNDGGUHVV
10 %RWKOLPLWVZLWFKHVZLWKWKHVDPHSRODULW\
Remember that the second programming /LPLWVZLWFKHQJDJHGDWWKHEHJLQQLQJRI
level features the encoder configuration 12 6(783
parameter (parameter EC). This “virtual”
encoder located on the board acts as 15 7LPHRXWILQLVKHG
an anti-crushing device. During the open/ 1RFRPPXQLFDWLRQZLWKWKH6/$9(XQLW
closing phase, should the gate collide 90 6/$9(XQLWPLVVLQJ
with an obstacle, the “virtual” encoder
will cause the motion to reverse. At the 91 (UURURQWKH6/$9(XQLW
next motion in the same direction, an 92 (UURURQWKH6/$9(XQLW
obstacle in the same position will cause
the motor to stop. It is essential to correctly Errors 9 0 9 1 and 9 2 are displayed
configure this parameter to adjust the only on E721 configured as MASTER and
correct sensitivity of the “virtual” encoder in particular 9 1 and 9 2 indicate errors
with respect to obstacles during motion. present on the SLAVE unit. Should such
errors be displayed, we recommend you
check on the SLAVE unit the type of error
shown on the display to solve it and restore
correct operation of the system.

E721 17 532014 - Rev. D


10 FUNCTION LOGICS
In brackets, the effects on the other inputs when If enabled during leaf motion, the SAFE command
the pulse is active. will immediately and completely reverse it; when
the automated system is stopped, if kept enabled
The CLOSE command can be enabled on the OPEN it will prevent its movement.
B input from programming level 2.
LOGIC "E" PULSES
STATUS OF AUTOMATED SYSTEM OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP

&/26(' RSHQVWKHJDWH RSHQVWKHJDWHSDUWLDOO\ QRHIIHFW QRHIIHFW QRHIIHFW QRHIIHFW QRHIIHFW


23(1LQKLELWHG 23(1LQKLELWHG 23(1LQKLELWHG

ORFNVDQGRSHQVRQ
'85,1*23(1,1* ORFNVRSHUDWLRQ  ORFNVRSHUDWLRQ UHFORVHVWKHJDWH ORFNVRSHUDWLRQ VHHQGOHYHOSURJ QRHIIHFW GLVHQJDJHPHQW 23(1
ORFNVVWRUHV&/26(

QRHIIHFW QRHIIHFW QRHIIHFW


ENGLISH

23(1 UHFORVHVWKHJDWH  UHFORVHVWKHJDWH UHFORVHVWKHJDWH 23(1&/26(LQKLELWHG QRHIIHFW &/26(LQKLELWHG 23(1&/26(LQKLELWHG

ORFNVDQGRSHQVRQ
UHYHUVHVWRRSHQLQJ VHH GLVHQJDJHPHQW 23(1
'85,1*&/26,1* UHRSHQVWKHJDWH UHRSHQVWKHJDWH QRHIIHFW ORFNVRSHUDWLRQ QRHIIHFW QGOHYHOSURJ  ORFNVVWRUHV&/26(

/2&.(' FORVHVWKHJDWH FORVHVWKHJDWH FORVHVWKHJDWH QRHIIHFW QRHIIHFW QRHIIHFW QRHIIHFW 23(1ORFNV


23(1&/26(LQKLELWHG 23(1LQKLELWHG &/26(LQKLELWHG VWRUHV&/26(
LOGIC "EP" PULSES
STATUS OF AUTOMATED SYSTEM OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP

&/26(' RSHQVWKHJDWH RSHQVWKHJDWHSDUWLDOO\ QRHIIHFW QRHIIHFW QRHIIHFW QRHIIHFW QRHIIHFW


23(1LQKLELWHG 23(1LQKLELWHG 23(1LQKLELWHG

ORFNVDQGRSHQVRQ
DURING OPENING ORFNVRSHUDWLRQ  ORFNVRSHUDWLRQ UHFORVHVWKHJDWH ORFNVRSHUDWLRQ VHHQGOHYHOSURJ QRHIIHFW GLVHQJDJHPHQW 23(1
ORFNVVWRUHV&/26(

OPEN UHFORVHVWKHJDWH  UHFORVHVWKHJDWH UHFORVHVWKHJDWH QRHIIHFW QRHIIHFW QRHIIHFW QRHIIHFW


23(1&/26(LQKLELWHG &/26(LQKLELWHG 23(1&/26(LQKLELWHG

ORFNVDQGRSHQVRQ
UHYHUVHVWRRSHQLQJ VHH GLVHQJDJHPHQW 23(1
DURING CLOSING ORFNVRSHUDWLRQ ORFNVRSHUDWLRQ QRHIIHFW ORFNVRSHUDWLRQ QRHIIHFW QGOHYHOSURJ  ORFNVVWRUHV&/26(
UHVXPHVPRWLRQLQUHYHUVH UHVXPHVPRWLRQLQUHYHUVH QRHIIHFW QRHIIHFW QRHIIHFW QRHIIHFW 23(1ORFNV
LOCKED GLUHFWLRQ$IWHU6723DOZD\V GLUHFWLRQ$IWHU6723DOZD\V FORVHVWKHJDWH 23(1&/26(LQKLELWHG 23(1LQKLELWHG &/26(LQKLELWHG VWRUHV&/26(
FORVHV FORVHV
LOGIC "A" PULSES
STATUS OF AUTOMATED SYSTEM OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP
RSHQVWKHJDWHSDUWLDOO\
RSHQVDQGUHFORVHVDIWHU DQGFORVHVLWDIWHUSDXVH QRHIIHFW QRHIIHFW QRHIIHFW
CLOSED WKHSDXVHWLPH QRHIIHFW 23(1LQKLELWHG 23(1LQKLELWHG QRHIIHFW 23(1LQKLELWHG
WLPH%
ORFNVDQGRSHQVRQ
DURING OPENING QRHIIHFW  QRHIIHFW UHFORVHVWKHJDWH ORFNVRSHUDWLRQ VHHQGOHYHOSURJ QRHIIHFW GLVHQJDJHPHQW
VWRUHV&/26(

OPEN IN PAUSE UHORDGVSDXVHWLPH  UHORDGVSDXVHWLPH% UHFORVHVWKHJDWH ORFNVRSHUDWLRQ QRHIIHFW UHORDGVSDXVHWLPH UHORDGVSDXVHWLPH


&/26(LQKLELWHG &/26(LQKLELWHG

UHYHUVHVWRRSHQLQJ VHH ORFNVDQGRSHQVRQ


DURING CLOSING UHRSHQVWKHJDWH UHRSHQVWKHJDWH QRHIIHFW ORFNVRSHUDWLRQ QRHIIHFW QGOHYHOSURJ  GLVHQJDJHPHQW
VWRUHV&/26(

LOCKED FORVHVWKHJDWH FORVHVWKHJDWH FORVHVWKHJDWH QRHIIHFW QRHIIHFW QRHIIHFW QRHIIHFW


23(1&/26(LQKLELWHG 23(1LQKLELWHG &/26(LQKLELWHG 23(1&/26(LQKLELWHG

LOGIC "A1" PULSES


STATUS OF AUTOMATED SYSTEM OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP
RSHQVWKHJDWHSDUWLDOO\
RSHQVDQGUHFORVHVDIWHU DQGFORVHVLWDIWHUSDXVH QRHIIHFW QRHIIHFW QRHIIHFW
CLOSED WKHSDXVHWLPH QRHIIHFW 23(1LQKLELWHG 23(1LQKLELWHG QRHIIHFW 23(1LQKLELWHG
WLPH%

FRQWLQXHVWRRSHQDQG ORFNVDQGRSHQVRQ
DURING OPENING QRHIIHFW  QRHIIHFW UHFORVHVWKHJDWH ORFNVRSHUDWLRQ VHHQGOHYHOSURJ UHFORVHVLPPHGLDWHO\ GLVHQJDJHPHQW
VWRUHV&/26(

OPEN IN PAUSE UHORDGVSDXVHWLPH  UHORDGVSDXVHWLPH% UHFORVHVWKHJDWH ORFNVRSHUDWLRQ QRHIIHFW ORFNVDQGLPPHGLDWHO\ UHORDGVSDXVHWLPH


FORVHVRQGLVHQJDJHPHQW &/26(LQKLELWHG

UHYHUVHVWRRSHQLQJ VHH ORFNVDQGRSHQVRQ


DURING CLOSING UHRSHQVWKHJDWH UHRSHQVWKHJDWH QRHIIHFW ORFNVRSHUDWLRQ QRHIIHFW QGOHYHOSURJ  GLVHQJDJHPHQW
VWRUHV&/26(

LOCKED FORVHVWKHJDWH FORVHVWKHJDWH FORVHVWKHJDWH QRHIIHFW QRHIIHFW QRHIIHFW QRHIIHFW


23(1&/26(LQKLELWHG 23(1LQKLELWHG &/26(LQKLELWHG 23(1&/26(LQKLELWHG
 'XULQJWKHSDUWLDORSHQLQJF\FOHDQ23(1$SXOVHFDXVHVWRWDORSHQLQJ
E721 18 532014 - Rev. D
LOGIC "AP" PULSES
STATUS OF AUTOMATED SYSTEM OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP
RSHQVWKHJDWHSDUWLDO \
RSHQVDQGUHFORVHVDIWHU DQGFO QRHIIHFW QRHIIHFW QRHIIHFW
CLOSED WKHSDXVHWLPH RVHVLWDIWHUSDXVH QRHIIHFW 23(1LQKLELWHG 23(1LQKLELWHG QRHIIHFW 23(1LQKLELWHG
WLPH%
ORFNVDQGRSHQVRQ
DURING OPENING ORFNVRSHUDWLRQ  ORFNVRSHUDWLRQ UHFORVHVWKHJDWH ORFNVRSHUDWLRQ VHHQGOHYHOSURJ QRHIIHFW GLVHQJDJHPHQW 23(1
ORFNVVWRUHV&/26(

OPEN IN PAUSE ORFNVRSHUDWLRQ  ORFNVRSHUDWLRQ UHFORVHVWKHJDWH ORFNVRSHUDWLRQ QRHIIHFW UHORDGVSDXVHWLPH UHORDGVSDXVHWLPH


&/26(LQKLELWHG &/26(LQKLELWHG

DURING CLOSING UHRSHQVWKHJDWH UHRSHQVWKHJDWH QRHIIHFW ORFNVRSHUDWLRQ QRHIIHFW UHYHUVHVWRRSHQLQJ VHH GLOVRHQJDJHPHQW 23(1
FNVDQGRSHQVRQ
QGOHYHOSURJ  ORFNVVWRUHV&/26(

QRHIIHFW QRHIIHFW QRHIIHFW QRHIIHFW

ENGLISH
LOCKED FORVHVWKHJDWH FORVHVWKHJDWH FORVHVWKHJDWH 23(1&/26(LQKLELWHG 23(1LQKLELWHG &/26(LQKLELWHG 23(1&/26(LQKLELWHG

LOGIC "At" (2) PULSES


STATUS OF AUTOMATED SYSTEM OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP
RSHQVWKHJDWHSDUWLDO \
RSHQVDQGUHFORVHVDIWHU DQGFO QRHIIHFW QRHIIHFW QRHIIHFW
CLOSED WKHSDXVHWLPH RVHVLWDIWHUSDXVH QRHIIHFW 23(1LQKLELWHG 23(1LQKLELWHG QRHIIHFW 23(1LQKLELWHG
WLPH%
ORFNVDQGRSHQVRQ
DURING OPENING QRHIIHFW  QRHIIHFW UHFORVHVWKHJDWH ORFNVRSHUDWLRQ UHYHUVHVWRFORVLQJ  QRHIIHFW GLVHQJDJHPHQW
VWRUHV&/26(

OPEN IN PAUSE UHORDGVSDXVHWLPH  UHORDGVSDXVHWLPH UHFORVHVWKHJDWH ORFNVRSHUDWLRQ QRHIIHFW UHORDGVSDXVHWLPH UHORDGVSDXVHWLPH


&/26(LQKLELWHG &/26(LQKLELWHG

UHYHUVHVWRRSHQLQJ VHH ORFNVDQGRSHQVRQ


DURING CLOSING UHRSHQVWKHJDWH UHRSHQVWKHJDWH QRHIIHFW ORFNVRSHUDWLRQ QRHIIHFW QGOHYHOSURJ  GLVHQJDJHPHQW
VWRUHV&/26(

LOCKED FORVHVWKHJDWH FORVHVWKHJDWH FORVHVWKHJDWH QRHIIHFW QRHIIHFW QRHIIHFW QRHIIHFW


23(1&/26(LQKLELWHG 23(1LQKLELWHG &/26(LQKLELWHG 23(1&/26(LQKLELWHG

LOGIC "S" PULSES


STATUS OF AUTOMATED SYSTEM OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP
RSHQVWKHJDWHSDUWLDO \
RSHQVDQGUHFORVHVDIWHU DQGFO QRHIIHFW QRHIIHFW QRHIIHFW
CLOSED WKHSDXVHWLPH RVHVLWDIWHUSDXVH QRHIIHFW 23(1LQKLELWHG 23(1LQKLELWHG QRHIIHFW 23(1LQKLELWHG
WLPH%

DURING OPENING UHYHUVHVWRFORVLQJ  UHYHUVHVWRFORVLQJ  UHFORVHVWKHJDWH ORFNVRSHUDWLRQ VHHQGOHYHOSURJ FRQWLQXHVWRRSHQDQG RQGLOVRHQJDJHPHQW VWRUHV
FNVDQGRSHQV
UHFORVHVLPPHGLDWHO\ &/26(

OPEN IN PAUSE UHFORVHVWKHJDWH  UHFORVHVWKHJDWH UHFORVHVWKHJDWH ORFNVRSHUDWLRQ QRHIIHFW ORFNVDQGLPPHGLDWHO\ ORFNVDQGFORVHVRQ


FORVHVRQGLVHQJDJHPHQW GLVHQJDJHPHQW
UHYHUVHVWRRSHQLQJ VHH
QGOHYHOSURJUDPPLQJ  ORFNVDQGRQGLVHQJDJH
DURING CLOSING UHRSHQVWKHJDWH UHRSHQVWKHJDWH QRHIIHFW ORFNVRSHUDWLRQ QRHIIHFW DQGFORVHVLPPHGLDWHO\DW PHQWRSHQVDQGDWWKH
WKHHQG HQGLPPHGLDWHO\FORVHV

LOCKED FORVHVWKHJDWH FORVHVWKHJDWH FORVHVWKHJDWH QRHIIHFW QRHIIHFW QRHIIHFW QRHIIHFW


23(1&/26(LQKLELWHG 23(1LQKLELWHG &/26(LQKLELWHG 23(1&/26(LQKLELWHG

LOGIC "SP" PULSES


STATUS OF AUTOMATED SYSTEM OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP
RSHQVWKHJDWHSDUWLDO \
RSHQVDQGUHFORVHVDIWHU DQGFO QRHIIHFW QRHIIHFW QRHIIHFW
CLOSED WKHSDXVHWLPH RVHVLWDIWHUSDXVH QRHIIHFW 23(1LQKLELWHG 23(1LQKLELWHG QRHIIHFW 23(1LQKLELWHG
WLPH%

FRQWLQXHVWRRSHQDQG ORFNVDQGRQGLVHQJDJHPHQW
DURING OPENING ORFNVRSHUDWLRQ  ORFNVRSHUDWLRQ UHFORVHVWKHJDWH ORFNVRSHUDWLRQ VHHQGOHYHOSURJ UHFORVHVLPPHGLDWHO\
RSHQVDQGDWWKHHQGLPPHGLDWHO\
FORVHV 23(1ORFNVVWRUHV&/26(

OPEN IN PAUSE UHFORVHVWKHJDWH  UHFORVHVWKHJDWH UHFORVHVWKHJDWH ORFNVRSHUDWLRQ QRHIIHFW ORFNVDQGLPPHGLDWHO\ ORFNVDQGLPPHGLDWHO\


FORVHVRQGLVHQJDJHPHQW FORVHVRQGLVHQJDJHPHQW

UHYHUVHVWRRSHQLQJ VHH ORFNVDQGRSHQVRQ


DURING CLOSING ORFNVRSHUDWLRQ ORFNVRSHUDWLRQ QRHIIHFW ORFNVRSHUDWLRQ QRHIIHFW QGOHYHOSURJ GLVHQJDJHPHQW
VWRUHV&/26(
UHVXPHVPRWLRQLQUHYHUVH UHVXPHVPRWLRQLQUHYHUVH QRHIIHFW QRHIIHFW QRHIIHFW QRHIIHFW
LOCKED GLUHFWLRQ$IWHU6723DOZD\V GLUHFWLRQ$IWHU6723DOZD\V UHFORVHVWKHJDWH 23(1&/26(LQKLELWHG 23(1LQKLELWHG &/26(LQKLELWHG 23(1&/26(LQKLELWHG
FORVHV FORVHV

 'XULQJWKHSDUWLDORSHQLQJF\FOHDQ23(1$SXOVHFDXVHVWRWDORSHQLQJ
E721 19 532014 - Rev. D
LOGIC "SA" PULSES
STATUS OF AUTOMATED SYSTEM OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP
2SHQVWKHJDWHSDUWLDO \
RSHQVDQGUHFORVHVDIWHU DQGFO QRHIIHFW QRHIIHFW QRHIIHFW
CLOSED WKHSDXVHWLPH RVHVLWDIWHUSDXVH QRHIIHFW 23(1LQKLELWHG 23(1LQKLELWHG QRHIIHFW 23(1LQKLELWHG
WLPH%
ORFNVDQGRSHQVRQ
DURING OPENING QRHIIHFW  QRHIIHFW UHFORVHVWKHJDWH ORFNVRSHUDWLRQ VHHQGOHYHOSURJ QRHIIHFW GLVHQJDJHPHQW
VWRUHV&/26(

OPEN IN PAUSE UHFORVHVWKHJDWH  UHFORVHVWKHJDWH UHFORVHVWKHJDWH ORFNVRSHUDWLRQ QRHIIHFW UHORDGVSDXVHWLPH UHORDGVSDXVHWLPH


&/26(LQKLELWHG &/26(LQKLELWHG

UHYHUVHVWRRSHQLQJ VHH ORFNVDQGRSHQVRQ


DURING CLOSING UHRSHQVWKHJDWH UHRSHQVWKHJDWH QRHIIHFW ORFNVRSHUDWLRQ QRHIIHFW QGOHYHOSURJ  GLVHQJDJHPHQW
VWRUHV&/26(

QRHIIHFW QRHIIHFW QRHIIHFW QRHIIHFW


ENGLISH

LOCKED FORVHVWKHJDWH FORVHVWKHJDWH FORVHVWKHJDWH 23(1&/26(LQKLELWHG 23(1LQKLELWHG &/26(LQKLELWHG 23(1&/26(LQKLELWHG

LOGIC "B" PULSES


STATUS OF AUTOMATED SYSTEM OPEN A / CLOSE STOP FSW OP FSW CL FSW CL/OP

CLOSED RSHQVWKHJDWH / QRHIIHFW QRHIIHFW QRHIIHFW QRHIIHFW QRHIIHFW


23(1LQKLELWHG 23(1LQKLELWHG 23(1LQKLELWHG

ORFNVDQGRSHQVRQ
DURING OPENING QRHIIHFW / FORVHVWKHJDWH ORFNVRSHUDWLRQ VHHQGOHYHOSURJ QRHIIHFW GLVHQJDJHPHQW VWRUHV
23(1&/26(

OPEN QRHIIHFW / FORVHVWKHJDWH QRHIIHFW QRHIIHFW QRHIIHFW QRHIIHFW


23(1&/26(LQKLELWHG &/26(LQKLELWHG 23(1&/26(LQKLELWHG

DURING CLOSING RSHQVWKHJDWH / QRHIIHFW ORFNVRSHUDWLRQ QRHIIHFW UHYHUVHVWRRSHQLQJ VHH GLOVRHQJDJHPHQW VWRUHV
FNVDQGRSHQVRQ
QGOHYHOSURJ  23(1&/26(

LOCKED RSHQVWKHJDWH / FORVHVWKHJDWH QRHIIHFW QRHIIHFW QRHIIHFW QRHIIHFW


23(1&/26(LQKLELWHG 23(1LQKLELWHG &/26(LQKLELWHG 23(1&/26(LQKLELWHG

LOGIC bC PULSES DURING OPENING/COMMANDS MAINTAINED PULSES


DURING CLOSING
STATUS OF AUTOMATED SYSTEM OPEN A / CLOSE STOP FSW OP FSW CL FSW CL/OP

CLOSED RSHQVWKHJDWH / QRHIIHFW QRHIIHFW QRHIIHFW QRHIIHFW QRHIIHFW


23(1LQKLELWHG 23(1LQKLELWHG 23(1LQKLELWHG

ORFNVDQGRSHQVRQ
DURING OPENING QRHIIHFW / FORVHVWKHJDWH ORFNVRSHUDWLRQ VHHQGOHYHOSURJ QRHIIHFW GLVHQJDJHPHQW VWRUHV
23(1&/26(

OPEN QRHIIHFW / FORVHVWKHJDWH QRHIIHFW QRHIIHFW QRHIIHFW QRHIIHFW


23(1&/26(LQKLELWHG &/26(LQKLELWHG 23(1&/26(LQKLELWHG

DURING CLOSING RSHQVWKHJDWH / QRHIIHFW ORFNVRSHUDWLRQ QRHIIHFW UHYHUVHVWRRSHQLQJ VHH GLOVRHQJDJHPHQW VWRUHV
FNVDQGRSHQVRQ
QGOHYHOSURJ  23(1&/26(

LOCKED RSHQVWKHJDWH / FORVHVWKHJDWH QRHIIHFW QRHIIHFW QRHIIHFW QRHIIHFW


23(1&/26(LQKLELWHG 23(1LQKLELWHG &/26(LQKLELWHG 23(1&/26(LQKLELWHG

LOGIC "C" COMMANDS MAINTAINED PULSES


STATUS OF AUTOMATED SYSTEM OPEN A / CLOSE STOP FSW OP FSW CL FSW CL/OP

CLOSED RSHQVWKHJDWH / QRHIIHFW QRHIIHFW QRHIIHFW QRHIIHFW QRHIIHFW


23(1LQKLELWHG 23(1LQKLELWHG 23(1LQKLELWHG

DURING OPENING QRHIIHFW / FORVHVWKHJDWH ORFNVRSHUDWLRQ VHHQGOHYHOSURJ QRHIIHFW ORFNVDQGRQGLVHQJDJH


PHQWQGOHYHOSURJ

OPEN QRHIIHFW / FORVHVWKHJDWH QRHIIHFW QRHIIHFW QRHIIHFW QRHIIHFW


23(1&/26(LQKLELWHG &/26(LQKLELWHG 23(1&/26(LQKLELWHG

DURING CLOSING RSHQVWKHJDWH / QRHIIHFW ORFNVRSHUDWLRQ QRHIIHFW ORFNVRSHUDWLRQ ORFNVRSHUDWLRQ

LOCKED RSHQVWKHJDWH / FORVHVWKHJDWH QRHIIHFW QRHIIHFW QRHIIHFW QRHIIHFW


23(1&/26(LQKLELWHG 23(1LQKLELWHG &/26(LQKLELWHG 23(1&/26(LQKLELWHG
 'XULQJWKHSDUWLDORSHQLQJF\FOHDQ23(1$SXOVHFDXVHVWRWDORSHQLQJ
 :KHQWXUQHGRQWKHERDUGFKHFNVWKHLQSXWVDQGLIDQ23(1$RU%FRPPDQGLVDFWLYHLWRSHQVWKHOHDIRUJDWH2WKHUZLVHLWFORVHVLW
E721 20 532014 - Rev. D
INDEX
1 AVERTISSEMENTS ............................................................................................................................................ 2
2 PRÉSENTATION ET COMPOSANTS ..................................................................................................................... 2
2.1. DESCRIPTION DES COMPOSANTS .............................................................................................................................. 3
2.2. DESCRIPTION BORNIER J13 ....................................................................................................................................... 3
3 CARACTÉRISTIQUES TECHNIQUES.................................................................................................................... 3
4 BRANCHEMENTS ÉLECTRIQUES ........................................................................................................................ 4
4.1. PHOTOCELLULES A BUS-2EASY ................................................................................................................................... 5
4.1.1. ADRESSAGE DES PHOTOCELLULES BUS-2EASY ...............................................................................................................5
4.1.2. MÉMORISATION DES ACCESSOIRES BUS-2EASY.............................................................................................................5
4.2. PHOTOCELLULES TRADITIONNELLES ........................................................................................................................... 6
4.3 CONNEXIONS DE L’ENTRÉE SAFE ................................................................................................................. 7
5. PROGRAMMATION ......................................................................................................................................... 8
5.1 PROGRAMMATION DE 1ER NIVEAU ............................................................................................................................. 8
5.2. PROGRAMMATION DE 2ÈME NIVEAU ......................................................................................................................... 10
6 MÉMORISATION DE CODAGE RADIO ............................................................................................................. 12
6.1. MÉMORISATION DES RADIOCOMMANDES DS......................................................................................................... 12
6.2. MÉMORISATION DES RADIOCOMMANDES SLH....................................................................................................... 13
6.3 MÉMORISATION DES RADIOCOMMANDES LC/RC (UNIQUEMENT POUR CERTAINS MARCHÉS) ............................... 13
6.3.1 MÉMORISATION À DISTANCE DE RADIOCOMANDES LC/RC ........................................................................................13
6.4. PROCÉDURE D'EFFACEMENT DES RADIOCOMMANDES .......................................................................................... 13

FRANÇAIS
7 MISE EN SERVICE ........................................................................................................................................... 14
7.1 CONTRÔLE DES LEDS ................................................................................................................................................ 14
7.2 FONCTIONNEMENT À BATTERIE ................................................................................................................. 14
7.3. POSITIONNEMENT DES FINS DE COURSE.................................................................................................................. 15
7.4 CONFIGURATION MASTER/SLAVE ............................................................................................................................ 16
7.4.1 CÂBLAGES MASTER-SLAVE ........................................................................................................................................ 16
7.4.2 PROCÉDURE DE SETUP MASTER-SLAVE ....................................................................................................................... 16
7.5 SETUP ....................................................................................................................................................................... 17
8 TEST DE L'AUTOMATISME ........................................................................................................................... 17
9 SIGNALISATION D'ALARMES ET D'ANOMALIES ................................................................................................ 17
9.1 ALARMES ................................................................................................................................................................ 17
9.2 ERREURS .................................................................................................................................................................. 17
10 LOGIQUES DE FONCTIONNEMENT ............................................................................................................... 18

DÉCLARATION CE DE CONFORMITÉ
Fabricant : )$$&6S$
Adresse : 9LD&DODUL=ROD3UHGRVD%2/2*1(,7$/,(
Déclare que : /·DSSDUHLOODJHpOHFWURQLTXH(

 ‡HVWFRQIRUPHDX[FRQGLWLRQVUHTXLVHVHVVHQWLHOOHVGHVpFXULWpGHVGLUHFWLYHV&((
VXLYDQWHV

  &('LUHFWLYH%DVVH7HQVLRQ
  &('LUHFWLYHVXUOD&RPSDWLELOLWppOHFWURPDJQpWLTXH

  1RWHVXSSOpPHQWDLUH
   &HSURGXLWDpWpVRXPLVjGHVWHVWVGDQVXQHFRQILJXUDWLRQW\SLTXH
   KRPRJqQH WRXVOHVSURGXLWVVRQWIDEULTXpVSDU)$$&6S$ 
%RORJQH
      /
$GPLQLVWUDWHXU'pOpJXp
      $0DUFHOODQ
AVERTISSEMENTS
‡$WWHQWLRQ,OHVWLPSRUWDQWSRXUODVpFXULWpGHVSHUVRQQHVGHVXLYUHjODOHWWUHWRXWHVOHVLQVWUXFWLRQV
‡8QH LQVWDOODWLRQ HUURQpH RX XQH XWLOLVDWLRQ HUURQpH GX SURGXLW SHXW SURYRTXHU GH JUDYHV GRPPDJHV DX[
SHUVRQQHV
‡/LUHDWWHQWLYHPHQWOHVLQVWUXFWLRQVDYDQWGHGpEXWHUO
LQVWDOODWLRQGXSURGXLWHWOHVFRQVHUYHUSRXUUpIpUHQFHVXOWpULHXUHV
‡/H V\PEROH  PHW HQ pYLGHQFH OHV QRWHV LPSRUWDQWHV SRXU OD VpFXULWp GHV SHUVRQQHV HW O
LQWpJULWp GH
O
DXWRPDWLVPH
‡/HV\PEROH DWWLUHO
DWWHQWLRQVXUOHVQRWHVUHODWLYHVDX[FDUDFWpULVWLTXHVRXDXIRQFWLRQQHPHQWGXSURGXLW

E721 1 532014 - Rev. D


E721
1 AVERTISSEMENTS
Avant d'effectuer un type quelconque d'intervention sur l'appareil électronique (branchements,
entretien), couper toujours l'alimentation électrique.

En amont de l'installation, prévoir un interrupteur magnétothermique différentiel avec un seuil


d'intervention adapté.

Brancher le câble de terre à la borne correspondante.

Séparer toujours les câbles d'alimentation de ceux de com-


mande et de sécurité (poussoir, récepteur, photocellules, etc.).
Pour éviter toute perturbation électrique, utiliser des gaines sé-
parées ou un câble blindé (avec blindage relié à la masse).

2 PRÉSENTATION ET COMPOSANTS
FRANÇAIS

/ SAFE
/ SAFE

CAPTEUR
FIN DE COURSE

)LJ

E721 2 532014 - Rev. D


2.1 DESCRIPTION DES COMPOSANTS 3 CARACTÉRISTIQUES TECHNIQUES
/&' (&5$1'(6,*1$/,6$7,21(7352*5$00$7,21 Alimentation 99(56,219a+]
99(56,219a+]
6: 328662,5'(352*5$00$7,21©Fª Puissance absor- :
6: 328662,5'(352*5$00$7,21©-ª bée par le réseau
état d’attente
6: 328662,5'(352*5$00$7,21©+ª
Charge maxi du $
6: 328662,5'(©SETUPª moteur
/HGV /(''(&2175Ñ/('(/
e7$7'(6(175e(6 Alimentation 9
accessoires
- &211(&7(85'
$/,0(17$7,2135,0$,5( Courant maxi 9 PD[P$
- &211(&7(8535,0$,5('(75$16)250$7(85 accessoires %86($6<PD[P$
Température  ƒ&
- &211(&7(856(&21'$,5('(75$16)250$7(85
ambiante
- &211(&7(85'(%$77(5,(6'
85*(1&( $&&(662,5( Charge 9 :
clignotant
- &211(&7(85027(85
Charge sortie 9 P$ (2)
- &211(&7(85'(6257,(&/,*127$17(24 V= - 15W)
Fusibles de ) 7$9a
&211(&7(85'(9(5528,//$*(027(85(7 protection
-
&217$&7'e9(5528,//$*('(027(85 Logiques de 6HPLDXWRPDWLTXH6HPLDXWRPDWLTXH
- &211(&7(85'(6257,(287 fonctionnement ©SDVjSDVª$XWRPDWLTXH
$XWRPDWLTXH©SDVjSDVª$XWRPDWLTXH
- &211(&7(8586%3285%5$1&+(0(173& DYHFIRQFWLRQWLPHU$XWRPDWLTXH
- &211(&7(85'(%5$1&+(0(17'(6',6326,7,)6%86($6< 6pFXULWpV$XWRPDWLTXH6pFXULWpV©SDV

FRANÇAIS
jSDVª$XWRPDWLTXHDYHFLQYHUVLRQHQ
- &211(&7(85'
(175e(6(1%251,(5 SDXVH6HPLDXWRPDWLTXH©Eª/RJLTXH
&211(&7(85'802'8/(5e&(37(855$',23285 PL[WH©E&ª+RPPHSUpVHQW
- Durée de fonc- 3URJUDPPDEOH GHjPLQ
201,'(&
tionnement
/&' e&5$1'(6,*1$/,6$7,21(7352*5$00$7,21
Temps de pause 3URJUDPPDEOH GHjPLQ
) )86,%/('(3527(&7,21 OPEN A / OPEN B
2.2 DESCRIPTION BORNIER J13 Force moteur 3URJUDPPDEOHVXUQLYHDX[
Vitesse du moteur 3URJUDPPDEOHVXUQLYHDX[
N° ENTRÉE DESCRIPTION d'ouverture-fer-
1 23(1$ 'LVSRVLWLIDYHFFRQWDFWN.O meture
TXLSURYRTXHO
RXYHUWXUH Entrées/Sorties $OLPHQWDWLRQ%DWWHULH0RWHXU0RGXOH
WRWDOHGXSRUWDLO dans le connec- ;)%DWWHULHVGHGpYHUURXLOODJH
teur pOHFWULTXHGHYHUURXLOODJHPRWHXU9HUURXLOOD
2-6 *1' 1pJDWLIG
DOLPHQWDWLRQGHV
DFFHVVRLUHV JH0RWHXU86%
Entrées/Sorties %86($6<23(1$23(1%&/26(6$)(
3  23(1% 'LVSRVLWLIDYHFFRQWDFWN.O.
TXLSURYRTXHO
RXYHUWXUH dans le bornier 67236$)(*1'3KRWRFHOOXOHVG
2XYHUWXUH
'()$8/7
SDUWLHOOHGXSRUWDLO HW)HUPHWXUH9$OLPHQWDWLRQGH
UpVHDX&OLJQRWDQW'pYHUURXLOODJHpOHFWULTXH
CLOSE 'LVSRVLWLIDYHFFRQWDFWN.O
TXLSURYRTXHODIHUPHWXUH YHUURXLOODJHPRWHXU287
GXSRUWDLO
6$)( 'LVSRVLWLIDYHFFRQWDFW N.F.
TXLSURYRTXHO·LQYHUVLRQ
LPPpGLDWHHWFRPSOqWHGX (1) Les types d’utilisation des entrées
SRUWDLO 3 et 4 peuvent être sélectionnés à
4  6723 'LVSRVLWLIDYHFFRQWDFW travers la configuration des paramètres
'()$8/7 N.F.TXLSURYRTXHO
DUUrW correspondants, au 2ème niveau de
GXSRUWDLO programmation (paramètres Ob et SP). Pour
6$)( 'LVSRVLWLIDYHFFRQWDFW N.F. la description exacte du fonctionnement
TXLSURYRTXHO·LQYHUVLRQ de l’automatisme par rapport aux logiques
LPPpGLDWHHWFRPSOqWHGX sélectionnées, se référer aux tableaux qui
SRUWDLO se trouvent à la fin de ce manuel (Par. 10
5 )6:23 'LVSRVLWLIDYHFFRQWDFWN.F. - LOGIQUES DE FONCTIONNEMENT). En ce
TXLSURYRTXHO
LQYHUVLRQ qui concerne les câblages à réaliser en
GXPRXYHPHQWSHQGDQW utilisant ces entrées configurées en tant
O
RXYHUWXUHGXSRUWDLO que SAFE, se référer aux schémas indiqués
7 )6:&/ 'LVSRVLWLIDYHFFRQWDFWN.F. dans les figures Fig.13 et Fig. 14.
TXLSURYRTXHO
LQYHUVLRQGX
PRXYHPHQWSHQGDQWOD (2) L'alimentation en sortie doit déjà être
IHUPHWXUHGXSRUWDLO comprise dans le courant maximum
8 9 3RVLWLIG
DOLPHQWDWLRQGHV disponible pour les accessoires
DFFHVVRLUHV
E721 3 532014 - Rev. D
4 BRANCHEMENTS ÉLECTRIQUES
Les câblages indiqués dans la Fig. 2 se réfèrent aux entrées de la carte avec une configuration par DÉFAUT.

/ SAFE
/ SAFE

3RXUODFRQQH[LRQGHV
SKRWRFHOOXOHVHWGHVGL
VSRVLWLIVGHVpFXULWpYRLU
OHSDUDJUDSKH

230 V ~
115 V ~
=
FRANÇAIS

CONTACT
DEVERROUILLAGE
DE MOTEUR
(Bloque le moteur quand
la poignée de déver-
= rouillage moteur est
actionnée)
)LJ

E721
E721 E721
E721

C720
C 72 C721
C 721
)LJ

$ 3KRWRFHOOXOHVDYHFLQWHUYHQWLRQHQ)(50(785(
% 3KRWRFHOOXOHVDYHFLQWHUYHQWLRQHQ289(5785(
& 3KRWRFHOOXOHVDYHFLQWHUYHQWLRQHQ289(5785(
HWHQ)(50(785(

)LJ

E721 4 532014 - Rev. D


$YDQWGHEUDQFKHUOHVSKRWRFHOOXOHVLOFRQYLHQWGHFKRL Tab. 1 - Adressage des photocellules BUS-2EASY
VLUOHW\SHGHIRQFWLRQQHPHQWVXUODEDVHGHOD]RQHGH
PRXYHPHQWTX
HOOHVGRLYHQWSURWpJHU 'LS 'LS 'LS 'LS 5pI 7\SRORJLH
Sécurités à la fermeture : HOOHVQ
LQWHUYLHQQHQWTXHSHQ
GDQWOHPRXYHPHQWGHIHUPHWXUHGHO
DXWRPDWLVPHHW 2)) 2)) 2)) 2))
VRQWGRQFDGDSWpHVSRXUSURWpJHUOD]RQHGHIHUPHWXUH 2)) 2)) 2)) 21
FRQWUHOHULVTXHG
LPSDFW
2)) 2)) 21 2)) 289(5785(
Sécurités à l'ouverture : HOOHV Q
LQWHUYLHQQHQW TXH SHQ % Max 6 paires
GDQWOHPRXYHPHQWG
RXYHUWXUHGHO
DXWRPDWLVPHHW 2)) 2)) 21 21
VRQWGRQFDGDSWpHVSRXUSURWpJHUOD]RQHG
RXYHUWXUH 2)) 21 21 2))
FRQWUHOHULVTXHG
LPSDFW
Sécurités à l'ouverture/fermeture : HOOHV LQWHUYLHQQHQW 2)) 21 21 21
DXVVLELHQSHQGDQWOHPRXYHPHQWG
RXYHUWXUHTXHGH 21 2)) 2)) 2))
IHUPHWXUHGHO
DXWRPDWLVPHHOOHVVRQWGRQFDGDSWpHV
21 2)) 2)) 21
SRXUSURWpJHUWRXWHOD]RQHGHPDQXWHQWLRQFRQWUHOH
ULVTXHG
LPSDFW 21 2)) 21 2))
21 2)) 21 21 $ )(50(785(
Max 7 paires
4.1. PHOTOCELLULES A BUS-2EASY 21 21 2)) 2))
&HWWHFDUWHHVWGRWpHG
XQFLUFXLW%86($6<TXLSHUPHW 21 21 2)) 21
GHEUDQFKHUIDFLOHPHQWXQQRPEUHpOHYpGHGLVSRVLWLIV
21 21 21 2))
%86($6<DX[LOLDLUHVjODVpFXULWp SDUH[MXVTX
jSDLUHV
GH SKRWRFHOOXOHV  FRQYHQDEOHPHQW SURJUDPPpV HQ 2)) 21 2)) 2)) 289(5785(HW
XWLOLVDQWXQLTXHPHQWGHX[FkEOHVVDQVSRODULWp & )(50(785(

FRANÇAIS
2)) 21 2)) 21 Max 2 paires
$YDQWGHEUDQFKHUOHVSKRWRFHOOXOHVLOFRQYLHQWGHFKRLVLU
OHW\SHGHIRQFWLRQQHPHQW )LJ VXUODEDVHGHOD]RQH 21 21 21 21  ,038/6,21
23(1
GHPRXYHPHQWTX
HOOHVGRLYHQWSURWpJHUHWGHSRVLWLRQQHU
OHV',36:,7&+(VVXUO
pPHWWHXUDLQVLTXHVXUOHUpFHSWHXU 4.1.2. MÉMORISATION DES ACCESSOIRES BUS-2EASY
YRLU)LJ FRQIRUPpPHQWDX7DE ­WRXWPRPHQWRQSHXWDMRXWHUGHVSKRWRFHOOXOHVHWGHV
)LJ
DFFHVVRLUHV %86($6< j O·LQVWDOODWLRQ VLPSOHPHQW HQ
SURFpGDQWFRPPHVXLW
DL1  $OLJQH  ,QVWDOOHUHWSURJUDPPHUOHVDFFHVVRLUHVDYHFO
DGUHVVH
RX TX PHQW VRXKDLWpH YRLUSDU 
DL2
DL2 (WDW%86  &RXSHUO
DOLPHQWDWLRQjODFDUWH
DL1 ($6<$OLPHQ  %UDQFKHUOHVGHX[FkEOHVGHVDFFHVVRLUHV%86($6<
ON
DS1
ON
DS1 WDWLRQ DXERUQLHUURXJH- SRODULWpLQGLIIpUHQWH 
DS1 ',36:,7  $OLPHQWHUODFDUWH
1 2 3 4 1 2 3 4

DL2
BUS BUS BUS BUS
&+(6 SRXU OD  $SSX\HUUDSLGHPHQWXQHIRLVVXUOHSRXVVRLU6(783 6: 
SRXUHIIHFWXHUO
LQVFULSWLRQGHVDFFHVVRLUHV9pULILHUOH
RX - TX
SURJUDPPD IRQFWLRQQHPHQWGHVGLVSRVLWLIVj%86($6<LQVWDOOpV
WLRQ
 /DFDUWHDPpPRULVpOHVDFFHVVRLUHV%86($6<
6XLYUHOHVLQGLFDWLRQVGXWDEOHDXVXLYDQWSRXUFRQWU{OHUOH
ERQpWDWGXEUDQFKHPHQW%86($6<
Exécuter la même procédure sur une centrale
MASTER également pour la saisie d’une
centrale SLAVE connectée au BUS-2EASY par
4.1.1. ADRESSAGE DES PHOTOCELLULES BUS-2EASY l’intermédiaire d’une connexion POLARISÉE.
Il est important de donner la même adresse Tab. 2 - Description de la led BUS-2EASY
à l'émetteur et au récepteur.
$FWLYLWp QRUPDOH OHG DOOXPpH PrPH
Il faut s'assurer qu'il n'y ait pas deux ou Allumé fixe HQ O
DEVHQFH GH SKRWRFHOOXOHV  $XFXQH
plusieurs paires de photocellules avec la SKRWRFHOOXOHLQVFULWHHQJDJpH
même adresse.
Clignotant $XPRLQVXQHSKRWRFHOOXOHLQVFULWHHQJD
Si l'on n'utilise aucun accessoire BUS-2EASY, lent JpHRXQRQDOLJQpH
laisser libre le connecteur BUS-2EASY (J12 -
Fig. 1). Éteint
(clignotement
/LJQH%86($6<HQFRXUWFLUFXLW
toutes les 2,5
sec.)
/LJQH%86($6<GpVDFWLYpH HOOHQHIRXUQLW
SDVG·DOLPHQWDWLRQ
Éteint
)RQFWLRQQHPHQWjEDWWHULH
&HQWUDOHSURJUDPPpHFRPPH6/$9(

E721 5 532014 - Rev. D


4.2. PHOTOCELLULES TRADITIONNELLES %UDQFKHPHQWG
XQHSDLUHGHSKRWRFHOOXOHVHQ
IHUPHWXUHHWXQHHQRXYHUWXUH
%UDQFKHPHQWSDLUHGHSKRWRFHOOXOHVHQIHUPHWXUH
DYHFVpFXULWp)$,/6$)(activée
Régler dans le second niveau de programmation
o1 = 01

OUT

Autres sécurités

OUT
OUT

)LJ
%UDQFKHPHQWSDLUHGHSKRWRFHOOXOHVHQIHUPHWXUH
DYHFVpFXULWp)$,/6$)(HW6723désactivée
%UDQFKHPHQWGHGHX[SDLUHVGHSKRWRFHOOXOHVHQIHUPHWXUH
FRANÇAIS

Autres sécurités

)LJ

Si l'on n'utilise pas la sécurité FAIL-SAFE, il


faut brancher l'alimentation des émetteurs
aux bornes 6 et 8 de J13.
En utilisant la sécurité FAIL-SAFE, brancher
l'alimentation des émetteurs à l’OUT après
l'avoir convenablement réglée (voir pro- )LJ
grammation de 2ème niveau et Fig. 6).
%UDQFKHPHQWG
XQHSDLUHGHSKRWRFHOOXOHVHQ
En utilisant la sécurité FAIL-SAFE, les entrées de IHUPHWXUHHWXQHHQRXYHUWXUHIHUPHWXUH
sécurité non utilisées devront également être
shuntées avec le négatif d'OUT (voir Fig. 6).

%UDQFKHPHQWG·XQHSDLUHGHSKRWRFHOOXOHVHQRXYHUWXUH

Autres sécurités

)LJ )LJ

E721 6 532014 - Rev. D


%UDQFKHPHQWG
XQHSDLUHGHSKRWRFHOOXOHVHQIHUPH %UDQFKHPHQWG
DXFXQGLVSRVLWLIGHVpFXULWpHWG
DUUrW
WXUHO
XQHHQRXYHUWXUHHWO
DXWUHHQRXYHUWXUHIHUPHWXUH

)LJ

FRANÇAIS
)LJ

4.3 CONNEXIONS DE L’ENTRÉE SAFE


En cas d’activation de la sécurité Fail Safe (paramètre configurable au 2ème niveau de programmation),
le négatif à utiliser pour la gestion de l’entrée SAFE devra être - OUT (voir Fig. 13).

&RQQH[LRQG·XQHVpFXULWp DXWUHVVpFXULWpV jO·HQWUpH6$)(DYHFIRQFWLRQFAIL SAFE activée


(QVpOHFWLRQQDQWqPHQLYHDXo 1=01 )$,/6$)($&7,9e (QVpOHFWLRQQDQWqPHQLYHDXo 1=01 )$,/6$)($&7,9e
qPHQLYHDX SP=01 (175e( 6e&85,7e%25' qPHQLYHDX Ob=02 (175e( 6e&85,7e%25'

Autres sécurités
Autres sécurités
OPEN A OPEN A
GND GND
OPEN B / CLOSE - OUT SAFE / OPEN B / CLOSE
- OUT SAFE / STOP STOP
FSW OP FSW OP
GND GND
FSW CL FSW CL
+24V +24V )LJ

En cas d’activation de la sécurité Fail Safe (paramètre configurable au 2ème niveau de programmation),
le négatif à utiliser pour la gestion de l’entrée SAFE devra être -  (voir Fig. 14).

&RQQH[LRQG·XQHVpFXULWp DXWUHVVpFXULWpV jO·HQWUpH6$)(DYHFIRQFWLRQ FAIL SAFE désactivée

(QVpOHFWLRQQDQWqPHQLYHDXo 1=00 )$,/6$)('e6$&7,9e (QVpOHFWLRQQDQWqPHQLYHDXo 1=00 )$,/6$)('e6$&7,9e


qPHQLYHDX SP=01 (175e( 6e&85,7e%25' qPHQLYHDX Ob=02 (175e( 6e&85,7e%25'

Autres sécurités
Autres sécurités OPEN A
GND OPEN A
OPEN B / CLOSE GND
SAFE / STOP - SAFE / OPEN B / CLOSE
- FSW OP STOP
GND FSW OP
FSW CL GND
+24V FSW CL
+24V )LJ

Si l’on utilise les dispositifs avec un contact N.F. (Autres sécurités), ponter l’entrée SAFE au négatif -OUT
avec FAIL SAFE activé ou à GND avec FAIL SAFE désactivé.
E721 7 532014 - Rev. D
5. PROGRAMMATION La modification des paramètres de
3RXUSURJUDPPHUOHIRQFWLRQQHPHQWGHO
DXWRPDWLVPHLOHVW programmation est immédiatement efficace,
tandis que la mémorisation définitive ne se
QpFHVVDLUHG
DFFpGHUjODPRGDOLWp©352*5$00$7,21ª
produit qu’à la sortie de la programmation et
/DSURJUDPPDWLRQVHGLYLVHHQGHX[SDUWLHVHU1,9($8qPH au retour de l’affichage de l’état des entrées. Si
1,9($8 l’on met l’armoire hors tension avant le retour
Normalement, l'état de l'automatisme est de l’affichage de l’état des entrées, toutes les
affiché à l'écran. En appuyant sur le poussoir variations effectuées seront perdues.
F, ou bien en appuyant simultanément sur Il est possible de revenir à l'affichage de
F et +, on accède respectivement à la l'état des entrées et de mémoriser tous les
programmation de 1er ou de 2ème niveau. paramètres modifiés jusqu'alors, depuis
L’afficheur est éteint durant le fonctionnement n'importe quel point de la programmation de
à batterie. Appuyer brièvement sur la touche
1er et 2ème niveau, en appuyant simultanément
+ pour afficher l’état de l’automatisme.
sur les touches F et -.
Afin de rétablir les réglages par défaut,
A l'allumage de la carte sur l'écran LCD1,
il suffit de recharger la valeur par défaut
la version logicielle de la carte apparaîtra
souhaitée pendant le premier passage de
pendant quelques secondes à deux chiffres
la programmation de 1er niveau.
séparés par le point décimal.
5.1 PROGRAMMATION DE 1er NIVEAU
3RXUDFFpGHUjODSURJUDPPDWLRQGHHUQLYHDXLOIDXWDSSX\HUVXUOHSRXVVRLUF
‡ (QDSSX\DQWVXUODWRXFKHF HWHQODPDLQWHQDQWHQIRQFpH O·DIILFKHXULQGLTXHOHQRPGHODIRQFWLRQ
‡ (QUHOkFKDQWOHSRXVVRLUO
pFUDQDIILFKHODYDOHXUGHODIRQFWLRQTXLSHXWrWUHPRGLILpHDYHFOHVWRXFKHVHW
‡ (QDSSX\DQWjQRXYHDXVXUF HWHQOHPDLQWHQDQWHQIRQFp O
pFUDQPRQWUHOHQRPGHODIRQFWLRQVXLYDQWHHWF
‡ $UULYpVjODGHUQLqUHIRQFWLRQODSUHVVLRQGXSRXVVRLUFSURYRTXHODVRUWLHGHODSURJUDPPDWLRQHWODVDXYHJDUGH
FRANÇAIS

GHVSDUDPqWUHV/
pFUDQUHFRPPHQFHG
DIILFKHUO
pWDWGHO
DXWRPDWLVPH

PROGRAMMATION DE 1er NIVEAU


Par
Écran Fonction
défaut 1
PAR DÉFAUT :
dF 1 ,OFRQILJXUHOHVSDUDPqWUHVDYHFGHVYDOHXUVSDU'e)$87
1
CU 6LHQUHOkFKDQWOHSRXVVRLUFODYDOHXUCU DSSDUDvWFHODVLJQLILHTXHODFRQILJXUDWLRQ
VWDQGDUGPRGLILpHSDUOHELDLVGHVSRXVVRLUVHWpFUDQVDpWpVpOHFWLRQQpH6LO
RQYHXW
PDLQWHQLUFHWWHSURJUDPPDWLRQDSSX\HUjQRXYHDXVXUOHSRXVVRLUF DXWUHPHQW
DSSX\HUVXUHWVpOHFWLRQQHUODYDOHXUSDUGpIDXW1 
CONFIGURATION MASTER-SLAVE :
Ct M A  &RQILJXUHODFDUWHHQPRGDOLWpMASTER MA
SL &RQILJXUHODFDUWHHQPRGDOLWpSLAVE
En configurant la carte en modalité SLAVE, les paramètres LO-PA-Pb-Ph-Op ne
sont pas affichés (pour le fonctionnement Master/Slave, voir Par. 7.4)
LOGIQUES DE FONCTIONNEMENT :
LO E 6HPLDXWRPDWLTXH E
EP 6HPLDXWRPDWLTXH©3DVjSDVª
A $XWRPDWLTXH
A1 $XWRPDWLTXH
AP $XWRPDWLTXH©3DVjSDVª
At $XWRPDWLTXHDYHFIRQFWLRQWLPHU
S $XWRPDWLTXH©6pFXULWpVª
SP $XWRPDWLTXH©6pFXULWpV3DVjSDVª
SA $XWRPDWLTXHDYHFLQYHUVLRQHQSDXVH
b 6HPLDXWRPDWLTXH©Eª
bC  0L[WH $3jLPSXOVLRQ&+DYHFKRPPHSUpVHQW
C
+RPPHSUpVHQW Paramètre non affiché en modalité SLAVE
TEMPS DE PAUSE A :
PA /HWHPSVGHSDXVHIDFHjXQHFRPPDQGHG
RXYHUWXUHTOTALEQHSUHQGHIIHWTXHVLXQH 20
ORJLTXH DXWRPDWLTXH D pWp VpOHFWLRQQpH 5pJODEOH GH  j  VHFRQGHV SDU SDV G
XQH
VHFRQGH
(QVXLWHO
DIILFKDJHFKDQJHHQPLQXWHVHWGL[LqPHVGHVHFRQGH VpSDUpVSDUXQSRLQW HW
OHWHPSVHVWUpJOpSDUSDVGHVHFRQGHVMXVTX
jODYDOHXUPD[LPDOHGH9,5 PLQXWHV
(;VLO
pFUDQLQGLTXH2,5 OHWHPSVGHSDXVHFRUUHVSRQGjPLQHWVHF
Paramètre non affiché en modalité SLAVE

E721 8 532014 - Rev. D


Par
Ecran Fonction
défaut 1
TEMPS DE PAUSE B :
Pb /HWHPSVGHSDXVHIDFHjXQHFRPPDQGHG
RXYHUWXUHPARTIELLEQHSUHQGHIIHWTXHVLXQH
20
ORJLTXHDXWRPDWLTXHDpWpVpOHFWLRQQpH5pJODEOHGHjVHFRQGHVSDUSDVG
XQHVHFRQGH
(QVXLWHO
DIILFKDJHFKDQJHHQPLQXWHVHWGL[LqPHVGHVHFRQGHV VpSDUpVSDUXQSRLQW HW
OHWHPSVHVWUpJOpSDUSDVGHVHFRQGHVMXVTX
jODYDOHXUPD[LPDOHGH9,5 PLQXWHV
(;VLO
pFUDQLQGLTXH2,5 OHWHPSVGHSDXVHFRUUHVSRQGjPLQHWVHF
Paramètre non affiché en modalité SLAVE
FORCE MOTEUR :
FO 5qJOHOHQLYHDXGHIRUFHGXPRWHXU
50
 01  IRUFHPLQLPDOH
 50  IRUFHPD[LPDOH
En modifiant la valeur de la force, il est conseillé d'effectuer un nouveau
SETUP (voir par. 7.3)
VITESSE D'OUVERTURE:
So 5qJOHVXUQLYHDX[ODYLWHVVHG
RXYHUWXUHGXPRWHXU
08
 0 1  YLWHVVHPLQLPDOH
 1 0  YLWHVVHPD[LPDOH
En modifiant la valeur de la vitesse, il est conseillé d'effectuer un nouveau
SETUP (voir par. 7.3)

FRANÇAIS
VITESSE DE FERMETURE :
Sc 5qJOHVXUQLYHDX[ODYLWHVVHGHIHUPHWXUHGXPRWHXU
08
 0 1  YLWHVVHPLQLPDOH
 1 0  YLWHVVHPD[LPDOH
En modifiant la valeur de la vitesse, il est conseillé d'effectuer un nouveau
SETUP (voir par. 7.3)
RALENTISSEMENT EN OUVERTURE :
ro ,OUqJOHO
HVSDFHGHUDOHQWLVVHPHQWHQSRXUFHQWDJHGHODFRXUVHWRWDOHGXSRUWDLO5pJODEOH
20
jSDUWLUGH5  DYHFYLWHVVH 10  DYHFYLWHVVHHQWUHHW 15  DYHFYLWHVVH! j99 
SDUSDVGH
 5-10-15 UDOHQWLVVHPHQWPLQLPXP
 99  UDOHQWLVVHPHQWPD[LPXP
RALENTISSEMENT EN FERMETURE :
rc ,OUqJOHO
HVSDFHGHUDOHQWLVVHPHQWHQSRXUFHQWDJHGHODFRXUVHWRWDOHGXSRUWDLO5pJODEOH
20
jSDUWLUGH5  DYHFYLWHVVH 10  DYHFYLWHVVHHQWUHHW 15  DYHFYLWHVVH! j99 
SDUSDVGH
 5-10-15 UDOHQWLVVHPHQWPLQLPXP
 99  UDOHQWLVVHPHQWPD[LPXP
VITESSE EN RALENTISSEMENT :
Sr 5qJOHODYLWHVVHGXSRUWDLOSHQGDQWOHUDOHQWLVVHPHQW
0
 0  YLWHVVH%$66(
 1  YLWHVVH(/(9((
ÉTAT DE L'AUTOMATISME :
St 6RUWLHGHODSURJUDPPDWLRQPpPRULVDWLRQGHVGRQQpHVHWUHWRXUjO
DIILFKDJHGHO
pWDWGHO
DXWRPD
WLVPH

00  )(50e 07 )$,/6$)(HQFRXUV
01 289(57 08 YpULILFDWLRQGHVGLVSRVLWLIV%86($6<HQ
02  $UUrWpSXLV©2895(ª FRXUV
03  $UUrWpSXLV©)(50(ª 09 3UpFOLJQRWHPHQWHQVXLWH©2895(ª
04 (Q©3$86(ª 10 3UpFOLJQRWHPHQWHQVXLWH©)(50(ª
05 (QSKDVHG
RXYHUWXUH 11 289(57HQ2XYHUWXUH3DUWLHOOH
06 (QSKDVHGHIHUPHWXUH 12 (Q3$86(2XYHUWXUH3DUWLHOOH

E721 9 532014 - Rev. D


5.2. PROGRAMMATION DE 2ème NIVEAU
3RXUDFFpGHUjOD352*5$00$7,21qPH1,9($8DSSX\HUVXUOHSRXVVRLUFHWHQOHPDLQWHQDQWHQIRQFpDSSX\HUVXUOH
SRXVVRLU+ 
‡ HQUHOkFKDQWpJDOHPHQWOHSRXVVRLUFO
pFUDQDIILFKHODYDOHXUGHODIRQFWLRQTXLSHXWrWUHPRGLILpHDYHFOHVWRXFKHV+HW-
‡ (QDSSX\DQWVXUODWRXFKHF HWHQODPDLQWHQDQWHQIRQFpH O
pFUDQPRQWUHOHQRPGHODIRQFWLRQVXLYDQWHHQ
ODUHOkFKDQWODYDOHXUTXLSHXWrWUHPRGLILpHDYHFOHVWRXFKHV+HW-HVWDIILFKpH
‡ $UULYpVjODGHUQLqUHIRQFWLRQODSUHVVLRQGXSRXVVRLUFSURYRTXHODVRUWLHGHODSURJUDPPDWLRQHWO
pFUDQUHFRP
PHQFHjDIILFKHUO
pWDWGHO
DXWRPDWLVPH

PROGRAMMATION DE 2ème NIVEAU

Par
Écran Fonction
défaut 1
FORCE MAXIMALE AU DÉMARRAGE :
bo /HPRWHXUWUDYDLOOHjODIRUFHPD[LPDOH HQLJQRUDQWOHQLYHDXGHIRUFHVpOHFWLRQQp SHQGDQW
no
OHGpPDUUDJHGHODPDQXWHQWLRQ
 Y  DFWLI
 no  H[FOXV
PRÉ-CLIGNOTEMENT :
PF 3HUPHWGHVpOHFWLRQQHUW\SHVGHSUpFOLJQRWHPHQWG
XQHGXUpHpJDOHjVHFRQGHV
no
no  DXFXQSUpFOLJQRWHPHQW
OC  SUpFOLJQRWHPHQWDYDQWFKDTXHPDQXWHQWLRQ
FRANÇAIS

CL  SUpFOLJQRWHPHQWDYDQWXQHPDQXWHQWLRQGHIHUPHWXUH
OP  SUpFOLJQRWHPHQWDYDQWXQHPDQXWHQWLRQHQRXYHUWXUH
PA  SUpFOLJQRWHPHQWXQLTXHPHQWjODILQG
XQHSDXVH
TEMPS DE PRÉ-CLIGNOTEMENT (visible uniquement si un pré-clignotement a été sélectionné
tP dans le menu précédent) : 03
5qJOHOHWHPSVGHSUpFOLJQRWHPHQWGH 1 j10 VHFSDUSDVG
VHFRQGH
 01 SUpFOLJQRWHPHQWPLQLPXP
10 SUpFOLJQRWHPHQWPD[LPXP
PHOTOCELLULES EN FERMETURE :
Ph $FWLYHUODIRQFWLRQVLO
RQVRXKDLWHTXHOHVSKRWRFHOOXOHVGHIHUPHWXUHEORTXHQWOHPRXYH
no
PHQWHWO
LQYHUVHQWORUVGHODGpVDFWLYDWLRQ1RUPDOHPHQWDYHFFHWWHIRQFWLRQGpVDFWLYpH
O
LQWHUYHQWLRQGHVSKRWRFHOOXOHVHQIHUPHWXUHGpWHUPLQHXQHLQYHUVLRQLPPpGLDWHGXSRUWDLO
Y  LQYHUVLRQORUVGHODGpVDFWLYDWLRQ
n o  LQYHUVLRQLPPpGLDWHHQRXYHUWXUH
Paramètre non affiché en modalité SLAVE
PHOTOCELLULES EN OUVERTURE :
oP $FWLYHU OD IRQFWLRQ VL O
RQ VRXKDLWH TXH OHV SKRWRFHOOXOHV G
RXYHUWXUH EORTXHQW OH PRXYH
no
PHQWHWO
LQYHUVHQWORUVGHODGpVDFWLYDWLRQ1RUPDOHPHQWDYHFFHWWHIRQFWLRQGpVDFWLYpH
O
LQWHUYHQWLRQGHVSKRWRFHOOXOHVHQRXYHUWXUHGpWHUPLQHODUHSULVHGXPRXYHPHQWORUVGH
OHXUGpVDFWLYDWLRQ
Y  LQYHUVLRQLPPpGLDWHHQIHUPHWXUH
n o  UHSULVHGXPRXYHPHQWORUVGHODGpVDFWLYDWLRQ
Paramètre non affiché en modalité SLAVE
FONCTION ADMAP :
Ad 3HUPHWG
DFWLYHUOHIRQFWLRQQHPHQWVHORQOHVQRUPHVIUDQoDLVHV1)3
no
Y  DFWLI
no GpVDFWLYp
ENCODER :
EC /
HQFRGHXU©YLUWXHOªSUpVHQWVXUODFDUWHIRQFWLRQQHFRPPHXQGLVSRVLWLIDQWLpFUDVHPHQW 02
HWJqUHOHVSRLQWVGHGpEXWGHUDOHQWLVVHPHQWHWG
RXYHUWXUHSDUWLHOOH
6LOHSRUWDLOSHQGDQWODSKDVHG
RXYHUWXUHRXGHIHUPHWXUHKHXUWHXQREVWDFOHO
HQFRGHU
©YLUWXHOªSURYRTXHO
LQYHUVLRQGXPRXYHPHQW/HVHFRQGREVWDFOHGpWHFWpGDQVODPrPH
GLUHFWLRQSURYRTXHO
DUUrWGXPRWHXU'DQVOHVGHX[FDVXQHDODUPHHVWVLJQDOpH YRLUSDU
DODUPHV 
,OIDXWUpJOHUODVHQVLELOLWpGHO
HQFRGHU©YLUWXHOªHQPRGLILDQWOHWHPSVSHQGDQWOHTXHOOD
FDUWHDWWHQGDYDQWGHFRPPDQGHUO
LQYHUVLRQGXPRXYHPHQWG
XQPLQLPXPGH 0 VHFj
XQPD[LPXPGH10 VHFSDUSKDVHG
XQHVHFRQGH
00 VHQVLELOLWpPD[LPDOH
 10 VHQVLELOLWpPLQLPDOH
E721 10 532014 - Rev. D
Par
Écran Fonction
défaut 1
OUVERTURE PARTIELLE :
PO ,OHVWSRVVLEOHGHUpJOHUO
DPSOHXUGHO
RXYHUWXUHSDUWLHOOHGXEDWWDQWHQSRXUFHQWDJHGHOD 50
FRXUVHWRWDOHGXSRUWDLO
5pJODEOHGHjSDUSDVGH
 00  DXFXQHRXYHUWXUHSDUWLHOOH
 01  RXYHUWXUHSDUWLHOOHPLQLPDOH
 99  RXYHUWXUHSDUWLHOOHPD[LPDOH
DURÉE DE FONCTIONNEMENT (time-out) :
t ,OFRQYLHQWG
pWDEOLUXQHYDOHXUVXSpULHXUHDXWHPSVQpFHVVDLUHDXSRUWDLOSRXUV
RXYULUHWVH 2.0
IHUPHUWRWDOHPHQW
5pJODEOHGH0 j59 VHFSDUSDVG
VHFRQGH(QVXLWHO
DIILFKDJHFKDQJHHQPLQXWHVHW
GL[LqPHVGHVHFRQGH VpSDUpVSDUXQSRLQW HWOHWHPSVHVWUpJOpSDUSDVGHVHFRQGHV
MXVTX
jODYDOHXUPD[LPDOHGH9,5 PLQXWHV
(;VLO
pFUDQLQGLTXH2,5 OHWHPSVGHSDXVHFRUUHVSRQGjPLQHWVHF
En cas d’installation en configuration MASTER/SLAVE, sélectionner un TEMPS DE
FONCTIONNEMENT sur la centrale MASTER qui tienne compte des temps
d’actionnement des deux vantaux.
OUT 1 :
o1 3HUPHWGHUpJOHUODVRUWLH287 RSHQFROOHFWRU12 DFWLYHGDQVO
XQHGHVIRQFWLRQVVXLYDQWHV 00
00 7RXMRXUVDFWLYH IRXUQLWXQHWHQVLRQ9 DYHFDEVRUSWLRQPD[LPDOHGHP$ 
01 )$,/6$)( 9pULILHOHIRQFWLRQQHPHQWFRUUHFWGHVSKRWRFHOOXOHVWUDGLWLRQQHOOHVUDFFRUGpHV
02 /$03(7e02,1 pWHLQWHGHIHUPpHDOOXPpHHQRXYHUWXUHHWRXYHUWHSDXVHFOLJQRWDQWHQIHUPHWXUH

FRANÇAIS
03 /80,(5('(&28572,6,( YRLUIRQFWLRQVXLYDQWH
04 $/$50(GHIRQFWLRQQHPHQWj%$77(5,(
05 SRUWDLO289(57RXHQ3$86(
06 SRUWDLO)(50(
07 SRUWDLOHQ0289(0(17
08 SRUWDLOHQ289(5785(
09 SRUWDLOHQ)(50(785(
1 0  VpFXULWp$&7,9(
1 1  VRUWLHWHPSRULVpHSRXYDQWrWUHDFWLYpHGHSXLVOHVHFRQGFDQDOUDGLR YRLUIRQFWLRQVXLYDQWH
1 2  VRUWLHSRXYDQWrWUHDFWLYpHGHSXLVOHVHFRQGFDQDOUDGLR IRQFWLRQSDVjSDV
t1 TEMPORISATION OUT 1 (visible uniquement si le poste 03 ou 11 a été sélectionné à l'étape
précédente) :
02
3HUPHWGHUpJOHUODWHPSRULVDWLRQGHODVRUWLH287VLXQHIRQFWLRQDpWpVpOHFWLRQQpHjWHPSV
FRPPHSDUH[03RX11 GH1 j99 PLQXWHVSDUpWDSHVG
PLQXWH
OPEN B / CLOSE / SÉCURITÉ BORD:
Ob ,O HVW SRVVLEOH GH VpOHFWLRQQHU O
XWLOLVDWLRQ GH O
HQWUpH 23(1 % FRPPH RXYHUWXUH SDUWLHOOH 00
FRPPDQGHGH&/26(RX6e&85,7e%25'
00 23(1%
01  &/26(
02 6e&85,7e%25' FRQWDFW1)
Si l'on sélectionne une logique de fonctionnement qui prévoit l'utilisation de la
commande de CLOSE (logique b, bC, C), cette fonction sera préréglée sur 01
et il ne sera pas possible de la modifier.
STOP / SÉCURITÉ BORD :
SP ,OHVWSRVVLEOHGHVpOHFWLRQQHUO
XWLOLVDWLRQGHO
HQWUpH6723FRPPH6723RX6e&85,7e%25' 00
00 6723
01  6e&85,7e%25' FRQWDFW1)
INVERSION PARTIELLE :
IP 2QSHXWVpOHFWLRQQHUOHW\SHG·LQYHUVLRQ FRPSOqWHRXSDUWLHOOH VXLWHjXQREVWDFOHRXjXQH no
LQWHUYHQWLRQGXERUGVHQVLEOH
Y $FWLYDWLRQGHO·LQYHUVLRQSDUWLHOOH(QSUpVHQFHG·XQREVWDFOHRXVXLWHjO·DFWLYDWLRQ
GX ERUG VHQVLEOH OH PRXYHPHQW GX YDQWDLO HVW LQYHUVp SHQGDQW HQYLURQ 
VHFRQGHVSXLVV·DUUrWH
no 'pVDFWLYDWLRQGHO·LQYHUVLRQSDUWLHOOH(QSUpVHQFHG·XQREVWDFOHRXVXLWHjO·DFWLYDWLRQ
GXERUGVHQVLEOHOHPRXYHPHQWGXYDQWDLOHVWFRPSOqWHPHQWLQYHUVpFHOXLFLVH
SRVLWLRQQHHQSRVLWLRQRXYHUWHRXIHUPpH
BLOCAGE MOTEUR :
Lc ,OHVWSRVVLEOHGHVpOHFWLRQQHUO·XWLOLVDWLRQGXEORFDJHGHPRWHXUSHQGDQWOHIRQFWLRQQHPHQW Y
DYHFODEDWWHULH
Y OHEORFDJHGHPRWHXUFRQWLQXHGHIRQFWLRQQHUUpJXOLqUHPHQWPrPHSHQGDQW
OHIRQFWLRQQHPHQWDYHFODEDWWHULH
no TXDQGRQSDVVHDXIRQFWLRQQHPHQWSDUEDWWHULHOHEORFDJHGHPRWHXU
UHVWHWRXMRXUVRXYHUW
E721 11 532014 - Rev. D
Par
Ecran Fonction
défaut 1
DEMANDE D'ASSISTANCE - COMPTEUR DE CYCLES (combinée aux deux fonctions suivantes) :
AS Y ORUVTXHO
RQDWWHLQWOHQRPEUHGHF\FOHVUpJODEOHDYHFOHVIRQFWLRQVVXLYDQWHVnc HW no
nd HIIHFWXHXQSUpFOLJQRWHPHQWGHVHF HQSOXVGHFHOXLpYHQWXHOOHPHQWGpMj
pWDEOLDYHFODIRQFWLRQPF DYDQWWRXWHPDQXWHQWLRQ
no OHVIRQFWLRQVVXLYDQWHVnc HWnd LQGLTXHQWFRPELHQGHF\FOHVO
LQVWDOODWLRQDHIIHFWXpV
MXVTX
jXQPD[LPXPSRXYDQWrWUHDIILFKpGH99 990
Si le nombre de cycles effectué est supérieur à 99 990 les deux fonctions
suivantes nc et nd afficheront respectivement 99 et 99.
&HWWHIRQFWLRQSHXWrWUHXWLOHSRXUpWDEOLUGHVLQWHUYHQWLRQVG
HQWUHWLHQSURJUDPPpRXSRXU
YpULILHUOHVF\FOHVGHWUDYDLOHIIHFWXpV
PROGRAMMATION DES CYCLES (MILLIERS) :
nc 6L AS   Y  O
pFUDQ LQGLTXH OH QRPEUH GH PLOOLHUV GH F\FOHV DSUqV OHTXHO RQ GHPDQGH
00
O
DVVLVWDQFH UpJODEOHGH0 j99 
6LAS  no O
pFUDQLQGLTXHOHQRPEUHGHPLOOLHUVGHF\FOHVHIIHFWXpV/DYDOHXUDIILFKpH
HVWPLVHjMRXUDYHFODVXFFHVVLRQGHVF\FOHVHQLQWHUDJLVVDQWDYHFODYDOHXUGHnd 
Si AS = no en appuyant sur les touches + et - pendant 5 sec., le compteur
de cycles est mis à zéro.
PROGRAMMATION DES CYCLES (DIZAINES) :
nd 6L AS   Y O
pFUDQLQGLTXHOHQRPEUHGHGL]DLQHVGHF\FOHVDSUqVOHTXHOO
DVVLVWDQFH HVW
00
GHPDQGpH UpJODEOHGH0 j99 
6LAS  no O
pFUDQLQGLTXHOHQRPEUHGHGL]DLQHVGHF\FOHVHIIHFWXpV/DYDOHXUDIILFKpH
VHPHWjMRXUDYHFODVXFFHVVLRQGHVF\FOHVHQLQWHUDJLVVDQWDYHFODYDOHXUGHnc 
FRANÇAIS

Exemple : si l'installation a effectué 11 218, nc = 11 et nd = 21 seront


affichés
ETAT DE L'AUTOMATISME :
St 6RUWLHGHODSURJUDPPDWLRQPpPRULVDWLRQGHVGRQQpHVHWUHWRXUjO
DIILFKDJHGHO
pWDWGHO
DXWRPDWLVPH
00  )(50e 07 )$,/6$)(HQFRXUV
01 289(57 08 YpULILFDWLRQGHVGLVSRVLWLIV%86($6<HQFRXUV
02  $UUrWpSXLV©2895(ª 09 3UpFOLJQRWHPHQWHQVXLWH©2895(ª
03  $UUrWpSXLV©)(50(ª 10 3UpFOLJQRWHPHQWHQVXLWH©)(50(ª
04 (Q©3$86(ª 11 289(57HQ2XYHUWXUH3DUWLHOOH
05 (QSKDVHG
RXYHUWXUH 12 (Q3$86(2XYHUWXUH3DUWLHOOH
06 (QSKDVHGHIHUPHWXUH

6 MÉMORISATION DE CODAGE RADIO 6.1. MÉMORISATION DES RADIOCOMMANDES DS


/
DSSDUHLOODJH pOHF
WURQLTXH HVW GRWp G
XQ )LJ Il est possible de mémoriser au maximum
V\VWqPHGHGpFRGDJH 256 codes divisés entre OPEN A et OPEN
'6 6/+ /&5&  EL B/CLOSE.
FDQDO LQWpJUp DSSHOp   6XU OD UDGLRFRPPDQGH '6 FKRLVLU OD FRPELQDLVRQ
201,'(&&HV\VWqPH 212))VRXKDLWpHGHV',36:,7&+(6
SHUPHW GH PpPRULVHU  0DLQWHQLUOHSRXVVRLU+ 6: RX- 6: HQIRQFpSXLV
SDUOHELDLVG
XQPRGXOH DSSX\HUVXUOHSRXVVRLU6(783 6: SRXUPpPRULVHU
UpFHSWHXU VXSSOpPHQ UHVSHFWLYHPHQWO
RXYHUWXUHWRWDOH 23(1$ RXO
RXYHU
WDLUH )LJ  UqI  HW UDGLRFRPPDQGHV GH OD PrPH WXUHSDUWLHOOH 23(1%&/26( /DOHGFRUUHVSRQGDQWH
IUpTXHQFHO
RXYHUWXUHWRWDOH 23(1$ DLQVLTXHO
RXYHUWXUH FRPPHQFHUDjFOLJQRWHUOHQWHPHQWSHQGDQWVHF
SDUWLHOOH 23(1% GHO
DXWRPDWLVPH  5HOkFKHUOHVGHX[SRXVVRLUV
Les 3 types de codage radio (DS, SLH, LC/  'DQVFHGpODLGHVHFRQGHVDSSX\HUVXUOHSRXVVRLU
RC) peuvent coexister simultanément sur VRXKDLWpGHODUDGLRFRPPDQGH
les deux canaux. Il est possible d'insérer  /D OHG FRUUHVSRQGDQWH V
DOOXPHUD IL[H SHQGDQW 
jusqu'à 256 codes radio divisés entre OPEN
VHFRQGHSRXUV
pWHLQGUHHQVXLWHHQLQGLTXDQWODPp
A et OPEN B.
PRULVDWLRQHIIHFWLYH
Pour utiliser différents systèmes de codage  3RXUDMRXWHUG
DXWUHVFRGHVGLIIpUHQWVGHFHOXLjSHLQH
sur le même canal, il faut terminer l'appren- PpPRULVpUpSpWHUODSURFpGXUHGHSXLVOHSRLQW
tissage de chaque système et répéter suc-
cessivement la procédure pour l'autre..
Ne connecter aucun dispositif radio sur des
armoires configurées comme SLAVE.
E721 12 532014 - Rev. D
 3RXU XWLOLVHU GHV UDGLRFRPPDQGHV D\DQW OH PrPH 6.3 MÉMORISATION DES RADIOCOMMANDES LC/RC
FRGH LO HVW QpFHVVDLUH GH FRSLHU OD PrPH FRPEL
QDLVRQ212))VXUOHVDXWUHVUDGLRFRPPDQGHVVDQV Il est possible de mémoriser au maximum
GHYRLUULHQPRGLILHUVXUODILFKHGHFRQWU{OH 256 codes divisés entre OPEN A et OPEN
B/CLOSE.

6.2. MÉMORISATION DES RADIOCOMMANDES SLH Utiliser les télécommandes LC/RC uniquement
avec un module récepteur à 433 MHz.
Il est possible de mémoriser au maximum  0DLQWHQLUOHSRXVVRLU+ 6: RX- 6: HQIRQFpSXLV
256 codes divisés entre OPEN A et OPEN B/
DSSX\HU VXU OH SRXVVRLU 6(783 6:  SRXU PpPRULVHU
CLOSE.
UHVSHFWLYHPHQWO
RXYHUWXUHWRWDOH 23(1$ RXO
RXYHUWXUH
 6XU OD UDGLRFRPPDQGH 6/+ DSSX\HU HW PDLQWHQLU SDUWLHOOH 23(1%&/26( /DOHGFRUUHVSRQGDQWHFRP
HQIRQFpVOHVSRXVVRLUV3HW3VLPXOWDQpPHQW PHQFHUDjFOLJQRWHUOHQWHPHQWSHQGDQWVHF
 /D OHG GH OD UDGLRFRPPDQGH FRPPHQFHUD j FOL  5HOkFKHUOHSRXVVRLU
JQRWHU
 'DQVFHGpODLGHVHFRQGHVDSSX\HUVXUOHSRXVVRLU
 5HOkFKHUOHVGHX[SRXVVRLUV
VRXKDLWpVXUODWpOpFRPPDQGH/&5&
 0DLQWHQLUOHSRXVVRLU+ 6: RX- 6: HQIRQFpSXLV
DSSX\HUVXUOHSRXVVRLU6(783 6: SRXUPpPRULVHU  /DOHGV
DOOXPHUDGHIDoRQIL[HSHQGDQWVHFRQGH
UHVSHFWLYHPHQWO
RXYHUWXUHWRWDOH 23(1$ RXO
RXYHU HQLQGLTXDQWODPpPRULVDWLRQHIIHFWLYHSRXUUHFRP
WXUHSDUWLHOOH 23(1%&/26( /DOHGFRUUHVSRQGDQWH PHQFHUHQVXLWHjFOLJQRWHUSHQGDQWDXWUHVVHFRQGHV
FRPPHQFHUDjFOLJQRWHUOHQWHPHQWSHQGDQWVHF SHQGDQW OHVTXHOOHV LO HVW SRVVLEOH GH PpPRULVHU XQH
 5HOkFKHUOHVGHX[SRXVVRLUV DXWUHUDGLRFRPPDQGH
 3HQGDQW FHV  VHF WDQGLV TXH OD OHG GH OD UDGLR  8QHIRLVSDVVpHVOHVVHFRQGHVODOHGV
pWHLQWHQLQGL
FRPPDQGHFOLJQRWHHQFRUHHQIRQFHUHWPDLQWHQLU TXDQWODILQGHODSURFpGXUH
HQIRQFpOHSRXVVRLUVRXKDLWpVXUODUDGLRFRPPDQGH
6.3.1 MÉMORISATION À DISTANCE DE
ODOHGGHODUDGLRFRPPDQGHV
DOOXPHUDGHPDQLqUH

FRANÇAIS
IL[H  RADIOCOMANDES LC/RC
 /DOHGVXUODFDUWHV
DOOXPHUDIL[HSHQGDQWVHFRQGHV $YHF GHV UDGLRFRPPDQGHV /&5& RQ SHXW PpPRULVHU
SRXUV
pWHLQGUHHQVXLWHHQLQGLTXDQWODPpPRULVDWLRQ G
DXWUHV UDGLRFRPPDQGHV j GLVWDQFH F
HVWjGLUH VDQV
HIIHFWLYH LQWHUYHQLUGLUHFWHPHQWVXUODFDUWHHQXWLOLVDQWXQHUDGLR
 5HOkFKHUOHSRXVVRLUGHODUDGLRFRPPDQGH FRPPDQGHSUpFpGHPPHQWPpPRULVpH
 $SSX\HUGHX[IRLVVXFFHVVLYHPHQWHWUDSLGHPHQWVXU  6HSURFXUHUXQHUDGLRFRPPDQGHGpMjPpPRULVpHVXU
OHSRXVVRLUGHODUDGLRFRPPDQGHPpPRULVpH O
XQGHVGHX[FDQDX[ 23(1$RX23(1%&/26( 
L’automatisme effectuera une ouverture.  (QIRQFHUHWPDLQWHQLUHQIRQFpVOHVSRXVVRLUV3HW3
S'assurer que l'automatisme ne présente VLPXOWDQpPHQWMXVTX
jFHTXHOHVGHX[OHGVFOLJQRWHQW
aucun obstacle créé par des personnes OHQWHPHQWSHQGDQWVHFRQGHV
ou des biens.  'DQVXQGpODLGHVHFDSSX\HUVXUOHSRXVVRLUSUp
3RXU DFWLYHU G
DXWUHV UDGLRFRPPDQGHV D\DQW OH PrPH FpGHPPHQWPpPRULVpGHODUDGLRFRPPDQGHSRXU
FRGHG
LQVWDOODWLRQLOHVWQpFHVVDLUHGHWUDQVIpUHUOHFRGH DFWLYHUODSKDVHG
DSSUHQWLVVDJHVXUOHFDQDOFKRLVL
GHO
LQVWDOODWLRQGXSRXVVRLUGHODUDGLRFRPPDQGHPpPR  /DOHGVXUODFDUWHFRUUHVSRQGDQWDXFDQDOHQDSSUHQ
ULVpHDXSRXVVRLUFRUUHVSRQGDQWGHVUDGLRFRPPDQGHVj WLVVDJHFOLJQRWHSHQGDQWVHFSHQGDQWOHVTXHOOHVLOIDXW
DMRXWHUHQVXLYDQWODSURFpGXUHVXLYDQWH WUDQVPHWWUHOHFRGHG
XQHDXWUHUDGLRFRPPDQGH
D VXUODUDGLRFRPPDQGHPpPRULVpHDSSX\HUHW  /DOHGV
DOOXPHUDGHIDoRQIL[HSHQGDQWVHFRQGHHQ
PDLQWHQLUHQIRQFpVOHVSRXVVRLUV3HW3VLPXO LQGLTXDQWODPpPRULVDWLRQHIIHFWLYHHWUHFRPPHQFHUD
WDQpPHQW HQVXLWHjFOLJQRWHUSHQGDQWDXWUHVVHFRQGHVSHQ
E /D OHG GH OD UDGLRFRPPDQGH FRPPHQFHUD j GDQWOHVTXHOOHVLOHVWSRVVLEOHGHPpPRULVHUXQHDXWUH
FOLJQRWHU UDGLRFRPPDQGH
F 5HOkFKHUOHVGHX[SRXVVRLUV
G $SSX\HUVXUOHSRXVVRLUPpPRULVpHWOHPDLQWHQLU
6.4. PROCÉDURE D'EFFACEMENT DES RADIOCOMMANDES
HQIRQFp ODOHGGHODUDGLRFRPPDQGHV
DOOXPHUD 3RXUHIIDFHUTOUSOHVFRGHVGHVUDGLRFRPPDQGHVLQVp
GHPDQLqUHIL[H  UpHVLOVXIILWGHPDLQWHQLUOHVGHX[SRXVVRLUV+ 6: HW-
H $SSURFKHUOHVUDGLRFRPPDQGHVDSSX\HUVXUOH 6: HQIRQFpVSXLVG
DSSX\HUSHQGDQWXQHVHFRQGHVXU
SRXVVRLUFRUUHVSRQGDQWGHODUDGLRFRPPDQGHj OHSRXVVRLU6(783 6: HWGHPDLQWHQLUHQIRQFpVOHVGHX[
DMRXWHUHWOHPDLQWHQLUHQIRQFpHQQHOHUHOkFKDQW SUHPLHUVSRXVVRLUVSHQGDQWVHF
TX
DSUqVOHGRXEOHFOLJQRWHPHQWGHODOHGGHOD ‡ /HVOHGV5$',2HW5$',2FOLJQRWHURQWUDSLGHPHQW
UDGLRFRPPDQGH TXL LQGLTXH OD PpPRULVDWLRQ SHQGDQWVHFRQGHV
HIIHFWLYH ‡ /HVOHGVV
DOOXPHURQWIL[HPHQWSHQGDQWVHFRQGHV
I $SSX\HU GHX[ IRLV VXFFHVVLYHPHQW HW UDSLGH SRXUV
pWHLQGUHHQVXLWH HIIDFHPHQWHIIHFWXp 
PHQW VXU OH SRXVVRLU GH OD UDGLRFRPPDQGH
‡ 5HOkFKHUOHVGHX[SRXVVRLUV
PpPRULVpH
Cette opération N'est PAS réversible. Tous les
L’automatisme effectuera une ouverture.
codes des radiocommandes mémorisées se-
Il faut s'assurer que l'automatisme ne pré-
ront effacés, tant comme OPEN A que comme
sente aucun obstacle créé par des personnes
OPEN B/CLOSE.
ou des biens.

E721 13 532014 - Rev. D


7 MISE EN SERVICE
7.1 CONTRÔLE DES LEDS
$SUqVDYRLUHIIHFWXpWRXVOHVEUDQFKHPHQWVHWDOLPHQWpODFDUWHYpULILHUDYHFOHWDEOHDXFLGHVVRXVO
pWDWGHVOHGV
UHODWLYHPHQWjO
pWDWGHVHQWUpHV VXUODILJO
DXWRPDWLVPHHVWIHUPpHWDXUHSRV 
&HV/('LQGLTXHQWO
pWDWGHVHQWUpHVGHODFDUWHHWVRQWG
XQHJUDQGHLPSRUWDQFHSRXUODPDQXWHQWLRQGHO
DXWRPD
WLVPH
,OIDXWQRWHUTXH  LED ALLUMÉE  FRQWDFWIHUPp  LED ÉTEINTE  FRQWDFWRXYHUW

< (1) F
BUS 2EASY
< (2)
< OPEN A -
< GND
< OPEN B / CLOSE < SAFE
+

R
A
C

1
RADIO XF

R
2
IO

E
FC
FC

IO

O
< STOP / SAFE

W
R
D

O
R
A

P
R
< FSW OP

R
SETUP
< GND
< FSW CL
< +24

USB
FRANÇAIS

BATTERY
RELEASE
Y
R
)

R
F

OUT
-L

E
S

S
E IN

TO
R M

K
K
K
T
-N

N
T EC

C
T
T RI

C
C
(P A

- +
A

LO
LA

LO
LO
M

R
P

M
B
<

<

<

<

<

<

<
<
<

)LJ

/HVOHGV)&$HW)&&UHSUpVHQWHQWOHVFRQWDFWV1)GXILQ Les entrées STOP (SAFE), FSW CL, FSW OP,


GHFRXUVHLQWpJUpVXUODFDUWHTXLVLHOOHVVRQWHQJDJpHV OPEN B configurées comme SAFE sont
V
RXYUHQWHQpWHLJQDQWSDUFRQVpTXHQWODOHGFRUUHVSRQ des entrées de sécurité avec un contact
GDQWH N.F. (Normalement Fermé) ; ainsi, les LEDs
correspondantes doivent être ALLUMÉES dans
)&$ la condition d’automatisme au repos ; elles
$XWRPDWLVPH)(50(
)&&  )&&HQJDJp s’éteindront lorsque le dispositif connecté sera
engagé.
)&$  )&$HQJDJp Les entrées OPEN A, OPEN B/CLOSE sont des
$XWRPDWLVPH289(57 entrées avec un contact N.O. (Normalement
)&& Ouvert) ; ainsi, les LEDs correspondantes
doivent être ÉTEINTES dans la condition
Tab.3 - Description de la led POWER d’automatisme au repos ; elles s’allumeront
lorsque le dispositif connecté sera engagé.
En cas d’armoire programmée comme
Allumé fixe $OLPHQWDWLRQGXVHFWHXUSUpVHQWH
SLAVE, les LEDs correspondant au bornier J13
devront être hors tension.
Clignotant $OLPHQWDWLRQSDUEDWWHULH
Led ERROR clignotante indique l'alarme
en cours (situation ne nuisant pas au bon
Éteint &DUWHpWHLQWH fonctionnement du portail)
Led ERROR allumé fixe indique l'erreur en
cours (situation qui bloque le fonctionne-
ment jusqu'à l'élimination de la cause de
7.2 FONCTIONNEMENT À BATTERIE l'erreur)
ATTENTION
3RXURSWLPLVHUOHVFRQVRPPDWLRQVHWHQVDXYHJDUGHUODFKDUJHGXUDQWOHIRQFWLRQQHPHQWjEDWWHULHORUVTXHO·DXWRPDWLVPH
HVWDUUrWpHWOHV\VWqPHHQVWDQGE\O·DIILFKHXU/&'OD/('%86HDV\HWOHV/('V)&&HW)&$VRQWpWHLQWHVWDQGLVTXHOD
/('32:(5FOLJQRWH
'XUDQWFHWWHSKDVHLOHVWWRXMRXUVSRVVLEOHG·DIILFKHUO·pWDWGHO·DXWRPDWLVPH3RXUFHODLOVXIILWG·DSSX\HUEULqYHPHQWVXUOD
WRXFKHSUpVHQWHVXUODFDUWH$SUqVFHWWHFRXUWHSUHVVLRQO·DIILFKHXU/&'LQGLTXHSHQGDQWVHFRQGHVHQYLURQO·pWDWGH
O·DXWRPDWLVPHSXLVV·pWHLQGUDGHQRXYHDX(QUHYDQFKHDXFRXUVG·XQDFWLRQQHPHQWQRUPDOWRXWHVOHV/('VGHGLDJQRVWLF
HWOHVVLJQDOLVDWLRQVG·pWDWGHO·DIILFKHXUUHGHYLHQQHQWFRKpUHQWHVDYHFO·pWDWGHO·DXWRPDWLVPH YRLU)LJ 
E721 14 532014 - Rev. D
7.3. POSITIONNEMENT DES FINS DE COURSE
Pour un positionnement correct des aimants de fin de course, il est nécessaire que la centrale de
commande soit installée et branchée correctement à tous les accessoires de commande et de
sécurité.
/
RSpUDWHXUHVWGRWpG
XQFDSWHXUPDJQpWLTXHGHILQGHFRXUVHLQWpJUpGLUHFWHPHQWVXUODSODWLQHpOHFWURQLTXHGH
FRPPDQGH
/
DUUrWGXSRUWDLOHQRXYHUWXUHRXHQIHUPHWXUHV
HIIHFWXHORUVTXHO
DLPDQWSRODULVpIL[pGDQVODSDUWLHVXSpULHXUHGH
ODFUpPDLOOqUHDFWLYHOHFDSWHXU
 9pULILHUTXHO
RSpUDWHXUDpWpSUpYXSRXUOHIRQFWLRQQHPHQWPDQXHOFRQIRUPpPHQWDX[
LQVWUXFWLRQVGHO
RSpUDWHXU
 0HWWUHPDQXHOOHPHQWOHSRUWDLOHQSRVLWLRQG·ouvertureHQODLVVDQWPPGHODEXWpH
PpFDQLTXHGHILQGHFRXUVH YRLU)LJ 

A
C

R O1

2
FC
FC

IO
I
 )DLUHFRXOLVVHUVXUODFUpPDLOOqUHO
DLPDQWDYHFOHRONDGDQVODGLUHFWLRQGXPRWHXU'qV

R
A

E
R
TXHODOHGUHODWLYHjODILQGHFRXUVH)&$SUpVHQWHVXUODFDUWHV
pWHLQWODIL[HUDYHFOHV
YLVDGKRF
 0HWWUHPDQXHOOHPHQWOHSRUWDLOHQSRVLWLRQGH fermetureHQODLVVDQWPPGHO
DUUrW
PpFDQLTXHGHILQGHFRXUVH
 )DLUHFRXOLVVHUVXUODFUpPDLOOqUHO
DLPDQWDYHFOHCARRÉGDQVODGLUHFWLRQGXPRWHXU'qV
TXHODOHGUHODWLYHjODILQGHFRXUVH)&&SUpVHQWHVXUODFDUWHV
pWHLQWODIL[HUDYHFOHV
YLVDGKRF

A
C

R O1

2
FC
FC

IO
 &RQWU{OHUTX
jODILQGHODPDQRHXYUHWDQWHQRXYHUWXUHTX
HQIHUPHWXUHODOHGGHODILQ

I
D

R
A

A
GHFRXUVHUHVSHFWLYHV
pWHLJQHFRUUHFWHPHQWHWOHFDVpFKpDQWDSSRUWHUOHVPRGLILFDWLRQV

E
R
FRQYHQDEOHVjODSRVLWLRQGHVDLPDQWVGHILQGHFRXUVH
Pour éviter des dommages de l'opérateur et/ou des interruptions du

FRANÇAIS
fonctionnement de l'automatisme, il est nécessaire de laisser environ 40 mm
par rapport aux butées mécaniques de fin de course.

Pour un bon
fonctionnement de
l'opérateur, l'aimant
représentant le
ROND doit être
utilisé comme fin de
course d'OUVERTURE
et l'aimant avec le
CARRÉ doit être utilisé
comme fin de course
de FERMETURE
(VOIR FIG.17)
En cas d’installation
en configuration
MA STER/SL AVE, les
aimants de fin de
course devront être
installés d’après la
Fig. 18.

)LJ

MASTER/SLAVE

)LJ

E721 15 532014 - Rev. D


7.4 CONFIGURATION MASTER/SLAVE
6·LOHVWQpFHVVDLUHGHUpDOLVHUXQHLQVWDOODWLRQDYHFGHVYDQWDX[RSSRVpVjDFWLRQQHUVLPXOWDQpPHQWSRXUO·RXYHUWXUH
HWODIHUPHWXUHGXSDVVDJHRQSHXWFRQQHFWHUHWFRQILJXUHUGHX[DUPRLUHV(HQPRGDOLWp0DVWHU6ODYH
/·DUPRLUH 0$67(5 SDUDPqWUH C t  GX SUHPLHU QLYHDX GH SURJUDPPDWLRQ FRQILJXUp FRPPH M A  GHYUD GLVSRVHU
GH WRXWHV OHV FRQQH[LRQV QpFHVVDLUHV SRXU OH IRQFWLRQQHPHQW FRUUHFW GH O·LQVWDOODWLRQ SKRWRFHOOXOHV VpFXULWpV
UDGLRLPSXOVLRQVG·RXYHUWXUHODPSHFOLJQRWDQWH WDQGLVTXHO·DUPRLUH6/$9( SDUDPqWUH C t GXSUHPLHUQLYHDXGH
SURJUDPPDWLRQFRQILJXUpFRPPH S L  QHGHYUDSUpVHQWHUDXFXQW\SHGHFkEODJHDXQLYHDXGXERUQLHU-
YXTXHOHVHQWUpHVSUpVHQWHVVRQWWRWDOHPHQWLJQRUpHV/HVGHX[DUPRLUHVFRPPXQLTXHURQWHQWUHHOOHVjWUDYHUVOH
%86($6<SDUO·LQWHUPpGLDLUHG·XQFkEODJHjGHX[S{OHVPOLARISÉVXUOHERUQLHU-
/·DUPRLUH0$67(5FRQWU{OHHQWRXWSRLQWO·DUPRLUH6/$9(SDUO·LQWHUPpGLDLUHGX%86($6<HWJqUHWRXVOHVDFWLRQQHPHQWV
DLQVLTXHOHVWHPSVGHVGHX[YDQWDX[

Éviter tout type de connexion et de câblage sur le bornier J13 de la centrale SLAVE

La connexion BUS entre les deux cartes devra être POLARISÉE en respectant la séquence des deux
pôles du bornier J12 (POLE (1) - POLE (2)) - (voir Fig. 19).

Lorsqu’on configure une centrale comme SLAVE, on force les valeurs de certains paramètres de
programmation qui ne sont plus affichés dans le menu (LO-PA-Pb-Ph-Op). Lorsqu’on ramène
la carte en modalité MASTER, ces valeurs qui avaient été forcées sont maintenues à l’intérieur
de la programmation.
7.4.1 CÂBLAGES MASTER-SLAVE
FRANÇAIS

(1) (1)
BUS 2 EASY BUS 2 EASY
(2) (2)

1HUpDOLVHU
DXFXQHFRQQH[LRQ
jFHERUQLHU

E721 MASTER E721 SLAVE


)LJ

7.4.2 PROCÉDURE DE SETUP MASTER-SLAVE

La demande de SETUP par l’intermédiaire du clignotement du sigle S0 sur l’afficheur peut s’afficher
sur la centrale MASTER et sur la centrale SLAVE. Dans le second cas, l’erreur 91 s’affiche sur la
centrale MASTER. Quoi qu’il en soit, la procédure de SETUP ne pourra être exécutée que sur la
centrale MASTER.

3RXUH[pFXWHUOH6(783VXUXQHLQVWDOODWLRQ0$67(56/$9(SURFpGHUFRPPHVXLW

 'pEORTXHUOHVGHX[YDQWDX[OHVDPHQHUjODPRLWLpGHODFRXUVHHWOHVEORTXHUGHQRXYHDX YRLUSURFpGXUHQƒ


3DU6(783
 0DLQWHQLUOHERXWRQ6(783GHODFDUWH0$67(5HQIRQFpMXVTX·jFHTXHOHSRUWDLO0$67(5FRPPHQFHOHPRXYHPHQW
 /HSRUWDLO0$67(5H[pFXWHjSUpVHQWXQHSURFpGXUHFRPSOqWHGH6(783 YRLU3DU6(783
 $XWHUPHGX6(783FRUUHFWGHODFDUWH0$67(5FRPPHQFHODSURFpGXUHFRPSOqWHGH6(783GHODFDUWH6/$9(
YRLU3DU6(783 
 ­ODILQGHFHWWHSURFpGXUHODFDUWH0$67(5YpULILHODSRVLWLRQGXYDQWDLO6/$9(HWO·DPqQHGDQVODPrPHSRVLWLRQ
RXYHUWRXIHUPp GXYDQWDLO0$67(5
 3URFpGXUHWHUPLQpH
En cas d’erreur ou d’inachèvement de la procédure de SETUP décrite ci-dessus, la répéter à partir
du point n°1.

E721 16 532014 - Rev. D


7.4. SETUP 9 SIGNALISATION D'ALARMES ET D'ANOMALIES
En alimentant la carte, si aucun SETUP n'a 6LGHValarmes VHSUpVHQWHQW FRQGLWLRQVQHQXLVDQWSDVDX
jamais été effectué, ou si la carte l'exige, IRQFWLRQQHPHQW GX SRUWDLO  RX des anomalies FRQGLWLRQV
le sigle S0 clignote avec la led SETUP pour TXLRQWEORTXpOHIRQFWLRQQHPHQWGXSRUWDLO VXUO
pFUDQLOHVW
indiquer qu'il est nécessaire d'effectuer le SRVVLEOHGHYRLUOHQXPpURUHODWLIjODFRQGLWLRQHQYLJXHXU
SETUP. Les signaux d'ALARME ou d'ERREUR dispa-
raîtront lors du cycle suivant uniquement
Pour le bon résultat de la procédure de si la cause qui les provoque est éliminée.
SETUP, vérifier minutieusement la polarité
correcte des fins de course magnétiques 9.1 ALARMES
comme décrit au paragraphe précèdent. Quand une ALARME se vérifie, la led ERROR
commence à clignoter et en appuyant
3RXUHIIHFWXHUOH6(783VXLYUHOHVSDVVDJHVVXLYDQWV simultanément sur les touches + et - sur
1. Amener le portail à la moitié de sa course (cela est l'écran, le numéro relatif à l'anomalie en
très important pour la réussite du SETUP) et vérifier cours sera affiché.
que les deux LEDs FCA et FCC sont allumées. Dans 'DQVOH7DEVRQWLQGLTXpHVWRXWHVOHVDODUPHVSRXYDQW
le cas contraire, la carte signalera l’erreur 12 (voir rWUHDIILFKpHVjO
pFUDQ
tabl. 5). Tableau 4 - Alarmes
 0DLQWHQLUOHSRXVVRLU6(783HQIRQFp 6: MXVTX
jFH 2 2 &RXUDQWGX027(85OLPLWp
TXHOHSRUWDLOFRPPHQFHOHPRXYHPHQWUDOHQWLHQ
V
DUUrWDQWORUVTX
LODWWHLQWODILQGHFRXUVH6LODILQGH 2 4 6RUWLH/$03HQFRXUWFLUFXLW
FRXUVH DWWHLQWH HVW FHOOH GH OD IHUPHWXUH DYHF OH 2 7 'pWHFWLRQG
REVWDFOH YLVLEOHSHQGDQWVHF
CARRÉ O·DSSDUHLOODJHPpPRULVHUDFHSRLQWFRPPH 0pPRLUHGHVFRGHVUDGLR;)PRGXOHSOHLQ
EXWpHHQfermetureLQYHUVHPHQWVLODILQGHFRXUVH 3 0 YLVLEOHSHQGDQWVHF

FRANÇAIS
HVW FHOOH G
RXYHUWXUH DYHF OH ROND  O·DSSDUHLOODJH 4 0 'HPDQGHG
DVVLVWDQFH
PpPRULVHUD FH SRLQW FRPPH EXWpH HQ ouverture 5pWDEOLVVHPHQWIRUFpGHODSURJUDPPDWLRQ
'DQVFHWWHSKDVHS 1 FOLJQRWHjO
pFUDQ 4 6 SDUGpIDXW
 /H SRUWDLO FRPPHQFH DXWRPDWLTXHPHQW OH 9.2 ERREURS
PRXYHPHQW UDOHQWL GDQV OD GLUHFWLRQ RSSRVpH HQ Quand une ERREUR se présente, la led
V
DUUrWDQWORUVTX
LODWWHLQWODILQGHFRXUVH6LODILQGH DL20 s'allume fixement et en appuyant
FRXUVHDWWHLQWHVHUDFHOOHGHO
RXYHUWXUH DYHFOHROND  simultanément sur les touches + et - sur
O·DSSDUHLOPpPRULVHUDFHSRLQWFRPPHXQHEXWpHHQ l'écran, le numéro relatif à l'anomalie en
ouvertureLQYHUVHPHQWVLODILQGHFRXUVHHVWFHOOHGH cours sera affiché.
IHUPHWXUH DYHFOHCARRÉ O·DSSDUHLOODJHPpPRULVHUD 'DQVOH7DEVRQWLQGLTXpHVWRXWHVOHVDQRPDOLHVSRXYDQW
FHSRLQWFRPPHXQDUUrWHQfermeture'DQVFHWWH rWUHDIILFKpHVjO
pFUDQ
SKDVHS 3 FOLJQRWHjO
pFUDQ Tab. 5 - Erreurs
 6HORQODGHUQLqUHILQGHFRXUVHDWWHLQWHO
DSSDUHLOVH
PHWWUD j O
pWDW IHUPp 0 0  RX RXYHUW 0 1  'DQV OH 0 1 &DUWHHQSDQQH
VHFRQG FDV GRQQHU XQH LPSXOVLRQ 23(1 SRXU IDLUH 0 3 0RWHXUHQSDQQH
IHUPHUOHSRUWDLO %ORFDJHPRWHXUEORTXpIHUPp FRQWU{OHUOH
0 6 EORFDJHGXPRWHXUHWpYHQWXHOOHPHQWOH
UHPSODFHU
8 TEST DE L'AUTOMATISME 3RUWDLOWURSORXUGRXIURWWHPHQWVpOHYpV WHQWHU
ÉODILQGHO
LQVWDOODWLRQHWGHODSURJUDPPDWLRQFRQWU{OHUOHERQ 0 7 G
DXJPHQWHUODIRUFHGXPRWHXU
IRQFWLRQQHPHQWGHO
LQVWDOODWLRQ9pULILHUVXUWRXWO
LQWHUYHQWLRQ (UUHXUGLVSRVLWLI%86($6< H[PrPHDGUHVVH
FRUUHFWHGHVGLVSRVLWLIVGHVpFXULWpHWYpULILHUTXHO
LQVWDOODWLRQ
UHVSHFWHOHVQRUPHVGHVpFXULWpHQYLJXHXU 0 8 VXUGHX[SDLUHVGHSKRWRFHOOXOHVYpULILHUOHV
DGUHVVHV
Nous rappelons qu’au second niveau de 1 0 /HVGHX[ILQVGHFRXUVHDYHFODPrPHSRODULWp
programmation, on dispose du paramètre
de configuration de l’encoder (paramètre 1 2 )LQGHFRXUVHHQJDJpHDXGpEXW6(783
EC). Cet encoder « virtuel » présent sur 1 5 7LPHRXWpSXLVp
la carte fonctionne comme un dispositif $EVHQFHGHFRPPXQLFDWLRQDYHFODFHQWUDOH
anti-écrasement. Si, durant la phase 9 0 6/$9(FHQWUDOH6/$9(DEVHQWH
d’ouverture ou de fermeture, le portail
heurte un obstacle, l’encoder « virtuel » 9 1 (UUHXUVXUODFHQWUDOH6/$9(
provoque l’inversion du mouvement.
Au mouvement suivant dans la même 9 2 (UUHXUVXUODFHQWUDOH6/$9(
direction, un obstacle dans la même
position provoquera l’arrêt du moteur. Les erreurs 9 0 9 1 et 9 2 s’affichent
Il est fondamental de configurer uniquement sur E721 configuré comme
correctement ce paramètre pour régler MASTER et en particulier les codes 9 1 et
la sensibilité correcte de l’encoder 9 2 indiquent des erreurs sur la centrale
« virtuel » aux éventuels obstacles durant SLAVE. Si ces erreurs s’affichent, il est
le mouvement. recommandé de vérifier le type d’erreur
sur l’afficheur de la centrale SLAVE pour
la résoudre et rétablir le fonctionnement
correct de l’installation.
E721 17 532014 - Rev. D
10 LOGIQUES DE FONCTIONNEMENT
Si la commande SAFE est activée durant
Les effets sur les autres entrées à impulsion active l’actionnement du vantail, celle-ci en provoque
sont indiqués entre parenthèses. l’inversion immédiate et complète. Lorsque
La commande CLOSE est activable sur l’entrée OPEN l’automatisme est à l’arrêt, la commande
B à partir du 2ème niveau de programmation. maintenue active en empêche l’actionnement.
LOGIQUE « E » IMPULSIONS
ETAT DE L'AUTOMATISME OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP

FERME RXYUHOHSRUWDLO RXYUHOHSRUWDLOSDUWLHO DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW


OHPHQW 23(1LQKLEp 23(1LQKLEp 23(1LQKLEp

EORTXHOHIRQFWLRQQHPHQW EORTXHOHIRQFWLRQQHPHQW EORTXHHWRXYUHORUVGHOD


EN OUVERTURE  UHIHUPHOHSRUWDLO EORTXHOHIRQFWLRQQHPHQW YRLUSURJqPHQLYHDX DXFXQHIIHW OLEpUDWLRQ 23(1EORTXp
PpPRULVDWLRQ&/26(

OUVERT UHIHUPHOHSRUWDLO  UHIHUPHOHSRUWDLO UHIHUPHOHSRUWDLO DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW


23(1&/26(LQKLEpV &/26(LQKLEp 23(1&/26(LQKLEpV

EN FERMETURE URXYUHOHSRUWDLO URXYUHOHSRUWDLO DXFXQHIIHW EORTXHOHIRQFWLRQQHPHQW DXFXQHIIHW LQYHUVHHQRXYHUWXUH YRLU EORTXHHWRXYUHORUVGHOD


OLEpUDWLRQ 23(1EORTXp
SURJqPHQLYHDX  PpPRULVDWLRQ&/26(

BLOQUE IHUPHOHSRUWDLO IHUPHOHSRUWDLO IHUPHOHSRUWDLO DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW 23(1EORTXH


23(1&/26(LQKLEpV 23(1LQKLEp &/26(LQKLEp PpPRULVDWLRQGH&/26(

LOGIQUE « EP » IMPULSIONS
ETAT DE L'AUTOMATISME OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP

FERME RXYUHOHSRUWDLO RXYUHOHSRUWDLOSDUWLHO DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW


OHPHQW 23(1LQKLEp 23(1LQKLEp 23(1LQKLEp
FRANÇAIS

EORTXHOHIRQFWLRQQHPHQW EORTXHOHIRQFWLRQQHPHQW EORTXHHWRXYUHORUVGHOD


EN OUVERTURE  UHIHUPHOHSRUWDLO EORTXHOHIRQFWLRQQHPHQW YRLUSURJqPHQLYHDX DXFXQHIIHW OLEpUDWLRQ 23(1EORTXp
PpPRULVDWLRQ&/26(

OUVERT UHIHUPHOHSRUWDLO  UHIHUPHOHSRUWDLO UHIHUPHOHSRUWDLO DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW


23(1&/26(LQKLEpV &/26(LQKLEp 23(1&/26(LQKLEpV

EN FERMETURE EORTXHOHIRQFWLRQQHPHQW EORTXHOHIRQFWLRQQHPHQW DXFXQHIIHW EORTXHOHIRQFWLRQQHPHQW DXFXQHIIHW LQYHUVHHQRXYHUWXUH YRLU EORTXHHWRXYUHORUVGHOD


OLEpUDWLRQ 23(1EORTXp
SURJqPHQLYHDX  PpPRULVDWLRQ&/26(
UHSUHQGOHPRXYHPHQW UHSUHQGOHPRXYHPHQW DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW 23(1EORTXH
BLOQUE GDQVOHVHQVLQYHUVH$SUqV GDQVOHVHQVLQYHUVH$SUqV IHUPHOHSRUWDLO 23(1&/26(LQKLEpV 23(1LQKLEp &/26(LQKLEp PpPRULVDWLRQGH&/26(
6723IHUPHWRXMRXUV 6723IHUPHWRXMRXUV
LOGIQUE « A » IMPULSIONS
ETAT DE L'AUTOMATISME OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP
RXYUHOHSRUWDLOSDUWLHOOH
V
RXYUHHWVHUHIHUPHDSUqV PHQWHWOHIHUPHDSUqVOH DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW
FERME OHWHPSVGHSDXVH DXFXQHIIHW 23(1LQKLEp 23(1LQKLEp DXFXQHIIHW 23(1LQKLEp
WHPSVGHSDXVH%
EORFDJHHWRXYHUWXUHORUV
EN OUVERTURE DXFXQHIIHW  DXFXQHIIHW UHIHUPHOHSRUWDLO EORTXHOHIRQFWLRQQHPHQW YRLUSURJqPHQLYHDX DXFXQHIIHW GHODOLEpUDWLRQ
PpPRULVH&/26(

UHFKDUJHOHWHPSVGH UHFKDUJHOHWHPSVGH UHFKDUJHOHWHPSVGH UHFKDUJHOHWHPSVGH


OUVERT EN PAUSE SDXVH  SDXVH% UHIHUPHOHSRUWDLO EORTXHOHIRQFWLRQQHPHQW DXFXQHIIHW SDXVH SDXVH
&/26(LQKLEp &/26(LQKLEp

EN FERMETURE URXYUHOHSRUWDLO URXYUHOHSRUWDLO DXFXQHIIHW EORTXHOHIRQFWLRQQHPHQW DXFXQHIIHW LQYHUVHHQRXYHUWXUH YRLU EORFDJHHWRXYHUWXUHORUV


GHODOLEpUDWLRQ
SURJqPHQLYHDX  PpPRULVH&/26(

BLOQUE IHUPHOHSRUWDLO IHUPHOHSRUWDLO IHUPHOHSRUWDLO DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW


23(1&/26(LQKLEpV 23(1LQKLEp &/26(LQKLEp 23(1&/26(LQKLEpV

LOGIQUE « A1 » IMPULSIONS
ETAT DE L'AUTOMATISME OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP
RXYUHOHSRUWDLOSDUWLHOOH
V
RXYUHHWVHUHIHUPHDSUqV PHQWHWOHIHUPHDSUqVOH DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW
FERME OHWHPSVGHSDXVH DXFXQHIIHW 23(1LQKLEp 23(1LQKLEp DXFXQHIIHW 23(1LQKLEp
WHPSVGHSDXVH%

FRQWLQXHjRXYULUHW EORFDJHHWRXYHUWXUHORUV
EN OUVERTURE DXFXQHIIHW  DXFXQHIIHW UHIHUPHOHSRUWDLO EORTXHOHIRQFWLRQQHPHQW YRLUSURJqPHQLYHDX GHODOLEpUDWLRQ
UHIHUPHDXVVLW{W PpPRULVH&/26(

UHFKDUJHOHWHPSVGH UHFKDUJHOHWHPSVGH EORTXHHWUHIHUPH UHFKDUJHOHWHPSVGH


OUVERT EN PAUSE SDXVH  SDXVH% UHIHUPHOHSRUWDLO EORTXHOHIRQFWLRQQHPHQW DXFXQHIIHW LPPpGLDWHPHQWORUVGHOD SDXVH
OLEpUDWLRQ &/26(LQKLEp

EN FERMETURE URXYUHOHSRUWDLO URXYUHOHSRUWDLO DXFXQHIIHW EORTXHOHIRQFWLRQQHPHQW DXFXQHIIHW LQYHUVHHQRXYHUWXUH YRLU EORFDJHHWRXYHUWXUHORUV


GHODOLEpUDWLRQ
SURJqPHQLYHDX  PpPRULVH&/26(

BLOQUE IHUPHOHSRUWDLO IHUPHOHSRUWDLO IHUPHOHSRUWDLO DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW


23(1&/26(LQKLEpV 23(1LQKLEp &/26(LQKLEp 23(1&/26(LQKLEpV

 3HQGDQWOHF\FOHG
RXYHUWXUHSDUWLHOOHXQHLPSXOVLRQG
23(1$SURYRTXHO
RXYHUWXUHWRWDOH
E721 18 532014 - Rev. D
/2*,48(©$3ª ,038/6,216
ETAT DE L'AUTOMATISME OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP
RXYUHOHSRUWDLOSDUWLHO H
V
RXYUHHWVHUHIHUPHDSUqV PHQWHWO DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW
FERME OHWHPSVGHSDXVH HIHUPHDSUqVOH DXFXQHIIHW 23(1LQKLEp 23(1LQKLEp DXFXQHIIHW 23(1LQKLEp
WHPSVGHSDXVH%

EORTXHOHIRQFWLRQQHPHQW EORTXHOHIRQFWLRQQHPHQW EORTXHHWRXYUHORUVGHOD


EN OUVERTURE  UHIHUPHOHSRUWDLO EORTXHOHIRQFWLRQQHPHQW YRLUSURJqPHQLYHDX DXFXQHIIHW OLEpUDWLRQ 23(1EORTXp
PpPRULVDWLRQ&/26(

EORTXHOHIRQFWLRQQHPHQW EORTXHOHIRQFWLRQQHPHQW UHFKDUJHOHWHPSVGH UHFKDUJHOHWHPSVGH


OUVERT EN PAUSE  UHIHUPHOHSRUWDLO EORTXHOHIRQFWLRQQHPHQW DXFXQHIIHW SDXVH SDXVH
&/26(LQKLEp &/26(LQKLEp

EN FERMETURE URXYUHOHSRUWDLO URXYUHOHSRUWDLO DXFXQHIIHW EORTXHOHIRQFWLRQQHPHQW DXFXQHIIHW LQYHUVHHQRXYHUWXUH YRLU EOOLERpUDWL


TXHHWRXYUHORUVGHOD
RQ 23(1EORTXp
SURJqPHQLYHDX  PpPRULVDWLRQ&/26(

BLOQUE IHUPHOHSRUWDLO IHUPHOHSRUWDLO IHUPHOHSRUWDLO DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW


23(1&/26(LQKLEpV 23(1LQKLEp &/26(LQKLEp 23(1&/26(LQKLEpV

LOGIQUE « A » (2) IMPULSIONS


ETAT DE L'AUTOMATISME OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP
RXYUHOHSRUWDLOSDUWLHO H
V
RXYUHHWVHUHIHUPHDSUqV PHQWHWO DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW
FERME OHWHPSVGHSDXVH HIHUPHDSUqVOH DXFXQHIIHW 23(1LQKLEp 23(1LQKLEp DXFXQHIIHW 23(1LQKLEp
WHPSVGHSDXVH%
EORFDJHHWRXYHUWXUHORUV
EN OUVERTURE DXFXQHIIHW  DXFXQHIIHW UHIHUPHOHSRUWDLO EORTXHOHIRQFWLRQQHPHQW LQYHUVHHQIHUPHWXUH DXFXQHIIHW GHODOLEpUDWLRQ
PpPRULVH&/26(
UHFKDUJHOHWHPSVGH UHFKDUJHOHWHPSVGH

FRANÇAIS
OUVERT EN PAUSE UHFKDUJHOHWHPSVGH UHFKDUJHOHWHPSVGH UHIHUPHOHSRUWDLO EORTXHOHIRQFWLRQQHPHQW DXFXQHIIHW SDXVH SDXVH
SDXVH  SDXVH &/26(LQKLEp &/26(LQKLEp

EN FERMETURE URXYUHOHSRUWDLO URXYUHOHSRUWDLO DXFXQHIIHW EORTXHOHIRQFWLRQQHPHQW DXFXQHIIHW LQYHUVHHQRXYHUWXUH YRLU EORFDJHHWRXYHUWXUHO


GHODOLEpUDWLRQ
RUV
SURJqPHQLYHDX  PpPRULVH&/26(

BLOQUE IHUPHOHSRUWDLO IHUPHOHSRUWDLO IHUPHOHSRUWDLO DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW


23(1&/26(LQKLEpV 23(1LQKLEp &/26(LQKLEp 23(1&/26(LQKLEpV

LOGIQUE « S » IMPULSIONS
ETAT DE L'AUTOMATISME OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP
RXYUHOHSRUWDLOSDUWLHO H
V
RXYUHHWVHUHIHUPHDSUqV PHQWHWO DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW
FERME OHWHPSVGHSDXVH HIHUPHDSUqVOH DXFXQHIIHW 23(1LQKLEp 23(1LQKLEp DXFXQHIIHW 23(1LQKLEp
WHPSVGHSDXVH%

FRQWLQXHjRXYULUHW EORTXHHWRXYUHORUVGHOD
EN OUVERTURE LQYHUVHHQIHUPHWXUH  LQYHUVHHQIHUPHWXUH UHIHUPHOHSRUWDLO EORTXHOHIRQFWLRQQHPHQW YRLUSURJqPHQLYHDX UHIHUPHDXVVLW{W OLEpUDWLRQ
PpPRULVDWLRQ&/26(
EORTXHHWUHIHUPH
OUVERT EN PAUSE UHIHUPHOHSRUWDLO  UHIHUPHOHSRUWDLO UHIHUPHOHSRUWDLO EORTXHOHIRQFWLRQQHPHQW DXFXQHIIHW LPPpGLDWHPHQWORUVGHOD EORFDJHHWIHUPHWXUHO
GHODOLEpUDWLRQ
RUV
OLEpUDWLRQ
LQYHUVHHQRXYHUWXUH YRLU EORTXHHWjODOLEpUDWLRQ
EN FERMETURE URXYUHOHSRUWDLO URXYUHOHSRUWDLO DXFXQHIIHW EORTXHOHIRQFWLRQQHPHQW DXFXQHIIHW SURJqPHQLY HWjODILQ RXYUHHWjODILQIHUPH
IHUPHLPPpGLDWHPHQW DXVVLW{W

BLOQUE IHUPHOHSRUWDLO IHUPHOHSRUWDLO IHUPHOHSRUWDLO DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW


23(1&/26(LQKLEpV 23(1LQKLEp &/26(LQKLEp 23(1&/26(LQKLEpV

LOGIQUE « SP » IMPULSIONS
ETAT DE L'AUTOMATISME OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP
RXYUHOHSRUWDLOSDUWLHO H
V
RXYUHHWVHUHIHUPHDSUqV PHQWHWO DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW
FERME OHWHPSVGHSDXVH HIHUPHDSUqVOH DXFXQHIIHW 23(1LQKLEp 23(1LQKLEp DXFXQHIIHW 23(1LQKLEp
WHPSVGHSDXVH%

EORTXHOHIRQFWLRQQHPHQW EORTXHOHIRQFWLRQQHPHQW FRQWLQXHjRXYULUHW EORTXHHWRXYUHORUVGHODOLEpUDWLRQ


EN OUVERTURE  UHIHUPHOHSRUWDLO EORTXHOHIRQFWLRQQHPHQW YRLUSURJqPHQLYHDX UHIHUPHDXVVLW{W
HWjODILQIHUPHDXVVLW{W 23(1
EORTXpPpPRULVDWLRQ&/26(

EORTXHHWUHIHUPH EORTXHHWUHIHUPH
OUVERT EN PAUSE UHIHUPHOHSRUWDLO  UHIHUPHOHSRUWDLO UHIHUPHOHSRUWDLO EORTXHOHIRQFWLRQQHPHQW DXFXQHIIHW LPPpGLDWHPHQWORUVGHOD LPPpGLDWHPHQWORUVGHOD
OLEpUDWLRQ OLEpUDWLRQ

EN FERMETURE EORTXHOHIRQFWLRQQHPHQW EORTXHOHIRQFWLRQQHPHQW DXFXQHIIHW EORTXHOHIRQFWLRQQHPHQW DXFXQHIIHW LQYHUVHHQRXYHUWXUH YRLU EORFDJHHWRXYHUWXUHO


GHODOLEpUDWLRQ
RUV
SURJqPHQLYHDX PpPRULVH&/26(
UHSUHQGOHPRXYHPHQW UHSUHQGOHPRXYHPHQW DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW
BLOQUE GDQVOHVHQVLQYHUVH$SUqV GDQVOHVHQVLQYHUVH$SUqV UHIHUPHOHSRUWDLO 23(1&/26(LQKLEpV 23(1LQKLEp &/26(LQKLEp 23(1&/26(LQKLEpV
6723IHUPHWRXMRXUV 6723IHUPHWRXMRXUV

 3HQGDQWOHF\FOHG
RXYHUWXUHSDUWLHOOHXQHLPSXOVLRQG
23(1$SURYRTXHO
RXYHUWXUHWRWDOH
E721 19 532014 - Rev. D
LOGIQUE « SA » IMPULSIONS
ETAT DE L'AUTOMATISME OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP
RXYUHOHSRUWDLOSDUWLHO H
V
RXYUHHWVHUHIHUPHDSUqV PHQWHWO DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW
FERME OHWHPSVGHSDXVH HIHUPHDSUqVOH DXFXQHIIHW 23(1LQKLEp 23(1LQKLEp DXFXQHIIHW 23(1LQKLEp
WHPSVGHSDXVH%
EORFDJHHWRXYHUWXUHORUV
EN OUVERTURE DXFXQHIIHW  DXFXQHIIHW UHIHUPHOHSRUWDLO EORTXHOHIRQFWLRQQHPHQW YRLUSURJqPHQLYHDX DXFXQHIIHW GHODOLEpUDWLRQ
PpPRULVH&/26(
UHFKDUJHOHWHPSVGH UHFKDUJHOHWHPSVGH
OUVERT EN PAUSE UHIHUPHOHSRUWDLO  UHIHUPHOHSRUWDLO UHIHUPHOHSRUWDLO EORTXHOHIRQFWLRQQHPHQW DXFXQHIIHW SDXVH SDXVH
&/26(LQKLEp &/26(LQKLEp

EN FERMETURE URXYUHOHSRUWDLO URXYUHOHSRUWDLO DXFXQHIIHW EORTXHOHIRQFWLRQQHPHQW DXFXQHIIHW LQYHUVHHQRXYHUWXUH YRLU EORFDJHHWRXYHUWXUHO


GHODOLEpUDWLRQ
RUV
SURJqPHQLYHDX  PpPRULVH&/26(

BLOQUE IHUPHOHSRUWDLO IHUPHOHSRUWDLO IHUPHOHSRUWDLO DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW


23(1&/26(LQKLEpV 23(1LQKLEp &/26(LQKLEp 23(1&/26(LQKLEpV

LOGIQUE « B » IMPULSIONS
ETAT DE L'AUTOMATISME OPEN A / CLOSE STOP FSW OP FSW CL FSW CL/OP

FERME RXYUHOHSRUWDLO / DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW


23(1LQKLEp 23(1LQKLEp 23(1LQKLEp

EORTXHHWRXYUHORUVGHOD
EN OUVERTURE DXFXQHIIHW / IHUPHOHSRUWDLO EORTXHOHIRQFWLRQQHPHQW YRLUSURJqPHQLYHDX DXFXQHIIHW OLEpUDWLRQ PpPRULVDWLRQ
23(1&/26(

DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW


FRANÇAIS

OUVERT DXFXQHIIHW / IHUPHOHSRUWDLO 23(1&/26(LQKLEpV DXFXQHIIHW &/26(LQKLEp 23(1&/26(LQKLEpV

EN FERMETURE RXYUHOHSRUWDLO / DXFXQHIIHW EORTXHOHIRQFWLRQQHPHQW DXFXQHIIHW LQYHUVHHQRXYHUWXUH YRLU EOOLERpUDWL


TXHHWRXYUHORUVGHOD
RQ PpPRULVDWLRQ
SURJqPHQLYHDX  23(1&/26(

BLOQUE RXYUHOHSRUWDLO / IHUPHOHSRUWDLO DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW


23(1&/26(LQKLEpV 23(1LQKLEp &/26(LQKLEp 23(1&/26(LQKLEpV

LOGIQUE « bC » IMPULSIONS EN OUVERTURE / COMMANDES MAINTENUES IMPULSIONS


EN FERMETURE
ETAT DE L'AUTOMATISME OPEN A / CLOSE STOP FSW OP FSW CL FSW CL/OP

FERME RXYUHOHSRUWDLO / DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW


23(1LQKLEp 23(1LQKLEp 23(1LQKLEp

EORTXHHWRXYUHORUVGHOD
EN OUVERTURE DXFXQHIIHW / IHUPHOHSRUWDLO EORTXHOHIRQFWLRQQHPHQW YRLUSURJqPHQLYHDX DXFXQHIIHW OLEpUDWLRQ PpPRULVDWLRQ
23(1&/26(

OUVERT DXFXQHIIHW / IHUPHOHSRUWDLO DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW


23(1&/26(LQKLEpV &/26(LQKLEp 23(1&/26(LQKLEpV

EN FERMETURE RXYUHOHSRUWDLO / DXFXQHIIHW EORTXHOHIRQFWLRQQHPHQW DXFXQHIIHW LQYHUVHHQRXYHUWXUH YRLU EOOLERpUDWL


TXHHWRXYUHORUVGHOD
RQ PpPRULVDWLRQ
SURJqPHQLYHDX  23(1&/26(

BLOQUE RXYUHOHSRUWDLO / IHUPHOHSRUWDLO DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW


23(1&/26(LQKLEpV 23(1LQKLEp &/26(LQKLEp 23(1&/26(LQKLEpV

LOGIQUE « C » COMMANDES MAINTENUES IMPULSIONS


ETAT DE L'AUTOMATISME OPEN A / CLOSE STOP FSW OP FSW CL FSW CL/OP

FERME RXYUHOHSRUWDLO / DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW


23(1LQKLEp 23(1LQKLEp 23(1LQKLEp

EN OUVERTURE DXFXQHIIHW / IHUPHOHSRUWDLO EORTXHOHIRQFWLRQQHPHQW YRLUSURJqPHQLYHDX DXFXQHIIHW EORTXHHWjODOLEpUDWLRQ


YRLUSURJqPHQLYHDX

OUVERT DXFXQHIIHW / IHUPHOHSRUWDLO DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW


23(1&/26(LQKLEpV &/26(LQKLEp 23(1&/26(LQKLEpV

EN FERMETURE RXYUHOHSRUWDLO / DXFXQHIIHW EORTXHOHIRQFWLRQQHPHQW DXFXQHIIHW EORTXHOHIRQFWLRQQHPHQW EORTXHOHIRQFWLRQQHPHQW

BLOQUE RXYUHOHSRUWDLO / IHUPHOHSRUWDLO DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW DXFXQHIIHW


23(1&/26(LQKLEpV 23(1LQKLEp &/26(LQKLEp 23(1&/26(LQKLEpV

 3HQGDQWOHF\FOHG
RXYHUWXUHSDUWLHOOHXQHLPSXOVLRQG
23(1$SURYRTXHO
RXYHUWXUHWRWDOH
 $O
DOOXPDJHODFDUWHYpULILHOHVHQWUpHVHWVLXQHFRPPDQGH23(1$RX%HVWDFWLYHHOOHRXYUHOHEDWWDQWRXOHSRUWDLODXWUHPHQWHOOHOHIHUPH
E721 20 532014 - Rev. D
INHALTSVERZEICHNIS
1 HINWEISE ........................................................................................................................................................ 2
2 ANORDNUNG UND KOMPONENTEN ................................................................................................................ 2
2.1 BESCHREIBUNG DER KOMPONENTEN ........................................................................................................................ 3
2.2 BESCHREIBUNG KLEMMENBRETT J13 ......................................................................................................................... 3
3 TECHNISCHE EIGENSCHAFTEN ........................................................................................................................ 3
4 ELEKTRISCHE ANSCHLÜSSE ............................................................................................................................. 4
4.1 FOTOZELLEN BUS-2EASY ............................................................................................................................................. 5
4.1.1 ANSTEUERUNG DER BUS-2EASY-FOTOZELLEN ................................................................................................................5
4.1.2 SPEICHERUNG BUS-2EASY-ZUBEHÖRGERÄTE .................................................................................................................5
4.2 HERKÖMMLICHE FOTOZELLEN ................................................................................................................................... 6
4.3 ANSCHLÜSSE SAFE-EINGANG ...................................................................................................................... 7
5 PROGRAMMIERUNG ...................................................................................................................................... 8
5.1. PROGRAMMIERUNG 1. STUFE .................................................................................................................................. 8
5.2 PROGRAMMIERUNG 2. STUFE ................................................................................................................................. 10
6 SPEICHERUNG DES FUNKCODES .................................................................................................................. 12
6.1 SPEICHERUNG DER DS-FUNKSTEUERUNGEN............................................................................................................. 12
6.2 SPEICHERUNG DER SLH-FUNKSTEUERUNGEN .......................................................................................................... 13
6.3 SPEICHERUNG DER LC/RC-FUNKSTEUERUNGEN (NUR AUF EINIGEN MÄRKTEN) ....................................................... 13
6.3.1 FERNSPEICHERUNG DER LC/RC-FUNKSTEUERUNGEN ..................................................................................................13
6.4 LÖSCHEN DER FUNKSTEUERUNGEN ........................................................................................................................ 13
7 INBETRIEBNAHME ......................................................................................................................................... 14
7.1 ÜBERPRÜFUNG DER LEDS .......................................................................................................................................... 14
7.2 BATTERIEBETRIEB ...................................................................................................................................... 14
7.3 POSITIONIERUNG DER ENDSCHALTER ..................................................................................................................... 15
7.4 MASTER-SLAVE-KONFIGURATION ............................................................................................................................. 16
7.4.1 MASTER-SLAVE-VERDRAHTUNG ................................................................................................................................... 16
7.4.2 SETUP-VERFAHREN MASTER/SLAVE .............................................................................................................................. 16
7.5 SETUP ....................................................................................................................................................................... 17
8 TEST DER AUTOMATION ........................................................................................................................... 17
9 ANZEIGE ALARM- UND FEHLERMELDUNGEN ................................................................................................. 17

DEUTSCH
9.1 ALARME ................................................................................................................................................................... 17
9.2 FEHLERMELDUNGEN ............................................................................................................................................... 17
10 BETRIEBSLOGIKEN ...................................................................................................................................... 18

CE-KONFORMITÄTSERKLÄRUNG
Der Hersteller: FAAC S.p.A.
Anschrift: Via Calari, 10 - 40069 Zola Predosa BOLOGNA - ITALIEN
erklärt, dass: das elektronische Gerät E721
‡ den wesentlichen Sicherheitsanforderungen der folgenden weiteren E:G-5ichtlinien
entspricht

2006/95/EG Niederspannungsrichtlinie
2004/10/EG 5ichtlinie zur elektromagnetischen Verträglichkeit
Anmerkung:
Dieses Produkt wurde in einer typisch homogenen Konfiguration getestet
(sämtliche Bauprodukte der Firma FAAC S.p.A.).

Bologna, den 01-12-2011


Der Geschäftsführer
A. Marcellan

HINWEISE
‡ Achtung! Um die Personensicherheit zu gewährleisten, sollte die Anleitung aufmerksam befolgt werden.
‡ Eine falsche Montage oder ein falscher Einsatz des Produktes können zu schwerwiegenden Verletzungen führen.
‡ Die Anleitung aufmerksam lesen, bevor mit der Montage des Produktes begonnen wird. Die Anleitung griffbereit
aufbewahren, um auch in Zukunft Bezug auf sie nehmen zu können.
‡ Mit diesem Symbol werden wichtige Hinweise in Bezug auf die Personensicherheit und die Unversehrtheit der
Automation gekennzeichnet.
‡ Mit diesem Symbol soll auf die Hinweise in Bezug auf die Eigenschaften bzw. den Betrieb des Produktes
aufmerksam gemacht werden.

E721 1 532014 - Rev. D


E721
1 HINWEISE
Vor dem Ausführen jeglicher Art von Eingriffen am elektronischen Gerät (Anschlüsse, Instandhaltung)
muss immer die Stromzufuhr abgeschaltet werden.

Vor der Anlage sollte ein Differential-Wärmeschutzschalter mit entsprechender Auslöseschwelle


vorgesehen werden.

Das Erdungskabel an die entsprechende Klemme


anschließen.

Die Versorgungskabel immer von den Kabeln für die Steuerung


und die Sicherheitsvorrichtungen (Taste, Empfänger, Fotozellen
usw.) getrennt verlegen. Um jegliche elektrischen Störungen
auszuschließen, sollten separate Ummantelungen oder
abgeschirmte Kabel (mit an der Masse angeschlossener
Abschirmung) verwendet werden.

2 ANORDNUNG UND KOMPONENTEN

/ SAFE
/ SAFE

SENSOR
DEUTSCH

ENDSCHALTER

Fig.
Abb.11

E721 2 532014 - Rev. D


2.1 BESCHREIBUNG DER KOMPONENTEN 3 TECHNISCHE EIGENSCHAFTEN
LCD ANZEIGE- UND P5OG5AMMIE5UNGSDISPLA< Versorgung 20V Ausführung: 20V a 50Hz
115V Ausführung: 115V a 60Hz
S:1 P5OG5AMMIE5TASTE ÅF“
Leistungsaufnahme 10 :
S:2 P5OG5AMMIE5TASTE Å-“ des Netzes stand-by
S: P5OG5AMMIE5TASTE Å+“ Max. 10A
Motorlast
S:4 ÅSETUP“-TASTE Versorgung 24V=
LEDs LED Fh5 DIE KONT5OLLE DES STATUS DE5 EINGbNGE Zubehörgeräte
Max. Stromverbrauch 24 V= max. 500 mA
J1 STECKE5 DE5 P5IMb5EN ST5OMVE5SO5GUNG
Zubehörgeräte BUS-2EAS< max. 500 mA
J2 P5IMb5STECKE5 DES T5ANSFO5MATO5S Temperatur (-20 - +55) °C
J SEKUNDb5STECKE5 DES T5ANSFO5MATO5S am Aufstellungsort
Blinkleuchtenlast 24 V= - 15 :
J4 STECKE5 DE5 NOTBATTE5IEN (ZUBEHg5TEIL)
Last Ausgang 24 V= - 100 mA (2)
J5 MOTO5STECKE5 Sicherungen F1 =T1A - 250Va
J6 AUSGANGSSTECKE5 DE5 BLINKLEUCHTE (24 V= - 15W) Betriebslogiken Halbautomatik, HalbautomatiK
STECKE5 DE5 MOTO5VE55IEGELUNG UND KON- ÅSchrittbetrieb“, Automatikbetrieb,
J9 Automatikbetrieb ÅSchrittbetrieb“,
TAKT MOTO5ENT5IEGELUNG
Automatikbetrieb mit Timerfunktion,
J10 AUSGANGSSTECKE5 OUT Automatikbetrieb Sicherheitsvorrich-
J11 USB-STECKE5 Fh5 DEN ANSCHLUSS AN DEN PC tungen, Automatikbetrieb Sicher-
heitsvorrichtungen ÅSchrittbetrieb“,
STECKE5 Fh5 DEN ANSCHLUSS DE5 BUS-2EAS<- Automatikbetrieb mit Umkehr in
J12
VO55ICHTUNGEN Pause, Halbautomatik Åb“, Gemischte
J1 EINGANGSSTECKE5 AM KLEMMENB5ETT Logik ÅbC“, Totmann.
Betriebszeit 5egulierbar (zwischen 0 und 10 min)
J14 MODULSTECKE5 DES FUNKEMPFbNGE5S Fh5 OMNIDEC
Pausenzeit 5egulierbar (zwischen 0 und 10 min)
LCD1 ANZEIGE- UND P5OG5AMMIE5DISPLA< OPEN A / OPEN B
F1 SCHMELZSICHE5UNG Motorkraft Auf 50 Stufen regulierbar
2.2 BESCHREIBUNG KLEMMENBRETT J13 Motorgeschwindig- Auf 10 Stufen regulierbar
keit Öffnen-Schließen
Nr. EINGANG BESCHREIBUNG
Ein-/Ausgänge auf Stromzufuhr, Batterie, Motor, Modul
1 OPEN A Vorrichtung mit RUHEKONTAKT, Stecker ;F4/6, Batterien für die elektrische
die für das

DEUTSCH
Ver- und Entriegelung des Motors,
vollständige gffnen des Tors sorgt Motorverriegelung, USB
2-6 GND Negativ Versorgung Ein-/Ausgänge auf BUS-2EAS<, OPEN A, OPEN B/CLOSE/
Zubehörgeräte dem Klemmenbrett SAFE, STOP/SAFE, GND, Fotozellen zum
3(1) OPEN B Vorrichtung mit Schliesserkontakt, gffnen und Schließen, +24 V, Strom-
(DEFAULT) die die teilweise gffnung des Tors versorgung, Blinkleuchte, elektrische
bewirkt Entriegelung Motorverriegelung, OUT

CLOSE Vorrichtung mit Schließerkontakt,


die das Schließen des Tors
bewirkt. (1) Die Verwendungsarten der Eingänge 3
SAFE Vorrichtung mit Öffnerkontakt, und 4 können anhand der Konfiguration
die die sofortige und der entsprechenden Parameter auf
vollständige Umkehrung der der 2. Programmierstufe festgelegt
Bewegungsrichtung des Tors
bewirkt. werden (Parameter O b und S P ).
Für die genaue Beschreibung der
4(1) STOP Vorrichtung mit ARBEITSKONTAKT, Betriebsweise der Automation im Hinblick
(DEFAULT) die das Tor stoppt auf die ausgewählten Steuerungslogiken
SAFE Vorrichtung mit Öffnerkontakt, wird auf die Tabellen am Ende dieser
die die sofortige und Betriebsanleitung verwiesen (Abschn.
vollständige Umkehrung der
Bewegungsrichtung des Tors 10 – STEUERUNGSLOGIKEN). Für die bei
bewirkt. Verwendung dieser als SAFE eingerichteten
Eingänge vorzunehmenden Verdrahtungen
5 FS: OP Vorrichtung mit ARBEITSKONTAKT,
wird auf die in Abb. 13 und 14 dargestellten
durch welche die Bewegung Diagramme verwiesen
während des gffnen des Tors
umgekehrt wird (1) Die elektrische Ausgangsbelastung muss
7 FS: CL Vorrichtung mit ARBEITSKONTAKT, bereits im max. für die Zubehörgeräte ver-
durch welche die Bewegung fügbaren strom berücksichtigt werden
während des Schließens des Tors
umgekehrt wird
8 +24 V Positiv Versorgung Zubehörgeräte
E721 3 532014 - Rev. D
4 ELEKTRISCHE ANSCHLÜSSE
Die in Abb. 2 angegebenen Verdrahtungen beziehen sich auf die Eingänge der Steuerkarte mit DEFAULT-Konfiguration.

/ SAFE
/ SAFE

Für den Anschluss der


Fotozellen und der
Sicherheitsvorrichtungen
wird auf den Abschnitt
4.2 verwiesen

230 V ~
115 V ~
=

KONTAKT
MOTORENTRIEGELUNG
(Blockiert den Motor,
wenn der Griff für die
Entriegelung des Motors
= betätigt wird)
Abb.
Fig. 2
DEUTSCH

E721
E721 E721
E721

C720
C 72 C721
C 721
Abb.
Fig. 

A: Fotozellen für den SCHLIESS-Vorgang


B: Fotozellen für den gFFNUNGS-Vorgang
C: Fotozellen für den gFFNUNGS- und SCHLIESS-Vorgang

Abb.
Fig. 44

E721 4 532014 - Rev. D


Vor dem Anschluss der Fotozellen muss die Betriebsart je Tab. 1 - Ansteuerung der BUS-2EASY-Fotozellen
nach dem zu schützenden Bewegungsbereich ausgewählt
werden: Dip1 Dip2 Dip Dip4 Bez. Typologie
Sicherheitsvorrichtungen beim Schließvorgang: Sie OFF OFF OFF OFF
werden nur während der Schließbewegung der
Automation aktiviert und eignen sich somit dazu, das OFF OFF OFF ON
Tor im Schließbereich vor dem Anstoßen zu schützen. OFF OFF ON OFF
B gFFNUNG
Sicherheitsvorrichtungen beim Öffnungsvorgang: Max. 6 Paare
OFF OFF ON ON
Sie werden nur während der gffnungsbewegung der
Automation aktiviertund eignen sich somit dazu, das OFF ON ON OFF
Tor im gffnungsbereich vor dem Anstoßen zu schützen. OFF ON ON ON
Sicherheitsvorrichtungen beim Öffnungs-/
Schließvorgang: Sie werden sowohl während der ON OFF OFF OFF
gffnungs- als auch bei der Schließbewegung der ON OFF OFF ON
Automation aktiviertund eignen sich somit dazu, das
ON OFF ON OFF
Tor im gesamten gffnungs-/Schließbereich vor dem
Anstoßen zu schützen. ON OFF ON ON A SCHLIESSUNG
Max. 7 Paare
4.1 FOTOZELLEN BUS-2EASY ON ON OFF OFF
Diese Karte ist mit einem BUS-2EAS<-Kreis ausgestattet, ON ON OFF ON
an welchen problemlos eine hohe Anzahl an BUS-
2EAS<-Vorrichtungen für die Sicherheit (z.B. bis zu 16 ON ON ON OFF
Fotozellenpaare) angeschlossen werden kann, die mithilfe
von lediglich zwei Kabeln ohne Polarität entsprechend OFF ON OFF OFF gFFNUNG und
C SCHLIESSUNG
programmiert werden. OFF ON OFF ON Max. 2 Paare
Vor dem Anschluss der Fotozellen muss die Betriebsart
(Abb. 4) je nach dem zu schützenden Bewegungsbereich ON ON ON ON / IMPULS OPEN
ausgewählt werden. Darüber hinaus müssen sowohl auf
dem Geber als auch auf dem Empfänger die Dip-Schalter 4.1.2 SPEICHERUNG BUS-2EASY-ZUBEHÖRGERÄTE
(siehe Abb. 5) gemäß Tab. 1 positioniert werden. Jederzeit können der Anlage BUS-2EAS<-Fotozellen
und –Zubehörteile hinzugefügt werden, und zwar einfach
Fig. 5 DL1 = Ausrich- anhand des nachfolgenden Verfahrens:
Abb. 5
tung 1. Die Zubehörgeräte montieren und mit der gewünschten
DL2 = Status Adresse programmieren (siehe Abschnitt 4.1.1).
BUS-2EAS</Ver- 2. Die Karte von der Stromversorgung trennen.
RX TX sorgung . Die beiden Kabel der BUS-2EAS<-Zubehörgeräte an der
roten Klemmenleiste J12 anschließen (Polanschluss
DL2 D S 1 = D i p - spielt keine 5olle).

DEUTSCH
DL1
ON
DS1
ON
DS1 Schalter für die 4. Die Karte an die Versorgung anschließen.
Programmie- 5. Einmal kurz die SETUP-Taste drücken (S:4), um die
1 2 3 4 1 2 3 4

DL2
BUS BUS BUS BUS rung Einschreibung der Zubehörgeräte durchzuführen.
hberprüfen, ob die montierten BUS-2EAS<-Vorrichtungen
RX - TX ordnungsgemäß funktionieren.
6. Die BUS-2EAS<-Zubehörteile wurden von der Karte
gespeichert.
Die Angaben der folgenden Tabelle befolgen, um zu
4.1.1 ANSTEUERUNG DER BUS-2EASY-FOTOZELLEN überprüfen, ob die BUS-2EAS<-Anschluss ordnungsgemäß
Es ist wichtig, dass sowohl dem Geber als funktioniert.
auch dem Empfänger dieselbe Adresse Dieselben Anweisungen sind an einem
gegeben wird. MASTER-Steuergerät zu befolgen, auch um
Sicherstellen, dass nicht zwei bzw. mehrere ein an den BUS-2EASY mit POLARISIERTEM
Fotozellenpaare dieselbe Adresse haben. Kabel angeschlossenes SLAVE-Steuergerät
Wenn kein BUS-2EASY-Zubehör verwendet zu erfassen.
wird, bleibt der BUS-2EASY-Stecker (J12 - Tab. 2 - Beschreibung BUS-2EASY-LED
Abb. 1) unbelegt
Normale Aktivität (LED eingeschaltet, auch
Dauerhaft
wenn keine Fotozellen vorhanden sind). Keine
eingeschaltet
angesteuerte Fotozelle belegt.
Blinkt Mindestens eine angesteuerte Fotozelle belegt
langsam bzw. nicht ausgerichtet.
Ausgeschaltet
(blinkt alle Kurzschluss BUS-2EAS<-Leitung.
2,5 sec)
- BUS-2EAS<-Leitung deaktiviert (keine
Versorgung)
Ausgeschaltet
- Batteriebetrieb
- Steuergerät als SLAVE programmiert

E721 5 532014 - Rev. D


4.2 HERKÖMMLICHE FOTOZELLEN Anschluss eines Fotozellenpaars beim Schließvorgang
und eines Paars beim gffnungsvorgang
Anschluss eines Fotozellenpaars während des Schließvorgangs
die Sicherheitsvorrichtung FAIL-SAFE ist aktiviert
Auf die zweite Programmierstufe
o1 = 01 einstellen

OUT

Andere Sicher-
heitsvorrichtungen
OUT
OUT

Anschluss eines Fotozellenpaars während des Schließvorgangs Abb. 8


die Sicherheitsvorrichtungen FAIL-SAFE und STOP
sind deaktiviert
Anschluss von zwei Fotozellenpaaren beim Schließvorgang

Andere Sicher-
heitsvorrichtungen

Abb. 6
DEUTSCH

Falls die Sicherheitsvorrichtung FAIL-SAFE nicht benutzt


wird, muss die Versorgung der Übertragungsgeräte an
die Klemmen 6 und 8 von J13 angeschlossen werden.
Wenn die Sicherheitsvorrichtung FAIL-SAFE verwendet
wird, muss sie entsprechend eingestellt (siehe
Programmierung der 2. Stufe und Abb. 6) und dann Abb. 9
die Stromversorgung der Übertragungsgeräte mit dem
Ausgang OUT verbunden werden.
Anschluss eines Fotozellenpaars beim Schließvorgang
Wenn die Sicherheitsvorrichtung FAIL-SAFE verwendet wird,
müssen auch die nicht benutzten Sicherheitseingänge mit und eines Paars beim gffnungs-/Schließvorgang
dem Negativ von OUT (siehe Abb. 6) überbrückt werden.

Anschluss eines Fotozellenpaars beim gffnungsvorgang

Andere Sicher-
heitsvorrichtungen

Abb. 7 Abb. 10
E721 6 532014 - Rev. D
Anschluss eines Fotozellenpaars beim Schließvorgang, eines Paars beim Keine Sicherheits- bzw. Stoppvorrichtung angeschlossen
gffnungsvorgang sowie eines Paars beim gffnungs-/Schließvorgang

Abb. 12

Abb. 11

4.3 ANSCHLÜSSE SAFE-EINGANG


Wenn die FailSafe-Sicherheitsfunktion aktiviert wird (Parameter kann in der 2. Programmierstufe festgelegt
werden) muss -OUT als Minuspol für die Verwaltung des SAFE-Eingangs verwendet werden (siehe
Abb. 13).
Anschluss einer Sicherheitseinrichtung (anderer Sicherheitseinrichtungen) an den SAFE-Eingang bei aktivierter
FAILSAFE-Funktion
Einstellung: 2. Stufe o 1=01 (FAIL SAFE AKTIVIE5T)
Einstellung: 2. Stufe o 1=01 (FAIL SAFE AKTIVIE5T)
2. Stufe Ob=02 (EINGANG  = SICHE5HEITSLEISTE)
2. Stufe SP=01 (EINGANG 4 =SICHE5HEITSLEISTE)

DEUTSCH
Andere
Andere Sicherheitseinrichtungen
Sicherheitseinrichtungen OPEN A
OPEN A
GND GND
OPEN B / CLOSE - OUT SAFE / OPEN B / CLOSE
- OUT SAFE / STOP STOP
FSW OP FSW OP
GND GND
FSW CL FSW CL
+24V +24V Abb. 1

Wenn die FailSafe-Sicherheitsfunktion deaktiviert wird (Parameter kann in der 2. Programmierstufe festgelegt
werden) muss -  als Minuspol für die Verwaltung des SAFE-Eingangs verwendet werden (siehe Abb. 14).

Anschluss einer Sicherheitseinrichtung (anderer Sicherheitseinrichtungen) an den SAFE-Eingang bei deaktivierter


FAILSAFE-Funktion
Einstellung: 2. Stufe o 1=00 (FAIL SAFE DEAKTIVIE5T) Einstellung: 2. Stufe o 1=00 (FAIL SAFE DEAKTIVIE5T)
2. Stufe SP=01 (EINGANG 4 = SICHE5HEITSLEISTE) 2. Stufe Ob=02 (EINGANG  =SICHE5HEITSLEISTE)
Andere
Andere Sicherheitseinrichtungen
OPEN A
Sicherheitseinrichtungen OPEN A
GND
OPEN B / CLOSE GND
SAFE / STOP - SAFE / OPEN B / CLOSE
- FSW OP STOP
GND FSW OP
FSW CL GND
+24V FSW CL
+24V Abb. 14
Wenn Vorrichtungen mit Öffnerkontakt (andere Sicherheitseinrichtungen) eingesetzt werden, muss der
SAFE-Eingang bei aktivierter FAILSAFE-Funktion an -OUT und bei deaktivierter FAILSAFE-Funktion an GND
überbrückt werden.
E721 7 532014 - Rev. D
5 PROGRAMMIERUNG Die Änderung der Programmierparameter
Zum Programmieren des Betriebs der Automation muss der Modus ist sofort wirksam, während die endgültige
Speicherung erst dann erfolgt, wenn
ÅP5OG5AMMIE5UNG“ aufgerufen werden. die Programmierung beendet und der
Die Programmierung ist in zwei Phasen unterteilt: 1. PHASE, 2. PHASE. Anzeigemodus des Zustands der Eingänge
erneut aufgerufen wird. Wenn die Stromzufuhr
Normalerweise wird auf dem Display der zum Gerät unterbrochen wird, bevor der
Status der Automation angezeigt. Durch Druck Anzeigemodus des Zustands der Eingänge
der Taste F bzw. durch den gleichzeitigen erneut aufgerufen wird, gehen alle
Druck der Taste F und der Taste + gelangt vorgenommenen Änderungen verloren.
man zur Programmierung der 1. bzw. zur Von allen Schritten der Programmierung der 1.
2. Stufe. Während des Batteriebetriebs ist und 2. Stufe kann zur Anzeige des Status der
das Display ausgeschaltet. Zur Anzeige des Eingänge zurückgekehrt und sämtliche bis zu
Zustands der Automation kurz die Taste + diesem Zeitpunkt abgeänderten Parameter
drücken. können gespeichert werden. Hierzu müssen
Um die Standardeinstellungen wieder gleichzeitig die Tasten F und - gedrückt
werden.
herzustellen, genügt es, die gewünschte
Einstellung beim ersten Schritt der Beim Einschalten der Karte erscheint auf
Programmierung der 1. Stufe zu laden. dem Display LCD1 einige Sekunden lang
die zweistellige, durch einen Dezimalpunkt
5.1. PROGRAMMIERUNG 1. STUFE getrennte Software-Version der Karte.
Um zur Programmierung der 1. Stufe zu gelangen, muss die Taste F gedrückt werden.
‡ Bei (anhaltendem) Drücken der Taste F erscheint die Bezeichnung der Funktion am Display.
‡ Nachdem die Taste wieder losgelassen wird, zeigt das Display den :ert der Funktion an, der mit den Tasten + und -
verändert werden kann.
‡ Durch erneuten Druck der Taste F (die dann gedrückt gehalten wird), wird auf dem Display die Bezeichnung der nächsten
Funktion angezeigt usw.
‡ :enn die letzte Funktion erreicht ist und die Taste F gedrückt wird, wird die Programmierung beendet und die Parameter
werden gespeichert. Auf dem Display wird erneut der Status der Automation angezeigt.
PROGRAMMIERUNG 1. STUFE

Display Funktion Default 1


DEFAULT:
dF 1 Die Parameter mit den DEFAULT-:erten konfigurieren.
1
CU :enn beim Loslassen der Taste F der :ert CU erscheint, bedeutet dies, dass die
modifizierte Standardkonfiguration über die Tasten und das Display ausgewählt wurde.
:enn diese Programmierung beibehalten werden soll, erneut die Taste F bzw. +
DEUTSCH

drücken und den Default-:ert 1 auswählen.


MASTER-SLAVE-KONFIGURATION:
Ct MA Die Steuerkarte wird im MASTER-Modus konfiguriert
MA
SL Die Steuerkarte wird im SLAVE-Modus konfiguriert
Wird die Steuerkarte im SLAVE-Modus konfiguriert, werden die Parameter LO-PA-
Pb-Ph-Op nicht angezeigt (für den Master-Slave-Betrieb siehe Abschn. 7.4).
BETRIEBSLOGIKEN:
LO E Halbautomatik. E
EP HalbautomatiK ÅSchrittbetrieb“.
A Automatik.
A1 Automatik1.
AP AutomatiK ÅSchrittbetrieb“.
At Automatik mit Funktion ÅTimer“.
S Automatik ÅSicherheitsvorrichtungen“.
SP AutomatiK ÅSicherheitsvorrichtungen Schrittbetrieb“.
SA Automatik mit Umkehr in Pause
b Halbautomatik Åb“.
bC Gemischt (AP durch Impuls/CH durch Totmann)
C Totmann.
Im SLAVE-Modus nicht angezeigter Parameter
PAUSENZEIT A:
PA Beim gffnungsimpuls TOTAL wird die Pausenzeit lediglich dann eingehalten, wenn die
20
Betriebslogik Automatik eingestellt wurde. Einstellbar von 0 bis 59 sec in Schritten von 1 Sekunde.
Nachfolgend schaltet die Anzeige auf Minuten und Zehntelsekunden um (die durch einen
Punkt getrennt sind) und die Zeit wird mit Schritten von jeweils 10 Sekunden bis zum maximalen
:ert von 9,5 Minuten eingestellt.
Z.B.: :enn das Display 2.5 anzeigt, beträgt die Pausenzeit 2 min und 50 sec.
Im SLAVE-Modus nicht angezeigter Parameter
E721 8 532014 - Rev. D
Display Funktion Default 1
PAUSENZEIT B:
Pb Beim gffnungsimpuls TEILWEISE wird die Pausenzeit lediglich dann eingehalten, wenn die 20
Betriebslogik Automatik eingestellt wurde. Einstellbar von 0 bis 59 sec in Schritten von 1 Sekunde.
Nachfolgend schaltet die Anzeige auf Minuten und Zehntelsekunden um (die durch einen
Punkt getrennt sind) und die Zeit wird mit Schritten von jeweils 10 Sekunden bis zum maximalen
:ert von 9.5 Minuten eingestellt.
Z.B.: :enn das Display 2.5 anzeigt, beträgt die Pausenzeit 2 min und 50 sec.
Im SLAVE-Modus nicht angezeigter Parameter
MOTORKRAFT:
FO 5eguliert das Niveau der Motorkraft. 50
01 = Mindestkraft
50 = Höchstkraft
Wenn der Kraftwert verändert wurde, wird empfohlen, ein SETUP
durchzuführen (siehe Abschnitt 7.3)
ÖFFNUNGSGESCHWINDIGKEIT:
So 5eguliert die gffnungsgeschwindigkeit des Motors auf 10 Stufen. 08
01 = Mindestgeschwindigkeit
10 = Höchstgeschwindigkeit
Wenn der Geschwindigkeitswert verändert wurde, wird empfohlen, ein
SETUP durchzuführen (siehe Abschnitt 7.3)
SCHLIESSGESCHWINDIGKEIT:
Sc 5eguliert die Schließgeschwindigkeit des Motors auf 10 Stufen. 08
01 = Mindestgeschwindigkeit
10 = Höchstgeschwindigkeit
Wenn der Geschwindigkeitswert verändert wurde, wird empfohlen, ein
SETUP durchzuführen (siehe Abschnitt 7.3)
ABBREMSUNG BEIM ÖFFNEN:
ro 5eguliert den Abbremsweg des vollständigen Torlaufs (in Prozent). Einstellbar auf 5 20
(Geschwindigkeit < 5), 10 (Geschwindigkeit zwischen 5 und 8), 15 (Geschwindigkeit > 8)

DEUTSCH
bei 99 % in 1%-Schritten.

5-10-15 = minimale Abbremsung


99 = maximale Abbremsung
ABBREMSUNG BEIM SCHLIESSEN:
rc 5eguliert den Abbremsweg des vollständigen Torlaufs (in Prozent). Einstellbar auf 5 20
(Geschwindigkeit < 5), 10 (Geschwindigkeit zwischen 5 und 8), 15 (Geschwindigkeit > 8)
bei 99 % in 1%-Schritten

5-10-15 = minimale Abbremsung


99 = maximale Abbremsung
GESCHWINDIGKEIT BEIM ABBREMSEN:
Sr 5egelt die Geschwindigkeit während des Abbremsvorgangs. 0
0 = NIED5IGE Geschwindigkeit
1 = HOHE Geschwindigkeit
STATUS DER AUTOMATION:
St Verlassen der Programmierung, Speichern der Daten und 5ückkehr zur Anzeige des Status der Automation.

00 = GESCHLOSSEN 07 = FAIL SAFE im Gange


01 = GEgFFNET 08 = hberprüfung BUS-2EAS<-Vorrichtungen
02 = Stillstand, dann ÅgFFNEN“ im Gange
03 = Stillstand, dann ÅSCHLIESSEN“ 09 = Vorblinken, dann ÅgFFNEN“
04 = In ÅPAUSE“ 10 = Vorblinken, dann ÅSCHLIESSEN“
05 = In gffnungsphase 11 = GEgFFNET bei Teilöffnung
06 = In Schließphase 12 = In PAUSE bei Teilöffnung

E721 9 532014 - Rev. D


5.2 PROGRAMMIERUNG 2. STUFE
Um zur 2. P5OG5AMMIE5STUFE zu gelangen, muss die Taste F gedrückt gehalten und zusätzlich die Taste + gedrückt werden:
‡ :enn auch die Taste F losgelassen wird, zeigt das Display den :ert der Funktion an, der mit den Tasten + und - verändert
werden kann.
‡ Durch Duck der Taste F (die dann gedrückt gehalten wird) wird auf dem Display die Bezeichnung der nächsten Funktion
und beim Loslassen der Taste der :ert angezeigt, der mit den Tasten + und - verändert werden kann.
‡ :enn die letzte Funktion erreicht ist und die Taste F gedrückt wird, wird die Programmierung abgeschlossen und das
Display zeigt wieder den Status der Automation an.

PROGRAMMIERUNG 2. STUFE

Display Funktion Default 1


MAXIMALE ANLAUFKRAFT:
bo :ährend des Bewegungsanlaufs arbeitet der Motor bei Höchstkraft (wobei das ausgewählte
no
Kraftniveau ignoriert wird).
Y = aktiv
no = deaktiviert
VORBLINKEN:
PF Ermöglicht es, 5 Vorblinkarten mit einer Dauer von  sec auszuwählen.
no
no = kein Vorblinken
OC = Vorblinken vor jeder Bewegung
CL = Vorblinken vor einer Schließbewegung
OP = Vorblinken vor einer gffnungsbewegung
PA = Vorblinken erst am Ende der Pause
VORBLINKZEIT (nur sichtbar, wenn im vorangegangenen Menü eine Vorblinkart ausgewählt
tP wurde): 03
5eguliert die Vorblinkzeit von 1 bis 10 sec in Schritten von 1 Sekunde.
01 = Min. Vorblinken
10 = Max. Vorblinken
FOTOZELLEN WÄHREND DER SCHLIESSUNG:
Ph Die Funktion aktivieren, wenn die Fotozellen für den Schließvorgang die Bewegung blockieren
no
und die Bewegung beim Freiwerden umkehren sollen. :enn diese Funktion deaktiviert ist, wird
die Bewegung des Tors normalerweise durch das Auslösen der Fotozellen im Schließvorgang
DEUTSCH

sofort umgekehrt.
Y = Umkehr beim Freiwerden
n o = Unverzügliche Umkehr während des gffnungsvorgangs.
Im SLAVE-Modus nicht angezeigter Parameter
PHOTOZELLEN WÄHREND DER ÖFFNUNG:
oP Die Funktion aktivieren, wenn die Fotozellen für den gffnungsvorgang die Bewegung
no
blockieren und die Bewegung beim Schließvorgang umkehren sollen. :enn diese Funktion
deaktiviert ist und die Fotozellen im gffnungsvorgang ausgelöst werden, läuft bei ihrem
Freiwerden normalerweise der Motor an.
Y = Unverzügliche Umkehr während des Schließvorgangs
n o = Anlauf der Bewegung beim Freiwerden.
Im SLAVE-Modus nicht angezeigter Parameter
FUNKTION ADMAP:
Ad Ermöglicht es, den Betrieb gemäß der französischen 5ichtlinie NFP 25/62 zu aktivieren.
no
Y = aktiv
n o = deaktiviert
ENCODER:
EC Der sich auf der Karte befindliche Åvirtuelle“ Geber (Encoder) dient als Sicherheitsvorrichtung für den 02
Quetschschutz und verwaltet die Punkte, an denen das Abbremsen und die Teilöffnung beginnen.
:enn das Tor während des gffnungs- bzw. Schließvorgangs gegen ein Hindernis stößt, sorgt der
Åvirtuelle“ Geber dafür, dass die Bewegung umgekehrt wird. :enn für dieselbe 5ichtung ein zweites
Hindernis geortet wird, hält der Motor an. In beiden Fällen wird ein Alarm angezeigt (siehe Abschnitt
Alarme).
Die Empfindlichkeit des Åvirtuellen“ Gebers muss eingestellt werden, wobei der Zeitraum, den die
Karte wartet, bevor die Umkehr der Bewegung veranlasst wird, von einem Minimum von 0 sec
bis zu einem Maximum von 10 sec in Schritten von einer Sekunde reichen kann.
00 = höchste Empfindlichkeit
10 = niedrigste Empfindlichkeit
E721 10 532014 - Rev. D
Display Funktion Default 1
TEILÖFFNUNG:
PO Die :eite der Teilöffnung des Flügels kann als Prozentsatz des vollständigen Torlaufs eingestellt werden.
50
Einstellbar von 0 bis 99% in 1%-Schritten.
00 = keine Teilöffnung
01 = minimale Teilöffnung
99 = maximale Teilöffnung
ARBEITSZEIT (Time-Out):
t Es muss ein :ert eingestellt werden, der höher als die Zeit ist, die das Tor zum vollständigen 2.0
gffnen und Schließen benötigt.
Einstellbar von 0 bis 59 sec in Schritten von 1 Sekunde. Nachfolgend schaltet die Anzeige
auf Minuten und Zehntelsekunden um (die durch einen Punkt getrennt sind) und die Zeit wird
mit Schritten von jeweils 10 Sekunden bis zum maximalen :ert von 9.5 Minuten eingestellt.
Z.B.: :enn das Display 2.5 anzeigt, beträgt die Pausenzeit 2 min und 50 sec..
Bei Anlagen mit MASTER-SLAVE-Konfiguration muss am MASTER-Steuergerät
eine BETRIEBSZEIT eingestellt werden, bei der die Bewegungsdauer beider Flügel
zu berücksichtigen ist.
OUT 1:
o1 Ermöglicht es, den Ausgang OUT (Open Collector 5UHEST5OMKONTAKT) in einer der folgenden 00
Funktionen zu aktivieren:
00 = Immer aktiv (liefert 24-V-Spannung = bei maximaler Stromaufnahme 100 mA)
01 = FAILSAFE (prüft den einwandfreien Betrieb der angeschlossenen herkömmlichen Fotozellen)
02 = KONT5OLLLAMPE (bei geschlossenem Tor ausgeschaltet, in der Schließphase und der Pause
eingeschaltet, in der Schließphase blinkend)
03 = SE5VICELAMPE (siehe folgende Funktion)
04 = ALA5M BATTE5IE-Betrieb
05 = Tor GEgFFNET bzw. in PAUSE
06 = Tor GESCHLOSSEN
07 = Tor in BE:EGUNG
08 = Tor in der gFFNUNGSPHASE
09 = Tor in der SCHLIESSPHASE
1 0 = Sicherheitsvorrichtung AKTIV
1 1 = Getakteter Ausgang, der vom zweiten Funkkanal aus aktiviert werden kann (siehe
nachfolgende Funktion)
1 2 = Ausgang, der vom zweiten Funkkanal aus aktiviert werden kann (Funktion Schrittbetrieb)
t1 VERZÖGERUNGSZEIT OUT 1 (nur sichtbar, wenn im vorangegangenen Schritt Punkt 03 bzw. 02

DEUTSCH
11 ) ausgewählt wurden:
Ermöglicht es, die Verzögerungszeit des Ausgangs OUT einzustellen, wenn eine Zeitfunktion
(Z.B. 03 bzw. 11 ) von 1 bis 99 Minuten in Schritten von 1 Minute ausgewählt wurde.
OPEN B / CLOSE/SICHERHEITSVORR. LEISTE E:
Ob Die Benutzung des Eingangs OPEN B kann als Teilöffnung bzw. SCHLIESS-Impuls ausgewählt 00
werden, oder SICHE5HEITSVO55. LEISTE.
00 = OPEN B
01 = CLOSE
02 = SICHE5HEITSLEISTE (gffnerkontakt)
Sollte eine Betriebslogik ausgewählt werden, die den Einsatz des SCHLIESS-Impulses
vorsieht (Logik b, bC, C), wird diese Funktion auf 01 voreingestellt und kann nicht
verändert werden.
STOP / SICHERHEITSVORR. LEISTE:
SP Die Benutzung des Eingangs STOP kann als STOP oder SICHE5HEITSVO55. LEISTE-Impuls aus- 00
gewählt werden.
00 = STOP
01 = SICHE5HEITSLEISTE (gffnerkontakt)
TEILUMKEHRUNG:
IP Es besteht die Möglichkeit, den Umkehrungstyp (vollständige Umkehrung oder Teilumkehrung) no
beim Erfassen eines Hindernisses oder dem Ansprechen der Sicherheitsleiste auszuwählen.
Y = Teilumkehrung aktiviert. Beim Erfassen eines Hindernisses oder beim Ansprechen
der Sicherheitsleiste wird die Bewegungsrichtung des Flügels für zirka 2“ umgekehrt,
und anschließend kommt dieser zum Stillstand
n o = Teilumkehrung deaktiviert. Beim Erfassen eines Hindernisses oder beim Ansprechen der
Sicherheitsleiste wird die Bewegungsrichtung des Flügels vollständig umgekehrt, und
dieser wird in die gffnungs- oder Schließposition gefahren.
MOTORVERRIEGELUNG:
Lc Es ist möglich, den Einsatz der Motorverriegelung während des Batteriebetriebs auszuwählen: Y
Y = die Motorverriegelung funktioniert auch während des Batteriebetriebs regelmäßig weiter
no = im Batteriebetrieb bleibt die Motorverriegelung stets geöffnet
E721 11 532014 - Rev. D
Display Funktion Default 1
KUNDENDIENSTANFORDERUNG - ZYKLUSZÄHLER (an die nachfolgenden Funktionen gekoppelt):
AS Y = beim Erreichen der Anzahl der Zyklen, die zusammen mit den nachfolgenden no
Funktionen nc und nd eingestellt werden können, wird vor sämtlichen Bewegungen
ein Vorblinkvorgang von 8 sec durchgeführt (abgesehen von dem bereits mit der
Funktion PF eingestellten Vorblinkvorgang).
no = die darauffolgenden Funktionen nc und nd zeigen an, wie viele Zyklen die Anlage
bis zu einem Maximum von 99Ü990 durchgeführt hat.
Wenn die Anzahl der durchgeführten Zyklen höher als 99 990 ist, zeigen die
beiden darauffolgenden Funktionen nc und nd beide 99 an.
Diese Funktion kann nützlich sein, um die Intervalle der programmierten Instandhaltung
einzustellen bzw. um die bereits durchgeführten Zyklen zu überprüfen.
ZYKLUSPROGRAMMIERUNG (MAL TAUSEND):
nc :enn AS
= Y zeigt das Display die Anzahl der Zyklen mal Tausend an, nach denen der
00
Kundendienst angefordert werden soll (einstellbar von 0 bis 99 ).
:enn A S = n o zeigt das Display die Anzahl der Zyklen mal Tausend an, die bereits
durchgeführt wurden. Der angezeigte :ert wird bei jedem Zyklus aktualisiert und
interagiert mit dem nd -:ert.
Wenn AS = no wird durch einen 5-sec-langen Druck der Tasten + und - der
Zykluszähler nullgestellt.
ZYKLUSPROGRAMMIERUNG (MAL ZEHN):
nd :enn AS = Y zeigt das Display die Anzahl Zyklen mal Zehn an, nach denen der Kundendienst
00
angefordert werden soll (einstellbar von 0 bis 99 ).
:enn AS = no zeigt das Display die Anzahl der Zyklen mal Zehn an, die bereits durchgeführt
wurden. Der angezeigte :ert wird bei jedem Zyklus aktualisiert und interagiert mit dem
nc -:ert.
Beispiel: Wenn die Anlage 11 218 Zyklen durchgeführt hat, werden
nc = 11 und nd = 21 angezeigt
STATUS DER AUTOMATION:
St Verlassen der Programmierung, Speichern der Daten und 5ückkehr zur Anzeige des Status der Automation.

00 = GESCHLOSSEN 07 = FAIL SAFE im Gange


01 = GEgFFNET 08 = hberprüfung BUS-2EAS<-Vorrichtungen im Gange
02 = Stillstand, dann ÅgFFNEN“ 09 = Vorblinken, dann ÅgFFNEN“
DEUTSCH

03 = Stillstand, dann ÅSCHLIESSEN“ 10 = Vorblinken, dann ÅSCHLIESSEN“


04 = In ÅPAUSE“ 11 = GEgFFNET bei Teilöffnung
05 = In gffnungsphase 12 = In PAUSE bei Teilöffnung
06 = In Schließphase

6 SPEICHERUNG DES FUNKCODES 6.1 SPEICHERUNG DER DS-FUNKSTEUERUNGEN


Das elektronische Gerät Fig. 15
ist mit einem integrierten Es können max. 256 verschiedene Codes
Decodiersystem (DS, gespeichert werden, die zwischen OPEN A
SLH, LC/5C) mit zwei und OPEN B aufgeteilt werden.
Kanälen ausgestattet,
dem so genannten  1. Auf der Funksteuerung DS die gewünschte Kombination
OMNIDEC. Mit diesem ON - OFF der 12 Dip-Schalter auswählen.
System können mittels 2. Die Tasten + (S:) bzw. - (S:2) gedrückt halten
eines zusätzlichen und dann die SETUP-Taste drücken (S:4), um die
Empfängermoduls und vollständige (OPEN A) bzw. die Teilöffnung (OPEN B/
Funksteuerungen derselben Frequenz (Abb. 15 Bez. )
sowohl die vollständige (OPEN A) als auch die Teilöffnung CLOSE) zu speichern. Das entsprechende LED blinkt 5
(OPEN B) der Automation gespeichert werden. sec lang langsam.
Die 3 Funkcode-Typologien (DS, SLH, LC/ . Beide Tasten loslassen.
RC) können auf beiden Kanälen gleichzeitig 4. Innerhalb dieser 5 sec muss die gewünschte Taste auf
eingesetzt werden. Es können bis zu 256 der Funksteuerung gedrückt werden.
Funkcodes eingegeben werden, die zwischen
OPEN A und OPEN B aufgeteilt werden. 5. Das entsprechende LED leuchtet dauerhaft 1 Sekunde
lang, geht dann wieder aus und zeigt schließlich die
Um verschiedene Kodiersysteme auf erfolgte Speicherung an.
demselben Kanal einsetzen zu können,
muss zuerst der Lernvorgang für ein System 6. Um andere Codes hinzuzufügen, müssen die
abgeschlossen und derselbe Arbeitsschritt Arbeitsschritte ab Punkt 1 wiederholt werden.
dann für das nächste System angewandt
werden.
Keine Funkeinrichtung an als SLAVE
konfigurierte Geräte anschließen.
E721 12 532014 - Rev. D
7. Um Funksteuerungen mit demselben Code verwenden 6.3 SPEICHERUNG DER LC/RC-FUNKSTEUERUNGEN
zu können, muss dieselbe ON - OFF-Kombination auf
die anderen Funksteuerungen kopiert werden, ohne Es können max. 256 verschiedene Codes
dass etwas auf der Kontrollkarte verändert werden gespeichert werden, die zwischen OPEN A
und OPEN B/CLOSE aufgeteilt werden.
muss.
6.2 SPEICHERUNG DER SLH-FUNKSTEUERUNGEN Die LC/RC -Funksteuerungen dürfen
Es können max. 256 verschiedene Codes nur dann benutzt werden, wenn das
gespeichert werden, die zwischen OPEN A Empfängermodul 433 MHz aufweist.
und OPEN B/CLOSE aufgeteilt werden. 1. Die Tasten + (S:) bzw. - (S:2) gedrückt halten
1. Die Tasten P1 und P2 auf der SLH-Funksteuerung und dann die SETUP-Taste drücken (S:4), um die
gleichzeitig drücken und gedrückt halten. vollständige (OPEN A) bzw. die Teilöffnung (OPEN B/
CLOSE) zu speichern. Das entsprechende LED blinkt 5
2. Die LED der Funksteuerung beginnt zu blinken.
sec lang langsam.
. Beide Tasten loslassen.
2. Die Taste loslassen.
4. Die Tasten + (S:) bzw. - (S:2) gedrückt halten
. Innerhalb dieser 5 sec muss die gewünschte Taste auf
und dann die SETUP-Taste (S:4) drücken, um die
der LC/5C-Funksteuerung gedrückt werden.
vollständige (OPEN A) bzw. die Teilöffnung (OPEN B/
CLOSE) zu speichern. Das entsprechende LED blinkt 5 4. Die LED leuchtet dauerhaft 1 Sekunde lang, zeigt an,
sec lang langsam. dass die Speicherung erfolgt ist und blinkt dann weitere
5 sec, während derer eine weitere Funksteuerung
5. Beide Tasten loslassen.
gespeichert werden kann.
6. Innerhalb dieser 5 sec muss, während die LED der
5. :enn die 5 sec vorüber sind, geht die LED aus und
Funksteuerung noch blinkt, die gewünschte Taste auf
zeigt das Ende des Vorgangs an.
der Funksteuerung gedrückt und in dieser Stellung
gehalten werden (die LED der Funksteuerung leuchtet 6.3.1 FERNSPEICHERUNG DER LC/RC-FUNKSTEUERUNGEN
dauerhaft).
Mit den LC/5C-Funksteuerungen können andere
7. Die LED auf der Platte leuchtet dauerhaft 2 Sekunden
Funksteuerungen aus der Ferne gespeichert werden, d.h.
lang, geht dann wieder aus und zeigt schließlich die
ohne direkt auf die Karte zurückzugreifen. Hierzu wird eine
erfolgte Speicherung an.
zu einem früheren Zeitpunkt gespeicherte Funksteuerung
8. Die Taste der Funksteuerung loslassen.
benutzt.
9. Die Taste der gespeicherten Funksteuerung 2 Mal kurz 1. Es muss eine bereits auf einem der beiden Kanäle
hintereinander drücken. gespeicherte Funksteuerung (OPEN A bzw. OPEN B/
Die Automation öffnet sich. Sicherstellen, CLOSE) verwendet werden.
dass die Automation frei von Hindernissen 2. Die Tasten P1 und P2 gleichzeitig drücken und gedrückt
(Personen bzw. Gegenstände) ist.

DEUTSCH
halten, bis beide LEDs 5 sec lang langsam blinken.
Um die anderen Funksteuerungen mit demselben . Innerhalb von 5 sec die zuvor gespeicherte Taste der
Anlagencode zu aktivieren, muss der Anlagencode der Funksteuerung drücken, um die Lernphase auf dem
gespeicherten Taste der Funksteuerung an die Taste der ausgewählten Kanal zu aktivieren.
Funksteuerung, die hinzugefügt werden soll, übermittelt 4. Die LED auf der Karte, welche dem in der Lernphase
werden. Hierzu muss folgendermaßen vorgegangen befindlichen Kanal entspricht, blinkt 5 sec lang,
werden: während derer der Code einer anderen Funksteuerung
a. Die Tasten P1 und P2 auf der gespeicherten übermittelt werden muss.
Funksteuerung gleichzeitig drücken und gedrückt 5. Die LED leuchtet dauerhaft 1 Sekunde lang und zeigt
halten. an, dass die Speicherung erfolgt ist. Dann blinkt sie
b. Die LED der Funksteuerung beginnt zu blinken. weitere 5 sec, während derer andere Funksteuerungen
gespeichert werden können.
c. Beide Tasten loslassen.
d. Die gespeicherte Taste drücken und gedrückt 6.4 LÖSCHEN DER FUNKSTEUERUNGEN
halten (die LED der Funksteuerung leuchtet Um ALLE Codes der eingegebenen Funksteuerungen zu
dauerhaft). löschen, müssen die beiden Tasten + (S:) und - (S:2)
e. Die Funksteuerungen einander nähern, die Taste gedrückt werden. Dann eine Sekunde lang die SETUP-Taste
der Funksteuerung, die hinzugefügt werden soll, (S:4) und die beiden ersten Tasten 10 sec lang drücken
drücken und gedrückt halten und erst dann wieder werden.
loslassen, wenn die LED der Funksteuerung anzeigt, ‡ Die LEDs 5ADIO1 und 5ADIO2 blinken 10 sec lang
dass die Speicherung erfolgt ist. schnell.
f. Die Taste der gespeicherten Funksteuerung 2 Mal ‡ Die beiden LEDs leuchten 2 Sekunden lang und gehen
kurz hintereinander drücken. dann aus (Löschung erfolgt).
Die Automation öffnet sich. Sicherstellen, ‡ Beide Tasten loslassen.
dass die Automation frei von Hindernissen
Dieser Vorgang kann NICHT rückgängig
(Personen bzw. Gegenstände) ist.
gemacht werden. Es werden sämtliche
sowohl als OPEN A als auch als OPEN B/CLOSE
gespeicherten Codes der Funksteuerungen
gelöscht.
E721 13 532014 - Rev. D
7 INBETRIEBNAHME
7.1 ÜBERPRÜFUNG DER LEDS
Nachdem sämtliche Anschlüsse durchgeführt worden sind und die Karte mit Strom versorgt ist, muss in der unten
aufgeführten Tabelle der Status der LEDs im Vergleich zum Status der Eingänge überprüft werden (auf Abb. 16 ist die
Automation geschlossen und befindet sich in 5uhestellung).
Die LEDs zeigen den Status der Eingänge der Karte an und sind zum Bewegen des Automatismus von großer Bedeutung:
Dabei ist zu berücksichtigen, dass: LED AN = Kontakt geschlossen LED AUS = Kontakt offen

< (1) F
BUS 2EASY
< (2)
< OPEN A -
< GND
< OPEN B / CLOSE < SAFE
+

R
A
C

1
RADIO XF

R
2
IO

E
FC
FC

IO

O
< STOP / SAFE

W
R
D

O
R
A

P
R
< FSW OP

R
SETUP
< GND
< FSW CL
< +24

USB

BATTERY
RELEASE
Y
R
)

R
F

OUT
-L

E
S

S
E IN

TO
R M

K
K
K
T
-N

N
T EC

C
T
T RI

C
C
(P A

- +
A

LO
LA

LO
LO
M

R
P

M
B
<

<

<

<

<

<

<
<
<

Fig. 16
Abb. 16
Die LEDs FCA und FCC stellen die Arbeitskontakte des Die Eingänge STOP (SAFE), FSW CL, FSW
auf der Karte integrierten Endschalters dar, die sich im OP, OPEN B, konfiguriert als SAFE, sind
DEUTSCH

belegten Zustand öffnen, wodurch das entsprechende Sicherheitseingänge mit Öffnerkontakt.


LED abschaltet: Die entsprechenden LED müssen daher
LEUCHTEN, wenn sich die Automation in
A u t o m a t i o n FCA Ruhestellung befindet. Sie erlöschen, wenn
GESCHLOSSEN die angeschlossene Vorrichtung anspricht.
FCC FCC belegt
Die Eingänge OPEN A, OPEN B/CLOSE
A u t o m a t i o n FCA FCA belegt sind Eingänge mit Schließerkontakt. Die
GEgFFNET
entsprechenden LED leuchten daher
FCC NICHT, wenn sich die Automation in
Ruhestellung befindet. Sie leuchten, wenn
Tab. 3 - Beschreibung POWER-LED die angeschlossene Vorrichtung anspricht.
Bei als SLAVE programmierten Geräten dürfen
Dauerhaft die der Klemmenleiste J13 entsprechenden
Stromversorgung vorhanden
eingeschaltet LED nicht leuchten.
Wenn die ERROR-LED blinkt, zeigt dies an,
Blinkt Batterieversorgung dass ein Alarm vorliegt (eine Situation, die
den Betrieb des Tors nicht beeinträchtigt).
Ausgeschaltet Karte aus Wenn die ERROR-LED dauerhaft eingeschal-
tet ist, zeigt dies an, dass eine Fehlermel-
dung vorliegt (Situation, durch welche der
Betrieb gestoppt wird, bis die Ursache der
7.2 BATTERIEBETRIEB Fehlermeldung behoben ist).

ACHTUNG
:ährend des Batteriebetriebs bei stehender Automation und System im 5uhemodus ist das Display LCD1 abgeschaltet und
die LED BUS 2easy sowie die LED FCC und FCA leuchten nicht, während die LED Power blinkt, um den Verbrauch zu optimieren
und die Ladung aufrechtzuerhalten.
In dieser Phase besteht auf jeden Fall die Möglichkeit, den Zustand der Automation anzuzeigen. Hierfür einfach kurz die
Taste + auf der Steuerkarte drücken. Nach diesem kurzen Tastendruck wird der Zustand der Automation für 2 Sekunden am
Display LCD1 angezeigt, das danach wieder abgeschaltet wird. :ährend einer normalen Bewegung arbeiten dagegen alle
Diagnose-LED und LED zur Statusanzeige des Displays wieder entsprechend dem Zustand der Automation (siehe Abb. 16).
E721 14 532014 - Rev. D
7.3 POSITIONIERUNG DER ENDSCHALTER
Um die Endschalter-Magneten ordnungsgemäß positionieren zu können, muss die Steuerzentrale
vorschriftsmäßig montiert und mit sämtlichen Zubehörgeräten der Steuerzentrale und den
Sicherheitsvorrichtungen verbunden werden.
Der Antrieb ist mit einem Magnetsensor (Endschalter) ausgestattet, welcher in der Karte der Steuerung integriert ist.
Der Stillstand des Tors erfolgt sowohl beim gffnen als auch beim Schließen in dem Moment, in dem der Sensor von dem
am oberen Teil der Zahnstange befestigten polarisierten Magneten, aktiviert wird.
1. Überprüfen, ob der Antrieb gemäß der entsprechenden Anleitungen für den manuellen Betrieb
eingerichtet ist.
2. Das Tor von Hand in die Öffnungsposition schieben und dabei einen Abstand von 40 mm zum
mechanischen Endanschlag lassen (siehe Abb. 17).
. Den Magneten mit dem RUNDEN ENDE auf der Zahnstange in 5ichtung des Motors gleiten

A
C

R O1

2
FC
FC

IO
I
lassen. Sobald die LED des FCA-Endschalters auf der Karte erlischt, kann dieser mit den

R
A

E
R
entsprechenden Schrauben befestigt werden.
4. Das Tor von Hand in die Schließposition schieben und dabei einen Abstand 40 mm zum
mechanischen Endanschlag lassen.
5. Den Magneten mit dem QUADRATISCHEN ENDE auf der Zahnstange in 5ichtung des Motors
gleiten lassen. Sobald das LED des FCC-Endschalters auf der Leiterplatte ausgeht, mit den
entsprechenden Schrauben befestigen.

A
C

R O1

2
FC
FC

IO
6. Sowohl beim gffnen als auch beim Schließen überprüfen, ob die LED des entsprechenden

I
D

R
A
Endschalters sich am Ende des Vorgangs ordnungsgemäß ausschaltet und falls notwendig die

E
R
entsprechenden bnderungen an der Position der Endschaltermagneten vornehmen.
Um eine Beschädigung des Antriebs und/oder Betriebsstörungen an der
Automation zu vermeiden, muss ein Abstand von etwa 40 mm zu den
mechanischen Endanschlägen gewahrt werden.

Für den ordnungsgemäßen


Betrieb des Antriebs muss
der Magnet mit dem RUNDEN
ENDE als Endschalter für den
ÖFFNUNGS- und der Magnet
mit dem QUADRATISCHEN
ENDE als Endschalter für den

DEUTSCH
SCHLIESSVORGANG benutzt
werden.
(SIEHE ABB. 17)
Bei Anlagen mit MASTER-
SLAVE-Konfiguration müssen
die Magneten der Endschalter
gemäß den Anweisungen in
Abb. 18 eingebaut werden.

Abb, 17

MASTER/SLAVE

Abb. 18

E721 15 532014 - Rev. D


7.4 MASTER-SLAVE-KONFIGURATION
Muss eine Anlage mit gegenläufigen Torflügeln realisiert werden, die zum gffnen und Schließen der Zufahrt gleichzeitig
zu betätigen sind, besteht die Möglichkeit, zwei E721-Geräte im Master-Slave-Modus anzuschließen und einzurichten.
Das MASTE5-Gerät (festgelegter :ert für den Parameter C t der ersten Programmierebene: M A ) muss alle für
den einwandfreien Betrieb der Anlage notwendigen Anschlüsse besitzen (Fotozellen, Sicherheitseinrichtungen,
Funkvorrichtung, gffnungsimpulse, Blinkleuchte), während das SLAVE-Gerät (festgelegter :ert für den Parameter
C t der ersten Programmierebene: S L ) keine Verdrahtungen in der Klemmenleiste J1 aufweisen darf, da die
entsprechenden Eingänge vollständig übergangen werden. Die beiden Geräte kommunizieren über BUS-2EAS<
anhand einer zweipoligen POLARISIERTEN Verdrahtung auf der Klemmenleiste J12.
Das MASTE5-Gerät überwacht das SLAVE-Gerät über BUS-2EAS< und verwaltet alle Bewegungs- und Zeitabläufe für
beide Torflügel.

Anschlüsse und Verdrahtungen für das SLAVE-Gerät auf der Klemmenleiste J13 sind zu vermeiden.

Die BUS-Verbindung zwischen den beiden Steuerkarten muss POLARISIERT sein, wobei die
Reihenfolge der Pole der Klemmenleiste J12 einzuhalten ist (POL (1) – POL (2)) – (siehe Abb. 19).

Bei der Konfiguration eines Steuergeräts als SLAVE werden die Werte einiger Programmierparameter
forciert und nicht mehr im Menü visualisiert (LO-PA-Pb-Ph-Op). Wird für die Steuerkarte erneut
der MASTER-Modus festgelegt, werden diese zuvor forcierten Werte in der Programmierung
beibehalten.

7.4.1 MASTER-SLAVE-VERDRAHTUNG

(1) (1)
BUS 2 EASY BUS 2 EASY
(2) (2)

Keine Anschlüsse an
diese Klemmenleiste
vornehmen.
DEUTSCH

E721 MASTER E721 SLAVE


Abb. 19

7.4.2 SETUP-VERFAHREN MASTER/SLAVE

Die SETUP-Anforderung, die durch das Blinken der Meldung S0 am Display angezeigt wird,
kann sowohl am MASTER-Steuergerät als auch am SLAVE-Steuergerät erscheinen. Wird sie am
SLAVE-Steuergerät visualisiert, erscheint am MASTER-Steuergerät der Fehlercode 91 . Auf jeden
Fall kann ein SETUP-Vorgang ausschließlich am MASTER-Steuergerät gestartet werden.

Für den SETUP-Vorgang bei einer MASTE5-SLAVE-Anlage sind folgende Schritte auszuführen:

1. Beide Flügel entriegeln, auf halben Hubweg fahren und wieder verriegeln (siehe Anweisung Nr. 1, Abschn. 7.5 SETUP)
2. Die SETUP-Taste am MASTE5-Steuergerät so lange drücken, bis das MASTE5-Tor die Bewegung startet.
. Das MASTE5-Tor führt einen vollständigen SETUP-Vorgang durch (siehe Abschn. 7.5 SETUP)
4. Nachdem der SETUP-Vorgang der MASTE5-Steuerkarte ordnungsgemäß abgeschlossen wurde, startet der komplette
SETUP-Vorgang der SLAVE-Steuerkarte (siehe Abschn. 7.5 SETUP).
5. :urde auch dieser Vorgang abgeschlossen, prüft das MASTE5-Steuergerät die Position des SLAVE-Flügels und fährt
diesen an dieselbe Position (offen oder geschlossen) des MASTE5-Flügels.
6. Vorgang abgeschlossen.

Bei Fehlern oder wurde der oben beschriebene SETUP-Vorgang nicht vollständig abgeschlossen,
sind die Schritte ab Punkt 1 zu wiederholen.

E721 16 532014 - Rev. D


7.4 SETUP 9 ANZEIGE ALARM- UND FEHLERMELDUNGEN
Wenn die Karte mit Strom versorgt und noch :enn auf dem Display Alarm- (Situation, die den Betrieb des
nie ein SETUP durchgeführt wurde bzw. die Tors nicht beeinträchtigt) bzw. Fehlermeldungen (Situation,
Karte ein SETUP fordert, blinkt auf dem Display die den Betrieb des Tors blockiert hat) angezeigt werden,
die Abkürzung S0 zusammen mit der SETUP- kann die entsprechende Statusnummer abgelesen werden.
LED, wodurch angezeigt wird, dass ein SETUP
durchgeführt werden muss. Die ALARM- bzw. FEHLERMELDUNGEN
erlöschen bei dem darauffolgenden Zyklus
Um ein erfolgreiches SETUP durchzuführen, erst dann, wenn die Ursache behoben wurde.
muss sorgfältig überprüft werden, ob
die magnetischen Endschalter gemäß 9.1 ALARME
dem vorangegangenen Abschnitt die Wenn ein ALARM ausgelöst wird, beginnt
ordnungsgemäßen Pole aufweisen. die ERROR-LED zu blinken und durch den
Zum Durchführen eines SETUP folgende Schritte durchführen: gleichzeitige Druck der Tasten + und - wird auf
1. Das Tor auf halben Hubweg fahren (dies ist sehr wichtig, dem Display der Code der entsprechenden
damit der SETUP-Vorgang erfolgreich abgeschlossen Störung angezeigt.
wird) und sicherstellen, dass die beiden LED FCA und Die Tab. 4 enthält sämtliche Alarme, die auf dem Display
FCC leuchten. Ist das nicht der Fall signalisiert die angezeigt werden können.
Steuerkarte den Fehler 12 (siehe Tab. 5).
2. Die SETUP-Taste (S:4) so lange gedrückt halten, bis Tab. 4 - Alarme
sich die Bewegung des Tors verlangsamt und beim
Erreichen des Endanschlags anhält. :enn es sich beim 22 MOTO5-Strom begrenzt
erreichten Endschalter um jenen des Schließvorgangs 24 Kurzschluss Ausgang LAMP
(mit dem QUADRATISCHEN ENDE) handelt, speichert
das Gerät diesen Punkt als Anschlagstelle für die 27 Ermittlung eines Hindernisses (10 sec sichtbar)
Schließphase, wenn es sich beim Endschalter hingegen Speicher Funkcodes XF-Module voll (10 sec
um jenen des gffnungsvorgangs (mit dem RUNDEN ENDE) 30 sichtbar)
handelt, speichert das Gerät diesen Punkt hingegen als
Anschlagstelle für die Öffnungsphase. In dieser Phase 40 Kundendienstanforderung
blinkt auf dem Display die Anzeige S1. Erzwungene :iederherstellung der Default-
. Das Tor beginnt, die Bewegung in die entgegengesetzte 46 programmierung
5ichtung automatisch zu verlangsamen und stoppt
beim Erreichen des Endschalters. :enn es sich beim 9.2 FEHLERMELDUNGEN
erreichten Endschalter um jenen des gffnungsvorgangs
(mit dem RUNDEN ENDE) handelt, speichert das Gerät Wenn eine FEHLERMELDUNG auftritt, schaltet
diesen Punkt als Anschlagstelle für die Öffnungsphase, sich die LED DL20 dauerhaft ein und durch
wenn es sich beim Endschalter hingegen um jenen den gleichzeitigen Druck der Tasten +
des Schließvorgangs (mit dem QUADRATISCHEN ENDE) und - wird auf dem Display der Code der
handelt, speichert das Gerät diesen Punkt hingegen als entsprechenden Störung angezeigt.

DEUTSCH
Anschlagstelle für die Schließphase. In dieser Phase blinkt
auf dem Display die Anzeige S3. Die Tab. 5 enthält sämtliche Fehlermeldungen, die auf
4. Je nach dem letzten erreichten Endschalter geht das dem Display angezeigt werden können.
Gerät in den geschlossenen (00) bzw. den geöffneten Tab. 5 - Fehlermeldungen
Status (01) über. Im zweiten Fall muss ein OPEN-Impuls
gegeben werden, damit sich das Tor schließt. 01 Karte defekt
03 Motor defekt
8 TEST DER AUTOMATION Motorverriegelung blockiert geschlossen (die Motor-
Am Ende der Montage und der Programmierung den ord- 06 verriegelung überprüfen und eventuell austauschen)
nungsgemäßen Betrieb der Anlage kontrollieren. Hierbei Das Tor ist schwer zu fahren bzw. weist eine hohe
vor allem überprüfen, ob die Sicherheitsvorrichtungen ord- 07 mechanische Schwergängigkeit auf (versuchen, die
Motorkraft zu erhöhen)
nungsgemäß funktionieren und die Anlage den geltenden
Fehler BUS-2EAS<-Vorrichtung (z.B.: dieselbe Adresse
Sicherheitsrichtlinien entspricht. 08 auf zwei Fotozellenpaaren; Adressen überprüfen)
Es wird darauf hingewiesen, dass der 10 Beide Endschalter haben dieselben Pole
Parameter für die Konfiguration des
Encoders in der zweiten Programmierstufe 12 Endschalter beim SETUP-Beginn belegt
zur Verfügung steht (Paramete rEC). Dieser 15 Time-Out abgelaufen
„virtuelle“ Encoder auf der Steuerkarte Keine Kommunikation mit dem SLAVE-Steuergerät –
dient als Quetschschutz. Wenn das Tor 90 kein SLAVE-Steuergerät angeschlossen
während des Öffnens oder Schließens
gegen ein Hindernis stößt, bewirkt der 91 Fehler am SLAVE-Steuergerät
„virtuelle“ Encoder die Umkehrung der
Bewegungsrichtung. Bei der nächsten 92 Fehler am SLAVE-Steuergerät
Bewegung in dieselbe Richtung bewirkt Die Fehlercodes 9 0 9 1 und 9 2 werden nur
ein Hindernis an derselben Position die an als MASTER konfigurierten E721-Geräten
Stillsetzung des Motors. Die korrekte angezeigt; insbesondere verweisen die Codes
E i n s t e l l u n g d i e s e s Pa r a m e t e r s z u r 9 1 und 9 2 auf Fehler am SLAVE-Steuergerät.
Regelung der korrekten Empfindlichkeit Werden diese Fehler angezeigt, zum Beheben
des „virtuellen“ Encoders auf eventuelle der Störung und Wiederherstellung des
Hindernisse während der Bewegung ist von einwandfreien Betriebs der Anlage den am
grundlegender Bedeutung. Display des SLAVE-Steuergeräts visualisierten
Fehlertyp überprüfen.

E721 17 532014 - Rev. D


10 BETRIEBSLOGIKEN Wenn der SAFE-Befehl während der Flügelbewegung
In Klammern sind die Auswirkungen auf die anderen geschaltet wird, bewirkt er die sofortige und
Eingänge mit aktivem Impuls angegeben vollständige Umkehrung der Bewegungsrichtung.
Wird der Befehl bei stehender Automation
Der CLOSE-Befehl kann am Eingang OPEN B von anhaltend gedrückt, wird deren Bewegung
der 2. Programmierstufe geschaltet werden verhindert.
LOGIK „E“ IMPULSE
AUTOMATIONSSTATUS OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP

GESCHLOSSEN öffnet das Tor öffnet das Tor teilweise keine Auswirkung keine Auswirkung keine Auswirkung keine Auswirkung keine Auswirkung
(OPEN unterdrückt) (OPEN unterdrückt) (OPEN unterdrückt)

blockiert und öffnet sich


IM gFFNUNGSVO5GANG blockiert den Betrieb (1) blockiert den Betrieb schließt das Tor wieder blockiert den Betrieb Siehe Prog. 2. Stufe keine Auswirkung beim Freiwerden (OPEN
blockiert - speichert CLOSE)

GEgFFNET schließt das Tor wieder (1) schließt das Tor wieder schließt das Tor wieder keine Auswirkung keine Auswirkung keine Auswirkung keine Auswirkung
(OPEN/CLOSE unterdrückt) (CLOSE unterdrückt) (OPEN/CLOSE unterdrückt)

IM SCHLIESSVO5GANG öffnet das Tor wieder öffnet das Tor wieder keine Auswirkung blockiert den Betrieb keine Auswirkung kehrt die gffnung um (siehe blockiert und öffnet sich
beim Freiwerden (OPEN
Prog. 2. Stufe) blockiert - speichert CLOSE)

BLOCKIE5T schließt das Tor schließt das Tor schließt das Tor keine Auswirkung keine Auswirkung keine Auswirkung keine Auswirkung (OPEN
(OPEN/CLOSE unterdrückt) (OPEN unterdrückt) (CLOSE unterdrückt) blockiert - speichert CLOSE)

LOGIK „EP“ IMPULSE


AUTOMATIONSSTATUS OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP

GESCHLOSSEN öffnet das Tor öffnet das Tor teilweise keine Auswirkung keine Auswirkung keine Auswirkung keine Auswirkung keine Auswirkung
(OPEN unterdrückt) (OPEN unterdrückt) (OPEN unterdrückt)

blockiert und öffnet sich


IM ÖFFNUNGSVORGANG blockiert den Betrieb (1) blockiert den Betrieb schließt das Tor wieder blockiert den Betrieb Siehe Prog. 2. Stufe keine Auswirkung beim Freiwerden (OPEN
blockiert - speichert CLOSE)

GEÖFFNET schließt das Tor wieder (1) schließt das Tor wieder schließt das Tor wieder keine Auswirkung keine Auswirkung keine Auswirkung keine Auswirkung
(OPEN/CLOSE unterdrückt) (CLOSE unterdrückt) (OPEN/CLOSE unterdrückt)

IM SCHLIESSVORGANG blockiert den Betrieb blockiert den Betrieb keine Auswirkung blockiert den Betrieb keine Auswirkung kehrt die gffnung um (siehe blockiert und öffnet sich
beim Freiwerden (OPEN
Prog. 2. Stufe) blockiert - speichert CLOSE)
Führt die Bewegung weiter Führt die Bewegung weiter
BLOCKIERT in umgekehrter 5ichtung in umgekehrter 5ichtung schließt das Tor keine Auswirkung keine Auswirkung keine Auswirkung keine Auswirkung (OPEN
aus. Nach dem STOP aus. Nach dem STOP (OPEN/CLOSE unterdrückt) (OPEN unterdrückt) (CLOSE unterdrückt) blockiert - speichert CLOSE)
schließt das Tor immer. schließt das Tor immer.
DEUTSCH

LOGIK „A“ IMPULSE


STATUS AUTOMATION OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP
öffnet das Tor teilweise
öffnet und schließt nach und keine Auswirkung keine Auswirkung keine Auswirkung
GESCHLOSSEN der Pausenzeit schließt es nach der keine Auswirkung (OPEN unterdrückt) (OPEN unterdrückt) keine Auswirkung (OPEN unterdrückt)
Pausenzeit B
blockiert und öffnet sich
IM ÖFFNUNGSVORGANG keine Auswirkung (1) keine Auswirkung schließt das Tor wieder blockiert den Betrieb Siehe Prog. 2. Stufe keine Auswirkung beim Freiwerden
(speichert CLOSE)

GEÖFFNET IN PAUSE Erneuter Ablauf Pausenzeit Erneuter Ablauf Pausenzeit schließt das Tor wieder blockiert den Betrieb keine Auswirkung Erneuter Ablauf Pausenzeit Erneuter Ablauf Pausenzeit
(1) B (CLOSE unterdrückt) (CLOSE unterdrückt)

IM SCHLIESSVORGANG öffnet das Tor wieder öffnet das Tor wieder keine Auswirkung blockiert den Betrieb keine Auswirkung kehrt die gffnung um (siehe blockiert und öffnet sich
beim Freiwerden
Prog. 2. Stufe) (speichert CLOSE)

BLOCKIERT schließt das Tor schließt das Tor schließt das Tor keine Auswirkung keine Auswirkung keine Auswirkung keine Auswirkung
(OPEN/CLOSE unterdrückt) (OPEN unterdrückt) (CLOSE unterdrückt) (OPEN/CLOSE unterdrückt)

LOGIK „A1“ IMPULSE


STATUS AUTOMATION OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP
öffnet das Tor teilweise
öffnet und schließt nach und keine Auswirkung keine Auswirkung keine Auswirkung
GESCHLOSSEN der Pausenzeit schließt es nach der keine Auswirkung (OPEN unterdrückt) (OPEN unterdrückt) keine Auswirkung (OPEN unterdrückt)
Pausenzeit B

IM ÖFFNUNGSVORGANG keine Auswirkung (1) keine Auswirkung schließt das Tor wieder blockiert den Betrieb Siehe Prog. 2. Stufe öffnet sich weiter und blockiert und öffnet sich
beim Freiwerden
schließt sich sofort wieder (speichert CLOSE)

Erneuter Ablauf Pausenzeit Erneuter Ablauf Pausenzeit schließt das Tor wieder blockiert und beim
GEÖFFNET IN PAUSE (1) B blockiert den Betrieb keine Auswirkung Freiwerden schließt es Erneuter Ablauf Pausenzeit
(CLOSE unterdrückt)
sich sofort

IM SCHLIESSVORGANG öffnet das Tor wieder öffnet das Tor wieder keine Auswirkung blockiert den Betrieb keine Auswirkung kehrt die gffnung um (siehe blockiert und öffnet sich
beim Freiwerden
Prog. 2. Stufe) (speichert CLOSE)

BLOCKIERT schließt das Tor schließt das Tor schließt das Tor keine Auswirkung keine Auswirkung keine Auswirkung keine Auswirkung
(OPEN/CLOSE unterdrückt) (OPEN unterdrückt) (CLOSE unterdrückt) (OPEN/CLOSE unterdrückt)
(1) :ährend des Teilöffnungszyklus wird das Tor durch einen OPEN-A-Impuls vollständig geöffnet.
E721 18 532014 - Rev. D
LOGIK „AP“ IMPULSE
AUTOMATIONSSTATUS OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP
öffnet das Tor teilweise
öffnet und schließt nach und keine Auswirkung keine Auswirkung keine Auswirkung
GESCHLOSSEN der Pausenzeit wieder schließt es nach der keine Auswirkung (OPEN unterdrückt) (OPEN unterdrückt) keine Auswirkung (OPEN unterdrückt)
Pausenzeit B
blockiert und öffnet sich
IM ÖFFNUNGSVORGANG blockiert den Betrieb (1) blockiert den Betrieb schließt das Tor wieder blockiert den Betrieb Siehe Prog. 2. Stufe keine Auswirkung beim Freiwerden (OPEN
blockiert - speichert CLOSE)

GEÖFFNET IN PAUSE blockiert den Betrieb (1) blockiert den Betrieb schließt das Tor wieder blockiert den Betrieb keine Auswirkung Erneuter Ablauf Pausenzeit Erneuter Ablauf Pausenzeit
(CLOSE unterdrückt) (CLOSE unterdrückt)

IM SCHLIESSVORGANG öffnet das Tor wieder öffnet das Tor wieder keine Auswirkung blockiert den Betrieb keine Auswirkung kehrt die gffnung um (siehe blbeiockiert und öffnet sich
m Freiwerden (OPEN
Prog. 2. Stufe) blockiert - speichert CLOSE)

BLOCKIERT schließt das Tor schließt das Tor schließt das Tor keine Auswirkung keine Auswirkung keine Auswirkung keine Auswirkung
(OPEN/CLOSE unterdrückt) (OPEN unterdrückt) (CLOSE unterdrückt) (OPEN/CLOSE unterdrückt)

LOGIK „At“ (2) IMPULSE


AUTOMATIONSSTATUS OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP
öffnet das Tor teilweise
öffnet und schließt nach und keine Auswirkung keine Auswirkung keine Auswirkung
GESCHLOSSEN der Pausenzeit wieder schließt es nach der keine Auswirkung (OPEN unterdrückt) (OPEN unterdrückt) keine Auswirkung (OPEN unterdrückt)
Pausenzeit B

kehrt während des blockiert und öffnet sich


IM ÖFFNUNGSVORGANG keine Auswirkung (1) keine Auswirkung schließt das Tor wieder blockiert den Betrieb Schließvorgangs um keine Auswirkung beim Freiwerden
(speichert CLOSE)

GEÖFFNET IN PAUSE Erneuter Ablauf Pausenzeit Erneuter Ablauf Pausenzeit schließt das Tor wieder blockiert den Betrieb keine Auswirkung Erneuter Ablauf Pausenzeit Erneuter Ablauf Pausenzeit
(1) (CLOSE unterdrückt) (CLOSE unterdrückt)

IM SCHLIESSVORGANG öffnet das Tor wieder öffnet das Tor wieder keine Auswirkung blockiert den Betrieb keine Auswirkung kehrt die gffnung um (siehe blockiert und öffnet sich
beim Freiwerden
Prog. 2. Stufe) (speichert CLOSE)

BLOCKIERT schließt das Tor schließt das Tor schließt das Tor keine Auswirkung keine Auswirkung keine Auswirkung keine Auswirkung
(OPEN/CLOSE unterdrückt) (OPEN unterdrückt) (CLOSE unterdrückt) (OPEN/CLOSE unterdrückt)

LOGIK „S“ IMPULSE


AUTOMATIONSSTATUS OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP
öffnet das Tor teilweise
öffnet und schließt nach und keine Auswirkung keine Auswirkung keine Auswirkung
GESCHLOSSEN schließt es nach der keine Auswirkung keine Auswirkung

DEUTSCH
der Pausenzeit wieder Pausenzeit B (OPEN unterdrückt) (OPEN unterdrückt) (OPEN unterdrückt)

IM ÖFFNUNGSVORGANG Schlkehrt während des kehrt während des schließt das Tor wieder blockiert den Betrieb Siehe Prog. 2. Stufe öffnet sich weiter und blockiert und öffnet sich
beim Freiwerden
ießvorgangs um (1) Schließvorgangs um schließt sich sofort wieder (speichert CLOSE)
blockiert und beim blockiert und schließt sich
GEÖFFNET IN PAUSE schließt das Tor wieder (1) schließt das Tor wieder schließt das Tor wieder blockiert den Betrieb keine Auswirkung Freiwerden schließt es beim Freiwerden
sich sofort
kehrt die gffnung um (siehe blockiert und öffnet sich
IM SCHLIESSVORGANG öffnet das Tor wieder öffnet das Tor wieder keine Auswirkung blockiert den Betrieb keine Auswirkung Prog. 2. Stufe) am Ende beim Freiwerden und am
schließt es sich sofort Ende schließt es sich sofort

BLOCKIERT schließt das Tor schließt das Tor schließt das Tor keine Auswirkung keine Auswirkung keine Auswirkung keine Auswirkung
(OPEN/CLOSE unterdrückt) (OPEN unterdrückt) (CLOSE unterdrückt) (OPEN/CLOSE unterdrückt)

LOGIK „SP“ IMPULSE


AUTOMATIONSSTATUS OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP
öffnet das Tor teilweise
öffnet und schließt nach und keine Auswirkung keine Auswirkung keine Auswirkung
GESCHLOSSEN der Pausenzeit wieder schließt es nach der keine Auswirkung (OPEN unterdrückt) (OPEN unterdrückt) keine Auswirkung (OPEN unterdrückt)
Pausenzeit B
blockiert und öffnet sich beim
IM ÖFFNUNGSVORGANG blockiert den Betrieb (1) blockiert den Betrieb schließt das Tor wieder blockiert den Betrieb Siehe Prog. 2. Stufe öffnet sich weiter und Freiwerden; am Ende schließt
schließt sich sofort wieder es sich sofort (OPEN blockiert
- speichert CLOSE)

blockiert und beim blockiert und beim


GEÖFFNET IN PAUSE schließt das Tor wieder (1) schließt das Tor wieder schließt das Tor wieder blockiert den Betrieb keine Auswirkung Freiwerden schließt es Freiwerden schließt es
sich sofort sich sofort

IM SCHLIESSVORGANG blockiert den Betrieb blockiert den Betrieb keine Auswirkung blockiert den Betrieb keine Auswirkung kehrt die gffnung um (siehe blockiert und öffnet sich
beim Freiwerden
Prog. 2. Stufe) (speichert CLOSE)
Führt die Bewegung weiter Führt die Bewegung weiter
BLOCKIERT in umgekehrter 5ichtung in umgekehrter 5ichtung schließt das Tor wieder keine Auswirkung keine Auswirkung keine Auswirkung keine Auswirkung
aus. Nach dem STOP aus. Nach dem STOP (OPEN/CLOSE unterdrückt) (OPEN unterdrückt) (CLOSE unterdrückt) (OPEN/CLOSE unterdrückt)
schließt das Tor immer schließt das Tor immer
(1) :ährend des Teilöffnungszyklus wird das Tor durch einen OPEN-A-Impuls vollständig geöffnet.
E721 19 532014 - Rev. D
LOGIK „SA“ IMPULSE
AUTOMATIONSSTATUS OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP
öffnet das Tor teilweise
öffnet und schließt nach und keine Auswirkung keine Auswirkung keine Auswirkung
GESCHLOSSEN der Pausenzeit wieder schließt es nach der keine Auswirkung (OPEN unterdrückt) (OPEN unterdrückt) keine Auswirkung (OPEN unterdrückt)
Pausenzeit B
blockiert und öffnet sich
IM ÖFFNUNGSVORGANG keine Auswirkung (1) keine Auswirkung schließt das Tor wieder blockiert den Betrieb Siehe Prog. 2. Stufe keine Auswirkung beim Freiwerden
(speichert CLOSE)

GEÖFFNET IN PAUSE schließt das Tor wieder (1) schließt das Tor wieder schließt das Tor wieder blockiert den Betrieb keine Auswirkung Erneuter Ablauf Pausenzeit Erneuter Ablauf Pausenzeit
(CLOSE unterdrückt) (CLOSE unterdrückt)

IM SCHLIESSVORGANG öffnet das Tor wieder öffnet das Tor wieder keine Auswirkung blockiert den Betrieb keine Auswirkung kehrt die gffnung um (siehe blockiert und öffnet sich
beim Freiwerden
Prog. 2. Stufe) (speichert CLOSE)

BLOCKIERT schließt das Tor schließt das Tor schließt das Tor keine Auswirkung keine Auswirkung keine Auswirkung keine Auswirkung
(OPEN/CLOSE unterdrückt) (OPEN unterdrückt) (CLOSE unterdrückt) (OPEN/CLOSE unterdrückt)

LOGIK „B“ IMPULSE


AUTOMATIONSSTATUS OPEN A / CLOSE STOP FSW OP FSW CL FSW CL/OP

GESCHLOSSEN öffnet das Tor / keine Auswirkung keine Auswirkung keine Auswirkung keine Auswirkung keine Auswirkung
(OPEN unterdrückt) (OPEN unterdrückt) (OPEN unterdrückt)

blockiert und öffnet sich


IM ÖFFNUNGSVORGANG keine Auswirkung / schließt das Tor blockiert den Betrieb Siehe Prog. 2. Stufe keine Auswirkung beim Freiwerden (speichert
OPEN/CLOSE)

GEÖFFNET keine Auswirkung / schließt das Tor keine Auswirkung keine Auswirkung keine Auswirkung keine Auswirkung
(OPEN/CLOSE unterdrückt) (CLOSE unterdrückt) (OPEN/CLOSE unterdrückt)

IM SCHLIESSVORGANG öffnet das Tor / keine Auswirkung blockiert den Betrieb keine Auswirkung kehrt die gffnung um (siehe beiblmockiFreiertwund öffnet sich
erden (speichert
Prog. 2. Stufe) OPEN/CLOSE)

BLOCKIERT öffnet das Tor / schließt das Tor keine Auswirkung keine Auswirkung keine Auswirkung keine Auswirkung
(OPEN/CLOSE unterdrückt) (OPEN unterdrückt) (CLOSE unterdrückt) (OPEN/CLOSE unterdrückt)

LOGIK „bC“ IMPULSE IN DER ÖFFNUNGSPHASE / IN DER SCHLIESSPHASE IMPULSE


BEIBEHALTENE BEFEHLE
AUTOMATIONSSTATUS OPEN A / CLOSE STOP FSW OP FSW CL FSW CL/OP

GESCHLOSSEN öffnet das Tor / keine Auswirkung keine Auswirkung keine Auswirkung keine Auswirkung keine Auswirkung
DEUTSCH

(OPEN unterdrückt) (OPEN unterdrückt) (OPEN unterdrückt)

blockiert und öffnet sich


IM ÖFFNUNGSVORGANG keine Auswirkung / schließt das Tor blockiert den Betrieb Siehe Prog. 2. Stufe keine Auswirkung beim Freiwerden (speichert
OPEN/CLOSE)

GEÖFFNET keine Auswirkung / schließt das Tor keine Auswirkung keine Auswirkung keine Auswirkung keine Auswirkung
(OPEN/CLOSE unterdrückt) (CLOSE unterdrückt) (OPEN/CLOSE unterdrückt)

IM SCHLIESSVORGANG öffnet das Tor / keine Auswirkung blockiert den Betrieb keine Auswirkung kehrt die gffnung um (siehe beiblmockiFreiertwund öffnet sich
erden (speichert
Prog. 2. Stufe) OPEN/CLOSE)

BLOCKIERT öffnet das Tor / schließt das Tor keine Auswirkung keine Auswirkung keine Auswirkung keine Auswirkung
(OPEN/CLOSE unterdrückt) (OPEN unterdrückt) (CLOSE unterdrückt) (OPEN/CLOSE unterdrückt)

LOGIK „C“ BEIBEHALTENE BEFEHLE IMPULSE


AUTOMATIONSSTATUS OPEN A / CLOSE STOP FSW OP FSW CL FSW CL/OP

GESCHLOSSEN öffnet das Tor / keine Auswirkung keine Auswirkung keine Auswirkung keine Auswirkung keine Auswirkung
(OPEN unterdrückt) (OPEN unterdrückt) (OPEN unterdrückt)

IM ÖFFNUNGSVORGANG keine Auswirkung / schließt das Tor blockiert den Betrieb Siehe Prog. 2. Stufe keine Auswirkung blockiert und beim Freiwer-
den siehe Prog. 2. Stufe

GEÖFFNET keine Auswirkung / schließt das Tor keine Auswirkung keine Auswirkung keine Auswirkung keine Auswirkung
(OPEN/CLOSE unterdrückt) (CLOSE unterdrückt) (OPEN/CLOSE unterdrückt)

IM SCHLIESSVORGANG öffnet das Tor / keine Auswirkung blockiert den Betrieb keine Auswirkung blockiert den Betrieb blockiert den Betrieb

BLOCKIERT öffnet das Tor / schließt das Tor keine Auswirkung keine Auswirkung keine Auswirkung keine Auswirkung
(OPEN/CLOSE unterdrückt) (OPEN unterdrückt) (CLOSE unterdrückt) (OPEN/CLOSE unterdrückt)
(1) :ährend des Teilöffnungszyklus wird das Tor durch einen OPEN-A-Impuls vollständig geöffnet.
(2) Beim Einschalten werden von der Karte die Eingänge überprüft, und wenn ein OPEN-A- bzw. ein OPEN-B-Befehl aktiv ist, öffnen sich der Flügel
bzw. das Tor, ansonsten werden sie geschlossen.
E721 20 532014 - Rev. D
ÍNDICE
1 ADVERTENCIAS ............................................................................................................................................... 2
2 ESQUEMA Y COMPONENTES........................................................................................................................... 2
2.1 DESCRIPCIÓN DE LOS COMPONENTES ..................................................................................................................... 3
2.2 DESCRIPCIÓN DEL TABLERO DE BORNES J13 ..........................................................................................................................3
3 CARACTERÍSTICAS TÉCNICAS ......................................................................................................................... 3
4 CONEXIONES ELÉCTRICAS ............................................................................................................................. 4
4.1 FOTOCÉLULAS A BUS-2EASY ....................................................................................................................................... 5
4.1.1 DIRECCIÓN DE LAS FOTOCÉLULAS A BUS-2EASY ..........................................................................................................5
4.1.2 MEMORIZACIÓN DE LOS ACCESORIOS BUS-2EASY ......................................................................................................5
4.2 FOTOCÉLULAS TRADICIONALES ................................................................................................................................. 6
4.3 CONEXIONES ENTRADA SAFE ...................................................................................................................... 7
5 PROGRAMACIÓN .......................................................................................................................................... 8
5.1 PROGRAMACIÓN DE 1° NIVEL .................................................................................................................................. 8
5.2 PROGRAMACIÓN DE 2° NIVEL ................................................................................................................................ 10
6 MEMORIZACIÓN CODIFICACIÓN RADIO ..................................................................................................... 12
6.1 MEMORIZACIÓN DE LOS RADIOMANDOS DS.......................................................................................................... 12
6.2 MEMORIZACIÓN DE LOS RADIOMANDOS SLH ....................................................................................................... 13
6.3 MEMORIZACIÓN DE LOS RADIOMANDOS LC/RC (SÓLO PARA ALGUNOS MERCADOS) .......................................... 13
6.3.1 MEMORIZACIÓN REMOTA DE LOS TELEMANDOS LC/RC .............................................................................................13
6.4 PROCEDIMIENTO DE ELIMINACIÓN DE LOS TELEMANDOS ..................................................................................... 13
7 PUESTA EN FUNCIONAMIENTO ..................................................................................................................... 14
7.1 COMPROBACIÓN DE LOS LED .................................................................................................................................. 14
7.2 FUNCIONAMIENTO CON BATERÍA .............................................................................................................. 14
7.3 COLOCACIÓN DE LOS FINALES DE RECORRIDO ..................................................................................................... 15
7.4 CONFIGURACIONES MASTER / SLAVE ...................................................................................................................... 16
7.4.1 CABLEADOS MASTER/SLAVE ....................................................................................................................................... 16
7.4.2 PROCEDIMIENTO DE SETUP MASTER/SLAVE ................................................................................................................ 16
7.5 SETUP ....................................................................................................................................................................... 17
8 PRUEBA DEL AUTOMATISMO .................................................................................................................... 17
9 SEÑALACIÓN DE ALARMAS Y ERRORES ........................................................................................................ 17
9.1 ALARMAS ................................................................................................................................................................. 17
9.2 ERRORES ................................................................................................................................................................. 17
10 LÓGICAS DE FUNCIONAMIENTO ................................................................................................................ 18

DECLARACIÓN CE DE CONFORMIDAD
Fabricante: FAAC S.p.A.
Dirección: Via Calari, 10 - 40069 Zola Predosa BOLONIA - ITALIA
Declara que: el equipo electrynico E721

‡ cumple con los requisitos esenciales de seguridad de las siguientes directivas CEE
ESPAÑOL
2006/95/CE Directiva Baja Tensiyn
2004/108/CE Directiva Compatibilidad Electromagnptica
Nota adicional:
Este producto se ha sometido a pruebas en una configuraciyn ttpica
homogpnea (todos los productos estin fabricados por FAAC S.p.A.).

Bolonia, 01-12-2011
El Administrador Delegado
A. Marcellan
ADVERTENCIAS
‡ £Atenciyn! Para la seguridad de las personas es sumamente importante seguir atentamente estas instrucciones.
‡ Una instalaciyn incorrecta o una utilizaciyn inadecuada del producto pueden causar graves daxos a las
personas.
‡ Lea detenidamente las instrucciones antes de empezar la instalaciyn del producto y guirdelas para futuras consultas.
‡ El stmbolo indica informaciyn importante para la seguridad de las personas y para la integridad del
automatismo.
‡ El stmbolo llama la atenciyn sobre las notas de las caractertsticas y del funcionamiento del producto.
E721 1 532014 - Rev. D
E721
1 ADVERTENCIAS
Desconecte la alimentación eléctrica antes de realizar cualquier intervención en la instalación
electrónica (conexiones, mantenimiento).

Coloque encima del equipo un interruptor magnetotérmico diferencial con un umbral de inter-
vención adecuado.

Conecte el cable de tierra al borne correspondiente.

Separe siempre los cables de alimentación de los de accio-


namiento y seguridad (pulsador, receptor, fotocélulas, etc.).
Para evitar interferencias eléctricas, utilice vainas separadas
o cable apantallado (con la pantalla conectada a masa).

2 ESQUEMA Y COMPONENTES

/ SAFE
/ SAFE

SENSOR
FINAL DE RECORRIDO
ESPAÑOL

Fig. 1

E721 2 532014 - Rev. D


2.1 DESCRIPCIÓN DE LOS COMPONENTES 3 CARACTERÍSTICAS TÉCNICAS
LCD PANTALLA DE SEfALACIÐN < P5OG5AMACIÐN Alimentación versiyn de 20V : 20 Va 50 Hz
versiyn de 115V : 115 Va 60 Hz
S:1 PULSADO5 DE P5OG5AMACIÐN “F”
Potencia
S:2 PULSADO5 DE P5OG5AMACIÐN “-” absorbida 10 :
por la red stand-by
S: PULSADO5 DE P5OG5AMACIÐN “+”
Carga máx. 10A
S:4 PULSADO5 DE “SETUP” del motor
LED LED DE CONT5OL DEL ESTADO DE ENT5ADAS Alimentación 24V=
accesorios
J1 CONECTO5 DE LA ALIMENTACIÐN P5IMA5IA Corriente máx. 24 V= mix. 500 mA
J2 CONECTO5 P5IMA5IO DEL T5ANSFO5MADO5 accesorios BUS-2EAS< mix. 500 mA
Temperatura (-20 - +55) °C
J CONECTO5 SECUNDA5IO DEL T5ANSFO5MADO5
ambiente
CONECTO5 DE LAS BATE5ÌAS DE EME5GENCIA Carga del testigo 24 V= - 15 :
J4
(ACCESO5IO) intermitente
J5 CONECTO5 DEL MOTO5 Carga de salida 24 V= - 100 mA (2)
J6 CONECTO5 DE SALIDA DEL TESTIGO INTE5MITENTE (24 V= - 15W) Fusibles de F1 =T1A - 250Va
protección
CONECTO5 DEL BLOQUE MOTO5 < CONTACTO
J9 Lógicas de Semiautomitica, Semiautomitica
DE DESBLOQUEO DEL MOTO5 funcionamiento “paso a paso“, Automitica, Automitica
J10 CONECTO5 DE SALIDA OUT “paso a paso”, Automitica con funciyn
temporizador, Automitica dispositivos
J11 CONECTO5 USB PA5A CONEXIÐN CON PC
de seguridad, Automitica dispositivos
J12 CONECTO5 PA5A CONEXIÐN CON DISPOSITIVOS BUS-2EAS< de seguridad “paso a paso“, Automitica
con inversiyn en pausa, Semiautomitica
J1 CONECTO5 DE ENT5ADAS AL TABLE5O DE BO5NES “b”, Lygica combinada “bC”, Hombre
J14 CONECTO5 DEL MÐDULO 5ECEPTO5 DE 5ADIO PA5A OMNIDEC presente.
Tiempo de tra- Programable (de 0 a 10 min)
LCD1 PANTALLA DE SEfALACIÐN < P5OG5AMACIÐN
bajo
F1 FUSIBLE DE P5OTECCIÐN Tiempo de pausa Programable (de 0 a 10 min)
2.2 DESCRIPCIÓN DEL TABLERO DE BORNES J13 OPEN A / OPEN B
Potencia del Programable en 50 niveles
N° ENTRADA DESCRIPCIÓN motor
1 OPEN A Dispositivo con contacto NA Velocidad del Programable en 10 niveles
que provoca la apertura motor de apertu-
total de la cancela ra-cierre
2-6 GND Negativo alimentaciyn Entradas/Salidas Alimentador, Baterta, Motor, Mydulo
accesorios al conector XF4/868, Batertas de desbloqueo elpctrico
3(1) OPEN B Dispositivo con contacto NA del bloque motor, Bloque Motor, USB
(DEFAULT) que provoca la apertura Entradas/Salidas BUS-2EAS<, OPEN A, OPEN B/CLOSE/
parcial de la cancela al tablero de SAFE, STOP/SAFE, GND, Fotocplulas de
bornes apertura y cierre, +24 V, Alimentaciyn
CLOSE Dispositivo con contacto N.A.
que cierra la cancela de red, Testigo intermitente, Desbloqueo
elpctrico bloque motor, OUT
SAFE Dispositivo con contacto
N.C. que invierte inmediata
y completamente el
ESPAÑOL
movimiento de la cancela
(1) Los tipos de uso de las entradas 3 y 4
4(1) STOP Dispositivo con contacto
pueden programarse configurando los
(DEFAULT) NC que provoca la parada correspondientes parámetros en el 2°
de la cancela nivel de programación (parámetro Ob
SAFE Dispositivo con contacto y SP). Para la exacta descripción sobre
N.C. que invierte inmediata el funcionamiento del automatismo en
y completamente el
movimiento de la cancela relación a las lógicas seleccionadas,
consulte las tablas incluidas al final
5 FS: OP Dispositivo con contacto de este manual (Párr. 10 - LÓGICAS DE
NC que provoca la FUNCIONAMIENTO).Por lo que respecta los
inversiyn del movimiento cableados que deben realizarse utilizando
durante la apertura estas entradas configuradas como SAFE,
de la cancela consulte los esquemas indicados en las
7 FS: CL Dispositivo con contacto Fig.13 y 14
NC que provoca la inver-
siyn del movimiento duran-
(2) La carga de la salida debe considerarse
te el cierre de la cancela
ya incluida en la corriente máx. disponible
para los accesorios
8 +24 V Positivo alimentaciyn
accesorios
E721 3 532014 - Rev. D
4 CONEXIONES ELÉCTRICAS
Los cableados indicados en la Fig. 2 se refieren a las entradas de la tarjeta con la configuración POR DEFECTO.

/ SAFE
/ SAFE

Para la conexiyn de
las fotocplulas y de los
dispositivos de seguridad,
remttase al pirrafo 4.2

230 V ~
115 V ~
=
CONTACTO
DE DESBLOQUEO
DEL MOTOR
(Bloquea el motor cuan-
do se acciona la mani-
= lla de desbloqueo del
motor)
Fig. 2

E721
E721 E721
E721

C720
C 72 C721
C 721
ESPAÑOL

Fig. 

A: Fotocplulas con intervenciyn en CIE55E


B: Fotocplulas con intervenciyn en APE5TU5A
C: Fotocplulas con intervenciyn en APE5TU5A y CIE55E

Fig. 4

E721 4 532014 - Rev. D


Antes de conectar las fotocplulas es necesario seleccionar Tab. 1 - Dirección de las fotocélulas BUS-2EASY
el tipo de funcionamiento seg~n la zona de movimiento
que deben proteger: Dip1 Dip2 Dip Dip4 5ef. Tipologta
Dispositivos de seguridad en cierre: intervienen ~nica- OFF OFF OFF OFF
mente durante el movimiento de cierre del automatis-
mo, por lo tanto, estin indicadas para proteger la zona OFF OFF OFF ON
de cierre del riesgo de impacto. OFF OFF ON OFF
B APE5TU5A
Dispositivos de seguridad en apertura: intervienen ~ni- Máx. 6 pares
OFF OFF ON ON
camente durante el movimiento de apertura del au-
tomatismo, por lo tanto, estin indicadas para proteger OFF ON ON OFF
la zona de apertura del riesgo de impacto. OFF ON ON ON
Dispositivos de seguridad en apertura/cierre: intervie-
nen durante el movimiento de apertura y de cierre ON OFF OFF OFF
del automatismo, por lo tanto, estin indicadas para ON OFF OFF ON
proteger toda la zona de movimiento del riesgo de
ON OFF ON OFF
impacto.
ON OFF ON ON A CIE55E
Máx. 7 pares
4.1 FOTOCÉLULAS A BUS-2EASY ON ON OFF OFF
Esta tarjeta dispone del circuito BUS-2EAS< que permite ON ON OFF ON
conectar ficilmente un n~mero elevado de dispositivos
BUS-2EAS< auxiliares al dispositivo de seguridad (por ej., ON ON ON OFF
hasta 16 pares de fotocplulas), programados correcta- OFF ON OFF OFF APE5TU5A y
mente y utilizando solamente dos cables sin polaridad. C CIE55E
OFF ON OFF ON Máx. 2 pares
Antes de conectar las fotocplulas es necesario seleccionar
el tipo de funcionamiento (Fig. 4) seg~n la zona de movi- ON ON ON ON / IMPULSO OPEN
miento que deben proteger y colocar los interruptores dip 4.1.2 MEMORIZACIÓN DE LOS ACCESORIOS
tanto en el transmisor como en el receptor (vpase Fig. 5)
de la manera indicada en la Tab. 1. BUS-2EASY
En cualquier momento se pueden axadir fotocplulas
Fig. 5
y accesorios BUS-2EAS< al equipo, simplemente realizando
DL1 = Alinea- las siguientes operaciones:
ción 1. Instale y programe los accesorios con la direcciyn
DL2 = Estado deseada (vpase apartado 4.1.1).
RX TX BUS-2EAS</Ali- 2. 5etire la alimentaciyn de la tarjeta.
DL1
DL2 mentación . Conecte los dos cables de los accesorios BUS-2EAS<
ON
DS1
ON
DS1 DS1 = Interrup- al tablero de bornes rojo J12 (polaridad indiferente).
1 2 3 4 1 2 3 4
tores Dip para 4. Proporcione alimentaciyn a la tarjeta.
DL2 la programa- 5. Pulse ripidamente y una sola vez el pulsador SETUP
ción
BUS BUS BUS BUS

(S:4) para memorizar los accesorios. Compruebe


RX - TX que los dispositivos a BUS-2EAS< instalados funcionen
correctamente.
6. La tarjeta ha memorizado los accesorios BUS-2EAS<.
Siga las indicaciones de la tabla siguiente para comprobar
que la conexiyn BUS-2EAS< esti en buenas condiciones.
4.1.1 DIRECCIÓN DE LAS FOTOCÉLULAS A BUS-2EASY El mismo procedimiento debe realizarse
ESPAÑOL
en una central MASTER también para la
Es importante dar al transmisor y al receptor la
adquisición de una central SLAVE conectada
misma dirección.
al BUS- 2EASY con conexión POLARIZADA
Asegúrese de que no haya dos o varios pares
Tab. 2 - Descripción LED BUS-2EASY
de fotocélulas con la misma dirección
Si no se utiliza ningún accesorio BUS-2EASY, deje Actividad normal (LED encendido incluso
Encendido
libre el conector BUS-2EASY (J12 - Fig. 1). sin fotocplulas). Ninguna fotocplula me-
fijo
morizada esti ocupada
Testigo in-
Al menos una fotocplula memorizada esti
termitente
ocupada o no alineada.
lento
Apagado
(luz cada Ltnea BUS-2EAS< en cortocircuito
2,5 s)
-Ltnea BUS-2EAS< desactivada (no sumini-
stra alimentaciyn)
Apagado
- Funcionamiento con baterta.
- Central programada como SLAVE
E721 5 532014 - Rev. D
4.2 FOTOCÉLULAS TRADICIONALES Conexión de un par de fotocplulas en cierre y
un par en apertura
Conexión 1 par de fotocplulas en cierre
con dispositivo de seguridad FAIL-SAFE activado
Configure en el segundo nivel de programación
o1 = 01

OUT

Otros dispositivos
de seguridad

OUT
OUT

Conexión 1 par de fotocplulas en cierre Fig. 8


con dispositivo de seguridad FAIL-SAFE y STOP desactivado
Conexión de dos pares de fotocplulas en cierre

Otros dispositivos
de seguridad

Fig. 6

En caso de que no se utilice el dispositivo de


seguridad FAIL-SAFE es necesario conectar la
alimentación de los transmisores a los bornes 6 y
8 de J13.
Utilizando el dispositivo de seguridad FAIL-SAFE
conecte la alimentación de los transmisores al
OUT después de configurarla correctamente Fig. 9
(véase la programación de 2° nivel y Fig. 6).
Conexión de un par de fotocplulas en cierre y
Utilizando el dispositivo de seguridad FAIL-SAFE las
entradas de seguridad que no se utilicen también un par en apertura/cierre
ESPAÑOL

se conectarán con el negativo de OUT (véase Fig. 6).

Conexión de un par de fotocplulas en apertura

Otros dispositivos
de seguridad

Fig. 7 Fig. 10
E721 6 532014 - Rev. D
Conexión de un par de fotocplulas en cierre, Ning~n dispositivo de seguridad y parada conectado
un par en apertura y un par en apertura/cierre

Fig. 12

Fig. 11

4.3 CONEXIONES ENTRADA SAFE


Si se activa el dispositivo de seguridad Fail Safe (parámetro configurable en el 2° nivel de programación),
el negativo que debe utilizarse para la gestión de la entrada SAFE deberá ser el - OUT (véase Fig. 13).
Conexión de un dispositivo de seguridad (otros dispositivos de seguridad) a la entrada SAFE con función FAIL SAFE activada
Programando: 2° nivel o 1=01 (FAIL SAFE ACTIVADO) Programando: 2° nivel o 1=01 (FAIL SAFE ACTIVADO)
2° nivel SP=01 (ENT5ADA 4 = BO5DE DE SEGU5IDAD) 2° nivel Ob=02 (ENT5ADA  = BO5DE DE SEGU5IDAD)
Otros dispositivos de
Otros dispositivos de seguridad
seguridad OPEN A OPEN A
GND GND
OPEN B / CLOSE - OUT SAFE / OPEN B / CLOSE
- OUT SAFE / STOP STOP
FSW OP FSW OP
GND GND
FSW CL FSW CL
+24V +24V Fig. 1

Si se desactiva el dispositivo de seguridad Fail Safe (parámetro configurable en el 2° nivel de programación),


ESPAÑOL
el negativo que debe utilizarse para la gestión de la entrada SAFE deberá ser el -  (véase Fig. 14).
Conexión de un dispositivo de seguridad (otros dispositivos de seguridad) a la entrada SAFE con función FAIL SAFE desactivada

Programando: 2° nivel o 1=00 (FAIL SAFE DESACTIVADO) Programando: 2° nivel o 1=00 (FAIL SAFE DESACTIVADO)
2° nivel SP=01 (ENT5ADA 4 = BO5DE DE SEGU5IDAD) 2° nivel Ob=02 (ENT5ADA  =BO5DE DE SEGU5IDAD)
Otros dispositivos de
Otros dispositivos de seguridad
seguridad OPEN A
GND OPEN A
OPEN B / CLOSE GND
SAFE / STOP - SAFE / OPEN B / CLOSE
- FSW OP STOP
GND FSW OP
FSW CL GND
+24V FSW CL
+24V Fig. 14

Si no se utilizan dispositivos con contacto N.C. (Otros dispositivos de seguridad) la entrada SAFE deberá
puentearse con el -OUT con FAIL SAFE activado, o con el GND con FAIL SAFE desactivado.
E721 7 532014 - Rev. D
5 PROGRAMACIÓN La modificación de los parámetros de
programación es eficaz tan pronto como
Para programar el funcionamiento del automatismo es
se ejecuta, mientras que la memorización
necesario acceder a la modalidad “P5OG5AMACIÐN”. definitiva sólo tiene lugar cuando se sale
La programación se divide en dos partes: 1° NIVEL, 2° NIVEL. de la programación y se regresa a la
Normalmente en la pantalla se muestra visualización del estado de las entradas.
el estado del automatismo. Pulsando Si se quita la alimentación al equipo antes
el pulsador F o pulsando a la vez F y de regresar a la visualización del estado
+ se accede respectivamente a la de las entradas, todas las modificaciones
programación de 1° o de 2° nivel. Durante realizadas se perderán.
el funcionamiento con batería el display Se puede volver a la vista del estado de las
está apagado. Presione brevemente
la tecla + para visualizar el estado del entradas, y memorizar todos los parámetros
automatismo. modificados hasta aquel momento, desde
cualquier punto de la programación de 1° y
Para restablecer las configuraciones 2° nivel pulsando a la vez los pulsadores F y -.
predeterminadas basta con recargar la
configuración predeterminada deseada en el Cuando se encienda la tarjeta en la pantalla
primer paso de la programación de 1° nivel. LCD1 aparecerá durante unos segundos la
versión del software de la tarjeta con dos
5.1 PROGRAMACIÓN DE 1° NIVEL cifras separadas por un punto decimal.
Para acceder a la programación de 1° nivel es necesario pulsar el pulsador F.
‡ Si se presiona y mantiene presionada la tecla F en el display aparece el nombre de la función.
‡ Soltando el pulsador, la pantalla muestra el valor de la función, que puede modificarse con los pulsadores + y -.
‡ Volviendo a pulsar F (y mantenipndola pulsada) la pantalla muestra el nombre de la función siguiente, etc.
‡ Al llegar a la ~ltima función, la presión del pulsador F provoca la salida de la programación y la memorización de
los parimetros. La pantalla vuelve a mostrar el estado del automatismo.

PROGRAMACIÓN DE 1° NIVEL
Valor
Panta- predeter-
Función
lla
minado 1
VALOR PREDETERMINADO:
dF 1 Configura los parimetros con valores de DEFAULT.
1
CU Si al soltar el pulsador F aparece el valor CU significa que se ha seleccionado la
configuración estindar a travps de los pulsadores y la pantalla. Si desea mantener
esta programación, vuelva a pulsar el pulsador F , de lo contrario, pulse + y selec-
cione el default 1 .
CONFIGURACIÓN MASTER/SLAVE
Ct MA Configura la tarjeta en modo MASTER
MA
SL Configura la tarjeta en modo SLAVE
Configurando la tarjeta en modo SLAVE no se visualizarán los parámetros
LO-PA-Pb-Ph-Op (para funcionamiento Master/Slave véase el párrafo 7.4.)
LÓGICAS DE FUNCIONAMIENTO:
LO E Semiautomitica E
EP
ESPAÑOL

Semiautomitica “Paso a paso”


A Automitica
A1 Automitica1
AP Automitica “Paso a paso”
At Automitica con función temporizador.
S Automitica “Dispositivos de seguridad”
SP Automitica “Dispositivos de seguridad paso a paso”
SA Automitica con inversión en pausa
b Semiautomitica “b”
bC Combinada (AP de impulso/ CH con persona presente)
C Persona presente
Parámetro no visualizado en modo SLAVE
TIEMPO DE PAUSA A:
PA El tiempo de pausa frente a un accionamiento de apertura TOTAL. Solamente tiene efecto si se ha
20
seleccionado una lógica automitica. 5egulable de 0 a 59 segundos en pasos de un segundo.
A continuación, la visualización cambia en minutos y decenas de segundo (separados por un punto) y
el tiempo se regula en pasos de 10 segundos hasta un valor miximo de 9.5 minutos.
EJ.: si la pantalla indica 2.5, el tiempo de pausa corresponde a 2 minutos y 50 segundos
Parámetro no visualizado en modo SLAVE

E721 8 532014 - Rev. D


Valor
Panta- predeter-
Función
lla
minado 1
TIEMPO DE PAUSA B:
Pb El tiempo de pausa frente a un accionamiento de apertura PARCIAL. Solamente tiene 20
efecto si se ha seleccionado una lógica automitica. 5egulable de 0 a 59 segundos en
pasos de un segundo.
A continuación, la visualización cambia en minutos y decenas de segundo (separados por un
punto) y el tiempo se regula en pasos de 10 segundos hasta un valor miximo de 9.5 minutos.
EJ.: si la pantalla indica 2.5 , el tiempo de pausa corresponde a 2 minutos y 50 segundos
Parametro non visualizzato in modalità SLAVE
POTENCIA DEL MOTOR:
FO Ajusta el nivel de la potencia del motor.
50
01 = potencia mtnima
50 = potencia mixima
En función del valor de la potencia es recomendable realizar un nuevo
SETUP (véase apartado 7.3)
VELOCIDAD DE APERTURA:
So Ajuste en 10 niveles la velocidad de apertura del motor.
08
01 = velocidad mtnima
10 = velocidad mixima
En función del valor de la velocidad es recomendable realizar un nuevo
SETUP (véase apartado 7.3)
VELOCIDAD DE CIERRE:
Sc Ajuste en 10 niveles la velocidad de cierre del motor.
08
01 = velocidad mtnima
10 = velocidad mixima
En función del valor de la velocidad es recomendable realizar un nuevo
SETUP (véase apartado 7.3)
DESACELERACIÓN DURANTE LA APERTURA:
ro 5egula el espacio de desaceleración como el porcentaje del recorrido total de la cancela.
20
5egulable de 5 (con velocidad < 5), 10 (con velocidad entre 5 y 8), 15 (con velocidad
> 8) a 99 % en pasos del 1%.
5-10-15 = desaceleración mtnima
99 = desaceleración mixima
DESACELERACIÓN DURANTE EL CIERRE:
rc 5egula el espacio de desaceleración como el porcentaje del recorrido total de la cancela.
20
5egulable de 5 (con velocidad < 5), 10 (con velocidad entre 5 y 8), 15 (con velocidad
> 8) a 99 % en pasos del 1%.
5-10-15 = desaceleración mtnima
99 = desaceleración mixima
ESPAÑOL

VELOCIDAD DURANTE LA DESACELERACIÓN:


Sr 5egula la velocidad de la cancela durante la desaceleración.
0
0 = velocidad BAJA
1 = velocidad ALTA
ESTADO DEL AUTOMATISMO:
St Salida de la programación, memorización de los datos y vuelta a la visualización del estado del auto-
matismo.

00 = CE55ADO 07 = FAIL SAFE en curso


01 = ABIE5TO 08 = comprobación de los dispositivos
02 = Parado, despups “AB5I5” BUS-2EAS< en curso
03 = Parado, despups “CE55A5” 09 = Parpadeo previo, despups “AB5I5”
04 = En “PAUSA” 09 = Parpadeo previo, despups “CE55A5”
05 = En fase de apertura 11 = ABIE5TO en Apertura parcial
06 = En fase de cierre 12 = En PAUSA Apertura parcial

E721 9 532014 - Rev. D


5.2 PROGRAMACIÓN DE 2° NIVEL
Para acceder a la P5OG5AMACIÐN DE 2° NIVEL pulse el pulsador F y, mantenipndolo pulsado, pulse el pulsador +:
‡ soltando el pulsador F, la pantalla muestra el valor de la función, que puede modificarse con los pulsadores + y -.
‡ soltando el pulsador F (y mantenipndola pulsada) la pantalla muestra el nombre de la función siguiente, soltin-
dola aparece el valor que puede modificarse con los pulsadores + y -.
‡ al llegar a la ~ltima función, la presión del pulsador F provoca la salida de la programación y la pantalla vuelve
a mostrar el estado del automatismo.

PROGRAMACIÓN DE 2° NIVEL

Valor
Panta-
Función predeter-
lla
minado 1
POTENCIA MÁXIMA EN EL MOMENTO DEL ARRANQUE:
bo El motor trabaja con la mixima potencia (ignorando el nivel de potencia seleccionado)
no
durante el momento del arranque.
Y = activo
no = excluido
PARPADEO PREVIO:
PF Permite seleccionar 5 tipos de parpadeo previo, con una duración de  segundos.
no
no = ninguno parpadeo previo.
OC = parpadeo previo antes de cualquier movimiento.
CL = parpadeo previo antes de cualquier movimiento durante el cierre.
OP = parpadeo previo antes de cualquier movimiento durante la apertura.
PA = parpadeo previo sólo al final de la pausa
TIEMPO DE PARPADEO PREVIO (visible sólo si se ha seleccionado un parpadeo previo en
tP el menú anterior): 03
5egula el tiempo de parpadeo previo de 1 a 10 segundos en pasos de 1 segundo.
01 = parpadeo previo mtnimo
10 = parpadeo previo miximo
FOTOCÉLULAS EN CIERRE:
Ph Active la función si desea que las fotocplulas de cierre bloqueen el movimiento y lo inviertan
no
para liberarlo. Normalmente, con esta función excluida, la intervención de las fotocplulas
de cierre determina una inversión inmediata de la cancela.
Y = inversión para liberación
no = inversión inmediata durante la apertura
Parámetro no visualizado en modo SLAVE
FOTOCÉLULAS EN APERTURA:
oP Active la función si desea que las fotocplulas de apertura bloqueen el movimiento y lo no
inviertan durante el cierre. Normalmente, con esta función excluida, la intervención de las
fotocplulas de apertura determina la recuperación del movimiento durante su liberación.
Y = inversión inmediata durante el cierre
n o = recuperación del movimiento durante la liberación
ESPAÑOL

Parámetro no visualizado en modo SLAVE


FUNCIÓN ADMAP:
Ad Permite activar el funcionamiento de acuerdo con la normativa francesa NFP 25/62.
no
Y = activo
n o = excluido
ENCODER:
EC El encoder “virtual“ presente en la tarjeta funciona como dispositivo antiaplastamiento y
02
gestiona los puntos de inicio de desaceleración y de apertura parcial.
En el caso de la cancela, durante la fase de apertura o cierre, golpes contra un obsticulo,
el encoder “virtual“ provoca la inversión del movimiento. El segundo obsticulo detectado en
la misma dirección provoca la parada del motor. En ambos casos se acciona una alarma
(vpase apartado Alarmas)
Es necesario regular la sensibilidad del encoder “virtual“ modificando el tiempo que la tarjeta
espera antes de accionar la inversión del movimiento desde un mtnimo de 0 segundos a
un miximo de 10 segundos en pasos de un segundo.
00 = mixima sensibilidad
10 = mtnima sensibilidad
E721 10 532014 - Rev. D
Valor
Panta- predeter-
Función
lla
minado 1
APERTURA PARCIAL:
PO Se puede regular la amplitud de la apertura parcial de la hoja como el porcentaje del re- 50
corrido total de la cancela.
5egulable de 0 a 99 % en pasos de 1%.
00 = ninguna apertura parcial
01 = apertura parcial mtnima
99 = apertura parcial mixima
TIEMPO DE TRABAJO (time-out):
t Es necesario configurar un valor superior al tiempo necesario para que la cancela se abra 2.0
y se cierra por completo.
5egulable de 0 a 59 segundos en pasos de 1 segundo. A continuación, la visualización
cambia en minutos y decenas de segundo (separados por un punto) y el tiempo se regula
en pasos de 10 segundos hasta un valor miximo de 9.5 minutos.
EJ.: si la pantalla indica 2.5 , el tiempo de pausa corresponde a 2 minutos y 50 segundos
En caso de equipo con configuración MASTER/SLAVE será necesario programar
un TIEMPO de TRABAJO en la central MASTER que tenga en cuenta los tiempos de
movimiento de ambas hojas.
OUT 1:
o1 Permite configurar la salida OUT (open collector NA) activa en una de las siguientes funciones: 00
00 = Siempre activa (suministra tensión 24V= con absorción mixima de 100 mA)
01 =FAIL-SAFE (Verifica el correcto funcionamiento de las fotocplulas tradicionales conectadas)
02 = LUZ TESTIGO (apagada cuando esti cerrada, encendida en fase de apertura y apertura/pausa, parpadea durante el cierre)
03 = LUZ DE CO5TESÌA (vpase la siguiente función)
04 = ALA5MA funcionamiento en BATE5ÌA
05 = cancela ABIE5TA o en PAUSA
06 = cancela CE55ADA
07 = cancela en MOVIMIENTO
08 = cancela en APE5TU5A
09 = cancela en CIE55E
1 0 = dispositivo de seguridad ACTIVO
1 1 = salida temporizada que puede activarse desde el segundo canal de radio (vpase la siguiente función)
1 2 = salida que puede activarse desde el segundo canal de radio (función paso a paso)
TEMPORIZACIÓN OUT 1 (visible sólo si en el paso anterior se ha seleccionado la opción
t1 03 o 11 ): 02
Permite regular la temporización de la salida OUT en caso de que se haya seleccionado una
función temporal (como, por ejemplo, 03 o 11) de 1 a 99 minutos en pasos de 1 minuto
OPEN B / CLOSE/SEGURIDAD “BORDE”:
Ob Se puede seleccionar el uso de la entrada OPEN B como apertura parcial, accionamiento 00
de CLOSE o SEGU5IDAD “BO5DE”.
00 = OPEN B
01 = CLOSE
02 = BO5DE DE SEGU5IDAD (contacto N.C.)
En caso de que se seleccione una lógica de funcionamiento que prevea la
ESPAÑOL
utilización del accionamiento de CLOSE (lógica b, bC, C) esta función se pre-
configurará en 01 y no podrá modificarse.
STOP / SEGURIDAD “BORDE”:
SP Se puede seleccionar el uso de la entrada STOP como STOP o SEGU5IDAD “BO5DE”.
00
00 = STOP
01 = BO5DE DE SEGU5IDAD (contacto N.C.)
INVERSIÓN PARCIAL:
IP Se puede seleccionar el tipo de inversión (completa o parcial) despups de encontrarse con no
un obsticulo o despups de la activación del borde de seguridad.
Y = Activación inversión parcial. Despups de un obsticulo o de la activación del borde
de seguridad la hoja invierte el movimiento durante unos 2” y luego se detiene
no = Desactivación inversión parcial. Despups de un obsticulo o de la activación del borde de seguridad,
la hoja invierte completamente el movimiento y se sit~a en posición de abierto o cerrado
BLOQUE MOTOR:
Lc Se puede seleccionar el uso del bloque motor durante el funcionamiento con baterta: Y
Y = el bloque motor sigue funcionando normalmente durante el funcionamiento con
baterta.
n o = cuando se pasa al funcionamiento con baterta el bloque motor permanece
siempre abierto.
E721 11 532014 - Rev. D
Valor
Panta- predeter-
Función
lla
minado 1
ASISTENCIA SOLICITADA - CONTADOR DE CICLOS (combinada con las dos funciones siguientes):
AS Y = cuando se alcanza el n~mero de ciclos configurado con las funciones siguientes nc y nd realiza
no
un parpadeo previo de 8 segundos (ademis del que pueda haberse configurado con la función
PF) antes de cualquier movimiento.
no = las funciones siguientes nc y nd indican cuintos ciclos ha realizado el equipo hasta un miximo
visualizable de 99Ü990.
6LHOQ~PHURGHFLFORVHVVXSHULRUDÜODVGRVIXQFLRQHVVLJXLHQWHV nc y nd
mostrarán 99 y 99 respectivamente.
Esta función puede ser ~til para configurar intervenciones de mantenimiento programado o para com-
probar los ciclos de trabajos realizados.
PROGRAMACIÓN DE CICLOS (MILLARES):
nc Si AS = Y la pantalla indica el n~mero de millares de ciclos despups del cual se solicita la asistencia
00
(puede configurarse de 0 a 99).
Si AS = no la pantalla indica el n~mero de millares de ciclos realizados. El valor visualizado se actualiza
cada vez que se realiza un ciclo, interactuando con el valor de nd.
Si AS = no pulsando los pulsadores + y - durante 5 segundos se pone a cero el
contador de ciclos.
PROGRAMACIÓN DE CICLOS (DECENAS):
nd Si AS = Y la pantalla indica el n~mero de decenas de ciclos despups del cual se solicita la asistencia
00
(puede configurarse de 0 a 99).
Si AS = no la pantalla indica el n~mero de decenas de ciclos realizados. El valor visualizado se actualiza
cada vez que se realiza un ciclo, interactuando con el valor de nc.
(MHPSORVLHOHTXLSRKDUHDOL]DGRÜDSDUHFHUinc = 11 y nd = 21

ESTADO DEL AUTOMATISMO:


St Salida de la programación, memorización de los datos y vuelta a la visualización del estado del automatismo.
00 = CE55ADO 07 = FAIL SAFE en curso
01 = ABIE5TO 08 = comprobación de los dispositivos BUS-2EAS< en curso
02 = Parado, despups “AB5I5” 09 = Parpadeo previo, despups “AB5I5”
03 = Parado, despups “CE55A5” 09 = Parpadeo previo, despups “CE55A5”
04 = En “PAUSA” 11 = ABIE5TO en Apertura parcial
05 = En fase de apertura 12 = En PAUSA Apertura parcial
06 = En fase de cierre

6 MEMORIZACIÓN CODIFICACIÓN RADIO


El equipo electrónico 6.1 MEMORIZACIÓN DE LOS RADIOMANDOS DS
dispone de un sistema Fig. 15 Puede memorizarse un máx. de 256 códigos
de descodificación divididos entre OPEN A y OPEN B/CLOSE.
(DS, SLH, LC/5C) de
dos canales integrado 1. En el radiomando DS seleccione la combinación ON
llamado OMNIDEC.  - OFF deseada de los 12 interruptores dip.
ESPAÑOL

Este sistema permite 2. Mantenga pulsado el pulsador + (S:) o - (S:2) y,


memorizar a travps de a continuación, pulse el pulsador SETUP (S:4) para
un módulo receptor
memorizar la apertura total (OPEN A) o la parcial
adicional (Fig. 15 ref.
) y radiomandos con la misma frecuencia, tanto en (OPEN B/CLOSE) respectivamente. El LED correspon-
caso de apertura total (OPEN A) como de apertura parcial diente empezari a parpadear lentamente durante
(OPEN B) del automatismo. 5 segundos
Los 3 tipos de codificación de la radio (DS, SLH, . Suelte los dos pulsadores.
LC/RC) pueden coexistir simultáneamente 4. Durante estos 5 segundos, pulse el pulsador deseado
en los dos canales. Pueden introducirse en el radiomando.
hasta 256 códigos de radio divididos entre 5. El LED correspondiente se encenderi fijo durante 1
OPEN A y OPEN B. segundo y, a continuación, se apagari indicando
Para utilizar diferentes sistemas de que se ha memorizado.
codificación en el mismo canal es necesario 6. Para axadir otros códigos diferentes al que acaba de
finalizar el aprendizaje de cada sistema y, a
memorizar repita el procedimiento desde el punto 1.
continuación, repetir el procedimiento para
el otro.
No conecte ningún dispositivo radio en
equipos configurados como SLAVE.

E721 12 532014 - Rev. D


7. Para utilizar radiomandos con el mismo código es 6.3 MEMORIZACIÓN DE LOS RADIOMANDOS LC/RC
necesario copiar la misma combinación ON - OFF
en los demis radiomandos, sin necesidad de realizar Puede memorizarse un máx. de 256 códigos
ninguna modificación en la tarjeta de control. divididos entre OPEN A y OPEN B/CLOSE.

Utilice los radiomandos LC/RC solamente


6.2 MEMORIZACIÓN DE LOS RADIOMANDOS SLH con un módulo receptor a 433 MHz.
Puede memorizarse un máx. de 256 códigos 1. Mantenga pulsado el pulsador + (S:) o - (S:2) y,
divididos entre OPEN A y OPEN B/CLOSE. a continuación, pulse el pulsador SETUP (S:4) para
1. En el radiomando SLH, pulse y mantenga pulsados memorizar la apertura total (OPEN A) o la parcial
(OPEN B/CLOSE) respectivamente. El LED correspon-
los pulsadores P1 y P2 simultineamente.
diente empezari a parpadear lentamente durante
2. El LED del radiomando empezari a parpadear. 5 segundos
. Suelte los dos pulsadores. 2. Suelte el pulsador.
4. Mantenga pulsado el pulsador + (S:) o - (S:2) y, . Durante estos 5 segundos, pulse el pulsador deseado
a continuación, pulse el pulsador SETUP (S:4) para en el radiomando LC/5C.
memorizar la apertura total (OPEN A) o la parcial 4. El LED se encenderi con luz fija durante 1 segundo,
(OPEN B/CLOSE) respectivamente. El LED correspon- indicando que se ha realizado la memorización y,
diente empezari a parpadear lentamente durante a continuación, volveri a parpadear durante 5 se-
5 segundos gundos, durante los cuales podri memorizarse otro
5. Suelte los dos pulsadores. radiomando.
5. Transcurridos los 5 segundos, el LED se apaga indican-
6. Durante estos 5 segundos, mientras el LED del radio-
do el final del procedimiento.
mando sigue parpadeando, pulse y mantenga pul-
sado el pulsador deseado en el radiomando (el LED 6.3.1 MEMORIZACIÓN REMOTA DE LOS
del radiomando se encenderi con luz fija).
RADIOMANDOS LC/RC
7. El LED de la tarjeta se encenderi con luz fijo durante Con radiomandos LC/5C se pueden memorizar otros
2 segundos y, a continuación, se apagari indicando radiomandos en modo remoto, es decir, sin intervenir
que se ha realizado la memorización. directamente en la tarjeta, utilizando un radiomando
8. Suelte el pulsador del radiomando. previamente memorizado.
9. Pulse 2 veces, con un breve intervalo de tiempo, el 1. Consiga un radiomando ya memorizado en uno de
pulsador del radiomando memorizado. los 2 canales (OPEN A o OPEN B/CLOSE).
2. Pulse y mantenga pulsados los pulsadores P1 y P2 a
El automatismo realizará una apertura. Ase- la vez, hasta que los dos LED empiecen a parpadear
gúrese de que en el automatismo no haya lentamente durante 5 segundos.
ningún obstáculo creado por personas u . Durante 5 segundos, pulse el pulsador previamente
objetos. memorizado del radiomando para activar la fase de
Para habilitar otros radiomandos con el mismo código aprendizaje en el canal seleccionado.
del equipo es necesario transmitir el código del equipo 4. El LED en la tarjeta correspondiente al canal en apren-
del pulsador del radiomando memorizado en el pulsador dizaje parpadea durante 5 segundos, durante los cua-
les debe transmitirse el código de otro radiomando.
correspondiente de los radiomandos que desea axadir,
5. El LED se enciende con luz fija durante 1 segundo,
siguiendo el procedimiento siguiente:
indicando que se ha realizado la memorización y, a
a. en el radiomando memorizado, pulse y man- continuación, vuelve a parpadear durante 5 segun-
tenga pulsados los pulsadores P1 y P2 simulti- dos, durante los cuales pueden memorizarse otros
neamente. radiomandos, y al final se apaga.
b. El LED del radiomando empezari a parpadear.
6.4 PROCEDIMIENTO DE ELIMINACIÓN DE
ESPAÑOL
c. Suelte los dos pulsadores.
d. Pulse el pulsador memorizado y mantpngalo LOS RADIOMANDOS
pulsado (el LED del radiomando se encenderi Para eliminar TODOS los códigos de los radiomandos
con luz fija). registrados basta con mantener pulsados los dos pulsa-
dores + (S:) y - (S:2) y, a continuación, pulsar durante
e. Acerque los radiomandos, pulse y mantenga
un segundo el pulsador SETUP (S:4) y mantener pulsados
pulsado el pulsador correspondiente del radio- los primeros dos pulsadores durante 10 segundos.
mando que desea axadir, soltindolo despups ‡ Los 2 LED 5ADIO1 y 5ADIO2 parpadean ripidamente
del doble parpadeo del LED del radiomando durante los 10 segundos.
que indica que se ha realizado la memorización. ‡ Los 2 LED se encenderin con luz fija durante 2 se-
f. Pulse 2 veces, con un breve intervalo de tiempo, gundos y, a continuación, se apagan (eliminación
el pulsador del radiomando memorizado. realizada).
‡ Suelte los dos pulsadores.
El automatismo realizará una apertura.
Asegúrese de que en el automatismo no Esta operación NO es reversible. Se elimina-
haya ningún obstáculo creado por perso- rán todos los códigos de los radiomandos
nas u objetos. memorizados como OPEN A o como OPEN
B/CLOSE.

E721 13 532014 - Rev. D


7 PUESTA EN FUNCIONAMIENTO
7.1 COMPROBACIÓN DE LOS LED
Una vez se han realizado todas las conexiones y proporcionado alimentación a la tarjeta, compruebe con la tabla
siguiente el estado de los LED en relación con el estado de las entradas (en la Fig. 16, el automatismo se muestra
en un estado cerrado en reposo). Estos LED indican el estado de las entradas de la tarjeta y son muy importantes
para que el automatismo se mueva correctamente:
Es importante recordar que: LED ENCENDIDO = contacto cerrado LED APAGADO = contacto abierto

< (1) F
BUS 2EASY
< (2)
< OPEN A -
< GND
< OPEN B / CLOSE < SAFE
+

R
A
C

1
RADIO XF

R
2
IO

E
FC
FC

IO

O
< STOP / SAFE

W
R
D

O
R
A

P
R
< FSW OP

R
SETUP
< GND
< FSW CL
< +24

USB

BATTERY
RELEASE
Y
R
)

R
F

OUT
-L

E
S

S
E IN

TO
R M

K
K
K
T
-N

N
T EC

C
T
T RI

C
C
(P A

- +
A

LO
LA

LO
LO
M

R
P

M
B
<

<

<

<

<

<

<
<
<

Fig. 16

Los LED FCA y FCC representan los contactos NC del final Las entradas STOP (SAFE), FSW CL, FSW
de carrera integrado en la tarjeta que, si estin ocupados, OP, OPEN B configurada como SAFE son
se abren apagando el LED correspondiente: entradas de seguridad con contacto N.C.
(Normalmente Cerrado) y, por lo tanto,
los correspondientes diodos deben estar
Automatismo FCA
ENCENDIDOS en condición de automatismo
CE55ADO en reposo, y se apagarán cuando se ocupe
FCC FCC ocupado
el dispositivo conectado.
FCA FCA ocupado Las entradas OPEN A, OPEN B/CLOSE son
Automatismo ABIE5TO
entradas con contacto N.A. (Normalmente
FCC
Abierto) y, por lo tanto, los correspondientes
diodos deben estar APAGADOS en condición
Tab. 3 - Descripción LED POWER de automatismo en reposo, y se encenderán
cuando se ocupe el dispositivo conectado.
ESPAÑOL

Encendido Si el equipo estuviera programado como


Alimentación de red presente
fijo SLAVE, los diodos correspondientes a la
Parpa- regleta de bornes J13 deben estar apagados.
Alimentación con baterta
deante
LED ERROR parpadeante indica alarma
en curso (situación que no afecta al
Apagado Tarjeta apagada funcionamiento de la cancela).

LED ERROR encendido fijo indica error


en curso (situación que bloquea el
funcionamiento hasta la eliminación de
7.2 FUNCIONAMIENTO CON BATERÍA la causa del error).

ATENCIÓN
Para optimizar los consumos y salvaguardar la carga, durante el funcionamiento con baterta, con el automatismo parado
y el sistema en stand-by, el display LCD1, el diodo BUS 2easy y los diodos FCC y FCA estin apagados, mientras que el
diodo PO:E5 destella.
En esta fase se puede visualizar el estado del automatismo. Para ello es suficiente presionar brevemente la tecla + presente
en la tarjeta. Despups de haber presionado esta tecla, el display LCD1 muestra durante unos 2 segundos el estado del
automatismo, para luego apagarse otra vez. Sin embargo, durante un movimiento normal, todos los diodos de diagnóstico
y las sexalizaciones del display vuelven a ser coherentes con el estado del automatismo (vpase Fig. 16).
E721 14 532014 - Rev. D
7.3 COLOCACIÓN DE LOS FINALES DE RECORRIDO
Para colocar correctamente los imanes de final de carrera, es necesario que la central de control
esté instalada y conectada correctamente con todos los accesorios de control y seguridad.
El operador dispone de un sensor magnptico de final de carrera, directamente integrado en la tarjeta electrónica de control.
La parada de la cancela, al abrirse o cerrarse, se produce en el momento en el que el imin polarizado, fijado en
la parte superior de la cremallera, activa el sensor.

1. Compruebe que el operador se haya preparado para el funcionamiento manual, de la


manera indicada en las instrucciones del operador.
2. Ponga manualmente la cancela en posición de apertura dejando 40 mm con respecto
al tope mecinico de final de carrera (vpase Fig. 17).
. Coloque en la cremallera el imin con la parte REDONDA en la dirección del motor.

A
C

R O1

2
FC
FC

IO
I
Cuando el LED que corresponde al final de carrera FCA presente en la tarjeta se apaga,

R
A

E
R
ftjelo con los tornillos correspondientes.
4. Ponga manualmente la cancela en posición de cierre dejando 40 mm con respecto
al tope mecinico de final de carrera.
5. Coloque en la cremallera el imin con la parte CUADRADA en la dirección del motor.
Cuando el LED que corresponde al final de carrera FCC presente en la tarjeta se apaga,
ftjelo con los tornillos correspondientes.

A
C

R O1

2
FC
FC

IO
6. Compruebe que al final de la maniobra, tanto en apertura como en cierre, el LED del

I
D

R
A
final de carrera correspondiente se apague correctamente y, si es necesario, aporte las

E
R
modificaciones oportunas a la posición de los imanes de final de carrera.
Para evitar que se produzcan daños en el operador y/o interrupciones del
funcionamiento del automatismo es necesario dejar unos 40 mm de distancia
de los topes mecánicos de final de carrera.

Para un funcionamiento
correcto del operador.
el imán que representa
la parte REDONDA debe
utilizarse como final de
carrera de APERTURA y
el imán con la parte
CUADRADA debe
utilizarse como final
de carrera de CIERRE
(VÉASE FIG. 17)
Si el equipo está
configurado MASTER/
SLAVE, los imanes de
los finales de carrera
deben estar instalados
como se muestra en la
Fig. 18.
ESPAÑOL

Fig. 17

MASTER/SLAVE

Fig. 18

E721 15 532014 - Rev. D


7.4 CONFIGURACIONES MASTER / SLAVE
Si fuera necesario realizar un equipo con hojas contrapuestas que se han de accionar simultineamente
para la apertura y el cierre de la vta, se pueden conectar y configurar dos equipos E721 en modo Master/Slave.
El equipo MASTE5 (parimetro C t del primer nivel de programación configurado como M A ) deberi tener todas
las conexiones necesarias para el correcto funcionamiento del equipo (fotocplulas, dispositivos de seguridad, radio,
impulsos de apertura, destellador), mientras que el equipo SLAVE (parimetro C t del primer nivel de programación
configurado como S L ), no deberi tener ning~n tipo de cableado en la regleta de bornes J1, dado que se ignoran
por completo las entradas presentes. Los dos equipos se comunicarin entre st por medio del BUS-2EAS< a travps de
un cableado de dos polos POLARIZADO en la regleta de bornes J12.
El equipo MASTE5 controlari completamente el equipo SLAVE por medio del BUS-2EAS< y gestionari todos los
movimientos y los tiempos de ambas hojas.

Evite cualquier tipo de conexión y cableado en la regleta de bornes J13 de la central SLAVE

La conexión BUS entre las dos tarjetas deberá ser POLARIZADA respetando la secuencia de los
polos de la regleta de bornes J12 (POLO (1) - POLO (2)) - (véase la Fig. 19).

Al configurar una central como SLAVE se fuerzan los valores de algunos parámetros de
programación que ya no se visualizan en el menú (LO-PA-Pb-Ph-Op). Si se vuelve a poner
la tarjeta en modo MASTER, estos valores, forzados anteriormente, se mantienen dentro de la
programación.
7.4.1 CABLEADOS MASTER/SLAVE

(1) (1)
BUS 2 EASY BUS 2 EASY
(2) (2)
Evite cualquier tipo de
conexión y cableado
en la regleta de
bornes J1 de la
central SLAVE

E721 MASTER E721 SLAVE


Fig. 19

7.4.2 PROCEDIMIENTO DE SETUP MASTER/SLAVE

La petición de realizar el SETUP, indicada por el destello de la sigla S0 en la pantalla, puede


aparecer tanto en la central MASTER como en la central SLAVE. En el segundo caso, en la central
MASTER aparecerá un error 91 . En cualquier caso, el inicio de un procedimiento de SETUP podrá
ESPAÑOL

realizarse sólo desde la central MASTER

Para realizar el SETUP en un equipo MASTE5/SLAVE proceda del siguiente modo:

1. Desbloquee ambas hojas, colóquelas a mitad del recorrido y bloqupelas de nuevo (vpase el procedimiento n° 1
Pirrafo 7.5 SETUP).
2. Mantenga presionado el pulsador SETUP de la tarjeta MASTE5 hasta que la cancela MASTE5 empiece el movimiento.
. Ahora la cancela MASTE5 realiza un procedimiento completo de SETUP (vpase pirrafo 7.5 SETUP).
4. Una vez terminado correctamente el SETUP de la tarjeta MASTE5 empieza el procedimiento completo de SETUP
de la tarjeta SLAVE (vpase pirrafo 7.5 SETUP).
5. Finalizado tambipn este procedimiento, la MASTE5 comprueba la posición de la hoja SLAVE y la coloca en la
misma posición (abierto o cerrado) que la hoja MASTE5.
6. Procedimiento completado.

En caso de error, o de no completarse el procedimiento de SETUP arriba descrito, será necesario


repetirla completamente empezando por el punto n°1.

E721 16 532014 - Rev. D


7.4 SETUP 9 SEÑALACIÓN DE ALARMAS Y ERRORES
Al alimentar la tarjeta, si nunca se ha En caso de que se activen alarmas (condiciones que no
realizado un SETUP o si la tarjeta lo afectan al funcionamiento de la cancela) o errores (con-
requiere, en la pantalla parpadea la sigla diciones que bloquean el funcionamiento de la cancela)
S0 junto con el LED SETUP para indicar que en la pantalla puede verse el n~mero correspondiente a la
es necesario realizar el SETUP. condición en st.
Para que el procedimiento de SETUP Las señalizaciones de ALARMAS o ERRORES
se realice correctamente, compruebe desaparecerán en el ciclo siguiente única-
detenidamente que la polaridad de mente si se elimina el problema que los ha
los finales de carrera magnéticos sea causado.
correcta, de la manera indicada en el 9.1 ALARMAS
apartado anterior. Cuando se produce una ALARMA, el LED
Para realizar el SETUP siga los siguientes pasos: ERROR empieza a parpadear y pulsando a
1. Lleve la cancela hasta la mitad de su recorrido la vez los pulsadores + y - en la pantalla se
(muy importante para que el SETUP se realice mostrará el número de la anomalía en curso
correctamente) y compruebe que ambos diodos En la Tab. 4 se indican todas las alarmas que pueden
FCA y FCC estén encendidos. Si no fuera así, la mostrarse en la pantalla.
tarjeta indicará error 12 (véase tab. 5) Tab. 4 - Alarmas
2. Mantenga pulsado el pulsador SETUP (S:4) hasta que
la cancela empiece a moverse lentamente y se
22 Corriente del MOTO5 limitada
detenga al alcanzar el final de carrera. Si el final de 24 Salida LAMP en cortocircuito
carrera alcanzado es el de cierre (con el CUADRADO) Detección del obsticulo (visible durante 10
el equipo memorizari este punto como tope en el
27 segundos)
cierre; de lo contrario, si el final de carrera es el de Memoria códigos radio XF-module llena
apertura (con el REDONDO) el equipo memorizari
30 (visible durante 10 segundos)
este punto como tope en la apertura. En esta fase, 40 Solicitud de asistencia
en la pantalla parpadea S 1 5establecimiento forzado de la programa-
. La cancela empieza automiticamente a moverse 46 ción predeterminada
lentamente en la dirección opuesta y se detiene 9.2 ERRORES
al alcanzar el final de carrera. Si el final de carrera Cuando se produce un ERROR, el LED DL20 se
alcanzado es el de apertura (con el REDONDO) enciende con luz fija y pulsando a la vez los
el equipo memorizari este punto como tope en pulsadores + y - en la pantalla se mostrará
abierto; de lo contrario, si el final de carrera es el de el número de la anomalía en curso
cierre (con el CUADRADO) el equipo memorizari este En la Tab. 5 se indican todos los errores que pueden mos-
punto como tope en la cerrado. En esta fase, en la trarse en la pantalla.
pantalla parpadea S 3 Tab. 5 - Errores
4. En función del ~ltimo final de carrera alcanzado, el
equipo se pondri en estado cerrado (0 0 ) o abierto 01 Tarjeta averiada
(0 1 ). En el segundo caso, dp un impulso de OPEN 03 Motor averiado
para que la cancela se cierre. Bloque motor bloqueado cerrado (compruebe
06 el bloque motor y, si es necesario, sustit~yalo)
8 PRUEBA DEL AUTOMATISMO
Al final de la instalación y de la programación, comprue- Cancela demasiado pesada o rozamientos ele-
07 vados (intente aumentar la potencia del motor)
be que el equipo funcione correctamente. Compruebe
especialmente que los dispositivos de seguridad interven- Error del dispositivo BUS-2EAS< (ej.: misma
08 dirección en dos pares de fotocplulas; com-
ESPAÑOL
gan correctamente y compruebe que el equipo cumpla pruebe direcciones)
las normativas de seguridad vigentes. Los dos finales de carrera tienen la misma
Recordamos que en el segundo nivel de 10 polaridad
programación está disponible el parámetro
de configuración del encoder (parámetro 12 Final de recorrido ocupado al empezar el SETUP
EC ). Este encoder “virtual” presente en 15 Time-out agotado
la tarjeta funciona como dispositivo Ninguna comunicación con la central SLAVE -
antiaplastamiento. Si la cancela, durante 90
la fase de apertura o cierre, golpea contra central SLAVE ausente
un obstáculo, el encoder “virtual” manda 91 Error en la central SLAVE
la inversión del movimiento. En el siguiente
movimiento en la misma dirección, un 92 Error en la central SLAVE
obstáculo en la misma posición ocasionará Los errores 9 0 9 1 y 9 2 sólo aparecen
la parada del motor. Es fundamental en E721 configuradas como MASTER y en
configurar correctamente este parámetro especial el 9 1 y el 9 2 indican errores
para ajustar la correcta sensibilidad del presentes en la central SLAVE. Se acon-
encoder “virtual” a los posibles obstáculos seja, en caso de visualización de dichos
durante el movimiento. errores, comprobar en la central SLAVE el
tipo de error que aparece en la pantalla
para solucionarlo y restablecer el correcto
funcionamiento del equipo.
E721 17 532014 - Rev. D
10 LÓGICAS DE FUNCIONAMIENTO
El mando SAFE, si está activado durante el
Entre paréntesis los efectos sobre las restantes movimiento de la hoja, ocasiona la inversión
entradas de impulso activo inmediata y total del movimiento. Con el
El mando CLOSE puede activarse en la entrada automatismo parado, si se mantiene activo,
OPEN B a partir del 2° nivel de programación impide el movimiento
LÐGICA “E” IMPULSOS
ESTADO AUTOMATISMO OPEN A OPEN B CLOSE STOP FS: OP FS: CL FS: CL/OP

CE55ADO abre la cancela abre la cancela ning~n efecto ning~n efecto ning~n efecto ning~n efecto ning~n efecto
parcialmente (OPEN inhibido) (OPEN inhibido) (OPEN inhibido)

bloquea el bloquea el vuelve a cerrar bloquea el bloquea y cuando se


EN APE5TU5A funcionamiento (1) funcionamiento la cancela funcionamiento vpase prog. 2° niv. ning~n efecto libera abre (OPEN bloquea
- memoriza CLOSE)

ABIE5TO vuelve a cerrar vuelve a cerrar vuelve a cerrar ning~n efecto ning~n efecto ning~n efecto ning~n efecto
la cancela (1) la cancela la cancela (OPEN/CLOSE inhibidos) (CLOSE inhibido) (OPEN/CLOSE inhibidos)

vuelve a abrir vuelve a abrir bloquea el invierte en apertura bloquea y cuando se


EN CIE55E la cancela la cancela ning~n efecto funcionamiento ning~n efecto (vpase prog. 2° niv.) libera abre (OPEN bloquea
- memoriza CLOSE)

ning~n efecto ning~n efecto ning~n efecto ning~n efecto (OPEN


BLOQUEADO cierra la cancela cierra la cancela cierra la cancela (OPEN/CLOSE inhibidos) (OPEN inhibido) (CLOSE inhibido) bloquea - memoriza
CLOSE)
LÐGICA “EP” IMPULSOS
ESTADO AUTOMATISMO OPEN A OPEN B CLOSE STOP FS: OP FS: CL FS: CL/OP

CE55ADO abre la cancela abre la cancela ning~n efecto ning~n efecto ning~n efecto ning~n efecto ning~n efecto
parcialmente (OPEN inhibido) (OPEN inhibido) (OPEN inhibido)

bloquea el bloquea el vuelve a cerrar bloquea el bloquea y cuando se


EN APERTURA funcionamiento (1) funcionamiento la cancela funcionamiento vpase prog. 2° niv. ning~n efecto libera abre (OPEN bloquea
- memoriza CLOSE)

ABIERTO vuelve a cerrar vuelve a cerrar vuelve a cerrar ning~n efecto ning~n efecto ning~n efecto ning~n efecto
la cancela (1) la cancela la cancela (OPEN/CLOSE inhibidos) (CLOSE inhibido) (OPEN/CLOSE inhibidos)

bloquea el bloquea el bloquea el invierte en apertura bloquea y cuando se


EN CIERRE funcionamiento funcionamiento ning~n efecto funcionamiento ning~n efecto (vpase prog. 2° niv.) libera abre (OPEN bloquea
- memoriza CLOSE)
recupera el movimiento recupera el movimiento ning~n efecto (OPEN
BLOQUEADO en sentido inverso. en sentido inverso. cierra la cancela ning~n efecto ning~n efecto ning~n efecto bloquea - memoriza
Despups de STOP cierra Despups de STOP cierra (OPEN/CLOSE inhibidos) (OPEN inhibido) (CLOSE inhibido) CLOSE)
siempre siempre
LÐGICA “A” IMPULSOS
ESTADO AUTOMATISMO OPEN A OPEN B CLOSE STOP FS: OP FSW CL FSW CL/OP
abre y vuelve a cerrar abre la cancela
CERRADO despups del tiempo de parcialmente y cierra ning~n efecto ning~n efecto ning~n efecto ning~n efecto ning~n efecto
pausa despups del tiempo de (OPEN inhibido) (OPEN inhibido) (OPEN inhibido)
pausa B

vuelve a cerrar bloquea el bloquea y cuando se


EN APERTURA ning~n efecto (1) ning~n efecto la cancela funcionamiento vpase prog. 2° niv. ning~n efecto libera abre
(memoriza CLOSE)

recarga el tiempo en recarga el tiempo vuelve a cerrar bloquea el recarga el tiempo recarga el tiempo en
ABIERTO EN PAUSA pausa (1) en pausa B la cancela funcionamiento ning~n efecto en pausa pausa
(CLOSE inhibido) (CLOSE inhibido)

vuelve a abrir vuelve a abrir bloquea el invierte en apertura bloquea y cuando se


EN CIERRE ning~n efecto ning~n efecto libera abre
ESPAÑOL

la cancela la cancela funcionamiento (vpase prog. 2° niv.) (memoriza CLOSE)

BLOQUEADO cierra la cancela cierra la cancela cierra la cancela ning~n efecto ning~n efecto ning~n efecto ning~n efecto
(OPEN/CLOSE inhibidos) (OPEN inhibido) (CLOSE inhibido) (OPEN/CLOSE inhibidos)

LÐGICA “A1” IMPULSOS


ESTADO AUTOMATISMO OPEN A OPEN B CLOSE STOP FS: OP FSW CL FSW CL/OP
abre y vuelve a cerrar abre la cancela
CERRADO despups del tiempo de parcialmente y cierra ning~n efecto ning~n efecto ning~n efecto ning~n efecto ning~n efecto
pausa despups del tiempo de (OPEN inhibido) (OPEN inhibido) (OPEN inhibido)
pausa B

vuelve a cerrar bloquea el contin~a abriendo y bloquea y cuando se


EN APERTURA ning~n efecto (1) ning~n efecto vpase prog. 2° niv. libera abre
la cancela funcionamiento vuelve cerrar ripido (memoriza CLOSE)

recarga el tiempo en recarga el tiempo vuelve a cerrar bloquea el bloquea y cuando se recarga el tiempo en
ABIERTO EN PAUSA ning~n efecto pausa
pausa (1) en pausa B la cancela funcionamiento libera cierra ripido (CLOSE inhibido)

vuelve a abrir vuelve a abrir bloquea el invierte en apertura bloquea y cuando se


EN CIERRE la cancela la cancela ning~n efecto funcionamiento ning~n efecto (vpase prog. 2° niv.) libera abre
(memoriza CLOSE)

BLOQUEADO cierra la cancela cierra la cancela cierra la cancela ning~n efecto ning~n efecto ning~n efecto ning~n efecto
(OPEN/CLOSE inhibidos) (OPEN inhibido) (CLOSE inhibido) (OPEN/CLOSE inhibidos)
(1) Durante el ciclo de apertura parcial, un impulso de OPEN A provoca la apertura total
E721 18 532014 - Rev. D
LÐGICA “AP” IMPULSOS
ESTADO AUTOMATISMO OPEN A OPEN B CLOSE STOP FS: OP FSW CL FSW CL/OP
abre y vuelve a cerrar abre la cancela parcial- ning~n efecto ning~n efecto ning~n efecto
CERRADO despups del tiempo de mente y cierra despups del ning~n efecto (OPEN inhibido) (OPEN inhibido) ning~n efecto (OPEN inhibido)
pausa tiempo de pausa B

bloquea el vuelve a cerrar bloquea el bloquea y cuando se


EN APERTURA funcionamiento (1) bloquea el funcionamiento la cancela funcionamiento vpase prog. 2° niv. ning~n efecto libera abre (OPEN bloquea
- memoriza CLOSE)

bloquea el vuelve a cerrar bloquea el recarga el tiempo recarga el tiempo


ABIERTO EN PAUSA funcionamiento (1) bloquea el funcionamiento la cancela funcionamiento ning~n efecto en pausa en pausa
(CLOSE inhibido) (CLOSE inhibido)

bloquea el invierte en apertura bloquea y cuando se


EN CIERRE vuelve a abrir la cancela vuelve a abrir la cancela ning~n efecto funcionamiento ning~n efecto (vpase prog. 2° niv.) libera abre (OPEN bloquea
- memoriza CLOSE)

BLOQUEADO cierra la cancela cierra la cancela cierra la cancela ning~n efecto ning~n efecto ning~n efecto ning~n efecto
(OPEN/CLOSE inhibidos) (OPEN inhibido) (CLOSE inhibido) (OPEN/CLOSE inhibidos)

LÓGICA “At” (2) IMPULSOS


ESTADO AUTOMATISMO OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP
abre y vuelve a cerrar abre la cancela parcial- ning~n efecto ning~n efecto ning~n efecto
CERRADO despups del tiempo de mente y cierra despups del ning~n efecto (OPEN inhibido) (OPEN inhibido) ning~n efecto (OPEN inhibido)
pausa tiempo de pausa B

bloquea el bloquea y cuando se


EN APERTURA ning~n efecto (1) ning~n efecto vuelve a cerrar la cancela funcionamiento invierte en cierre ning~n efecto libera abre
(memoriza CLOSE)

recarga el tiempo recarga el tiempo en vuelve a cerrar la cancela bloquea el recarga el tiempo recarga el tiempo en
ABIERTO EN PAUSA en pausa (1) pausa funcionamiento ning~n efecto en pausa pausa
(CLOSE inhibido) (CLOSE inhibido)

bloquea el invierte en apertura bloquea y cuando se


EN CIERRE vuelve a abrir la cancela vuelve a abrir la cancela ning~n efecto funcionamiento ning~n efecto (vpase prog. 2° niv.) libera abre
(memoriza CLOSE)

BLOQUEADO cierra la cancela cierra la cancela cierra la cancela ning~n efecto ning~n efecto ning~n efecto ning~n efecto
(OPEN/CLOSE inhibidos) (OPEN inhibido) (CLOSE inhibido) (OPEN/CLOSE inhibidos)

LÐGICA “S” IMPULSOS


ESTADO AUTOMATISMO OPEN A OPEN B CLOSE STOP FS: OP FSW CL FSW CL/OP
abre y vuelve a cerrar abre la cancela parcial- ning~n efecto ning~n efecto ning~n efecto
CERRADO despups del tiempo mente y cierra despups del ning~n efecto (OPEN inhibido) (OPEN inhibido) ning~n efecto (OPEN inhibido)
de pausa tiempo de pausa B

bloquea el contin~a abriendo y bloquea y cuando se


EN APERTURA invierte en cierre (1) invierte en cierre vuelve a cerrar la cancela funcionamiento vpase prog. 2° niv. vuelve cerrar ripido libera abre
(memoriza CLOSE)

ABIERTO EN PAUSA vuelve a cerrar vuelve a cerrar la cancela vuelve a cerrar la cancela bloquea el ning~n efecto bloquea y cuando se bloquea y cuando se
la cancela (1) funcionamiento libera cierra ripido libera cierra

bloquea el invierte en apertura (vpase bloquea y cuando se


EN CIERRE vuelve a abrir la cancela vuelve a abrir la cancela ning~n efecto funcionamiento ning~n efecto prog. 2° niv.) y, al finalizar, libera abre y, al finalizar,
cierra ripido cierra ripido

BLOQUEADO cierra la cancela cierra la cancela cierra la cancela ning~n efecto ning~n efecto ning~n efecto ning~n efecto
ESPAÑOL
(OPEN/CLOSE inhibidos) (OPEN inhibido) (CLOSE inhibido) (OPEN/CLOSE inhibidos)

LÐGICA “SP” IMPULSOS


ESTADO AUTOMATISMO OPEN A OPEN B CLOSE STOP FS: OP FSW CL FSW CL/OP
abre y vuelve a cerrar abre la cancela parcial- ning~n efecto ning~n efecto ning~n efecto
CERRADO despups del tiempo mente y cierra despups del ning~n efecto (OPEN inhibido) (OPEN inhibido) ning~n efecto (OPEN inhibido)
de pausa tiempo de pausa B

bloquea el bloquea el vuelve a cerrar bloquea el contin~a abriendo y bloquea y cuando se libera abre
EN APERTURA funcionamiento (1) funcionamiento la cancela funcionamiento vpase prog. 2° niv. vuelve a cerrar ripido
y, al finalizar, cierra ripido (OPEN
bloquea - memoriza CLOSE)

ABIERTO EN PAUSA vuelve a cerrar vuelve a cerrar vuelve a cerrar bloquea el ning~n efecto bloquea y cuando se bloquea y cuando se
la cancela (1) la cancela la cancela funcionamiento libera cierra ripido libera cierra ripido

bloquea el bloquea el bloquea el invierte en apertura bloquea y cuando se


EN CIERRE funcionamiento funcionamiento ning~n efecto funcionamiento ning~n efecto (vpase prog. 2° niv.) libera abre
(memoriza CLOSE)
recupera el movimiento en recupera el movimiento en vuelve a cerrar ning~n efecto ning~n efecto ning~n efecto ning~n efecto
BLOQUEADO sentido inverso. Despups sentido inverso. Despups la cancela (OPEN/CLOSE inhibidos) (OPEN inhibido) (CLOSE inhibido) (OPEN/CLOSE inhibidos)
de STOP cierra siempre de STOP cierra siempre

(1) Durante el ciclo de apertura parcial, un impulso de OPEN A provoca la apertura total
E721 19 532014 - Rev. D
LÐGICA “SA” IMPULSOS
ESTADO AUTOMATISMO OPEN A OPEN B CLOSE STOP FS: OP FSW CL FSW CL/OP
abre y vuelve a cerrar abre la cancela parcial- ning~n efecto ning~n efecto ning~n efecto
CERRADO despups del tiempo de mente y cierra despups del ning~n efecto (OPEN inhibido) (OPEN inhibido) ning~n efecto (OPEN inhibido)
pausa tiempo de pausa B

vuelve a cerrar bloquea el bloquea y cuando se


EN APERTURA ning~n efecto (1) ning~n efecto la cancela funcionamiento vpase prog. 2° niv. ning~n efecto libera abre
(memoriza CLOSE)

vuelve a cerrar la cancela vuelve a cerrar vuelve a cerrar bloquea el recarga el tiempo recarga el tiempo en
ABIERTO EN PAUSA (1) la cancela la cancela funcionamiento ning~n efecto en pausa pausa
(CLOSE inhibido) (CLOSE inhibido)

vuelve a abrir bloquea el invierte en apertura bloquea y cuando se


EN CIERRE vuelve a abrir la cancela la cancela ning~n efecto funcionamiento ning~n efecto (vpase prog. 2° niv.) libera abre
(memoriza CLOSE)

BLOQUEADO cierra la cancela cierra la cancela cierra la cancela ning~n efecto ning~n efecto ning~n efecto ning~n efecto
(OPEN/CLOSE inhibidos) (OPEN inhibido) (CLOSE inhibido) (OPEN/CLOSE inhibidos)

LÐGICA “B” IMPULSOS


ESTADO AUTOMATISMO OPEN A / CLOSE STOP FS: OP FSW CL FSW CL/OP

CERRADO abre la cancela / ning~n efecto ning~n efecto ning~n efecto ning~n efecto ning~n efecto
(OPEN inhibido) (OPEN inhibido) (OPEN inhibido)

bloquea el bloquea y cuando se


EN APERTURA ning~n efecto / cierra la cancela funcionamiento vpase prog. 2° niv. ning~n efecto libera abre (memoriza
OPEN/CLOSE)

ABIERTO ning~n efecto / cierra la cancela ning~n efecto ning~n efecto ning~n efecto ning~n efecto
(OPEN/CLOSE inhibidos) (CLOSE inhibido) (OPEN/CLOSE inhibidos)

bloquea el invierte en apertura bloquea y cuando se


EN CIERRE abre la cancela / ning~n efecto funcionamiento ning~n efecto (vpase prog. 2° niv.) libera abre (memoriza
OPEN/CLOSE)

BLOQUEADO abre la cancela / cierra la cancela ning~n efecto ning~n efecto ning~n efecto ning~n efecto
(OPEN/CLOSE inhibidos) (OPEN inhibido) (CLOSE inhibido) (OPEN/CLOSE inhibidos)

LÓGICA “bC" IMPULSOS EN APERTURA / ACCIONAMIENTOS MANTENIDOS IMPULSOS


EN CIERRE
ESTADO AUTOMATISMO OPEN A / CLOSE STOP FSW OP FSW CL FSW CL/OP

CERRADO abre la cancela / ning~n efecto ning~n efecto ning~n efecto ning~n efecto ning~n efecto
(OPEN inhibido) (OPEN inhibido) (OPEN inhibido)

bloquea el bloquea y cuando se


EN APERTURA ning~n efecto / cierra la cancela funcionamiento vpase prog. 2° niv. ning~n efecto libera abre (memoriza
OPEN/CLOSE)

ABIERTO ning~n efecto / cierra la cancela ning~n efecto ning~n efecto ning~n efecto ning~n efecto
(OPEN/CLOSE inhibidos) (CLOSE inhibido) (OPEN/CLOSE inhibidos)

bloquea el invierte en apertura bloquea y cuando se


EN CIERRE abre la cancela / ning~n efecto funcionamiento ning~n efecto (vpase prog. 2° niv.) libera abre (memoriza
OPEN/CLOSE)

BLOQUEADO abre la cancela / cierra la cancela ning~n efecto ning~n efecto ning~n efecto ning~n efecto
(OPEN/CLOSE inhibidos) (OPEN inhibido) (CLOSE inhibido) (OPEN/CLOSE inhibidos)
ESPAÑOL

LÓGICA “C” ACCIONAMIENTOS MANTENIDOS IMPULSOS


ESTADO AUTOMATISMO OPEN A / CLOSE STOP FSW OP FSW CL FSW CL/OP

CERRADO abre la cancela / ning~n efecto ning~n efecto ning~n efecto ning~n efecto ning~n efecto
(OPEN inhibido) (OPEN inhibido) (OPEN inhibido)

EN APERTURA ning~n efecto / cierra la cancela bloquea el vpase prog. 2° niv. ning~n efecto bloquea y cuando se
funcionamiento libera vpase prog. 2° niv.

ABIERTO ning~n efecto / cierra la cancela ning~n efecto ning~n efecto ning~n efecto ning~n efecto
(OPEN/CLOSE inhibidos) (CLOSE inhibido) (OPEN/CLOSE inhibidos)

EN CIERRE abre la cancela / ning~n efecto bloquea el ning~n efecto bloquea el bloquea el
funcionamiento funcionamiento funcionamiento

BLOQUEADO abre la cancela / cierra la cancela ning~n efecto ning~n efecto ning~n efecto ning~n efecto
(OPEN/CLOSE inhibidos) (OPEN inhibido) (CLOSE inhibido) (OPEN/CLOSE inhibidos)
(1) Durante el ciclo de apertura parcial, un impulso de OPEN A provoca la apertura total
(2) Cuando se enciende, la tarjeta comprueba las entradas y si un accionamiento de OPEN A o B esti activo abre la hoja o
la cancela, de lo contrario, cierra.
E721 20 532014 - Rev. D
INDEX
1 WAARSCHUWINGEN ....................................................................................................................................... 2
2 LAY-OUT EN COMPONENTEN .......................................................................................................................... 2
2.1 BESCHRIJVING COMPONENTEN ................................................................................................................................ 3
2.2 BESCHRIJVING KLEMMENBORD J13 .......................................................................................................................... 3
3 TECHNISCHE EIGENSCHAPPEN ........................................................................................................................ 3
4 ELEKTRISCHE AANSLUITINGEN ......................................................................................................................... 4
4.1 BUS-2EASY-FOTOCELLEN ............................................................................................................................................ 5
4.1.1 ADRESSERING BUS-2EASY-FOTOCELLEN ........................................................................................................................5
4.1.2 GEHEUGENOPSLAG BUS-2EASY-ACCESSOIRES ..............................................................................................................5
4.2 TRADITIONELE FOTOCELLEN ...................................................................................................................................... 6
4.3 AANSLUITINGEN SAFE-INGANG ................................................................................................................... 7
5 PROGRAMMERING ........................................................................................................................................ 8
5.1 PROGRAMMERING NIVEAU 1 ................................................................................................................................... 8
5.2 PROGRAMMERING NIVEAU 2 .................................................................................................................................. 10
6 GEHEUGENOPSLAG RADIOCODERING ......................................................................................................... 12
6.1 GEHEUGENOPSLAG VAN DE DS-RADIOBESTURINGEN .............................................................................................. 12
6.2 GEHEUGENOPSLAG VAN DE SLH-RADIOBESTURINGEN ........................................................................................... 13
6.3 GEHEUGENOPSLAG VAN DE LC/RC-RADIOBESTURINGEN (ALLEEN BESCHIKBAAR VOOR SOMMIGE LANDEN) ........ 13
6.3.1 GEHEUGENOPSLAG OP AFSTAND VAN DE LC/RC-RADIOBESTURINGEN .......................................................................13
6.4 RADIOBESTURINGEN UIT HET GEHEUGEN WISSEN ................................................................................................... 13
7 INBEDRIJFSTELLING ..................................................................................................................................... 14
7.1 CONTROLE VAN DE LEDs .......................................................................................................................................... 14
7.2 WERKING OP BATTERIJEN ......................................................................................................................... 14
7.3 POSITIONERING VAN DE EINDAANSLAG ................................................................................................................. 15
7.4 CONFIGURATIES MASTER / SLAVE ............................................................................................................................ 16
7.4.1 BEKABELING MASTER/SLAVE ....................................................................................................................................... 16
7.4.2 SET-UP-PROCEDURE MASTER/SLAVE ............................................................................................................................ 16
7.5 SETUP ....................................................................................................................................................................... 17
8 HET AUTOMATISCHE SYSTEEM TESTEN ........................................................................................................... 17
9 SIGNALERING VAN ALARMMELDINGEN EN FOUTEN ...................................................................................... 17
9.1 ALARMMELDINGEN.................................................................................................................................................. 17
9.2 FOUTEN ................................................................................................................................................................... 17
10 BEDRIJFSLOGICA'S .................................................................................................................................... 18
CE-VERKLARING VAN OVEREENSTEMMING
Fabrikant: FAAC S.p.A.
Adres: Via Calari, 10 - 40069 Zola Predosa BOLOGNA - ITALIÊ
verklaart dat: De elektronische apparatuur E721
‡ in overeenstemming is met de belangrijkste veiligheidseisen van de volgende
EEG-richtlijnen:

2006/95/EG Laagspanningsrichtlijn
2004/108/EG 5ichtlijn Elektromagnetische compatibiliteit
Extra opmerking:
Dit product is getest in een standaard, homogene configuratie
(gelijk voor alle producten van FAAC S.p.A.).

Bologna, 01-12-2011
De President-directeur
A.Marcellan
NEDERLANDS

WAARSCHUWINGEN
‡ Let op! Het is belangrijk voor de veiligheid dat deze hele instructie zorgvuldig wordt opgevolgd.
‡ Een onjuiste installatie of foutief gebruik van het product kan ernstig persoonlijk letsel veroorzaken.
‡ Lees de instructies aandachtig door alvorens te beginnen met de installatie van het product en bewaar ze voor latere
raadpleging.
‡ Het symbool markeert belangrijke informatie voor de persoonlijke veiligheid en de integriteit van het
automatische systeem.
‡ Het symbool vestigt de aandacht op informatie met betrekking tot de eigenschappen of de werking
van het product.
E721 1 532014 - Rev. D
E721
1 WAARSCHUWINGEN
Alvorens werkzaamheden aan de elektronische apparatuur te verrichten (aansluitingen, onderhoud)
moet altijd eerst de elektrische voeding worden weggenomen.

Breng bovenstrooms van het systeem een thermomagnetische differentieelschakelaar aan met
een juiste inschakellimiet.

Sluit de aardleiding op de betreffende klem aan.

Houd de voedingskabels altijd gescheiden van de bedienings-


en veiligheidskabels (drukknop, ontvanger, fotocellen enz.).
Om elektrische storingen te voorkomen dienen afzonderlijke
kabelmantels of afgeschermde kabels (met geaarde afscher-
ming) te worden gebruikt.

2 LAY-OUT EN COMPONENTEN

/ SAFE
/ SAFE

SENSOR
EINDAANSLAG

Fig. 1
NEDERLANDS

E721 2 532014 - Rev. D


2.1 BESCHRIJVING COMPONENTEN 3 TECHNISCHE EIGENSCHAPPEN
LCD DISPLA< VOO5 SIGNALE5ING EN P5OG5AMME5ING
Voeding 20V-versie : 20 Va 50 Hz
115V-versie : 115 a 60 Hz
S:1 P5OG5AMMEE5KNOP “F”
Opgenomen 10 :
S:2 P5OG5AMMEE5KNOP “-” netstroom stand-by
S: P5OG5AMMEE5KNOP “+” Maximale 6A
motorbelasting
S:4 KNOP “SETUP” Voeding 24V=
Leds CONT5OLELED STATUS INGANGEN accessoires
Max. stroom 24 V= max 500 mA
J1 EE5STE VOEDINGSCONNECTO5 accessoires BUS-2EAS< max 500 mA
J2 EE5STE CONNECTO5 T5ANSFO5MATO5 Omgevings (-20 - +55) °C
temperatuur
J T:EEDE CONNECTO5 T5ANSFO5MATO5
Belasting waar- 24 V= - 15 :
J4 CONNECTO5 NOODACCU (ACCESSOI5E) schuwingslamp
J5 MOTO5CONNECTO5 Belasting uitgang 24 V= - 100 mA (2)

J6 CONNECTO5 UITGANG :AA5SCHU:INGSLAMP (24 V= - 15W) Veiligheids F1 =T1A - 250Va


zekeringen
CONNECTO5 MOTO5BLOKKE5ING EN CONTACT Bedrijfs Halfautomatisch, Halfautomatisch stap-
J9
MOTO5ONTG5ENDELING logica's: voor-stap, Automatisch, Automatisch
J10 UITGANGSCONNECTO5 OUT stap-voor-stap, Automatisch met timer,
Automatisch beveiligingen, Automatisch
J11 USB-CONNECTO5 VOO5 PC-AANSLUTING beveiligingen stap-voor-stap, Automa-
J12 AANSLUITCONNECTO5 BUS-2EAS<-IN5ICHTINGEN tisch met omkering in pauze, Halfauto-
matisch b, Gemengde logica bC,
J1 CONNECTO5 INGANGEN OP KLEMMENBO5D Dead man.
CONNECTO5 5ADIO-ONTVANGSMODULE Werktijd Programmeerbaar (van 0 tot 10 min)
J14
VOO5 OMNIDEC Pauzetijd Programmeerbaar (van 0 tot 10 min)
LCD1 DISPLA< VOO5 SIGNALE5ING EN P5OG5AMME5ING OPEN A / OPEN B
F1 VEILIGHEIDSZEKE5ING Motorvermogen Programmeerbaar op 50 niveaus
Motorsnelheid Programmeerbaar op 10 niveaus
2.2 BESCHRIJVING KLEMMENBORD J13 opening-sluiting
Ingangen/Uitgan- Voedingsinrichting, Accu, Motor, Module
NR. INGANG BESCHRIJVING
gen op connec- XF4/868, Accu elektrische motoront-
1 OPEN A Inrichting met NO-contact dat tor grendeling, Motorblokkering, USB
zorgt voor de volledige opening Ingangen/Uitgan- BUS-2EAS<, OPEN A, OPEN B/CLOSE/SAFE,
van de poort gen op klem- STOP/SAFE, GND, Fotocellen Opening en
2-6 GND Negatieve voor voeding accessoires menbord Sluiting, +24V, Voedingsnet, :aarschu-
wingslamp, Elektrische motorontgrende-
3(1) OPEN B Inrichting met NO-contact dat zorgt
ling, OUT.
(DEFAULT) voor de gedeeltelijke opening van
de poort
CLOSE Inrichting met NO-contact dat
zorgt dat voor de sluiting van de
poort (1) Hoe de ingangen 3 en 4 worden gebruikt
kan worden ingesteld door de bijbehorende
SAFE Inrichting met NG-contact dat zorgt parameters in het 2e programmeerniveau
voor de onmiddellijke en volledige
omkering van de beweging van de te configureren (parameter Ob en SP ).
poort Voor de precieze beschrijving van de
werking van het automatisch systeem
4(1) STOP Inrichting met NG-contact dat zorgt afhankelijk van de ingestelde logica, zie
(DEFAULT) voor het stoppen van de poort de tabellen achterin deze handleiding
SAFE Inrichting met NG-contact dat zorgt (par. 10 - BEDRIJFSLOGICA’S).Voor de kabels
voor de onmiddellijke en volledige die op deze als SAFE geconfigureerde
omkering van de beweging van de ingangen moeten worden aangesloten, zie
poort
de schema’s in Fig.13 en Fig. 14
5 FS: OP Inrichting met NG-contact dat
NEDERLANDS

zorgt voor de omkering van de (2) De uitgangsbelasting moet zijn inbegre-


beweging tijdens het openen van pen in de maximaal beschikbare stroom
de poort voor de accessoires.
7 FS: CL Inrichting met NG-contact dat
zorgt voor de omkering van de
beweging tijdens het sluiten van
de poort
8 +24V Positieve voor voeding
accessoires
E721 3 532014 - Rev. D
4 ELEKTRISCHE AANSLUITINGEN
De in Fig. 2 aangegeven bekabeling betreft de ingangen van de kaart met de DEFAULT-configuratie.

/ SAFE
/ SAFE

Voor de aansluiting van


de fotocellen en de
veiligheidsvoorzieningen,
zie paragraaf 4.2

230 V ~
115 V ~
=

CONTACT
MOTORONTGRENDELING
(Blokkeert de motor
wanneer de hendel van
de motorontgrendeling
= wordt bewogen)
Fig. 2

E721
E721 E721
E721

C720
C 72 C721
C 721
Fig. 

A: Fotocellen voor interventie tijdens SLUITING


B: Fotocellen voor interventie tijdens OPENING
C: Fotocellen voor interventie tijdens OPENING
en SLUITING
NEDERLANDS

Fig. 4

E721 4 532014 - Rev. D


Alvorens de fotocellen aan te sluiten is het handig de Tab. 1 - Adressering BUS-2EASY-fotocellen
werking te kiezen op basis van het bewegingsgebied dat
ze moeten beschermen: Dip1 Dip2 Dip Dip4 5ef. Type
Beveiligingen tijdens sluiting: grijpen alleen in tijdens
het sluiten van het automatische systeem, en zijn dus OFF OFF OFF OFF
geschikt om het sluitingsgebied te beschermen tegen OFF OFF OFF ON
botsingen.
OFF OFF ON OFF OPENING
Beveiligingen tijdens opening: grijpen alleen in tijdens B
OFF OFF ON ON Max. 6 paar
het openen van het automatische systeem, en zijn
dus geschikt om het openingsgebied te beschermen OFF ON ON OFF
tegen botsingen.
Beveiligingen tijdens opening/sluiting: grijpen in zowel OFF ON ON ON
tijdens het openen als tijdens het sluiten van het auto- ON OFF OFF OFF
matische systeem, en zijn dus geschikt om het gehele
ON OFF OFF ON
bewegingsgebied te beschermen tegen botsingen.
ON OFF ON OFF
4.1 BUS-2EASY-FOTOCELLEN ON OFF ON ON A SLUITING
Deze kaart is voorzien van een BUS-2EAS<-circuit waarmee Max. 7 paar
gemakkelijk een groot aantal BUS-2EAS<-veiligheidsin- ON ON OFF OFF
richtingen kunnen worden aangesloten (bijv. tot 16 paar ON ON OFF ON
fotocellen) die op de juiste wijze zijn geprogrammeerd,
ON ON ON OFF
met behulp van slechts twee neutrale kabels.
Alvorens de fotocellen aan te sluiten is het handig de OFF ON OFF OFF OPENING en
werking te kiezen (fig. 4) op basis van het bewegingsge- C SLUITING
OFF ON OFF ON Max. 2 paar
bied dat ze moeten beschermen, en de dipschakelaars
zowel op de zender als op de ontvanger (zie fig. 5) aan ON ON ON ON / OPEN-IMPULS
te brengen, zoals in Tab. 1. 4.1.2 GEHEUGENOPSLAG BUS-2EASY-ACCESSOIRES
Op ieder willekeurig moment kunnen fotocellen en
accessoires met een BUS-2EAS<-aansluiting aan de installatie
Fig. 5 DL1 = Uitlijning worden toegevoegd, door de volgende procedure te volgen.
DL2 = Status 1. Installeer en programmeer de accessoires met het
BUS-2EAS</Voe- gewenste adres (zie par. 4.1.1).
ding 2. Schakel de voeding naar de kaart uit.
RX TX DS1 = Dipscha- . Sluit de twee kabels van de BUS-2EAS<-accessoires aan
DL1
DL2 kelaar voor de op het rode klemmenbord J12 (ongeacht de polariteit).
ON
DS1
ON
DS1 programme- 4. Schakel de voeding van de kaart in.
1 2 3 4 1 2 3 4
ring 5. Druk ppn keer kort op de SETUP-knop (S:4) om de
DL2 accessoires te registreren. Controleer de werking van de
gewnstalleerde BUS-2EAS<-inrichtingen.
BUS BUS BUS BUS

RX - TX 6. De kaart heeft de BUS-2EAS<-accessoires in het geheugen


opgeslagen.
Volg de aanwijzingen in de volgende tabel om te controleren
of de BUS-2EAS<-aansluiting goed is uitgevoerd.
4.1.1 ADRESSERING BUS-2EASY-FOTOCELLEN
Dezelfde procedure moet ook op een MASTER-
Het is belangrijk om zowel de zender als besturingseenheid worden uitgevoerd om een
de ontvanger hetzelfde adres te geven. op de met een GEPOLARISEERDE aansluiting op
Controleer of er geen twee of meer paren de BUS-2EASY aangesloten SLAVE-besturingse-
fotocellen zijn met hetzelfde adres. enheid in het systeem op te nemen.

Als er geen enkele BUS-2EASY-inrichting Tab. 2 - Beschrijving BUS-2EASY-led


wordt gebruikt, moet de BUS-2EASY-con- Normale activiteit (led brandt, ook
nector vrij worden gelaten (J12 - fig. 1). Brandt als er geen fotocellen zijn). Er is geen
geregistreerde fotocel actief
Knippert Minstens ppn geregistreerde fotocel is
langzaam actief of niet uitgelijnd.
NEDERLANDS

Uit (knippert
Kortsluiting in BUS-2EAS<-lijn
elke 2,5 sec.)
-Lijn BUS-2EAS< gedeactiveerd (geeft geen
voeding)
Uit - :erking op batterijen.
- Besturingseenheid als SLAVE
geprogrammeerd

E721 5 532014 - Rev. D


4.2 TRADITIONELE FOTOCELLEN Aansluiting van ppn paar fotocellen bij sluiting en
ppn paar bij opening
Aansluiting van 1 paar fotocellen bij sluiting
met geactiveerde FAIL-SAFE-beveiliging
In niveau 2 van de programmering instellen
o1 = 01

OUT

Overige
beveiligingen

OUT
OUT

Aansluiting van 1 paar fotocellen bij sluiting Fig. 8


met uitgeschakelde FAIL-SAFE en STOP-beveiliging
Aansluiting van twee paar fotocellen bij sluiting

Overige
beveiligingen

Fig. 6

Indien de FAIL-SAFE beveiliging niet wordt


gebruikt, moet de voeding van de zenders worden
aangesloten op de klemmen 6 en 8 van J13.
Wanneer de FAIL-SAFE beveiliging wel wordt
gebruikt, moet de voeding van de zenders worden
aangesloten op OUT nadat deze op de juiste wijze
is ingesteld (zie programmering niveau 2 en fig. Fig. 9
6).
Wanneer de FAIL-SAFE beveiliging wordt gebruikt, Aansluiting van ppn paar fotocellen bij sluiting en ppn
moeten ook de niet-gebruikte veiligheidsingangen paar bij opening/sluiting
worden verbonden met de negatieve pool van OUT
(zie fig. 6).

Aansluiting van ppn paar fotocellen bij opening

Overige
beveiligingen
NEDERLANDS

Fig. 7 Fig. 10
E721 6 532014 - Rev. D
Aansluiting van ppn paar fotocellen bij sluiting, ppn paar Aansluiting zonder veiligheids- en stopvoorzieningen
bij opening en ppn paar bij opening/sluiting

Fig. 12

Fig. 11

4.3 AANSLUITINGEN SAFE-INGANG


Als de veiligheidsinrichting Fail-Safe wordt geactiveerd (parameter kan worden geconfigureerd in het 2e
programmeerniveau), moet het negatief dat voor het beheer van de SAFE-ingang wordt gebruikt - OUT
zijn (zie Fig. 13).
Aansluiting van een veiligheidsinrichting (andere veiligheidsinrichtingen) op de SAFE-ingang met functie FAIL-SAFE geactiveerd

Instellen: 2e niveauo 1=01 (FAIL SAFE GEACTIVEE5D) Instellen: 2e niveau o 1=01 (FAIL SAFE GEACTIVEE5D)
2e niveau SP=01 (INGANG 4 = VEILIGHEIDSLIJST) 2e niveau Ob=02 (INGANG  = VEILIGHEIDSLIJST)

Andere veiligheidsvoorzieningen
Andere veiligheidsvoorzieningen OPEN A OPEN A
GND GND
OPEN B / CLOSE - OUT SAFE / OPEN B / CLOSE
- OUT SAFE / STOP STOP
FSW OP FSW OP
GND GND
FSW CL FSW CL
+24V +24V Fig. 1
Als de veiligheidsinrichting Fail-Safe wordt gedeactiveerd (parameter kan worden geconfigureerd in het
2e programmeerniveau), moet het negatief dat voor het beheer van de SAFE-ingang wordt gebruikt - 
zijn (zie Fig. 14).
Aansluiting van een veiligheidsinrichting (andere veiligheidsinrichtingen) op de SAFE-ingang met functie FAIL-SAFE gedeactiveerd

Instellen: 2e niveauo 1=00 (FAIL SAFE GEDEACTIVEE5D) Instellen: 2e niveauo 1=00 (FAIL SAFE GEDEACTIVEE5D)
2e niveau SP=01 (INGANG 4 = VEILIGHEIDSLIJST) 2e niveau Ob=02 (INGANG  =VEILIGHEIDSLIJST)

Andere veiligheidsvoorzieningen
OPEN A
Andere veiligheidsvoorzieningen OPEN A
GND
NEDERLANDS

OPEN B / CLOSE GND


SAFE / STOP - SAFE / OPEN B / CLOSE
- FSW OP STOP
GND FSW OP
FSW CL GND
+24V FSW CL
+24V Fig. 14
Als geen inrichtingen met een NG-contact (andere veiligheidsinrichtingen) worden gebruikt, moet de
SAFE-ingang met -OUT worden doorverbonden als FAIL-SAFE is geactiveerd, of met GND als FAIL-SAFE is
gedeactiveerd.
E721 7 532014 - Rev. D
5 PROGRAMMERING De gewijzigde programmeringsparameters
treden in werking zodra ze worden uitgevoerd,
Om de werking van het automatische systeem te programmeren, terwijl de definitieve opslag in het geheugen
moet u naar P5OG5AMME5ING gaan. pas plaatsvindt wanneer de programmering
De programmering bestaat uit twee delen: NIVEAU 1, NIVEAU 2. wordt afgesloten en wordt teruggekeerd
naar de statusweergave van de ingangen.
Gewoonlijk wordt op het scherm de status Als de voeding naar de apparatuur wordt
van het automatische systeem getoond. Door losgekoppeld vòòr terugkeer naar de
op de knop F te drukken of door gelijktijdig statusweergave van de ingangen, gaan alle
op F en + te drukken, krijgt u toegang tot aangebrachte wijzigingen verloren.
respectievelijk programmering niveau 1 of Het is mogelijk om, vanuit elk punt van de
niveau 2. Tijdens de werking op batterijen programmering op niveau 1 en 2, terug
staat het display uit. Druk kort op de toets + te keren naar de statusweergave van de
om de status van het automatisch systeem ingangen en alle tot op dat moment gewijzigde
weer te geven. parameters op te slaan, door gelijktijdig op de
Om de default instellingen te resetten, hoeft toetsen F en - te drukken.
u alleen de gewenste default instelling Bij de inschakeling van de kaart verschijnt op
opnieuw te laden bij de eerste stap van de het scherm LCD1 gedurende enkele seconden
programmering op niveau 1. de softwareversie van de kaart in twee cijfers
gescheiden door een punt.
5.1 PROGRAMMERING NIVEAU 1
Om toegang te krijgen tot de programmering op niveau 1, moet u op toets F drukken.
‡ Als de toets F wordt ingedrukt (en ingedrukt wordt gehouden), verschijnt de naam van de functie op het display.
‡ Door de knop los te laten, verschijnt de waarde van de functie op het scherm; deze kan worden gewijzigd met
de toetsen + en -.
‡ Door opnieuw op F te drukken (en ingedrukt te houden) toont het scherm de naam van de volgende functie,
enzovoorts.
‡ :anneer bij de laatste functie de knop F wordt ingedrukt, wordt de programmering verlaten en worden de pa-
rameters opgeslagen. Het scherm toont opnieuw de status van het automatische systeem.

PROGRAMMERING NIVEAU 1

Display Functie Default 1


DEFAULT:
dF 1 Configureert de parameters met DEFAULT-waarden.
1
CU :anneer de knop F wordt losgelaten, verschijnt de waarde CU , wat betekent dat
de gewijzigde standaard configuratie is geselecteerd door middel van de knoppen
en het display. Als u deze programmering wilt behouden, moet u opnieuw op de
toets F drukken, of anders op + drukken en de default 1 selecteren.
CONFIGURATIE MASTER/SLAVE:
Ct MA Configureert de kaart in de MASTER-modus
MA
SL Configureert de kaart in de SLAVE-modus
Als de kaart in de SLAVE-modus wordt geconfigureerd, worden de parameters
LO-PA-Pb-Ph-Op niet weergegeven (voor werking Master/Slave zie Par. 7.4)
BEDRIJFSLOGICA'S
LO E Halfautomatisch. E
EP Halfautomatisch Stap-voor-stap.
A Automatisch.
A1 Automatisch1.
AP Automatisch Stap-voor-stap.
At Automatisch met timer.
S Automatisch Beveiligingen.
SP Automatisch Beveiligingen stap-voor-stap.
SA Automatisch met omkering in pauze
b Halfautomatisch “b”.
bC Gemengd (AP met impuls/ CH met dead man).
C Dead man.
Parameter niet weergegeven in SLAVE-modus
NEDERLANDS

PAUZETIJD A:
PA De pauzetijd ten opzichte van een commando voor VOLLEDIGE opening. Heeft alleen effect
20
als een automatische bedrijfslogica is geselecteerd. Instelbaar van 0 tot 59 sec. in stappen
van een seconde.
Vervolgens verandert de weergave in minuten en tienden van seconden (gescheiden door een punt)
en is de tijd instelbaar in stappen van 10 seconden, tot de maximumwaarde van 9.5 minuten.
Bijv.: als het scherm 2.5 aangeeft, correspondeert de pauzetijd met 2 min. en 50 sec.
Parameter niet weergegeven in SLAVE-modus

E721 8 532014 - Rev. D


Display Functie Default 1
PAUZETIJD B:
Pb De pauzetijd ten opzichte van een comando voor GEDEELTELIJKE opening. Heeft alleen
20
effect als een automatische bedrijfslogica is geselecteerd. Instelbaar van 0 tot 59 sec. in
stappen van een seconde.
Vervolgens verandert de weergave in minuten en tienden van seconden (gescheiden door een punt)
en is de tijd instelbaar in stappen van 10 seconden, tot de maximumwaarde van 9.5 minuten.
Bijv.: als het scherm 2.5 aangeeft, correspondeert de pauzetijd met 2 min. en 50 sec..
Parameter niet weergegeven in SLAVE-modus
MOTORVERMOGEN:
FO 5egelt de hoogte van het motorvermogen.
50
01 = minimaal vermogen
50 = maximaal vermogen
Wanneer de waarde van het vermogen wordt gewijzigd, is het raadzaam
een nieuwe SETUP uit te voeren (zie par. 7.3)
SNELHEID OPENING:
So 5egelt de openingssnelheid van de motor op 10 niveaus.
08
01 = minimumsnelheid
10 = maximumsnelheid
Wanneer de waarde van de snelheid wordt gewijzigd, is het raadzaam een
nieuwe SETUP uit te voeren (zie par. 7.3)
SNELHEID SLUITING:
Sc 5egelt de sluitingssnelheid van de motor op 10 niveaus.
08
01 = minimumsnelheid
10 = maximumsnelheid
Wanneer de waarde van de snelheid wordt gewijzigd, is het raadzaam een
nieuwe SETUP uit te voeren (zie par. 7.3)
VERTRAGING BIJ OPENING:
ro 5egelt de vertragingsafstand als percentage van het totale loopvlak van de poort. Instelbaar
20
van 5 (met een snelhleid < 5), 10 (met een snelheid tussen 5 en 8), 15 (met een snelheid
> 8) tot 99 %. in stappen van 1%.

5-10-15 = minimale vertraging


99 = maximale vertraging
VERTRAGING BIJ SLUITING:
rc 5egelt de vertragingsafstand als percentage van het totale loopvlak van de poort. Instelbaar
20
van 5 (met een snelhleid < 5), 10 (met een snelheid tussen 5 en 8), 15 (met een snelheid
> 8) tot 99 %. in stappen van 1%.
5-10-15 = minimale vertraging
99 = maximale vertraging
VERTRAGINGSSNELHEID:
Sr 5egelt de snelheid van de poort tijdens de vertraging.
0
0 = LAGE snelheid
1 = HOGE snelheid
STATUS VAN HET AUTOMATISCHE SYSTEEM:
St Verlaten van de programmering, opslag van de gegevens in het geheugen en terugkeer naar de
statusweergave van het automatische systeem
NEDERLANDS

00 = DICHT 07 = FAIL SAFE actief


01 = OPEN 08 = controle actieve BUS-2EAS<-inrichtingen
02 = Gestopt daarna “OPENEN” 09 = Voorknipperen daarna “OPENEN”
03 = Gestopt daarna “SLUITEN” 10 = Voorknipperen daarna “SLUITEN”
04 = In “PAUZE” 11 = OPEN bij Gedeeltelijke opening
05 = Gaat open 12 = In PAUZE bij Gedeeltelijke opening
06 = Gaat dicht

E721 9 532014 - Rev. D


5.2 PROGRAMMERING NIVEAU 2
Om toegang te krijgen tot de P5OG5AMME5ING NIVEAU 2 moet op de knop F worden gedrukt en, terwijl deze ingedrukt blijft,
op de knop +:
‡ door ook de knop F los te laten, verschijnt de waarde van de functie op het scherm; deze kan worden gewijzigd met
de toetsen + en -.
‡ door op de toets F te drukken (en deze ingedrukt te houden) verschijnt de naam van de volgende functie; als hij
wordt losgelaten verschijnt de waarde die kan worden gewijzigd met de toetsen + en -.
‡ wanneer bij de laatste functie de knop F wordt ingedrukt, wordt de programmering verlaten en toont het scherm
opnieuw de status van het automatische systeem.
PROGRAMMERING NIVEAU 2

Display Functie Default 1


MAX. VERMOGEN BIJ AANLOOP:
bo De motor werkt op maximaal vermogen (ongeacht het geselecteerde vermogensniveau) no
tijdens de aanloop van de beweging.
Y = actief
no = uitgeschakeld
VOORKNIPPERFUNCTIE:
PF Hiermee kunnen 5 voorknipperfuncties worden geselecteerd die  seconden duren. no
no = geen voorknipperfunctie.
OC = voorknipperen voor elke beweging.
CL = voorknipperen voor een sluiting.
OP = voorknipperen voor een opening.
PA = voorknipperen alleen bij einde pauze
VOORKNIPPERTIJD (alleen zichtbaar wanneer in het vorige menu een voorknipperfunctie
tP is geselecteerd): 03
5egelt de voorknippertijd van 1 tot 10 sec. in stappen van 1 seconde.
01 = minimale voorknippering
10 = maximale voorknippering
FOTOCELLEN BIJ SLUITING:
Ph Activeer deze functie als u wilt dat de fotocellen bij sluiting de beweging blokkeren en deze
no
omkeren bij deactivering. Gewoonlijk, als deze functie is uitgeschakeld, zorgt de interventie
van de fotocellen bij sluiting voor een onmiddellijke omkering van de beweging van de
poort.
Y = omkering bij deactivering
n o = onmiddellijke omkering bij opening
Parameter niet weergegeven in SLAVE-modus
FOTOCELLEN BIJ OPENING:
oP Activeer deze functie als u wilt dat de fotocellen bij opening de beweging blokkeren en deze
no
omkeren bij sluiting. Gewoonlijk, als deze functie is uitgeschakeld, zorgt de interventie van de
fotocellen bij opening voor de hervatting van de beweging bij hun deactivering.
Y = onmiddellijke omkering bij sluiting
n o = hervatting van de beweging bij deactivering
Parameter niet weergegeven in SLAVE-modus
FUNCTIE ADMAP:
Ad Zorgt voor de werking volgens de Franse norm NFP 25/62.
no
Y = actief
n o = uitgeschakeld
ENCODER:
EC De virtuele encoder die zich op de kaart bevindt, werkt als beknellingsbeveiliging en regelt
02
de startpunten voor de vertraging en de gedeeltelijke opening.
NEDERLANDS

Indien de poort, tijdens het openen of het sluiten, tegen een obstakel botst, zorgt de virtuele
encoder voor de omkering van de beweging. Een tweede obstakel dat in dezelfde richting
wordt waargenomen, veroorzaakt de uitschakeling van de motor. In beide gevallen wordt er
een alarmmelding gegenereerd (zie par. alarmmeldingen)
De gevoeligheid van de virtuele encoder moet worden ingesteld door de wachttijd, voordat
de kaart het commando geeft tot omkering van de beweging, in te stellen van minimaal
0 sec tot maximaal 10 sec in stappen van een seconde.
00 = maximale gevoeligheid
10 = minimale gevoeligheid
E721 10 532014 - Rev. D
Display Functie Default 1
GEDEELTELIJKE OPENING:
PO Het is mogelijk de omvang van de gedeeltelijke opening van de vleugel in te stellen als 50
percentage van het totale loopvlak van de poort.
Instelbaar van 0 tot 99 %. in stappen van 1%.
00 = geen gedeeltelijke opening
01 = minimale gedeeltelijke opening
99 = maximale gedeeltelijke opening
WERKTIJD (time-out):
t Het is handig om een hogere waarde in te stellen dan de tijd die de poort nodig heeft om 2.0
volledig te openen en te sluiten.
Instelbaar van 0 tot 59 sec. in stappen van 1 seconde. Vervolgens verandert de weergave
in minuten en tienden van seconden (gescheiden door een punt) en is de tijd instelbaar in
stappen van 10 seconden, tot de maximumwaarde van 9.5 minuten.
Bijv.: als het scherm 2.5 aangeeft, correspondeert de pauzetijd met 2 min. en 50 sec.
In geval van een installatie met een MASTER/SLAVE-configuratie moet een WER
KINGSTIJD op de MASTER-besturingseenheid worden ingesteld die met de
bewegingstijd van beide vleugels rekening houdt.
OUT 1:
o1 Hiermee kan de uitgang OUT (open collector N.A.) worden geactiveerd in een van de 00
volgende funties:
00 = Altijd actief (geeft spanning 24V= met maximale absorptie van 100 mA)
01 = FAIL-SAFE (Controleer of de aangesloten traditionele fotocellen goed werken)
02 = CONT5OLELAMPJE (gedoofd als de poort dicht is, brandt tijdens het openen open/pauze, knippert
tijdens het sluiten)
03 = VE5LICHTING (zie volgende functie)
04 = ALA5M werkt op ACCU
05 = poort OPEN of in PAUZE
06 = poort DICHT
07 = poort in BE:EGING
08 = poort gaat OPEN
09 = poort gaat DICHT
1 0 = beveiliging ACTIEF
1 1 = tijdgeschakelde uitgang kan worden geactiveerd vanaf het tweede radiokanaal (zie
volgende functie)
1 2 = uitgang kan worden geactiveerd vanaf het tweede radiokanaal (werking stap-voor-stap)
t1 UITSCHAKELTIJD OUT 1 (alleen zichtbaar als bij de vorige stap het item 03 of 11 is geselecteerd):
Hiermee kan de uitschakeltijd van de uitgang OUT worden ingesteld indien een tijdswerking
02
is geselecteerd (zoals bijv. 03 of 11 ) van 1 tot 99 minuten, in stappen van 1 minuut
OPEN B / CLOSE / VEILIGHEIDSLIJST:
Ob Het is mogelijk om het gebruik van de ingang OPEN B te selecteren als gedeeltelijke opening 00
, commando CLOSE of VEILIGHEIDSLIJST.
00 = OPEN B
01 = CLOSE
02 = VEILIGHEIDSLIJST (NG-contact)
Indien er een bedrijfslogica is geselecteerd dat gebruik maakt van het
commando CLOSE (logica b, bC, C) dan is deze functie vooraf ingesteld als 01
en kan niet meer worden gewijzigd.
OPEN B / VEILIGHEIDSLIJST
SP Het is mogelijk om het gebruik van de ingang STOP te selecteren als STOP of VEILIGHEIDSLIJST. 00
00 = STOP
01 = VEILIGHEIDSLIJST (NG-contact)
GEDEELTELIJKE OMKERING:
IP Het type omkering (volledig of gedeeltelijk) vanwege een obstakel of na ingrijpen door de no
veiligheidslijst is instelbaar.
Y = Activering gedeeltelijke omkering. In geval van een obstakel of door activering van
NEDERLANDS

een veiligheidslijst wordt de beweging van de vleugel de ongeveer 2 sec. omgekeerd,


om vervolgens te stoppen
no = Deactivering gedeeltelijke omkering. In geval van een obstakel of door activering van een
veiligheidslijst wordt de beweging van de vleugel volledig omgekeerd tot hij helemaal open
of dicht is.
MOTORBLOKKERING:
Lc Het is mogelijk om het gebruik van de motorblokkering te selecteren tijdens de werking op accu: Y
Y = de motorblokkering blijft gewoon functioneren ook tijdens de werking op accu
no = wanneer wordt overgegaan op de werking op accu blijft de motorblokkering
altijd open.
E721 11 532014 - Rev. D
Display Functie Default 1
VERZOEK OM ASSISTENTIE - CYCLUSTELLER (in combinatie met de twee volgende functies):
AS Y = wanneer het aantal cycli is bereikt die instelbaar zijn met de volgende functies nc no
en nd wordt er gedurende 8 sec. voorgeknipperd (naast de eventuele tijd die al is
ingesteld met de functie PF ) vóór elke beweging.
no = de volgende functies nc en nd geven aan hoeveel cycli het systeem heeft uitgevoerd
tot een maximum weer te geven aantal van 99Ü990.
$OVKHWDDQWDOXLWJHYRHUGHF\FOLPHHUEHGUDDJWGDQÜ]XOOHQGHWZHH
volgende functies nc en nd respectievelijk 99 en 99 weergeven.
Deze functie kan handig zijn om geplande onderhoudsbeurten in te stellen of om te con-
troleren hoeveel bedrijfscycli er zijn uitgevoerd.
PROGRAMMERING CYCLI (DUIZENDTALLEN):
nc Als AS = Y geeft het scherm het aantal cycli waarna om assistentie wordt gevraagd in
00
duizendtallen weer (instelbaar van 0 tot 99 ).
Als AS = no geeft het display het aantal cycli dat is uitgevoerd in duizendtallen weer. De
weergegeven waarde wordt aangepast naarmate het aantal cycli toeneemt, wat
invloed heeft op de waarde nd .
Als AS = no kan de cyclusteller worden gereset door de toetsen + en -
gedurende 5 sec. in te drukken.
PROGRAMMERING CYCLI (TIENTALLEN):
nd Als AS = Y geeft het scherm het aantal cycli waarna om assistentie wordt gevraagd in
00
tientallen weer (instelbaar van 0 tot 99 ).
Als AS = no geeft het display het aantal cycli dat is uitgevoerd in tientallen weer. De weer-
gegeven waarde wordt aangepast naarmate het aantal cycli toeneemt, wat invloed
heeft op de waarde nc .
%LMYRRUEHHOGDOVKHWV\VWHHPÜKHHIWXLWJHYRHUGYHUVFKLMQWHUnc = 11
en nd = 21
STATUS VAN HET AUTOMATISCHE SYSTEEM:
St Verlaten van de programmering, opslag van de gegevens in het geheugen en terugkeer naar de statusweergave
van het automatische systeem.
00 = DICHT 07 = FAIL SAFE actief
01 = OPEN 08 = controle actieve BUS-2EAS<-inrichtingen
02 = Gestopt daarna “OPENEN” 09 = Voorknipperen daarna “OPENEN”
03 = Gestopt daarna “SLUITEN” 10 = Voorknipperen daarna “SLUITEN”
04 = In “PAUZE” 11 = OPEN bij Gedeeltelijke opening
05 = Gaat open 12 = In PAUZE bij Gedeeltelijke opening
06 = Gaat dicht
6 GEHEUGENOPSLAG RADIOCODERING 6.1 GEHEUGENOPSLAG VAN DE DS-
De elektronische RADIOBESTURINGEN
apparatuur is voorzien Fig. 15
van een gewntegreerd Er kunnen maximaal 256 codes verdeeld
t w e e k a n a a l s over OPEN A en OPEN B/CLOSE in het ge-
decoderingssysteem heugen worden opgeslagen.
(DS, SLH, LC/5C) met
de naam OMNIDEC.  1. Kies op de DS-radiobesturing de gewenste combinatie
Met dit systeem kan, ON - OFF van de 12 dipschakelaars.
door middel van een 2. Houd de toets + (S:) of - (S:2) ingedrukt en druk
extra ontvangstmodule daarna op de SETUP-toets (S:4), om respectievelijk de
( f i g . 1 5 r e f.  ) e n volledige opening (OPEN A) of de gedeeltelijke ope-
radiobesturingen met dezelfde frequentie, zowel de volledige ning (OPEN B/CLOSE) op te slaan. De overeenkomstige
opening (OPEN A) als de gedeeltelijke opening (OPEN B)
van het automatische systeem in het geheugen worden
led knippert langzaam gedurende 5 sec.
opgeslagen. . Laat beide toetsen weer los.
De 3 types radiocoderingen (DS, SLH, LC/RC) 4. Druk binnen deze 5 sec. op de gewenste toets van
kunnen tegelijkertijd naast elkaar op de twee de radiobesturing.
NEDERLANDS

kanalen bestaan. Er kunnen maximaal 256 5. De bijbehorende led zal gedurende 1 seconde bran-
radiocoderingen, verdeeld over OPEN A en den en daarna doven, wat aangeeft dat de gegevens
OPEN B, worden ingevoerd zijn opgeslagen.
Om verschillende coderingssystemen op 6. Om meer en andere codes toe te voegen dan die
hetzelfde kanaal te gebruiken, moet het reeds zijn opgeslagen, moet de procedure vanaf punt
zelflerende proces van elk systeem worden 1 worden herhaald.
beëindigd en moet vervolgens de procedure
voor het andere worden herhaald.
Sluit geen enkele radiovoorziening op de als
SLAVE geconfigureerde apparatuur aan.

E721 12 532014 - Rev. D


7. Om radiobesturingen met dezelfde code te kunnen 6.3 GEHEUGENOPSLAG VAN DE
gebruiken, moet dezelfde combinatie ON - OFF wor- LC/RC-RADIOBESTURINGEN
den gekopieerd naar de andere radiobesturingen,
zonder dat er iets op de besturingskaart hoeft te wor- Er kunnen maximaal 256 codes, verdeeld
den gewijzigd. over OPEN A en OPEN B/CLOSE, in het ge-
heugen worden opgeslagen.
6.2 GEHEUGENOPSLAG VAN DE
SLH-RADIOBESTURINGEN Gebruik de LC/RC-afstandsbedieningen
Er kunnen maximaal 256 codes, verdeeld alleen met een ontvangsmodule van
over OPEN A en OPEN B/CLOSE, in het ge- 433 MHz.
heugen worden opgeslagen. 1. Houd de toets + (S:) of - (S:2) ingedrukt en druk
1. Druk op de SLH-radiobesturing de toetsen P1 en P2 daarna op de SETUP-toets (S:4), om respectievelijk
gelijktijdig in en houd deze ingedrukt. de volledige opening (OPEN A) of de gedeeltelijke
2. De led van de radiobesturing begint te knipperen. opening (OPEN B/CLOSE) op te slaan. De bijbehorende
led knippert langzaam gedurende 5 sec.
. Laat beide toetsen los.
2. Laat de toets weer los.
4. Houd de toets + (S:) of - (S:2) ingedrukt en druk
daarna op de SETUP-toets (S:4), om respectievelijk . Druk binnen deze 5 sec. op de gewenste toets van
de volledige opening (OPEN A) of de gedeeltelijke de LC/5C-afstandsbediening.
opening (OPEN B/CLOSE) op te slaan. De bijbehorende 4. De led zal gedurende 1 seconde branden, wat
led knippert langzaam gedurende 5 sec. aangeeft dat de gegevens zijn opgeslagen, om ver-
5. Laat de beiden toetsen weer los. volgens gedurende 5 sec. te knipperen. Binnen deze
tijd kan een andere radiobesturing in het geheugen
6. Druk binnen deze 5 sec., terwijl de led van de radio- worden opgeslagen.
besturing nog steeds knippert, op de gewenste toets
op de radiobesturing en houd hem ingedrukt (de led 5. Na deze 5 sec. zal de led doven, wat aangeeft dat
van de radiobesturing zal gaan branden). de procedure is voltooid.
7. De led op de kaart zal gedurende 2 seconden gaan 6.3.1 GEHEUGENOPSLAG OP AFSTAND
branden en daarna doven, wat aangeeft dat de VAN DE LC/RC-RADIOBESTURINGEN
gegevens zijn opgeslagen. Bij de LC/5C-radiobesturingen is het mogelijk om op af-
8. Laat de toets van de radiobesturing weer los. stand andere radiobesturingen in het geheugen op te
9. Druk de toets van de opgeslagen radiobesturing twee slaan, dat wil zeggen zonder direct handelingen aan de
maal kort achter elkaar in. kaart te verrichten, maar door een eerder opgeslagen
radiobesturing te gebruiken.
Het automatische systeem zal de poort 1. Neem een radiobesturing die al op een van de 2 ka-
openen. Controleer of het automatische nalen (OPEN A of OPEN B/CLOSE) is opgeslagen.
systeem niet wordt gehinderd door obsta- 2. Druk gelijktijdig op de toetsen P1 en P2 en houd deze
kels in de vorm van personen of voorwer- ingedrukt totdat beide leds gedurende 5 sec. lang-
pen. zaam knipperen.
Om andere radiobesturingen met dezelfde systeemcode . Druk binnen 5 sec op de eerder opgeslagen toets van
te kunnen gebruiken, moet de systeemcode van de toets de radiobesturing om het zelflerende proces op het
van de opgeslagen radiobesturing worden overgezet op geselecteerde kanaal te activeren.
de overeenkomstige toets van de radiobesturingen die 4. De led op de kaart die bij het kanaal in de zelflerende
worden toegevoegd, door als volgt te werk te gaan: fase hoort, knippert gedurende 5 sec. Binnen dit tijds-
a. Druk op de opgeslagen radiobesturing de toetsen bestek moet de code van een andere radiobesturing
P1 en P2 gelijktijdig in en houd ze ingedrukt. worden verzonden.
b. De led van de radiobesturing begint te knippe- 5. De led zal gedurende 1 sec. branden, wat aangeeft
ren. dat de gegevens zijn opgeslagen, om vervolgens
c. Laat de beiden toetsen los. gedurende 5 sec. te knipperen. Binnen deze tijd kun-
nen andere radiobesturingen in het geheugen worden
d. Druk op de opgeslagen toets en houd hem in-
opgeslagen, waarna de led weer dooft.
gedrukt (de led van de radiobesturing begint te
branden). 6.4 RADIOBESTURINGEN UIT HET GEHEUGEN WISSEN
e. Houd de radiobesturingen dicht bij elkaar, druk Om ALLE ingevoerde codes van de radiobesturingen te
op de betreffende toets van de radiobesturing wissen, hoeft u alleen de twee toetsen + (S:) en - (S:2)
die wordt toegevoegd en laat hem pas weer los tegelijkertijd ingedrukt te houden, druk ververvolgens gedu-
nadat de led van de radiobesturing twee keer rende een seconde op de SETUP-toets (S:4) en houd de
heeft geknipperd, wat aangeeft dat de gegevens eerste twee toetsen gedurende 10 sec. ingedrukt.
zijn opgeslagen. ‡ De 2 leds 5ADIO1 en 5ADIO2 zullen gedurende 10 sec.
f. Druk de toets van de opgeslagen radiobesturing snel knipperen.
NEDERLANDS

twee maal kort achter elkaar in. ‡ De 2 leds zullen gedurende 2 sec. branden en daarna
doven (wissen voltooid).
Het automatische systeem zal de poort
‡ Laat de beiden toetsen weer los.
openen. Controleer of het automatische
systeem niet wordt gehinderd door obsta- Deze handeling kan NIET ongedaan worden
kels in de vorm van personen of voorwer- gemaakt. Alle codes van de radiobesturin-
pen. gen die zowel als OPEN A of OPEN B/CLOSE
in het geheugen zijn opgeslagen, zullen
worden gewist.

E721 13 532014 - Rev. D


7 INBEDRIJFSTELLING
7.1 CONTROLE VAN DE LEDs
Controleer, nadat alle aansluitingen zijn uitgevoerd en de voeding van de kaart is ingeschakeld, aan de hand van
de onderstaande tabel de status van de leds ten opzichte van de status van de ingangen (in fig. 16 bevindt het
automatische systeem zich in de gesloten rustpositie). Deze leds geven de status van de ingangen van de kaart aan
en zijn van wezenlijk belang voor de beweging van het automatische systeem:
NB: LED AAN = contact gesloten LED UIT = contact open

< (1) F
BUS 2EASY
< (2)
< OPEN A -
< GND
< OPEN B / CLOSE < SAFE
+

R
A
C

1
RADIO XF

R
2
IO

E
FC
FC

IO

O
< STOP / SAFE

W
R
D

O
R
A

P
R
< FSW OP

R
SETUP
< GND
< FSW CL
< +24

USB

BATTERY
RELEASE
Y
R
)

R
F

OUT
-L

E
S

S
E IN

TO
R M

K
K
K
T
-N

N
T EC

C
T
T RI

C
C
(P A

- +
A

LO
LA

LO
LO
M

R
P

M
B
<

<

<

<

<

<

<
<
<

Fig. 16

De leds FCA en FCC vertegenwoordigen de NG-contacten De ingangen STOP (SAFE), FSW CL, FSW OP,
OPEN B geconfigureerd als SAFE zijn ingangen
van de gewntegreerde eindaanslag op de kaart. :anneer
voor veiligheidsinrichtingen met NG-contact
ze zijn geactiveerd, openen ze, waardoor de bijbehorende (normaliter gesloten), dus als het automatisch
led dooft. systeem in de ruststand staat moeten de
bijbehorende leds BRANDEN; ze doven
Automatisch systeem FCA wanneer de aangesloten inrichting wordt
DICHT FCC FCC actief
ingeschakeld.
De ingangen OPEN A, OPEN B/CLOSE zijn
Automatisch systeem FCA FCA actief ingangen met NO-contact (normaliter
open), dus als het automatisch systeem in de
OPEN FCC ruststand staat moeten de bijbehorende leds
GEDOOFD zijn, ze gaan branden wanneer de
Tab. 3 - Beschrijving POWER-leds aangesloten inrichting wordt ingeschakeld.
In geval van als SLAVE geprogrammeerde
Brandt Netvoeding aanwezig. apparatuur moeten de bijbehorende leds
op klemmenbord J13 gedoofd zijn.
Knippert Accuvoeding. Als de led ERROR knippert, betekent dit dat
er een alarmmelding actief is (een situatie
die geen afbreuk doet aan de werking van
Uit Kaart uitgeschakeld.
de poort).

Als de led ERROR brandt, betekent dit dat er


een fout actief is (een situatie die de werking
NEDERLANDS

7.2 WERKING OP BATTERIJEN verhindert, totdat de oorzaak van de fout


LET OP wordt weggenomen).
Voor een zo zuinig mogelijk verbruik en om de batterij te sparen, zijn als tijdens de werking op batterijen het automatisch
systeem stil staat en het systeem in stand-by staat, het display LCD1, de led BUS 2easy en de leds FCC en FCA gedoofd,
terwijl de led PO:E5 knippert.
In deze fase kan wel de status van het automatisch systeem worden weergegeven. Om dat te doen moet kort op de
toets + op de kaart worden gedrukt. Na het kort indrukken toont het display LCD1 ongeveer 2 seconden de status van het
automatisch systeem, om vervolgens weer te doven. Gedurende de normale beweging werken alle diagnoseleds en de
signaleringen van de status van het display daarentegen weer conform de daadwerkelijke toestand van het automatisch
systeem (zie Fig. 16).
E721 14 532014 - Rev. D
7.3 POSITIONERING VAN DE EINDAANSLAG
Voor een juiste positionering van de eindaanslagmagneten moet de bedieningscentrale op de juiste
wijze zijn geïnstalleerd en zijn aangesloten op alle bedieningsinrichtingen en veiligheidsvoorzieningen.
De aandrijving is voorzien van een magneetsensor voor de eindaanslag die direct in de elektronische besturingskaart is
gewntegreerd.
Het stoppen van de poort, in geopende of gesloten toestand, vindt plaats op het moment dat de gepolariseerde magneet,
die in het bovenste deel van de tandheugel is bevestigd, de sensor activeert.Controleer of de aandrijving is ingesteld voor
de handmatige bediening, volgens de instructies van de aandrijving.
1. Breng de poort handmatig in de geopende positie tot op 40 mm vanaf de mechanische
eindaanslag (zie fig. 17).
2. Schuif de magneet met de CIRKEL over de tandheugel in de richting van de motor. Zodra de

A
C

R O1

2
led op de kaart die bij de eindaanslag FCA hoort dooft, moet de magneet met de bijbehorende

FC
FC

IO
I
D

D
schroeven worden bevestigd.

R
A

E
R
. Breng de poort handmatig in de gesloten positie tot op 40 mm vanaf de mechanische
eindaanslag.
4. Schuif de magneet met het VIERKANT over de tandheugel in de richting van de motor. Zodra
de led op de kaart die bij de eindaanslag FCC hoort dooft, moet de magneet met de
bijbehorende schroeven worden bevestigd.

A
C

R O1

2
5. Controleer of aan het einde van de beweging, zowel in de geopende als in de gesloten

FC
FC

IO
I
D

R
A
positie, de led van de betreffende eindaanslag op de juiste wijze dooft en wijzig indien nodig

E
R
de positie van de eindaanslagmagneten.
Om schade aan de aandrijving en/of onderbrekingen van de werking van het
automatische systeem te voorkomen, moet er een afstand van circa 40 mm
vanaf de mechanische eindaanslagstops worden overgelaten.

Voor een correcte werking


van de aandrijving moet
de magneet met de
CIRKEL als eindaanslag
voor de OPENING worden
gebruikt en de magneet
met het VIERKANT als
eindaanslag voor de
SLUITING
(ZIE FIG. 17)
In geval van een installatie
met een MASTER/SLAVE-
configuratie moeten
de magneten van de
eindschakelaars worden
geïnstalleerd zoals
aangegeven in Fig. 18.

Fig. 17
NEDERLANDS

MASTER/SLAVE

Fig. 18

E721 15 532014 - Rev. D


7.4 CONFIGURATIES MASTER / SLAVE
Als een installatie moet worden vervaardigd met tegenoverstaande vleugels die tegelijkertijd moeten worden
ingeschakeld voor het openen en sluiten van de doorgang, moeten de twee apparaten E721 in de modus Master-/
Slave worden aangesloten en geconfigureerd.
Voor een goede werking van de installatie moeten alle noodzakelijke voorzieningen (fotocellen, veiligheidsvoorzieningen,
radio, openingsimpulsen, waarschuwingslamp) op de MASTE5-apparatuur zijn aangesloten (parameter C t van het
eerste programmeerniveau geconfigureerd als M A ), terwijl bij de SLAVE-apparatuur (parameter C t van het eerste
programmeerniveau geconfigureerd als S L ) geen enkele kabel op klemmenbord J1 mag zijn aangesloten,
aangezien de bestaande ingangen volkomen worden genegeerd. De twee apparaten communiceren onderling
via de BUS-2EAS< middels een GEPOLARISEERDE tweepolige kabel op klemmenbord J12.
De MASTE5-apparatuur heeft volledige controle over de SLAVE-apparatuur door middel van de BUS-2EAS<, en beheert
alle bewegingen en tijden van beide vleugels.
Zorg dat er geen voorzieningen of kabels op klemmenbord J13 van de SLAVE-besturingseenheid
zijn aangesloten.

De BUS-aansluiting tussen de twee kaarten moet GEPOLARISEERD zijn ten opzichte van de volgorde
van de polen van klemmenbord J12 (POOL (1) - POOL (2)) - (zie Fig. 19).

Als een besturingseenheid als SLAVE wordt geconfigureerd, worden de waarden van een aantal
programmeerparameters die niet meer in het menu zijn weergegeven, geforceerd (LO-PA-Pb-
Ph-Op). Als de kaart weer in de MASTER-modus wordt gebracht, worden deze eerder geforceerde
waarden in de programmering gehandhaafd.
7.4.1 BEKABELING MASTER/SLAVE

(1) (1)
BUS 2 EASY BUS 2 EASY
(2) (2)

Sluit niets op dit


klemmenbord aan

E721 MASTER E721 SLAVE


Fig. 19

7.4.2 SET-UP-PROCEDURE MASTER/SLAVE

Het SET-UP-verzoek, gesignaleerd door het knipperen van de code S0 op het display, kan op
zowel de MASTER- als de SLAVE-besturingseenheid verschijnen. In het tweede geval verschijnt op
de MASTER-besturingseenheid foutmelding 91 . In elk geval kan een SET-UP-procedure uitsluitend
vanaf de MASTER-besturingseenheid worden gestart.

Handel als volgt om de SET-UP van een MASTE5/SLAVE-installatie uit te voeren:

1. Ontgrendel beide vleugels, zet ze half open en vergrendel ze weer (zie procedure n. 1 par. 7.5 SET-UP)
2. Houd de SET-UP-toets van de MASTE5-kaart ingedrukt tot de MASTE5-poort begint te bewegen.
. De MASTE5-poort voert nu een volledige SET-UP-procedure uit (zie par. 7.5 SET-UP)
4. Als de SET-UP-procedure van de MASTE5-kaart eenmaal correct is uitgevoerd, begint de volledige SET-UP-procedure
NEDERLANDS

van de SLAVE-kaart (zie par. 7.5 SET-UP)


5. Als ook deze procedure is voltooid, controleert de MASTE5 de positie van de SLAVE-vleugel, die in dezelfde stand
(open of gesloten) als de MASTE5-vleugel wordt gezet.
6. Procedure voltooid.

Als de hierboven beschreven SET-UP-procedure niet volledig of verkeerd wordt uitgevoerd, moet
hij helemaal worden herhaald vanaf punt 1.

E721 16 532014 - Rev. D


7.4 SETUP 9 SIGNALERING VAN ALARMMELDINGEN
Als de voeding naar de kaart wordt EN FOUTEN
ingeschakeld terwijl er nog nooit een SETUP Indien zich alarmmeldingen (omstandigheden die geen
afbreuk doen aan de werking van de poort) of fouten
is uitgevoerd, of indien de kaart dit vereist, (omstandigheden die de werking van de poort verhinderen)
knippert op het display de afkorting S0 voordoen, kan op het display het nummer van de betreffende
samen met de SETUP-led om aan te geven conditie worden afgelezen.
dat de SETUP moet worden uitgevoerd.
De signalering van een ALARMMELDING of
Voor een goede uitvoering van de SETUP- FOUT zal bij de volgende cyclus verdwijnen
indien de oorzaak is weggenomen.
procedure, moet zorgvuldig de juiste
polariteit van de eindaanslagmagneten 9.1 ALARMMELDINGEN
worden gecontroleerd, zoals in de vorige
paragraaf is beschreven. Als er zich een ALARMMELDING voordoet,
begint de led ERROR te knipperen. Door
Om de SETUP uit te voeren, dient u als volgt te werk te gelijktijdig de toetsen + en - op het display
gaan: in te drukken, wordt het nummer van de
betreffende storing getoond.
1. Zet de poort half open (zeer belangrijk voor een In Tab. 4 worden alle alarmmeldingen getoond die op het
geslaagde SET-UP) en controleer of de leds FCA en display kunnen worden weergegeven.
FCC allebei branden. Als dat niet het geval is, dan Tab. 4 - Alarmmeldingen
signaleert de kaart fout 12 (zie tab. 5).
2. Houd de SETUP-toets (S:4) ingedrukt totdat de poort 22 Stroom MOTO5 beperkt
de vertraagde beweging start en stopt wanneer de 24 Kortsluiting uitgang LAMP
eindaanslag is bereikt. Als de bereikte eindaanslag Obstakel waargenomen (zichtbaar gedu-
de eindaanslag voor sluiting is (met het VIERKANT) zal 27 rende 10 sec.)
de apparatuur dit punt opslaan als stop bij sluiting, Geheugen radiocodes XF-module vol (zicht-
vice versa als de eindaanslag die voor de opening is 30 baar gedurende 10 sec.)
(met de CIRKEL) zal de apparatuur dit punt opslaan 40 Verzoek om assistentie
als stop bij opening. In deze fase knippert op het
display S 1 . 46 Geforceerde resetting default programmering
. De poort start de vertraagde beweging automatisch 9.2 FOUTEN
in de tegenovergestelde richting en stopt wanneer de
Als er zich een FOUT voordoet, begint de led
eindaanslag is bereikt. Als de bereikte eindaanslag de DL20 te branden. Door gelijktijdig de toetsen
eindaanslag voor opening is (met de CIRKEL) zal de + en - op het display in te drukken, wordt
apparatuur dit punt opslaan als stop bij opening, vice het nummer van de betreffende storing
versa als de eindaanslag die voor de sluiting is (met het getoond.
VIERKANT) zal de apparatuur dit punt opslaan als stop In Tab. 5 worden alle fouten getoond die op het display
kunnen worden weergegeven.
bij sluiting. In deze fase knippert op het display S 3 .
Tab. 5 - Fouten
4. Afhankelijk van de laatst bereikte eindaanslag, plaatst
de apparatuur zich in de gesloten (0 0 ) of geopende 01 Storing kaart
positie (0 1 ). In het tweede geval moet een OPEN-
impuls worden gegeven om de poort te sluiten.
03 Motorstoring
Motorblokkering geblokkeerd in gesloten positie
8 HET AUTOMATISCHE SYSTEEM TESTEN 06 (controleer de motorblokkering en vervang deze
Controleer bij voltooiing van de installatie en program- indien nodig)
mering of het systeem goed werkt. Controleer met name Poort te zwaar of veel wrijving (probeer het
de juiste interventie van de veiligheidsvoorzieningen en 07 motorvermogen te verhogen)
controleer of het systeem aan de geldende veiligheids- Fout BUS-2EAS<-inrichting (bijv.: hetzelfde adres voor
voorschriften voldoet. 08 twee paar fotocellen; controleer de adressen)
Wij herinneren eraan dat in het tweede 10 Beide eindaanslagen hebben dezelfde polariteit
programmeerniveau de parameter van
de encoder kan worden geconfigureerd 12 Eindaanslag actief bij aanvang van SETUP
(parameter EC). Deze “virtuele” encoder 15 Time-out overschreden
die zich op de kaart bevindt werkt als een Geen communicatie met de centrale SLAVE -
beknellingsbeveiliging. Als de poort tijdens 90
het openen of sluiten tegen een obstakel SLAVE-besturingseenheid ontbreekt
stoot, zorgt de “virtuele” encoder ervoor 91 Foutmelding op de SLAVE-besturingseenheid
dat de beweging wordt omgekeerd. Als
NEDERLANDS

wanneer de poort opnieuw in dezelfde 92 Foutmelding op de SLAVE-besturingseenheid


richting wordt bewogen zich op dezelfde De foutmeldingen 9 0 9 1 en 9 2 worden alleen
plaats een obstakel bevindt, wordt de weergegeven op als MASTER geconfigureerde
motor gestopt. Het is fundamenteel deze E721’s; 9 9 1 en 9 2 geven foutmeldingen
parameter correct te configureren om aan op de SLAVE-besturingseenheid. Als deze
de juiste gevoeligheid van de “virtuele” foutmeldingen worden weergegeven, wordt
encoder voor eventuele obstakels tijdens aangeraden op de SLAVE-besturingseenheid
de beweging in te stellen. het type foutmelding te controleren om het
probleem te verhelpen en de correcte werking
van de installatie te hervatten.
E721 17 532014 - Rev. D
10 BEDRIJFSLOGICA'S Als het commando SAFE tijdens de beweging
Tussen haakjes staan de effecten op de andere van de vleugel wordt geactiveerd, wordt de
ingangen met een actieve impuls. beweging onmiddellijk volledig omgedraaid. Als
het commando actief blijft terwijl het automatisch
Het commando CLOSE kan op de ingang OPEN B worden systeem stil staat, wordt de beweging ervan
geactiveerd vanuit programmering niveau 2. verhinderd.
LOGICA “E” IMPULSEN
STATUS AUTOMATISCH OPEN A OPEN B CLOSE STOP FS: OP FS: CL FS: CL/OP
S<STEEM

DICHT opent de poort opent de poort gedeeltelijk geen effect geen effect geen effect geen effect geen effect
(OPEN onderdrukt) (OPEN onderdrukt) (OPEN onderdrukt)

blokkeert en opent bij dis-


GAAT OPEN blokkeert de werking (1) blokkeert de werking sluit de poort weer blokkeert de werking zie prog. niveau 2 geen effect activering (OPEN blokkeert
- slaat CLOSE op)

OPEN sluit de poort weer (1) sluit de poort weer sluit de poort weer geen effect geen effect geen effect geen effect
(OPEN/CLOSE onderdrukt) (CLOSE onderdrukt) (OPEN/CLOSE onderdrukt)

blokkeert en opent bij dis-


keert om in opening (zie activering
GAAT DICHT opent de poort weer opent de poort weer geen effect blokkeert de werking geen effect prog. niveau 2) (OPEN blokkeert
- slaat CLOSE op)

GEBLOKKEE5D sluit de poort sluit de poort sluit de poort geen effect geen effect geen effect geen effect (OPEN blok-
(OPEN/CLOSE onderdrukt) (OPEN onderdrukt) (CLOSE onderdrukt) keert - slaat CLOSE op)

LOGICA “EP” IMPULSEN


STATUS AUTOMATISCH OPEN A OPEN B CLOSE STOP FS: OP FS: CL FS: CL/OP
S<STEEM

DICHT opent de poort opent de poort gedeeltelijk geen effect geen effect geen effect geen effect geen effect
(OPEN onderdrukt) (OPEN onderdrukt) (OPEN onderdrukt)

blokkeert en opent bij dis-


GAAT OPEN blokkeert de werking (1) blokkeert de werking sluit de poort weer blokkeert de werking zie prog. niveau 2 geen effect activering (OPEN blokkeert
- slaat CLOSE op)

OPEN sluit de poort weer (1) sluit de poort weer sluit de poort weer geen effect geen effect Geen effect geen effect
(OPEN/CLOSE onderdrukt) (CLOSE onderdrukt) (OPEN/CLOSE onderdrukt)

blokkeert en opent bij dis-


keert om in opening (zie activering
GAAT DICHT blokkeert de werking blokkeert de werking geen effect blokkeert de werking geen effect prog. niveau 2) (OPEN blokkeert
- slaat CLOSE op)
hervat de beweging in hervat de beweging in geen effect geen effect geen effect geen effect (OPEN blok-
GEBLOKKEERD omgekeerde richting. Sluit omgekeerde richting. Sluit sluit de poort (OPEN/CLOSE onderdrukt) (OPEN onderdrukt) (CLOSE onderdrukt) keert - slaat CLOSE op)
na STOP altijd na STOP altijd
LOGICA “A” IMPULSEN
STATUS AUTOMATISCH OPEN A OPEN B CLOSE STOP FS: OP FSW CL FSW CL/OP
S<STEEM

DICHT opent en sluit weer na de opent de poort gedeeltelijk geen effect geen effect geen effect geen effect geen effect
pauzetijd en sluit na pauzetijd B (OPEN onderdrukt) (OPEN onderdrukt) (OPEN onderdrukt)

blokkeert en opent bij


GAAT OPEN geen effect (1) geen effect sluit de poort weer blokkeert de werking zie prog. niveau 2 geen effect disactivering
(slaat CLOSE op)

GEOPEND IN PAUZE herlaad de pauzetijd (1) herlaad de pauzetijd B sluit de poort weer blokkeert de werking geen effect herlaad de pauzetijd herlaad de pauzetijd
(CLOSE onderdrukt) (CLOSE onderdrukt)

keert om in opening (zie blokkeert en opent bij


GAAT DICHT opent de poort weer opent de poort weer geen effect blokkeert de werking geen effect prog. niveau 2) disactivering
(slaat CLOSE op)

GEBLOKKEERD sluit de poort sluit de poort sluit de poort geen effect geen effect geen effect geen effect
(OPEN/CLOSE onderdrukt) (OPEN onderdrukt) (CLOSE onderdrukt) (OPEN/CLOSE onderdrukt)

LOGICA “A1” IMPULSEN


STATUS AUTOMATISCH OPEN A OPEN B CLOSE STOP FS: OP FSW CL FSW CL/OP
S<STEEM

DICHT opent en sluit weer na de opent de poort gedeeltelijk geen effect geen effect geen effect geen effect geen effect
pauzetijd en sluit na pauzetijd B (OPEN onderdrukt) (OPEN onderdrukt) (OPEN onderdrukt)

blokkeert en opent bij


NEDERLANDS

GAAT OPEN geen effect (1) geen effect sluit de poort weer blokkeert de werking zie prog. niveau 2 gaat verder met openen disactivering
en sluit direct weer (slaat CLOSE op)

GEOPEND IN PAUZE herlaad de pauzetijd (1) herlaad de pauzetijd B sluit de poort weer blokkeert de werking geen effect blokkeert en sluit bij herlaad de pauzetijd
disactivering direct (CLOSE onderdrukt)

keert om in opening (zie blokkeert en opent bij


GAAT DICHT opent de poort weer opent de poort weer geen effect blokkeert de werking geen effect prog. niveau 2) disactivering
(slaat CLOSE op)

GEBLOKKEERD sluit de poort sluit de poort sluit de poort geen effect geen effect geen effect geen effect
(OPEN/CLOSE onderdrukt) (OPEN onderdrukt) (CLOSE onderdrukt) (OPEN/CLOSE onderdrukt)
(1) Tijdens de gedeeltelijke openingscyclus zorgt een impuls OPEN A voor de totale opening
E721 18 532014 - Rev. D
LOGICA “AP” IMPULSEN
STATUS AUTOMATISCH OPEN A OPEN B CLOSE STOP FS: OP FSW CL FSW CL/OP
S<STEEM

DICHT opent en sluit weer na de opent de poort gedeeltelijk geen effect geen effect geen effect geen effect geen effect
pauzetijd en sluit na pauzetijd B (OPEN onderdrukt) (OPEN onderdrukt) (OPEN onderdrukt)
blokkeert en opent bij
GAAT OPEN blokkeert de werking (1) blokkeert de werking sluit de poort weer blokkeert de werking zie prog. niveau 2 geen effect disactivering (OPEN blok-
keert - slaat CLOSE op)

GEOPEND IN PAUZE blokkeert de werking (1) blokkeert de werking sluit de poort weer blokkeert de werking geen effect herlaad de pauzetijd herlaad de pauzetijd
(CLOSE onderdrukt) (CLOSE onderdrukt)

GAAT DICHT opent de poort weer opent de poort weer geen effect blokkeert de werking geen effect keert om in opening (zie disblacti
okkeert en opent bij
vering (OPEN blok-
prog. niveau 2) keert - slaat CLOSE op)

GEBLOKKEERD sluit de poort sluit de poort sluit de poort geen effect geen effect geen effect geen effect
(OPEN/CLOSE onderdrukt) (OPEN onderdrukt) (CLOSE onderdrukt) (OPEN/CLOSE onderdrukt)

LOGICA “At” (2) IMPULSEN


STATUS AUTOMATISCH OPEN A OPEN B CLOSE STOP FSW OP FSW CL FSW CL/OP
SYSTEEM

DICHT opent en sluit weer na de opent de poort gedeeltelijk geen effect geen effect geen effect geen effect geen effect
pauzetijd en sluit na pauzetijd B (OPEN onderdrukt) (OPEN onderdrukt) (OPEN onderdrukt)
blokkeert en opent bij
GAAT OPEN geen effect (1) geen effect sluit de poort weer blokkeert de werking keert om in sluiting geen effect disactivering
(slaat CLOSE op)

GEOPEND IN PAUZE herlaad de pauzetijd (1) herlaad de pauzetijd sluit de poort weer blokkeert de werking geen effect herlaad de pauzetijd herlaad de pauzetijd
(CLOSE onderdrukt) (CLOSE onderdrukt)

keert om in opening (zie blokkeert en opent bij


GAAT DICHT opent de poort weer opent de poort weer geen effect blokkeert de werking geen effect prog. niveau 2) disactivering
(slaat CLOSE op)

GEBLOKKEERD sluit de poort sluit de poort sluit de poort geen effect geen effect geen effect geen effect
(OPEN/CLOSE onderdrukt) (OPEN onderdrukt) (CLOSE onderdrukt) (OPEN/CLOSE onderdrukt)

LOGICA “S” IMPULSEN


STATUS AUTOMATISCH OPEN A OPEN B CLOSE STOP FS: OP FSW CL FSW CL/OP
S<STEEM

DICHT opent en sluit weer na de opent de poort gedeeltelijk geen effect geen effect geen effect geen effect geen effect
pauzetijd en sluit na pauzetijd B (OPEN onderdrukt) (OPEN onderdrukt) (OPEN onderdrukt)

gaat verder met openen blokkeert en opent bij


GAAT OPEN keert om in sluiting (1) keert om in sluiting sluit de poort weer blokkeert de werking zie prog. niveau 2 en sluit direct weer disactivering
(slaat CLOSE op)

GEOPEND IN PAUZE sluit de poort weer (1) sluit de poort weer sluit de poort weer blokkeert de werking geen effect blokkeert en sluit bij blokkeert en sluit bij
disactivering direct disactivering
keert om in opening (zie blokkeert en opent bij
GAAT DICHT opent de poort weer opent de poort weer geen effect blokkeert de werking geen effect prog. niveau 2) en sluit aan disactivering en sluit aan
het einde direct het einde direct

GEBLOKKEERD sluit de poort sluit de poort sluit de poort geen effect geen effect geen effect geen effect
(OPEN/CLOSE onderdrukt) (OPEN onderdrukt) (CLOSE onderdrukt) (OPEN/CLOSE onderdrukt)

LOGICA “SP” IMPULSEN


STATUS AUTOMATISCH OPEN A OPEN B CLOSE STOP FS: OP FSW CL FSW CL/OP
S<STEEM

DICHT opent en sluit weer na de opent de poort gedeeltelijk geen effect geen effect geen effect geen effect geen effect
pauzetijd en sluit na pauzetijd B (OPEN onderdrukt) (OPEN onderdrukt) (OPEN onderdrukt)

gaat verder met openen blokkeert en opent bij disactivering


GAAT OPEN blokkeert de werking (1) blokkeert de werking sluit de poort weer blokkeert de werking zie prog. niveau 2 en sluit direct weer
en sluit aan het einde direct weer
NEDERLANDS

(OPEN blokkeert - slaat CLOSE op)

GEOPEND IN PAUZE sluit de poort weer (1) sluit de poort weer sluit de poort weer blokkeert de werking geen effect blokkeert en sluit bij blokkeert en sluit bij
disactivering direct disactivering direct

keert om in opening (zie blokkeert en opent bij


GAAT DICHT blokkeert de werking blokkeert de werking geen effect blokkeert de werking geen effect prog. niveau 2) disactivering
(slaat CLOSE op)
hervat de beweging in hervat de beweging in geen effect geen effect geen effect geen effect
GEBLOKKEERD omgekeerde richting. Sluit omgekeerde richting. Sluit sluit de poort weer (OPEN/CLOSE onderdrukt) (OPEN onderdrukt) (CLOSE onderdrukt) (OPEN/CLOSE onderdrukt)
na STOP altijd na STOP altijd
(1) Tijdens de gedeeltelijke openingscyclus zorgt een impuls OPEN A voor de totale opening
E721 19 532014 - Rev. D
LOGICA “SA” IMPULSEN
STATUS AUTOMATISCH OPEN A OPEN B CLOSE STOP FS: OP FSW CL FSW CL/OP
S<STEEM

DICHT opent en sluit weer na de Opent de poort gedeelte- geen effect geen effect geen effect geen effect geen effect
pauzetijd lijk en sluit na pauzetijd B (OPEN onderdrukt) (OPEN onderdrukt) (OPEN onderdrukt)
blokkeert en opent bij
GAAT OPEN geen effect (1) geen effect sluit de poort weer blokkeert de werking zie prog. niveau 2 geen effect disactivering
(slaat CLOSE op)

GEOPEND IN PAUZE sluit de poort weer (1) sluit de poort weer sluit de poort weer blokkeert de werking geen effect herlaad de pauzetijd herlaad de pauzetijd
(CLOSE onderdrukt) (CLOSE onderdrukt)

keert om in opening (zie blokkeert en opent bij


GAAT DICHT opent de poort weer opent de poort weer geen effect blokkeert de werking geen effect prog. niveau 2) disactivering
(slaat CLOSE op)

GEBLOKKEERD sluit de poort sluit de poort sluit de poort geen effect geen effect geen effect geen effect
(OPEN/CLOSE onderdrukt) (OPEN onderdrukt) (CLOSE onderdrukt) (OPEN/CLOSE onderdrukt)

LOGICA “B” IMPULSEN


STATUS AUTOMATISCH OPEN A / CLOSE STOP FS: OP FSW CL FSW CL/OP
S<STEEM

DICHT opent de poort / geen effect geen effect geen effect geen effect geen effect
(OPEN onderdrukt) (OPEN onderdrukt) (OPEN onderdrukt)
blokkeert en opent
GAAT OPEN geen effect / sluit de poort blokkeert de werking zie prog. niveau 2 geen effect bij disactivering (slaat
OPEN/CLOSE op)

OPEN geen effect / sluit de poort geen effect geen effect geen effect geen effect
(OPEN/CLOSE onderdrukt) (CLOSE onderdrukt) (OPEN/CLOSE onderdrukt)

keert om in opening (zie blokkeert en opent


GAAT DICHT opent de poort / geen effect blokkeert de werking geen effect prog. niveau 2) bij disactivering (slaat
OPEN/CLOSE op)

GEBLOKKEERD opent de poort / sluit de poort geen effect geen effect geen effect geen effect
(OPEN/CLOSE onderdrukt) (OPEN onderdrukt) (CLOSE onderdrukt) (OPEN/CLOSE onderdrukt)

LOGICA “bC IMPULSEN TIJDENS OPENING / BLIJVENDE COMMANDO'S IMPULSEN