Documenti di Didattica
Documenti di Professioni
Documenti di Cultura
2
Liz Dong Rosetta Workshop 2011 03.12.11
Outline
Introduction to comparative modeling General comparative modeling protocol Comparative modeling in Rosetta 3.2 Loop building in Rosetta 3.2: CCD vs. KIC Clustering output models Analyzing results Modeling membrane proteins Useful references and websites
Template
Comparative Modeling: construction of an atomic-resolution model of a protein with no experimentally determined structure using the 3D structure of a related protein Homology Modeling: modeling a protein based on a template with common evolutionary origin Threading: placing amino acids of the target sequence onto the coordinates of the template structure Application of Models Predict structure-function relationships Predict binding pockets for ligands for structure-based drug design Suggest site-directed mutagenesis experiments
Identifying a Suitable Template: Templates should ideally have >30% sequence identity to the target. There are two approaches to identifying templates:
Template
1. Sequence Similarity: comparing proteins based on amino acid properties alone (BLAST, PSI-BLAST) 2. Fold Recognition: using predicted secondary structure information to detect proteins with similar 3D characteristics (DALI, PHYRE)
1f4pA
1f4pA
1f4pA
1f4pA
1: Target sequence
Find this file at $WORKSHOP_ROOT/tutorials/modeling/input_model/2foxA.fasta
>2foxA MKIVYWSGTGNTEKMAELIAKGIIESGKDVNTINVSDVNIDELLNEDILILGCSAMG DEVLEESEFEPFIEEISTKISGKKVALFGSYGWGDGKWMRDFEERMNGYGCVVVETP LIVQNEPDEAEQDCIEFGKKIANI
http://www.ncbi.nlm.nih.gov/protein
2: Template PDB
Find this file at $WORKSHOP_ROOT/tutorials/modeling/input_model/1f4pA.pdb
http://www.rcsb.org
3: Fragments
Find these files at $WORKSHOP_ROOT/tutorials/modeling/input_model/aa2foxA03_05.200_v1_3 and $WORKSHOP_ROOT/tutorials/modeling/input_model/aa2foxA09_05.200_v1_3
http://robetta.bakerlab.org/ fragmentsubmit.jsp
4: Alignment
Find this file at $WORKSHOP_ROOT/tutorials/modeling/input_model/2foxA.1f4pA.aln
2foxA 1 --MKIVYWSGTGNTEKMAELIAKGIIE 1f4pA 1 PKALIVYGSTTGNTEYTAETIARELAD
http://align.genome.jp/
5: PSIPRED
Find this file at $WORKSHOP_ROOT/tutorials/modeling/input_model/2foxA.psipred_ss2
http://bioinf.cs.ucl.ac.uk/psipred/
Options: Input
Find this file at $WORKSHOP_ROOT/tutorials/modeling/input_model/comparative_model.options
-run:protocol threading #call threading protocol -in:file:fasta *.fasta #target sequence -in:file:template_pdb *.pdb #template structure -in:file:fullatom #input will be fullatom -in:file:psipred_ss2 *.psipred_ss2 #optional: psipred secondary structure -in:file:alignment *.aln #input alignment
Options: Output
-out:nstruct <int> #number of models to build -out:file:silent_struct_type binary #output file type -out:file:silent *.out #output file name -out:file:fullatom #output file will be fullatom
Running Rosetta
$ROSETTA_BIN/minirosetta.$ROSETTA_SUFFIX @$WORKSHOP_ROOT/tutorials/modeling/input_model/comparative _model.options -database $ROSETTA_DATABASE >& $WORKSHOP_ROOT/tutorials/modeling/comparative_model.log &
1f4pA
S. Lindert
J. Willis
Sparse experimental data provide information about secondary structure elements, but rarely loop conformations
M. Karakas G. Lemmon
Loops can play an important role in ligand & peptide binding sites
Stage 1: Remodel (CCD or KIC) fast, broad sampling of backbone conformations, centroid Stage 2: Refine (KIC) side-chains are represented in all-atom detail, and together with backbone conformations, evaluated by Rosetta's high-resolution scoring function.
1: Loop File
Find this file at $WORKSHOP_ROOT/tutorials/modeling/input_loop/2foxA.loops LOOP 6 11 0 0 0
Column 1 Column 2 LOOP <integer> The loop file identity tag Residue number for starting loop anchor. NOTE: The starting structure must have real coordinates for all residues outside the loop definition, including the loop anchors (residues indicated in the loops file). Residue number for ending loop anchor Cut point residue number, >=startRes, <=endRes. default - let LoopRebuild choose cutpoint Skip rate (probability between 0 and 1). default - never skip Extend loop. Default false
Differences for KIC: For de novo reconstruction of protein loops, set 'extend loop' field in the loop definition file (the last column) to '1'.
Common Options
-nstruct <int> #number of models to build. 1000 recommended for production runs. -loops:input_pdb *.pdb #starting pdb with loops to rebuild -loops:loop_file *.loops #loop file -loops:relax fastrelax #does a minimization of the structure in the torsion space -loops:extended #force phi-psi angles to be set to 180 degrees independent of loop input file (recommended for production runs) -out:file:silent_struct_type binary #output file type -out:file:silent *.out #output file name -out:file:fullatom #output file will be fullatom
Running Rosetta
$ROSETTA_BIN/loopmodel.$ROSETTA_SUFFIX @$WORKSHOP_ROOT/tutorials/modeling/input_loop/ccd.options -database $ROSETTA_DATABASE >& $WORKSHOP_ROOT/ tutorials/modeling/ccd.log & $ROSETTA_BIN/loopmodel.$ROSETTA_SUFFIX @$WORKSHOP_ROOT/tutorials/modeling/input_loop/kic.options -database $ROSETTA_DATABASE >& $WORKSHOP_ROOT/ tutorials/modeling/kic.log &
(Clustering in Rosetta)
The Rosetta clustering algorithm is slightly unconventional Traditional clustering methods require the calculation of a pairwise distance matrix
The memory requirements of this method are n2 where n is the number of models being clustered For large numbers of models, these methods are therefore impractical
(Clustering In Rosetta)
Initial cluster assignment
(Clustering In Rosetta)
Initial cluster assignment
Distance matrix for first 400 models
Based on CA distance
(Clustering In Rosetta)
Initial cluster assignment
Distance matrix for first 400 models
Based on CA distance
Clustering : Options
Find this file at $WORKSHOP_ROOT/tutorials/modeling/input_cluster/cluster.options -in:file:fullatom #Read as fullatom input structure -out:file:silent #Output silent structures instead of PDBs -run:shuffle #Use shuffle mode -cluster:radius <float> #Cluster radius in A for RMS clustering or in inverse GDT_TS for Global Distance Test score clustering. Use "-1" to trigger automatic radius detection -cluster:exclude_res <int> [<int> <int> ..] #Exclude residue numbers from structural comparisons
Clustering : Running
Before running the cluster application, combine all your silent files:
$ROSETTA_BIN/combine_silent.$ROSETTA_SUFFIX -database $ROSETTA_DATABASE -in:file:silent *.out -in:file:silent_struct_type binary -out:file:silent cluster_all.out -out:file:silent_struct_type binary
The clustering python script runs the Rosetta application and outputs summary files:
python $WORKSHOP_ROOT/py_protein_utils/scripts/clustering.py --silent=cluster_all.out --rosetta=$ROSETTA_BIN/cluster.$ROSETTA_SUFFIX --database=$ROSETTA_DATABASE --options=cluster.options cluster_summary.txt cluster_histogram.txt
Clustering : Results
cluster number (random) model number, sorted by energy Tag file_name score size S_1F4PA_0410_1 c.0.0.pdb -267.131 S_1F4PA_0356_1 c.6.0.pdb -252.855 S_1F4PA_0036 c.22.0.pdb -248.465 S_1F4PA_0127_1 c.13.0.pdb -251.634 S_1F4PA_0116_1 c.14.0.pdb -251.295 S_1F4PA_0281 c.25.0.pdb -248.026 S_1F4PA_0162 c.29.0.pdb -245.988 S_1F4PA_0167_1 c.2.0.pdb -257.18 S_1F4PA_0250 c.3.0.pdb -256.946 S_1F4PA_0043 c.26.0.pdb -248.033 S_1F4PA_0333 c.11.0.pdb -252.798 S_1F4PA_0407 c.7.0.pdb -254.178 S_1F4PA_0065 c.28.0.pdb -247.865 S_1F4PA_0245_1 c.79.0.pdb -237.464 203 40 29 24 24 24 20 17 17 16 14 13 13 13
c.0.203
c.0.0
RMSD of 2foxA model (c.0.0) to 2foxA native structure: 1.376 Angstroms RMSD of 2foxA model (c.0.0) to 1f4pA template: 1.312 Angstroms
Generate LIPS and spanfile (see workshop 1) Add the following options to the options file:
-in:file:spanfile *.span # newly created spanfile -in:file:lipofile *.lips4 # newly created lipo file -membrane:no_interpolate_Mpair # membrane scoring specification -membrane:Menv_penalties # turn on membrane penalty scores -score:weights membrane_highres_Menv_smooth.wts
References
Rosetta 3.2 User Guide http://www.rosettacommons.org/manuals/archive/rosetta3.2_user_guide/comparative_modeli ng.html Comparative Modeling http://www.rosettacommons.org/manuals/archive/rosetta3.2_user_guide/comparative_modeli ng.html Raman, S., Vernon, R., Thompson, J., Tyka, M., Sadreyev, R., Pei, J., Kim, D., et al. (2009). Structure prediction for CASP8 with all-atom refinement using Rosetta. Proteins, 77 Suppl 9, 8999. Loop Building http://www.rosettacommons.org/manuals/archive/rosetta3.2_user_guide/ccd_loop_modeling.h tml
Wang, C., Bradley, P., & Baker, D. (2007). Protein-Protein Docking with Backbone Flexibility. Journal of Molecular Biology, 373(2), 503-519. Mandell, D. J., Coutsias, E. A., & Kortemme, T. (2009). Sub-angstrom accuracy in protein loop reconstruction by robotics-inspired conformational sampling. Nat Meth, 6(8), 551-552.