Sei sulla pagina 1di 51

α

Con l’eccezione della glicina, tutti gli


amminoacidi sono otticamente attivi, vale a
dire ruotano il piano della luce polarizzata.
Le molecole otticamente attive sono
asimmetriche (chirali), cioè non sono
sovrapponibili alla loro immagine speculare,
come la mano sinistra non si può
sovrapporre alla sua immagine speculare, la
mano destra.
gli amminoacidi

COO-
L-alanina
+
H3N C H

CH3
COO-
+
H3N H
proiezione di Fischer
CH3
G A P V

F Y W

L I M

K R H
S T C

N Q D G
i polipeptidi

Tirosil-glicil-glicil-fenilalanil-leucina

Nei polipeptidi i
residui amminoacidci
sono indicati
eliminando il suffisso,
in genere –ina e
sostituendolo con –
ile. L’amminoacido
all’estremità
carbossilica mantiene
il suo nome originale.
Dissociazione acido-base degli amminoacidi – il punto isoelettrico

Ala
Ala H
Alanina:
pKa1 = 2.34
pKa2 = 9.69

Ala H2+
pI Ala
-

Alanine
Il punto isoelettrico (P.I.) di una proteina è quel valore di pH cui
corrisponde una carica netta zero.

1,8
9,1

6,0
10,5 4,1
pKa
+3
1,8
Il punto isoelettrico (P.I.) di una
+2 proteina è quel valore di pH cui
corrisponde una carica netta
zero.
4,1
+1

6,0 + 9,1
6,0 P.I.teorico = = 7,55
2
0

9,1 -1
P.I.reale ???

10,5 -2
Elettroforesi in condizioni denaturanti

SDS: sodio dodecilsolfato


M.W.
Focalizzazione isoelettrica (isoelectric focusing , IEF)

Il punto isoelettrico delle proteine ( pI ) è il pH a cui la carica netta di


una proteina è zero

+ -
pH=3 pH=10

pH < pI pH > pI
pH = pI
Elettroforesi bidimensionale in SDS
pH=3 pH=10

-
M.W.

+
sul batterio Escherichia coli sono state individuate
oltre 4000 diverse proteine
Alcune funzioni biologiche delle proteine
la struttura di una proteina è definita attraverso quattro diversi
gradi di organizzazione della molecola
Struttura primaria: sequenza di amminoacidi, scheletro covalente.

Struttura secondaria: unità di struttura che si ripetono, basate, di solito sulla formazione di
legami idrogeno che si realizzano tra i gruppi C=O e N-H dei legami peptidici delle
proteine. Si tratta dunque dell’organzzazione spaziale della catena principale, per la quale
normalmente le catene laterali non sono determinanti.

Struttura terziaria: il modo in cui la catena polipeptidica è ripiegata tridimensionalmente,


stabilizzata da interazioni che si realizzano per lo più tra le catene laterali degli
amminoacidi che compongono la catena polipeptidica

Struttura quaternaria: il modo in cui le singole catene polipeptidiche di una proteina


composta da due o più subunità sono disposte l’una rispetto all’altra.
la struttura di una proteina è definita attraverso quattro diversi
gradi di organizzazione della molecola
la “struttura primaria” di una proteina è definita dalla
sua specifica sequenza amminoacidica

l’analisi delle relazioni fra sequenze amminoacidiche e struttura


tridimensionale delle proteine sta chiarendo le regole che
governano il ripiegamento delle catene polipeptidiche

la determinazione della sequenza è parte dello studio molecolare


di patologie. Alterazioni nella sequenza di amminoacidi può
produrre anomalie di funzione e malattie (es. anemia a cellule
falciformi)

il confronto della sequenza di una stessa proteina in specie


diverse fornisce informazioni sulle vie seguite dall’evoluzione
Scimmia 1
Il citocromo C:
Coniglio 9 una proteina conservata nell’evoluzione
Canguro 17 -18
Balena Uomo:
Mucca 10 1GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKT40
Pecora 41GQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKM80
Maiale 81IFVGIKKKEERADLIAYLKKATNE 104
Cane
Asino 11
Cavallo 12 14
Pollo 70 -80
13
tacchino
Serpente 14
Tartaruga 15
Tonno 21
Pescecane 23
Mosca 25
Numero residui Farfalla 31
varianti rispetto Grano 35
all’uomo Neurospora 43
Lievito 44 p.M.12.400
Albero filogenetico riferito al citocromo c
Citocromo C a confronto

Citocromo C550
Paracoccus denitrificans
Il parziale carattere di doppio legame del legame
peptidico

distanze teoriche
..

_
C N 1.47Å

_
C _ O 1.22Å

_
C C 1.51Å
I legami peptidici assumono normalmente la configurazione trans in cui
gli atomi Cα in successione sono situati ai lati opposti del legame
peptidico che li unisce. La configurazione cis, in cui questi atomi si
trovano sullo stesso lato del legame peptidico è meno stabile rispetto
alla trans





Quando nel legame peptidico è impegnato un residuo di prolina la differenza tra la
stabilità della conformazione trans e cis si attenua, e circa il 10% dei residui di
prolina presenti nelle proteine si trovano in un legame peptidico con configurazione
cis



Cα Cα
la planarità del legame peptidico riduce i gradi di libertà
la planarità del legame peptidico
riduce i gradi di libertà

struttura distesa di un polipeptide


non tutte le coppie di angoli hanno associata la stessa energia

Φ =180°, Ψ = 0° Φ =0°, Ψ =180° Φ =0°, Ψ =0°

Φ = 0 ; Cα-N trans C-O


Ψ = 0; Cα-C trans N-H
Il grafico di Ramachandran associa alle diverse
coppie di angoli la corrispondente energia

φ ψ
C
il grafico di Ramachandran
grafico di Ramachandran

la catalasi di Micrococcus lysodeikticus

88.5 % dei residui in regioni piu


favorite
11.1 % in regioni permesse

Val22 e Ser202 in regioni non


permesse

residui di glicina
la struttura secondaria delle proteine

α-elica destrorsa

foglietto-β
Linus Carl Pauling (1901-1994)

Premio Nobel per la Pace 1962


Per la sua azione per il blocco dei
test nucleari

Premio Nobel per la Chimica 1954


Per il suo contributo alla definizione della
struttura delle proteine
le proteine possono organizzarsi in strutture
elicoidali

elica sinistrorsa
elica destrorsa
φ -57.8 ψ -47
struttura secondaria
α-elica destrorsa

le catene laterali degli aa


Rappresentazione a Modello a sfere e
nastro bastoncini, visto di
lato

Modello a sfere e Modello spaziale di C


bastoncini, visto
da una estremità
α-elica destrorsa

L’-elica è la più frequente struttura elicoidale


nelle proteine globulari (~ un terzo dei residui);
La lunghezza media è in media di 10 residui aa; gli
angoli φ ψ ritrovati da misure sperimentali sono φ =
- 64 ±7 e ψ =- 41± 7 diversi dal teorico (φ = -
57.8; ψ = - 47)
Al centro di una buca di potenziale nel grafico di
Ramachandra
I dipoli per il legame sono perfettamente allineati
Il raggio appare ottimale per favorire le interazioni
van der Waal attraverso l’asse
Le catene laterali sono ben disposte per
minimizzare l’ingombro sterico.
Periodicità dell’α-elica
Ogni residuo è spostato
rispetto al precedente di
0,15 nm e forma con esso
un angolo di 100°.
Quindi, per ogni giro
dell’elica ci sono 3,6
residui. Il passo dell’elica
si ripete ogni 0,54 nm
residui di prolina destabilizzano l’ -elica


la struttura secondaria delle proteine

α-elica destrorsa

foglietto-β
struttura secondaria

Struttura a foglietti β: β-sheet antiparallelo


struttura secondaria

Struttura a foglietti β: β-sheet antiparallelo

+
NH3

O
C
-O
struttura secondaria
struttura secondaria

struttura a foglietti β: β-sheet parallelo

+
H 3N -
-COO -
i foglietti β possono
interagire
la fibroina della seta
le strutture secondarie sono variamente
rappresentate nelle proteine
Strutture supersecondarie

Greca da ripiegamento di
βα β hairpin α β hairpin
β α
ripetitività di strutture supersecondarie

Struttura a Greca (tutto β)

Struttura a barile αβ
domini strutturali delle proteine

dominio tutto  dominio tutto β

dominio tutto  /β
domini strutturali

Siero albumina umana Citocromo b1 E . coli Glucoamilasi A. awamori

Inibitore -amilasi HOE -467° UDP N-acetilglucosamina


Streptomyces tendae Collagenasi umana
aciltransferasi (E .coli)

Pilina (Neisseria Gonorrhoeae)


Timidilato sintasi Green fluorescent protein Human Ubiquitin
(E .coli) (Aequorea victoria) conjugatin enzyme