Sei sulla pagina 1di 560

A

Manuale di diritto delle arti e dello spettacolo

a cura di
Fabio Dell’Aversana

Contributi di
Aldo Albore Ilaria Guarnaccia
Caterina Barontini Laura Ieni
Enrico Buono Annalisa Korinthios
Rosalia Compagnone Angelica Lama
Nicola del Piano Clara Menale
Fabio Dell’Aversana Isabella Menale
Loredana Dell’Aversana Marco Miraglia
Maria Teresa Della Vittoria Scarpati Valeria Monti
Federica Fiore Alessandro Picarone
Copyright © MMXV
ARACNE editrice int.le S.r.l.

www.aracneeditrice.it
info@aracneeditrice.it

via Quarto Negroni, 


 Ariccia (RM)
() 

 ----

I diritti di traduzione, di memorizzazione elettronica,


di riproduzione e di adattamento anche parziale,
con qualsiasi mezzo, sono riservati per tutti i Paesi.

Non sono assolutamente consentite le fotocopie


senza il permesso scritto dell’Editore.

I edizione: settembre 


Indice

17 Introduzione
di FABIO DELL¶$VERSANA

23 Capitolo I
Fonti e principi del diritto dello spettacolo
di FABIO DELL¶$VERSANA

1.1. Premessa: le nozioni giuridiche fondamentali, 23 ± 1.2. Le fonti del di-


ritto dello spettacolo, 27 ± 1.2.1. Cosa si intende per fonte del diritto?, 28 ±
1.2.2. La Costituzione repubblicana, 28 ± 1.2.3. Le fonti primarie: leggi ed
atti aventi forza di legge, 31 ± 1.2.4. I regolamenti del Governo, 33 ± 1.2.5.
Le fonti del diritto comunitario, 34 ± 1.3. Lo spettacolo come spazio per
O¶HVHUFL]LR GL OLEHUWj36 ± 1.3.1. La libertà di manifestazione del pensiero
artistico, 36 ± /¶DUWGHOOD&RVWLWX]LRQHTXDOHUXRORSHUOD5HSXb-
blica?, 40 ± 'DOODOLEHUWjGLLQVHJQDPHQWRDOOD³&KLDPDWDDOOHDUWL´
43 ±  ,O GLULWWR FRVWLWX]LRQDOH GHOO¶DUWLVWD DOOD UHWULEX]LRQH 45 ± 1.4.
/¶LQWUHFFLRWUDOLEHUWjQHJDWLYHHSRVLWLYHQHOGLULWWRGHOOHDUWLHGHOORVSHWWa-
colo, 46

49 Capitolo II
,OIHQRPHQRDUWLVWLFR8QDYLVLRQHG¶LQVLHPH
di ILARIA GUARNACCIA

2.1. Introduzione, 49 ± 2.2. Il punto di vista giuridico, 50 ± 2.2.1. La no-


zione di spettacolo, 50 ± 2.2.2. La nozione di arte, 51 ± 2.2.3. La nozione
di bene culturale, 52 ± 2.3. Il punto di vista storico-estetico, 53 ± 2.4. Lo
spettacolo come prodotto culturale, 56 ± 2.5. Tipologie di spettacolo, 57 ±
2.6. La funzione sociale, 59 ± 2.7. Conclusioni, 60

5
6 Manuale di diritto delle arti e dello spettacolo

61 Capitolo III
Soggetti e persone giuridiche nel mondo dello spettacolo
di CATERINA BARONTINI

3.1. /¶DUWLVWD, 61 ± 3.1.1. Definizione e ruoli, 61 ± 3.1.2. Artista e pubblico,


63 ± 3.1.3. Classificazione, 65 ± /¶DUWLVWDRJJL66 ± 3.2. Il manager
dello spettacolo, 66 ± 3.2.1. Definizione e ruoli, 66 ± 3.2.2. Formazione e
lavoro, 69 ± /¶humus dello sviluppo culturale, 70 ± 3.3. Formazioni
sociali, 70 ± 3.3.1. Definizione e ruoli, 70 ± 3.3.2. Classificazione, 71 ±
3.3.3. /DFODVVLILFD]LRQHGHOO¶,67$7, 73 ± 3.3.4. Le Istituzioni Concertisti-
che Orchestrali, 74 ± 3.3.5. Una prima conclusione, 75 ± 3.4. Enti privati,
75 ± 3.4.1. Società, 75 ± 3.4.2. Comitati, 76 ± 3.4.3. Associazioni, 76 ±
3.4.4. Fondazioni, 77 ± 3.5. Il pubblico, 80

81 Capitolo IV
I contratti dello spettacolo: peculiarità e criticità
di ALESSANDRO PICARONE

4.1. Introduzione, 81 ± 4.2. Il contratto di scrittura artistica: quale tipo di


rapporto?, 82 ± 4.2.1. Clausola di protesta, 83 ± 4.3. I contratti di sponso-
rizzazione tra mecenatismo e pubblicità: quale tipizzazione?, 84 ± 4.4.
Contratti di edizione: autonomia negoziale e tutela costituzionale, 87 ±
4.4.1. Il contratto di edizione, 88 ± 4.4.2. Il contratto di edizione musicale:
tutele e particolarità, 92 ± 4.4.3. Pubblicazione di carteggi privati:
XQ¶DQDOLVLFRVWLWX]LRQDOPHQWHRULHQWDWD94 ± 4.5. Rappresentazioni pubbli-
che, 96 ± 4.5.1. Il contratto di rappresentazione e di esecuzione, 96 ± 4.5.2.
&RPPHUFLDOL]]D]LRQHGHOO¶RSHUDFLQHPDWRJUDILFD98 ± 4.6. Il management:
profili negoziali, 99

103 Capitolo V
Il rapporto di lavoro nello spettacolo
di FEDERICA FIORE

5.1. Introduzione, 103 ±  /D SUHVWD]LRQH DUWLVWLFD QHOO¶DPEito dei


rapporti speciali di lavoro, 105 ± 5.3. I contratti di lavoro nello spettacolo
tra autonomia, subordinazione e parasubordinazione, 107 ± 5.4. Il lavoro
subordinato, 109 ± 5.4.1. Il contratto a termine, 110 ± 5.4.2. Il contratto di
lavoro intermittente, 112 ± 5.5. Il lavoro autonomo, 113 ± 5.5.1. Le
collaborazioni coordinate e continuative, 115 ± 5.5.2. Il contratto di
scrittura artistica, 116 ± 5.6. La specialità del rapporto di lavoro nello
spettacolo, 117 ± 5.7. La tutela previdenziale, assistenziale e assicurativa,
118 ± 5.8. Conclusioni, 121
Indice 7

123 Capitolo VI
Le autorizzazioni amministrative in materia di pubblico spetta-
colo
di NICOLA DEL PIANO

6.1. La nozione di spettacolo nel diritto pubblico, 123 ± 6.2. Le autorizza-


zioni in diritto amministrativo, 124 ± 6.3. La materia del pubblico spettaco-
lo, 126 ± 6.4. La giurisdizione esclusiva del giudice amministrativo, 130 ±
6.5. I concetti di moralità pubblica e buon costume, 133

137 Capitolo VII


I regimi fiscali HO¶LPSRVWDVXJOLVSHWWDFROL
di ANGELICA LAMA

7.1. I regimi fiscali ordinario e semplificato, 137 ± 7.2. Il regime fiscale


agevolato, 138 ± 7.3. Il nuovo regime forfetario ex legge di stabilità 2015,
139 ± 7.4. /¶LPSRVL]LRQHILVFDOHVX concerti vocali e strumentali, 143 ± 7.5.
Il divieto di doppia imposizione fiscale, 143 ± 7.6. Il Fondo Unico per lo
Spettacolo, 145

149 Capitolo VIII


Il diritto dello spettacolo nella normativa internazionale e co-
munitaria
di ANNALISA KORINTHIOS

8.1. Profili introduttivi ed indicazioni metodologiche, 149 ± 8.2. Il diritto


G¶DXWRUH H GHOOR VSHWWDFROR QHOOD 'LFKLDUD]LRQH 8QLYHUVDOH GHL 'LULWWL
GHOO¶8RPR150 ± 8.3. La libertà di espressione in una prospettiva regiona-
OHO¶DUWGHOOD&('8151 ± /DWXWHODGHOO¶DUWHQHOOD&DUWDGL1L]]D
152 ± 8.5,OGLULWWRG¶DXWRUHQHOGLULWWRLQWHUQD]LRQDOHFRQYHQ]LRQDOH154 ±
8.5.1. La Convenzione di Berna, 154 ± 8.5.2. La Convenzione Universale
SHULOGLULWWR G¶DXWRUH156 ± 8.5.3. /¶2UJDQL]]D]LRQH 0RQGLDOHGHOOD3Uo-
prietà Intellettuale, 157 ± /¶$FFRUdo TRIPS, 158 ± 8.6. La normati-
YD FRPXQLWDULD VXO GLULWWR G¶DXWRUH 159 ± 8.7. Considerazioni conclusive,
165
8 Manuale di diritto delle arti e dello spettacolo

167 Capitolo IX
,OGLULWWRG¶DXWRUH
di ENRICO BUONO e VALERIA MONTI

9.1. Nozione, fonti e contenuto, 167 ± 9.2. Opere in collaborazione, 171 ±


9.3. Il caso della parodia, 173 ± 9.4. Atti di disposizione inter vivos del di-
ULWWRG¶DXWRUH 175 ± 9.5. La successione mortis causa, 176 ± 9.5.1. Diversi
tipi di delazione, 177 ± 9.5.2. Sulla successione testamentaria, 178 ± 9.6.
Le due componenti del GLULWWR G¶DXWRUH 179 ± 9.6.1. Diritti patrimoniali,
180 ± 9.6.2. Diritti morali, 182

185 Capitolo X
La Società Italiana degli Autori ed Editori
di MARIA TERESA DELLA VITTORIA SCARPATI

10.1. Cenni storici, 185 ± 10.2. Le funzioni della SIAE e la valorizzazione


dei suoi associati, 188 ± 10.3. La struttura, 190 ± 10.4. Il ruolo della SIAE:
nello specifico, i soggetti tutelati e le attività, 192 ± 10.5. La prevenzione e
UHSUHVVLRQH GHOOD YLROD]LRQH GHOOD OHJJH VXO GLULWWR G¶DXWRUH ,O FRQWUDVVe-
gno, 196 ± 1/¶HTXRFRPSHQVR198

201 Capitolo XI
,OGLULWWRG¶DXWRUHLQ,QWHUQHW
di LOREDANA DELL¶$VERSANA

11.1. Premessa: perché occuparsi di Internet?, 201 ± 11.2. Cenni sulle fonti
del diritto di Internet, 203 ± 11.3. I vari modelli di tutela del diritto
d¶DXWRUH XQD ULIOHVVLRQH GL GLULWWR FRPSDUDWR 204 ±  /¶HVSHULHQ]D
americana, 205 ± /¶HVSHULHQ]DIUDQFHVH210 ± 11.4. La regolamen-
WD]LRQH LWDOLDQD LOUHJRODPHQWRGHOO¶$XWRULWjSHU OH*DUDQ]LHQHOOH&RPu-
nicazioni, 213 ± 11.5. La composizione del dilemma digitale: il bilancia-
mento dei diritti, 217

221 Capitolo XII


/DWXWHODSHQDOHGHOGLULWWRG¶DXWRUH
di ALDO ALBORE

12.1. Premessa: il patrimonio come bene giuridico protetto, 221 ± 12.2.


(YROX]LRQHGHOODGLVFLSOLQDSHQDOHO¶DUWOGD., da norma fondamentale
Indice 9

a norma residuale, 223 ± 12.3. La tutela del software e delle banche di dati:
in particolare, il fine di profitto e lo scopo commerciale o imprenditoriale,
226 ± 12.4. La tutela delle opere audiovisive e letterarie, 231 ± 12.4.1. Art.
171 ter l.d.a. ed art. 648 cod. pen.: concorso di reati, 236 ± 12.5. DRM e
trasmissioni audiovisive ad accesso condizionato, 238 ± 12.6. Il file sha-
ring, 244 ±12.7. Conclusioni, 246

249 Capitolo XIII


Opera e impresa cinematografica: dalla legge sul diritto
G¶DXWRUHDOODOHJJHFLQHPD
di MARCO MIRAGLIA

/HIRQWLGHOGLULWWRFLQHPDWRJUDILFRO¶DSSURGRDXQDGLVFLSOLQDXQLWa-
ria, 249 ± /DFLQHPDWRJUDILDQHOODOHJJHVXOGLULWWRG¶DXWRUH250 ±
13.2. La legge cinema, 254 ± 13.2.1. Le imprese cinematografiche, 256 ±
13.2.2. La Commissione per la cinematografia e il Fondo Unico per lo
Spettacolo, 257 ± 13.2.3. Il product placement, 260 ± 13.2.4. I contratti di
distribuzione cinematografica, 266

267 Capitolo XIV


,EHQLFXOWXUDOLQHOO¶RUdinamento giuridico italiano
di CLARA MENALE

14.1. Introduzione, 267 ± 14.2. Il Testo Unico sui beni culturali, 268 ±
14.3. Il Codice dei beni culturali e del paesaggio, 269 ± 14.4. Il bene cultu-
rale: definizione e significato, 274 ± 14.5. Il Ministero dei beni e delle atti-
vità culturali e del turismo, 277

279 Capitolo XV
Il marketing culturale
di LAURA IENI

15.1. Introduzione, 279 ± 15.2. Le principali variabili socio-demografiche


del mercato dei consumatori, 281 ± 15.2.1. Il turismo, 283 ± 15.3. Progetto
e prodotto, 283 ± 15.4. La pubblicità, 285 ± 15.5. Il museo quale luogo cul-
turale aperto. Breve vademecum di marketing culturale applicato al museo,
286
10 Manuale di diritto delle arti e dello spettacolo

291 Capitolo XVI


,OVLVWHPDGHOO¶$OWD)RUPD]LRQH$UWLVWLFDH0XVLFDOH
di ISABELLA MENALE

16.1. Introduzione, 291 ± 16.2. Le Istituzioni AFAM, 293 ± 16.2.1. Acca-


demie di belle arti, 293 ± 16.2.2. Accademia nazionale di arte drammatica,
294 ± 16.2.3. Accademia nazionale di danza, 295 ± 16.2.4. Istituti superiori
per le industrie artistiche, 296 ± 16.2.5. Conservatori di musica e Istituti
musicali pareggiati: la statizzazione, 296 ± /¶DXWRQRPLDGHOOH,VWLWu-
zioni AFAM, 299 ± 16.3.1. Profilo storico, 299 ± /¶DXWRQRPLDVWa-
tutaria, 300 ±  /¶DXWRQRPLD GLGDWWLFD 301 ± 16.3. /¶DXWRQRPLD
amministrativa, 304 ± 16.4. La governance delle Istituzioni AFAM, 306 ±
16.4.1. Il Presidente, 307 ± 16.4.2. Il Direttore Artistico, 308 ± 16.4.3. Il
Consiglio di Amministrazione, 309 ± 16.4.4. Il Consiglio accademico, 311
± 16.5. Il personale docente e il sistema di reclutamento, 312 ± 16.6. Il va-
lore giuridico dei titoli di studio, 315 ± 16.7. Conclusioni, 319

321 Capitolo XVII


Riflessioni filosofiche sulla comunicazione artistica
di ROSALIA COMPAGNONE

17.1. È impossibile non comunicare, 321 ± 17.2. Esempi di comunicazione


artistica, 323 ± 17.3. Il ruolo del fruitore, 325

329 Appendice normativa

Costituzione della Repubblica Italiana, 329 ± Regio decreto 18 giugno


1931, n. 773, 343 ± Legge 22 aprile 1941, n. 633, 347 ± Decreto del Presi-
dente del Consiglio dei ministri del 19 dicembre 2012, 461 ± Delibera 12
dicembre 2013, n. 680/13/CONS, 467 ± Decreto legislativo 22 gennaio
2004, n. 28, 483 ± Legge 21 dicembre 1999, n. 508, 511 ± Legge 24 di-
cembre 2012, n. 228, 521

523 Bibliografia

553 Indice degli Autori

557 Ringraziamenti
Ai miei Maestri,
in segno di gratitudine per
aver stimolato la curiosità
che mi ha condotto sin qui
Si sarebbe tentati di dire che il di-
ritto è nel mondo delle forme visi-
ELOL TXHO FKH O¶DUWH è nel mondo
delle forme invisibili.
Salvatore Satta,
Il formalismo nel processo
Tra luci e ombre
delle realtà del mondo,
studiamo le radici
del terreno di chi lavora
esprimendo se stesso.

'RYHQRQF¶qDOEHUR
piantiamo semi;
dove ci sono paure,
mostriamo percorsi
nella foresta del diritto.

Eppure siamo piccoli punti


nel mosaico
dei nostri schermi accesi,
uniti
nello spazio della ricerca.

agli Autori

Caterina Barontini,
Ricerca
Introduzione

di FABIO DELL¶AVERSANA

Anche il mondo delle arti e dello spettacolo è retto da regole e alcune


di esse hanno natura giuridica: è questa la premessa che bisogna tener
presente quando ci si accinge allo studio del diritto delle arti e dello
spettacolo, disciplina complessa che nel corso degli ultimi anni ha as-
sunto un peso sempre maggiore nella formazione culturale degli artisti
che frequentano le Istituzioni di Alta Formazione Artistica e Musicale
del nostro Paese.
Il diritto delle arti e dello spettacolo è stato a lungo considerato po-
co interessante, sia da parte degli operatori giuridici, sia da parte degli
stessi artisti, colpevoli di non aver saputo valorizzare la funzione che
OD&RVWLWX]LRQHDIILGDDOODFXOWXUDHDOO¶DUWH,QSDUWLFRODUHO¶DVVRUGDQWH
silenzio dei giuristi ± interrotto, in verità, da alcuni contributi di gran-
de pregio ± KDFRQFRUVRLQPDQLHUDGHFLVLYDDOO¶DEEDVVDPHQWRGHOOi-
vello di tutela degli artisti, terminologia impiegata in questa sede per
riferirsi sia agli ideatori che ai realizzatori di un prodotto culturale.
La riduzione delle tutele risulta di tutta evidenza se si considera,
FRVu FRPH IDUHPR LQ SL SDUWL GL TXHVWR ODYRUR O¶LPSDWWR FKHDOFXQH
previsioni contenute nella legislazione vigente hanno sulla realizza-
zione di uno spettacolo. I problemi più frequenti si manifestano sin
dalle prime fasi della progettazione di uno spettacolo. Basti pensare,
ad esempio, ai tanti ostacoli che si incontrano durante la ricerca dei
fondi da impiegare per la produzione di uno spettacolo (il c.d. fundrai-
sing) per comprendere quanto sia pregiudizievole il comportamento
(omissivo) del soggetto pubblico. In questa sede possiamo già antici-
SDUH FKH O¶LQHVRUDELOH ULGX]LRQH GHJOL LQYHVWLPHQWL QHO VHWWRUH GHOOD
cultura ha determinato un appiattimento dei prodotti offerti al pubbli-

17
18 Manuale di diritto delle arti e dello spettacolo

co e la scomparsa di tante ottime realtà che rappresentavano una pecu-


liarità del sistema culturale italiano. La situazione è diventata ancor
più insostenibile a seguito delle recenti innovazioni in tema di distri-
buzione del Fondo Unico per lo Spettacolo (istituto su cui torneremo
LQ VHJXLWR ULFRUGDWR DQFKH FRQ O¶DFURQLPR )86  L PHFFDQLVPL GL
nuova introduzione, infatti, hanno escluso dal piano di riparto dei fon-
di alcune tra le realtà di maggior rilievo nel campo, con la conseguen-
za che queste ultime potrebbero addirittura scomparire nei prossimi
anni.
Lo scenario brevemente descritto è, dunque, conseguenza di una
precisa scelta del legislatore, il quale sovente giustifica politiche in-
soddisfacenti attraverso il mero richiamo di argomenti contingenti. Al-
ODOXFHGLTXHVWDYDOXWD]LRQHVLFRPSUHQGHSHUFKpO¶DWWXDOHVLWXD]LRQH
economica sia sempre più frequentemente utilizzata per dimostrare
O¶XWLOLWjHO¶LQHYLWDELOLWjGHJOLDSSURFFLULGX]LRQLVWLFLDGRWWDWLQHOFRUVR
degli ultimi anni. Eppure, il rischio di implementare politiche non coe-
renti, inutili e dannose è stato più volte manifestato al legislatore, in
particolare da parte degli economisti che hanno formulato teorie volte
a evidenziare il ruolo trainante della cultura nelle situazioni di crisi
economica.
A ben vedere, è lo stesso rispetto degli inderogabili principi costi-
tuzionali ad essere ormai seriamente compromesso dal persistente di-
sinteresse del soggetto che, invece, dovrebbe farsi carico, in via priori-
WDULDPDQRQHVFOXVLYDGHOO¶DWtuazione di tutte le norme costituzionali:
il legislatore, infatti, è intervenuto sulla materia che ci impegna con
una sporadicità che nella maggior parte dei casi non è stata compensa-
ta dalla qualità dei provvedimenti adottati. Non sono rari i casi in cui
O¶RSHUDWRUHqFRVWUHWWRDFRQIURQWDUVLFRQQRUPDWLYHGLVRUJDQLFKHSo-
co aderenti alla realtà dei fatti e fortemente disincentivanti per chi pre-
sta la propria opera professionale nel settore artistico.
Questa prima considerazione suscita alcuni interrogativi, la cui so-
OX]LRQH q SUHJLXGL]LDOH ULVSHWWR DOO¶DQDOLVL GHOOH VSHFLILFKH TXHVWLRQL
che affronteremo nelle pagine seguenti: perché occuparsi di diritto
delle arti e dello spettacolo? E ancora: quali sono gli obiettivi ± teorici
e non ± che ci si prefigge di raggiungere con una trattazione organica
dedicata a questo tema?
Per rispondere proficuamente a queste domande si deve necessa-
Introduzione 19

riamente condividere la volontà di avviare un serio processo di risco-


SHUWDGHOODGLJQLWjJLXULGLFDGHOO¶DUWLVWD3HUWDQWRLOcompito principale
che gli studiosi di diritto dello spettacolo dovrebbero perseguire si tra-
GXFH QHOO¶HODERUD]LRQH FDWDORJD]LRQH H GLIIXVLRQH GHL SULQFLSL FKH
SRVVDQR DYHUH XQ¶LQIOXHQ]D VXO VLVWHPD QRUPDWLYR GL ULIHULPHQWR ,O
giurista deve suggerire soluzioni al conditor jus e correggere le stortu-
UHFKHO¶DSSOLFD]LRQHSUDWLFDGHOOHQRUPHYLJHQWLGRYHVVHIDUHPHUJe-
re: in buona sostanza, e al pari di quanto avviene con riguardo ad altri
campi del diritto oggettivo, deve intervenire al fine di fissare un nuovo
VWDQGDUGGLWXWHODFHUFDQGRGLLQQDO]DUHO¶DWWXDOHOLYHOOR
Tuttavia, come già accennato, alcuni segnali positivi emergono dal-
la legislazione più recente ed è da questi dati che riteniamo utile parti-
re per offrire al lettore una chiave di lettura in positivo. Per esempio,
nella prospettiva di una reale riscoperta del valore sociale proprio del-
le arti e della musica assumono grande importanza le prescrizioni con-
WHQXWHQHOODOHJJHGLFHPEUHQUHFDQWHOD³5LIRUPDGHOOH
Accademie di belle arti GHOO¶$FFDGHPLD QD]LRQDOH GL GDQ]D
GHOO¶$FFDGHPLD QD]LRQDOH GL DUWH GUDPPDWLFD GHJOL ,VWLWXWL VXSHULRUL
per le industrie artistiche, dei Conservatori di musica e degli Istituti
PXVLFDOLSDUHJJLDWL´QRUPDWLYDFKHKDUDGLFDOPHQWHPRGLILFDWRLSULn-
cipi posti a fondamento della formazione degli artisti dei nostri tempi
VWDELOHQGRLQPDQLHUDGHILQLWLYDO¶HTXLSDUD]LRQHWUDSHUFRUVLGLVWXGLR
attivati presso le Università, i Conservatori di musica e le Accademie
di belle arti.
Il dato è particolarmente interessante perché, ad avviso di chi scri-
ve, una rinnovata sensibilità giuridica verso questi temi non può che
fondarsi sulla valorizzazione del momento formativo, prius (cro-
QR ORJLFR ULVSHWWR DOOR VYROJLPHQWR GHOO¶RSHUD SURIHVVLRQDOH
GHOO¶DUWLVWD TXHVW¶XOWLPR infatti, già durante la propria formazione,
deve essere messo nella condizione di comprendere la realtà circostan-
te, analizzare le principali regole che la governano e acquisire familia-
rità con quegli istituti che potrebbero toccare la propria sfera giuridica.
Dalle considerazioni sin qui svolte si comprende che
O¶LQVHJQDPHQWRGHOGLULWWRGHOOHDUWLHGHOORVSHWWDFRORDVVXPHXQDIXn-
zione fondamentale perché contribuisce concretamente alla diffusione
di una sensibilità giuridica tra gli artisti, assicurando, in particolare, al
IXWXURRSHUDWRUHGHOPRQGRGHOORVSHWWDFRORO¶DFTXLVL]LRQHGLFRPSe-
20 Manuale di diritto delle arti e dello spettacolo

WHQ]HHO¶DSSUHQGLPHQWRGLFRQRVFHQ]HJHQHUDOLHVSHFLDOLVWLFKHGLYe-
nute ormai irrinunciabili. Intesa in questi termini, quindi, questa disci-
plina assume una valenza pratica non trascurabile.
Il secondo interrogativo a cui riteniamo opportuno dare risposta in
queste notazioni introduttive sollecita una riflessione sul metodo e
prende le mosse dalla ricostruzione del rapporto che lega il diritto con
le discipline artistiche, ambiti che solo apparentemente sono distanti
tra loro.
3UHQGLDPRLQFRQVLGHUD]LRQHO¶DWWLYLWjSURIHVVLRQDOHGHOPXVLFLVWDH
confrontiamola con quella del giurista. Entrambi i soggetti sono chia-
PDWLDUHDOL]]DUHXQ¶DWWLYLWjHUPHQHXWLFDLOPXVLFLVWDGovrà interpreta-
re la partitura al fine di dare concretezza al pensiero musicale del
compositore; il giurista, analogamente, si confronterà con varie tipo-
logie di documenti, tra cui primeggiano i testi normativi, espressione
della voluntas del legislatore. Sia il musicista che il giurista, pertanto,
VLFRQIURQWDQRFRQO¶DIIDVFLQDQWHWHPDGHOO¶LQWHUSUHWD]LRQHSRQHQGRVL
domande che, a ben vedere, sono quasi del tutto coincidenti:
O¶LQWHQ]LRQH GHOO¶$XWRUH FRPSRVLWRUH R OHJLVODWRUH  FUHD XQ YLQFROR
insormontabiOHSHUO¶LQWHUSUHWH"4XLQGLqFRQILJXUDELOHXQRVSD]LRGL
DXWRQRPLDSHUO¶LQWHUSUHWH"
A tal proposito non è affatto irrilevante notare che i meccanismi
esegetici applicati nelle due discipline mostrano molti più punti di
contatto di quanto si possa ritenere prima facie. Ferme restando le in-
QHJDELOL GLIIHUHQ]H LQ PHULWR DOOD YLQFRODWLYLWj GHOO¶LQWHUSUHWD]LRQH
proposta ± FDUDWWHULVWLFDSURSULDGHOO¶LQWHUSUHWD]LRQHFRPSLXWDGDOJLu-
dice, sicuramente assente nel settore delle arti ± è possibile constatare
che analoghi sono stati i problemi posti e in larga parte sovrapponibili
sono stati gli itinera VHJXLWLGDLWHRULFLGHOO¶LQWHUSUHWD]LRQH,QHQWUDm-
be le discipline, per esempio, è stata ampiamente valorizzato O¶DSSRUWR
FUHDWLYRULFRQGXFLELOHDOO¶RSHUDGHOO¶LQWerprete, il quale non è più con-
siderato un mero esecutore di quanto previsto nel testo da interpretare.
Il tema è ampio e delicato ed è qui solamente accennato per dimo-
strare la contiguità tra le discipline giuridiche e il mondo delle arti, già
evidenziata nelle interessanti intuizioni formulate dagli studiosi che
hanno preso parte alle ricerche sul tema Law & Humanities, corrente
di pensiero entro cui è possibile collocare anche le belle riflessioni
sviluppate in merito al rapporto tra diritto e musica, declinate secondo
Introduzione 21

le varianti della Law in music e della Law as music. È evidente, dun-


que, che il giurista deve tenere nella giusta considerazione le peculia-
riWjGHOO¶RJJHWWRGHOO¶LQGDJLQHVHYuole realmente contribuire alla fon-
dazione di un sistema che sia coerente e non meramente astratto.
A questo primo modo di LQWHQGHUHO¶interdisciplinarietà si deve ag-
JLXQJHUHXQ¶XOWHULRUHDFFH]LRQHULJXDUGDQWHLOSLDQRVWUHWWDPHQWHJLu-
ridico. In particolare, non possiamo non notare che il diritto delle arti e
dello spettacolo è una disciplina di difficile configurazione, dato che
QRQ q DVFULYLELOH LQ PDQLHUD HVFOXVLYD Qp DOO¶DPELWR GHOOH GLVFLSOLQH
pubblicistiche né tra le discipline privatistiche: infatti, come risulterà
sempre più chiaro nel corso della trattazione, O¶DFFRVWDPHQWRGLVHWWRUL
solitamente ritenuti distanti è, invece, la risposta migliore alla com-
plessità del fenomeno qui indagato. Per questa ragione, è indispensa-
bile, ad avviso di chi scrive, il continuo riferimento a categorie tradi-
zionali del diritto pubblico ± costituzionalistiche, amministrativistiche
e penalistiche ± e ad istituti del diritto privato ± inclusi quelli di stam-
po prettamente commercialistico e giuslavoristico ± per avere una vi-
VLRQH G¶LQVLHPH GHOOD VWUXWWXUD SURSULD GHO GLULWWR GHOOH Drti e dello
spettacolo.
Per questa ragione, riteniamo utile concludere sottolineando che
QHOO¶LQWHUDWUDWWD]LRQHVLSHUVHJXHO¶RELHWWLYRGLVYLOXSSDUHLQPDQLHUD
armonica entrambe le accezioni di interdisciplinarietà a cui si è fatto
riferimento: è questaLQIDWWLO¶XQLFDYLDFKHDGDYYLVRGLFKLVFULYH
può condurre alla corretta ricostruzione della disciplina, presupposto
fondamentale per il riconoscimento della sua dignità scientifica.
Capitolo I

Fonti e principi del diritto dello spettacolo


di FABIO DELL¶$VERSANA

/¶DUWHGLLQVHJQDUHFRQVLVWHWXWWDHVROWDQWRQHOO¶DUWHGL destare la naturale


FXULRVLWjGHOOHJLRYDQLPHQWLFRQO¶LQWHQWRGLVRGGLVIDUODLQVHJXLWR
Per digerire il sapere, bisogna averlo divorato con appetito.

Anatole France,
LHFULPHGH6\OYHVWUH%RQQDUGPHPEUHGHO¶,QVWLWXW

1.1. Premessa: le nozioni giuridiche fondamentali

Il diritto dello spettacolo costituisce una branca del diritto oggettivo


caratterizzata dalla presenza di una pluralità di fonti normative e dalla
totale assenza di un codice che raccolga queste ultime in maniera uni-
taria.
Questa prima definizione di diritto dello spettacolo rimanda ad al-
cuni concetti che impiegheremo più volte nel corso della successiva
trattazione ed è per questa ragione che riteniamo particolarmente utile
definire con precisione i concetti evocati (e altre nozioni preliminari)
SULPDGLDGGHQWUDUFLQHOO¶DQDOLVLGHLWDQWLSUREOHPLSRVWLGDOODDSSOLFa-
zione della normativa in materia di spettacolo. Pertanto, in questo
primo paragrafo ci limiteremo a dare quelle nozioni indispensabili per
il lettore che voglia leggere con profitto il presente manuale, consape-
voli del fatto che altre nozioni dovranno essere via via formulate nel
corso del ragionamento. Inoltre, articoleremo questa premessa defini-
toria tenendo nella giusta considerazione il fatto che il linguaggio giu-
ridico spesso non coincide con il linguaggio comune. Termini che
spesso utilizziamo nella quotidianità assumono un significato peculia-
re quando vengono impiegati dagli operatori del diritto. Chi si accosta,

23
24 Manuale di diritto delle arti e dello spettacolo

dunque, allo studio del diritto dello spettacolo ± ma analogo discorso


potrebbe farsi con riguardo agli altri settori del diritto ± deve saper ri-
conoscere il preciso significato di ogni termine, al fine di evitare quel-
le confusioni che si traducono inevitabilmente in errori in punto di di-
ritto.
In alcuni casi, inoltre, il medesimo termine tecnico-giuridico può
assumere diversi significati a seconda dello specifico contesto in cui
viene adoperato. Per esempio, il termine diritto può essere impiegato
in due modi diametralmente opposti: la dottrina, infatti, distingue il
diritto oggettivo dal diritto soggettivo con il preciso obiettivo di de-
scrivere due situazioni molto lontane tra loro. Il sintagma diritto og-
gettivo è normalmente impiegato come sinonimo di ordinamento giu-
ridico nel suo complesso: id estO¶LQVLHPHGHOOHQRUPHFKHFRPSRn-
gono un determinato sistema giuridico. A tal proposito, è bene avver-
tire il lettore che nel prosieguo della trattazione analizzeremo in ma-
niera compiuta il diritto oggettivo italiano, anche se spesso vi saranno
delle ampie parentesi che avranno ad oggetto la ricostruzione di altre
esperienze giuridiche. La seconda nozione che abbiamo individuato è
quella di diritto soggettivo. In questo caso, assume fondamentale im-
portanza il riferimento al soggetto giuridico ± sia esso persona fisica o
ente collettivo ± che è titolare della posizione di vantaggio prevista e
WXWHODWDGDOO¶RUGLQDPHQWRJLXULGLFR
Dunque, il quadro normativo di riferimento ± il diritto oggettivo ±
prevede delle situazioni giuridiche soggettive riferibili ai soggetti di
GLULWWRFKHRSHUDQRLQTXHOO¶RUGLQDPHQWRJLXULGLFR8QDEXRQDSDUWHGL
tali situazioni assume la forma del diritto soggettivo, anche se è op-
portuno precisare che esistono situazioni giuridiche soggettive diverse
dal diritto soggettivo. Per esempio, non sono rari in cui il privato ± an-
che con riferimento al diritto dello spettacolo ± sia titolare di un inte-
resse c.d. legittimo, ovvero di una posizione giuridica attiva che può
essere vantata nei confronti della Pubblica Amministrazione e che
UDSSUHVHQWDXQDSHFXOLDULWjGHOO¶RUGLQDPHQWRJLXULGLFRLWDOLDQRFRPH
dimostrano gli artt. 24, 103 e 113 della Costituzione.
La corretta ricostruzione del concetto di diritto soggettivo è di fon-
damentale importanza e, non a caso, è stato a lungo dibattuto dai giu-
risti di tutte le epoche storiche. Ampi riferimenti a questa nozione fu-
URQRIRUPXODWLJLjQHOO¶DPELWRGHOO¶HVSHULHQ]DJLXULGLFDURPDQDDQFKH
I. Fonti e principi del diritto dello spettacolo 25

se una chiara codificazione della nozione si deve ai giuristi della scuo-


la tedesca di B. Windscheid, il quale definiva il diritto soggettivo co-
me il potere o la signoria della volontà attribuita al singolo dal diritto
oggettivo.
La teoria appena richiamata ± la quale ha spinto altri giuristi e filo-
sofi del diritto ad occuparsi del tema con il preciso obiettivo di criti-
carla ± è qui utilmente richiamata perché mette in luce lo stretto lega-
me che sussiste tra le due nozioni di diritto.
Chiarito, dunque, che parlare genericamente di diritto è assoluta-
mente insufficiente, spostiamo la nostra attenzione sul titolo di questo
manuale per comprendere se esso faccia riferimento ad una nozione
soggettiva o ad una concezione oggettiva. Chi avrà ben capito la di-
stinzione sopra proposta, non esiterà ad affermare che il titolo di que-
sto manuale sottintende un riferimento alla nozione oggettiva. Il dirit-
to dello spettacolo a cui facciamo qui riferimento ± ed ora risulterà an-
che più chiara la definizione data in apertura ± è costituito proprio
GDOO¶LQVLHPHGHOOHQRUPHgiuridiche che hanno ad oggetto i tanti aspet-
ti che concerno la produzione di uno spettacolo.
A questo punto, pare importante procedere alla precisa delimitazio-
ne dei concetti di diritto e di legislazione, spesso impiegati congiun-
tamente per riferirsi alla normativa sullo spettacolo. Si tratta di una
tendenza che è stata oltremodo agevolata anche dalla recente riforma
GHJOLVWXGLPXVLFDOLFKHQHOO¶LQWURGXUUHORVSHFLILFRLQVHJQDPHQWRGL
diritto e legislazione dello spettacolo nei percorsi di studio attivati
presso gli Istituti superiori di studi musicali, ha contribuito notevol-
mente alla già diffusa confusione che caratterizzava i discorsi degli
operatori del settore. Anche nelle Accademie di belle arti questa ten-
denza è stata rafforzata dalla riforma e dai nuovi piani di studio, come
dimostra la scelta dLLQWURGXUUHO¶LQVHJQDPHQWRGLGiritto, legislazione
ed economia dello spettacolo.
Sul punto si deve subito precisare che le due terminologie appena
richiamate ± diritto e legislazione ± non possono in alcun modo essere
considerate equivalenti né tantomeno sovrapponibili. La nozione di
diritto ± evidentemente declinata nella sua dimensione oggettiva ± ri-
manda ad un concetto generale che racchiude al suo interno anche il
più specifico riferimento alla legislazione. In buona sostanza, non tut-
26 Manuale di diritto delle arti e dello spettacolo

to il diritto è racchiuso in leggi, con la conseguenza che la legislazione


in materia di spettacolo non esaurisce il tema.
Come vedremo meglio nel paragrafo successivo, la legge costitui-
sce una delle varie fonti che compongono il diritto oggettivo. Oltre al-
la legge, dunque, esistono fonti ad essa sovraordinate ± in primis, la
Costituzione ± ma anche fonti ad essa subordinate.
Per questa ragione, si ritiene preferibile il riferimento al solo con-
cetto di diritto dello spettacolo. Non a caso, si è ritenuto superfluo in-
serire anche il riferimento alla legislazione in materia di spettacolo
QHOO¶DPELWRGHOWLWRORGHOSUHVHQWHPDQXDOHWDOHULIHULPHQWRLQIDWWLq
già ricompreso nella nozione di diritto dello spettacolo.
Un ultimo argomento che può essere impiegato per descrivere il
UDSSRUWRWUDGLULWWRHOHJLVOD]LRQHSXzHVVHUHWUDWWRGDOO¶LPPDJLQHGHL
cerchi concentrici, normalmente impiegata dalla dottrina e dalla giuri-
sprudenza per descrivere il rapporto tra norma generale e norma spe-
ciale. A ben vedere, il cerchio concentrico più esterno ± quello che ha
il raggio più ampio ± rappresenta la nozione di diritto; quello più in-
terno, invece, può descrivere il riferimento alla legislazione: non tutto
FLzFKHGLULWWRqVXVVXPLELOHQHOO¶Dmbito della legislazione mentre si-
FXUDPHQWHVLSXzGLUHFKHWXWWDOHJLVOD]LRQHULHQWUDQHOO¶DPELWRGHOGi-
ritto oggettivo.
Infine, riteniamo utile precisare cosa intendono i giuristi quando si
riferiscono alla dottrina e alla giurisprudenza. Il dato normativo è
spesso racchiuso in una disposizione scritta che necessita di una inter-
pretazione, la quale può essere fornita dai giudici o dagli accademici
che si sono occupati di un determinato tema. Il termine giurisprudenza
è generalmente impiegato per riferirsi alla interpretazione prospettata
dai giudici, i quali, per espressa previsione costituzionale, sono chia-
mati ad individuare ed applicare la norma giuridica al caso concreto
che venga posto alla loro attenzione, in piena autonomia ed indipen-
denza dagli altULSRWHULGHOOR6WDWR/¶LQWHUSUHWD]LRQHGRWWULQDOHLQYe-
ce, è il frutto degli studi compiuti dagli esponenti della comunità
scientifica, la quale è essenzialmente composta dai professori univer-
sitari, dai ricercatori e, più generalmente, dai cultori di una determina-
ta materia.
Entrambe le interpretazioni hanno un ruolo fondamentale
QHOO¶DPELWRGHOQRVWURVLVWHPDJLXULGLFRSXUDYHQGRXQGLYHUVRSHVR
I. Fonti e principi del diritto dello spettacolo 27

LQWHUPLQLGLYLQFRODWLYLWjFRPHqQRWRLQIDWWLVRORO¶LQWHUSUHWD]LRQH
giurisprudenziale vincola i consociati ± in particolar modo, i soggetti
protagonisti del giudizio che si è celebrato dinanzi al giudice ± come
dimostrano le conseguenze giuridicamente rilevanti che si ricollegano
DO PDQFDWR ULVSHWWR GHOO¶RUGLQH GHO JLXGLFH WUDOHWDQWH QRUPH FKH VL
occupaQRGHOWHPDLQTXHVWDVHGHVLDFRQVHQWLWRLOVRORULQYLRDOO¶DUW
650 cod. pen., a mente del quale chiunque non osserva un provvedi-
PHQWROHJDOPHQWHGDWRGDOO¶DXWRULWj QR]LRQHHQWURFXLqSRVVLELOHIDU
ULHQWUDUHDQFKHO¶DXWRULWjJLXGL]LDULD SHUUDJLRQHGi giustizia o di sicu-
UH]]DSXEEOLFDRG¶RUGLQHSXEEOLFRRG¶LJLHQHqSXQLWRVHLOIDWWRQRQ
FRVWLWXLVFH XQ SL JUDYH UHDWR FRQ O¶DUUHVWR ILQR D WUH PHVL R FRQ
O¶DPPHQGDILQRDHXUR/¶LQWHUSUHWD]LRQHGRWWULQDOHLQYHFHQRQq
assistita dalla medesima sanzione, anche se, analogamente a quella
JLXULVSUXGHQ]LDOHFRQWULEXLVFHDOO¶HYROX]LRQHGHOO¶RUGLQDPHQWRJLXUi-
dico. Non sono rari i casi in cui è la dottrina a segnalare problemi di
cui poi il legislatore si occupa raccogliendo proprio le sollecitazioni
provenienti dalla comunità accademica. In ultima istanza, si può af-
IHUPDUHFKHDOORVWDWRDWWXDOHQpO¶LQWHUSUHWD]LRQHJLXULVSUXGHQ]LDOHQp
quella dottrinale sono ascrivibili nella nozione di diritto oggettivo.

1.2. Le fonti del diritto dello spettacolo

Quanto sin qui detto deve essere necessariamente completato attraver-


so il riferimento alle singole fonti da cui promana il diritto in generale
e il diritto dello spettacolo in particolare. Dunque, nelle pagine imme-
diatamente seguenti analizzeremo le singole fonti del diritto che as-
sumono un autonomo rilievo per il diritto dello spettacolo. Organizze-
remo il discorso seguendo il tradizionale ordine gerarchico. Partiremo
dalla Costituzione che, in quanto Grundnorm, si colloca al vertice del
nostro ordinamento. Analizzeremo, poi, le fonti primarie ± leggi ed at-
ti aventi forza di legge del Governo ± per poi passare alle c.d. fonti se-
condarie, le quali non possono contenere norme in contrasto con i due
livelli superiori. Chiuderemo il discorso con un breve riferimento alle
norme comunitarie, le quali, ormai, regolano aspetti non secondari
delle varie discipline che qui ci impegnano (come vedremo, ad esem-
28 Manuale di diritto delle arti e dello spettacolo

SLR QHOO¶DPELWR GHL FRQWULEXWL GHGLFDWL DO GLULWWR G¶DXWRUH H DO GLULWWR
cinematografico).

1.2.1. Cosa si intende per fonte del diritto?

Generalmente, per fonti del diritto si intendono tutti gli atti o fatti ca-
SDFL GL LQQRYDUH O¶RUGLQDPHQWR JLXULGLFR 6L WUDWWD D EHQ YHGHUH GL
una espressione che il diritto prende in prestito dal linguaggio delle
scienze naturali: essa, infatti, è stata impiegata dai giuristi, già in epo-
ca risalente, per mettere in evidenza gli elementi in comune tra
O¶LPPDJLQHQDWXUDOLVWLFDGHOODVRUJHQWHGDFXLVJRUJDO¶DFTXDHODIRQWH
da cui proviene il diritto.
Sono fonti del diritto quei fatti o atti qualificati come tali
GDOO¶RUGLQDPHQWR LQYLUWGHOFGSULQFLSLRGLrelatività); la loro prin-
FLSDOH IXQ]LRQH FRQVLVWH QHOO¶DVVLFXUDUH LO FRQWLQXR ULQQRYDPHQWR QHO
tempo delle regole poste a presidio della convivenza civile. Non a ca-
so, tra due fonti di pari grado prevale sempre la fonte più recente, in
UDJLRQH GHOO¶DSSOLFD]LRQH GHO FULWHULR FURQRORJLFR PHWRGR GL ULVROu-
]LRQHGHOOHDQWLQRPLHDFXLVLULFROOHJDO¶LVWLWXWRGHOO¶DEURJD]LRQH

1.2.2. La Costituzione repubblicana

Il nostro ordinamento giuridico si caratterizza per la presenza di una


pluralità di fonti, le quali vengono tradizionalmente organizzate se-
condo un criterio gerarchico.
La fonte più importante per il nostro ordinamento è rappresentata
dalla Costituzione repubblicana, un testo normativo vigente sin dal 1°
gennaio 1948 nato sulle macerie della seconda guerra mondiale grazie
alla indispensabile collaborazione di tutte le forze politiche che ave-
vano preso parte alla lotta contro il fascismo.
La nascita di una Costituzione è sempre un fatto complesso e la
sinWHWLFD ULFRVWUX]LRQH GHL IDWWL FKH KDQQR FRQGRWWR DOO¶DSSURYD]LRQH
della nostra Legge fondamentale ne è una chiara testimonianza. Prima
del 2 giugno 1946, lo Stato italiano aveva già una Costituzione: essa,
infatti, era contenuta nello Statuto albertino promulgato il 4 marzo
1848 da Carlo Alberto di Savoia, un testo che era stato inizialmente
pensato per i soli territori governati dalla monarchia Sabauda ma che
I. Fonti e principi del diritto dello spettacolo 29

lentamente estese la sua efficacia a tutto il territorio italiano. Lo Statu-


to albertino conteneva molte norme dedicate alla tutela dei diritti, an-
che se questo profilo fu notevolmente depotenziato in ragione della
principale caratteristica di tale testo normativo: esso costituiva, infatti,
un chiaro esempio di Costituzione flessibile, come dimostra il fatto
che le modifiche al testo costituzionale potevano essere disposte da
parte del legislatore senza particolari difficoltà, attraverso una legge
che disponesse in maniera contraria rispetto a quanto originariamente
previsto nello statuto. Se, dunque, da un lato, lo Statuto albertino ha
rappresentato un tassello fondamentale nel processo evolutivo in ma-
teria di riconoscimento e garanzia dei diritti dei cittadini, è innegabile
che la garanzia di tali situazioni giuridiche soggettive era rimessa alla
buona volontà del legislatore, il quale facilmente poteva svuotare i li-
miti individuati in Costituzione.
I limiti propri di una Costituzione flessibile furono particolarmente
evidenti nel corso del ventennio fascista, un periodo caratterizzato da
continue e profonde repressioni in tutti i settori, incluso quello dello
spettacolo. La facile modificabilità dello Statuto ± e delle garanzie in
esso previste ± agevolò notevolmente il processo autoritario che con-
GXVVH O¶,WDOLD DG XQ QRtevole arretramento delle garanzie individuali
prima e alla discesa in guerra poi.
La fine della guerra fu accompagnata da un vivace dibattito sulle
sorti dello Statuto albertino, una Costituzione che, come abbiamo vi-
sto, aveva dimostrato tutta la sua inefficacia proprio nel momento di
maggior bisogno. Questo dibattito culminò nella votazione del 2 giu-
gno 1946. In quella occasione, gli italiani ± che per la prima volta vo-
tarono a suffragio universale ± VFHOVHURLPHPEULGHOO¶$VVHPEOHD&o-
stituente, istituita proprio al fine di redigere il testo di una Costituzio-
ne per la Repubblica italiana.
,Q DVWUDWWR O¶$VVHPEOHD &RVWLWXHQWH DYUHEEH SRWXWR SURFHGHUH DG
un semplice un lifting dello Statuto, anche se questa ipotesi venne ben
SUHVWR DEEDQGRQDWD FRQ O¶RELHWWLYo di procedere alla scrittura di una
Costituzione radicalmente nuova e di rottura rispetto alla tradizione.
Influirono su questa scelta, il terribile peso del ventennio fascista e la
rottura consumatasi con i Savoia, finita nel contestato addio di Umber-
to ,,O¶XOWLPRUHG¶,WDOLD
30 Manuale di diritto delle arti e dello spettacolo

, ODYRUL GHOO¶$VVHPEOHD &RVWLWXHQWH WHUPLQDURQR QHO GLFHPEUH GHO


1947. In particolare, il 22 dicembre 1947 fu approvato il testo definiti-
vo, promulgato dal capo provvisorio dello Stato Enrico De Nicola il
27 dicembre 1947 e pubblicato nella Gazzetta Ufficiale della Repub-
blica Italiana n. 298, edizione straordinaria, del 27 dicembre 1947.
La Costituzione è essenzialmente suddivisa in tre parti. I primi 12
DUWLFROL FRQWHQJRQR O¶HOHQFD]Lone dei c.d. principi fondamentali, tra
cui ricordiamo quello di uguaglianza (art. 3 cost.) e quello di tutela del
patrimonio artistico e culturale del nostro Paese (art. 9 cost., su cui ci
soffermeremo in maniera diffusa nella ricostruzione dei principi del
GLULWWRGHOORVSHWWDFROR 'DOO¶DUWFRVWYHQJRQRHOHQFDWHOHOLEHUWj
dei cittadini: in questa parte della Costituzione coesistono diritti che
attengono a vari profili, tanto che, ai fini di una migliore organizza-
zione del testo, gli stessi Costituenti decisero di articolare questa parte
in quattro Titoli (rispettivamente dedicati ai rapporti civili, ai rapporti
etico-sociali, ai rapporti economici e ai rapporti politici): è questa la
parte di maggiore interesse per il giurista che voglia occuparsi della
ricostruzione della normativa riguardante lo spettacolo. Negli artt. 13-
54 cost. ritroviamo molte norma che, direttamente o indirettamente,
vincolano il legislatore ± o, più generalmente, il soggetto pubblico ±
TXDQGRVLRFFXSDGLVSHWWDFROR/¶XOWLPD parte della Costituzione è in-
WHUDPHQWHGHGLFDWDDOO¶RUGLQDPHQWRGHOOD5HSXEEOLFDLQTXHVWDSDUWH
dunque, sono inserite tutte le norme riguardanti il Parlamento (princi-
pale detentore del potere legislativo), il Presidente della Repubblica, il
Governo (titolare del potere esecutivo), il potere giudiziario, le auto-
nomie locali e le garanzie costituzionali.
Nel presente manuale non affronteremo i tanti problemi posti dalle
norme costituzionali in tema di organizzazione della Repubblica. Tut-
tavia, prima di chiudere il discorso riguardante la Costituzione repub-
blicana riteniamo particolarmente utile ricordare che i Costituenti ri-
tennero indispensabile conferire al nuovo testo il carattere della rigidi-
tà, caratteristica che rende molto più difficile la modifica delle dispo-
sizioni costituzionali, come dimostra il procedimento aggravato di cui
DOO¶DUWFRVW

Le leggi di revisione della Costituzione e le altre leggi costituzionali sono


adottate da ciascuna Camera con due successive deliberazioni ad intervallo
I. Fonti e principi del diritto dello spettacolo 31

non minore di tre mesi, e sono approvate a maggioranza assoluta dei compo-
nenti di ciascuna Camera nella seconda votazione.
Le leggi stesse sono sottoposte a referendum popolare quando, entro tre mesi
dalla loro pubblicazione, ne facciano domanda un quinto dei membri di una
Camera o cinquecentomila elettori o cinque Consigli regionali.
La legge sottoposta a referendum non è promulgata, se non è approvata dalla
maggioranza dei voti validi.
Non si fa luogo a referendum se la legge è stata approvata nella seconda vo-
tazione da ciascuna delle Camere a maggioranza di due terzi dei suoi compo-
nenti.

1.2.3. Le fonti primarie: leggi ed atti aventi forza di legge

Il livello immediatamente subordinato alla Costituzione include le


leggi e gli atti aventi forza di legge.
La legge ordinaria statale, fonte primaria per eccellenza, è il pro-
GRWWRGHOO¶HVHUFL]LRGHOODIXQ]LRQHOHJLVODWLYDDWWULEXLWDDO3DUODPHQWR
Si tratta di una fonte a competenza generale, come dimostra il fatto
che la legge può disciplinare qualsiasi materia, in qualunque momen-
to, e secondo le direttive che il Parlamento ritiene più opportuno. Tut-
tavia, il rispetto delle norme contenute nella Costituzione costituisce
un limite invalicabile per il legislatore, la cui violazione può essere
VDQ]LRQDWDFRQO¶HYentuale intervento della Corte costituzionale.
Accanto alla legge, si collocano il decreto legislativo e il decreto
legge, atti normativi del Governo che si caratterizzano per il fatto di
avere la medesima forza attiva e passiva della legge ordinaria formale.
Come abbiamo visto, la funzione legislativa spetta al Parlamento
che, tuttavia, può trasferirne temporaneamente l¶esercizio al Governo,
mediante approvazione di una legge delega (anche detta di delegazio-
ne). Questa possibilità è espressamente disciplinDWDQHOO¶DUWFRVWLO
quale fissa innanzitutto un limite di competenza in quanto destinatario
della delega può essere esclusivamente il Governo nel suo complesso
± id est: il Consiglio dei ministri ± e non il singolo ministro. Tale
norma, inoltre, fissa un limite di natura temporale laddove prevede che
O¶HVHUFL]LRGHOODGHOHJDQRQSRVVDHVVHUHSHUPDQHQWHPDVRORWHPSo-
ranea. Pertanto, le legge delega deve necessariamente fissare un ter-
PLQHHQWURLOTXDOHLO*RYHUQRSXzSURFHGHUHDOO¶DSSURYD]LRQHGHLUe-
ODWLYLGHFUHWL,QILQHO¶DUWFRVWILVVDXQOLPLWHIRUPDOHLQTXDQWROD
32 Manuale di diritto delle arti e dello spettacolo

delega può essere conferita solo con una legge formale, approvata a
seguito di un procedimento ordinario che contenga i principi e i criteri
direttivi a cui il Governo dovrà attenersi nel regolare la materia ogget-
to di delega.
4XLQGL LO GHFUHWR OHJLVODWLYR R GHFUHWR GHOHJDWR  q O¶DWWR DYHQWH
forza di legge che il Governo adotta a seguito di delega del Parlamen-
to conferita con legge. Tale atto viene adottato su proposta del mini-
stro o dei ministri competenti, su delibera del Consiglio dei ministri,
ed è emanato con decreto del Presidente della Repubblica, pubblicato
in Gazzetta Ufficiale con la denominazione decreto legislativo e con la
numerazione progressiva delle leggi.
/¶DPELWR di applicazione del decreto legge è diverso: infatti, esso è
O¶DWWRDYHQWHIRU]DGLOHJJHFKHLO*RYHUQRDGRWWDVRWWRODSURSULDUe-
VSRQVDELOLWjSHUIURQWHJJLDUH³FDVLVWUDRUGLQDULGLQHFHVVLWjHGXUJHn-
]D´ /DUHODWLYDGLVFLSOLQDqFRQWHQXWDQHOO¶DUWFRVWHQHOO¶DUW
della legge 23 agosto 1988, n. 400. Il decreto legge è deliberato dal
Consiglio dei ministri, è emanato dal Presidente della Repubblica e
pubblicato in Gazzetta Ufficiale. In casi eccezionali, il Presidente del-
la Repubblica può rifiutare di emanare il decreto nel normale esercizio
dei poteri di controllo che gli sono affidati dalla Costituzione. In ogni
FDVRODGRWWULQDKDSLYROWHDIIHUPDWRFKHO¶DVVXQ]LRQHGLUHVSRQVDEi-
OLWjGHO*RYHUQRQHOO¶DGR]LRQHGHOSURYYHGLPHQWRqHOHPHQWRGDWHne-
re nella giusta considerazione al fine di affermare che il Presidente
della Repubblica debba usare con cautela questo potere.
Il decreto legge entra in vigore il giorno stesso della sua pubblica-
zione (o, al massimo, quello successivo) e deve contenere la clausola
di presentazione al Parlamento per la sua conversione in legge: il Go-
verno, infatti, deve presentare alle Camere il disegno di legge, con il
testo del decreto, per attivare il procedimento di approvazione della
legge di conversione. Tale presentazione richiede la previa autorizza-
zione, con decreto, del Presidente della Repubblica, come avviene per
tutti i disegni di legge di iniziativa governativa. La conversione in
legge deve avvenire entro sessanta giorni dalla pubblicazione, pena la
decadenza del decreto con effetti retroattivi. Le Camere anche se
VFLROWH VL ULXQLVFRQR HQWUR FLQTXH JLRUQL SHU O¶HVDPH GHO GLVHJQR GL
legge di conversione.
I. Fonti e principi del diritto dello spettacolo 33

Come si evince dalla sintetica ricostruzione della normativa conte-


nuta negli artt. 77 e 78 cost., per entrambi gli atti del Governo si è
SHQVDWR DOO¶LQWURGX]LRQH GL XQD VRUWD GL FRQWUROOR GD SDUWH GHO 3DUOa-
mento. Tale controllo è preventivo nel caso di decreto legislativo e
chiaramente si estrinseca nella legge di delega. Nel caso del decreto
legge, invece, il controllo si realizza ex post, nel termine di 60 giorni
SUHYLVWRSHUO¶DSSURYD]LRQHGHOODOHJJHGLFRQYHUVLRQH
Infine, per completezza del discorso si ritiene opportuno ricordare
che quanto sin qui detto deve essere ripensato alla luce delle più re-
centi eYROX]LRQL FKH KDQQR ULJXDUGDWR O¶RUGLQDPHQWR JLXULGLFR LWDOLa-
no: infatti, il riferimento al livello primario delle fonti del diritto deve
essere necessariamente completato con il riferimento alle leggi regio-
nali, atti normativi che possono intervenire nelle materie contemplate
QHOO¶DUWWHU]RHTXDUWRFRPPDFRVW

1.2.4. I regolamenti del Governo

Il Governo è il principale soggetto titolare della potestà regolamentare.


A tal proposito è bene precisare che la Costituzione non contiene una
dettagliata disciplina del procedimento di formazione dei regolamenti,
come invece può osservarsi con riguardo alla legge ordinaria formale
(si vedano, in particolare, gli artt. 70 e ss. cost.). A ben vedere, un ri-
FKLDPR q FRQWHQXWR QHOO¶DUW  TXLQWR FRPPD FRVW Oaddove si di-
VSRQH FKH LO 3UHVLGHQWH GHOOD 5HSXEEOLFD ³HPDQD L UHJRODPHQWL´ 8Q
XOWHULRUH ULIHULPHQWR VL ULQYLHQH QHOO¶DUW  VHVWR FRPPD FRVW
norma che disciplina la potestà regolamentare delle Regioni.
Un ulteriore ed importante riferimento è contenuto nelle Disposi-
zioni sula legge in generale ± meglio note come Disposizioni prelimi-
nari al codice civile o Preleggi ± QHOODGLVSRVL]LRQHFRQWHQXWDQHOO¶DUW
GHGLFDWDDOODLQGLFD]LRQHGHOOHIRQWLGHOGLULWWRQHOO¶HOHQFD]LRQHIRr-
nita, infatti, al n. 2) vengono richiamati proprio i regolamenti, la cui
disciplina di dettaglio è poi indicata nel successivo art. 3.
La materia dei regolamenti governativi ha subito notevoli muta-
menti a seguito della introduzione della nuova disciplina riguardante
O¶DWWLYLWj GL *RYHUQR H O¶RUGLQDPHQWR GHOOD 3UHVLGHQ]D GHO &RQVLJOLR
dei Ministri. Il più dettagliato riferimento alla potestà regolamentare
del Governo ± la quale deve sempre esplicarsi nel rispetto del princi-
34 Manuale di diritto delle arti e dello spettacolo

pio di legalità ± è ormai individuato nella legge 23 agosto 1988, n.


LQSDUWLFRODUHQHOO¶DUWODGGRYHVLSUHYHGHFKHSRVVRQRHVVHUH
emanati regolamenti per disciplinare:

D O¶HVHFX]LRQHGHOOHOHJJLHGHLGHFUHWLOHJLVODWLYL
E  O¶DWWXD]LRQH H O¶LQWHJUD]LRQH GHOOH OHJJL H GHL GHFUHWL OHJLVODWLYL UHFDQWL
norme di principio, esclusi quelli relativi a materie riservate alla competenza
regionale;
c) le materie in cui manchi la disciplina da parte di leggi o di atti aventi forza
di legge, sempre che non si tratti di materie comunque riservate alla legge;
G O¶RUganizzazione ed il funzionamento delle amministrazioni pubbliche se-
condo le disposizioni dettate dalla legge;
H O¶RUJDQL]]D]LRQHGHOODYRURHGLUDSSRUWLGLODYRURGHLSXEEOLFLGLSHQGHQWL
in base agli accordi sindacali.

Come si evince dalla disposizione appena riportata, i regolamenti


governativi sono atti a forma riservata: essi vengono deliberati dal
Consiglio dei ministri, su proposta di uno o più ministri, sentito il pa-
rere ± obbligatorio ma non vincolante ± che il Consiglio di Stato deve
pronunciare entro 45 giorni. Vengono emanati sotto forma di decreto
del Presidente della Repubblica e devono necessariamente recare la
denominazione di regolamento. Infine, è bene ricordare che sono sot-
toposti al visto e alla registrazione della Corte dei conti e che, al pari
delle altre fonti del diritto sin qui esaminate, vengono pubblicate nella
principale fonte di cognizione del nostro sistema giuridico (id est: la
Gazzetta Ufficiale).

1.2.5. Le fonti del diritto comunitario

Il processo di integrazione europea ha prodotto effetti non secondari


anche sul piano delle fonti del diritto. Per questa ragione, prima di
chiudere questa breve rassegna sulle fonti interne, riteniamo utile cita-
re quelle fonti del diritto che pur avendo una provenienza comunitaria
trovano apSOLFD]LRQHDQFKHQHOO¶RUGLQDPHQWRJLXULGLFRLWDOLDQR
Le fonti del diritto comunitario si distinguono in fonti comunitarie
originarie e derivate.
Tipici esempi di fonti originarie sono rappresentati dai trattati isti-
tutivi delle Comunità europee, dal Trattato di Parigi del 1951, dal
I. Fonti e principi del diritto dello spettacolo 35

Trattato di Roma istitutivo della Comunità europea del 1957, modifi-


FDWLGDOO¶$WWR8QLFR(XURSHRGHOHGDQXPHURVLSURWRFROOLVRWWo-
scritti nel corso degli anni. Inoltre, è fondamentale ricordare il Trattato
di Maastricht del LVWLWXWLYRGHOO¶Unione europea, che ha modifi-
cato numerose norme del Trattato di Roma, il Trattato di Amsterdam
del 1997 e il Trattato di Nizza del 2000 contenente la Carta dei diritti
IRQGDPHQWDOLGHOO¶8QLRQHHXURSHDLQFXLVRQRHOHQFDWLLGLULWWL civili,
SROLWLFLHFRQRPLFLHVRFLDOLGHLFLWWDGLQLGHOO¶8QLRQHHXURSHD$TXe-
sti atti, bisogna aggiungere il riferimento al Trattato di Lisbona, il qua-
le conserva e rafforza la tutela dei diritti esistenti con nuove norme in
materia di protezione dei dati di carattere personale, di bioetica, di la-
voro e di buona amministrazione.
Invece, rientrano tra le fonti comunitarie derivate gli atti che le isti-
tuzioni comunitarie (Consiglio, Parlamento e Commissione) adottano
per dare concreta attuazione alle politiche comunitarie. Le fonti deri-
vate possono assumere varie forme, anche se le più frequenti sono
quelle del regolamento e della direttiva.
I regolamenti comunitari entrano contemporaneamente in vigore in
tutti gli Stati membri e producono immediati effetti giuridici senza bi-
sogno che vi sia un atto di recepimento da parte del legislatore statale,
stante il carattere della diretta applicabilità.
Le direttive, invece, vincolano gli Stati membri al raggiungimento
del risultato indicato. Tale risultato deve essere obbligatoriamente
raggiunto dallo Stato entro il termine fissato dalla direttiva, anche se
sono fatte salve la competenza e la discrezionalità degli organi nazio-
nali in merito alla forma (legge, regolamento, atto amministrativo) e,
più generalmente, ai mezzi per perseguire tale risultato. A ben vedere,
le direttive contengono norme che devono essere completate, detta-
gliate e integrate. Le direttive possono essere immediatamente appli-
cate solo nel caso in cui il loro contenuto sia incondizionato e suffi-
cientemente preciso, come afferma la giurisprudenza della Corte di
giustizia, la quale precisa che tali elementi ricorrono quando non sus-
sistono margini di discrezionalità in capo allo Stato (in tal caso si par-
la di direttive self-executing).
Infine, tra le fonti comunitarie derivate si devono ricordare anche le
decisioni i pareri e le raccomandazioni (con la precisazione che queste
ultime due categorie di atti non sono vincolanti).
36 Manuale di diritto delle arti e dello spettacolo

/RVSHWWDFRORFRPHVSD]LRSHUO¶HVHUFL]LRGLOLEHUWj

Le libertà interessate dal diritto dello spettacolo sono molteplici ed è


per questa ragione che si ritiene opportuno offrire al lettore una sinte-
tica ma circostanziata ricostruzione dei principi ± in particolar modo,
costituzionali ± che hanno una diretta influenza sulla disciplina speci-
fica che esamineremo nei capitoli successivi.
Per iniziare il discorso, è necessario partire dalla considerazione
che lo spettacolo costituisce una particolare tipologia di manifestazio-
ne del pensiero, situazione giuridica soggettiva tutelata GDOO¶DUW 
della Costituzione.
Partiremo, dunque, dalla analisi di questa norma, consapevoli del
fatto che ± oltre alle altre disposizioni analizzate diffusamente nel pre-
sente paragrafo ± esistono svariate norme costituzionali che possono
avere una, diretta o indiretta, applicazione nel campo del diritto dello
spettacolo. Basti pensare alle libertà di riunione e associazione (feno-
meni assai frequenti nel mondo dello spettacolo, espressamente con-
templati negli artt. 17 e 18 cost.) per comprendere quanto importante
VLDO¶LPSDWWRGHOOD&RVWLWX]LRQHLQPDWHULDGLGLULWWRGHOORVSHWWDFROR

1.3.1. La libertà di manifestazione del pensiero artistico

Come vedremo anche in prosieguo, si definisce spettacolo quella ma-


nifestazione del pensiero che abbia un contenuto artistico e che sia di-
retta ad un pubblico ± non necessariamente pagante ± interessato alla
IUXL]LRQHGHOSURGRWWRFXOWXUDOHLGHDWRHUHDOL]]DWRGDOO¶DUWLVWD,OFRn-
tenuto artistico costituisce un elemento essenziale e la sua assenza in-
fluisce negativamente sulla possibilità di applicare le norme ascrivibili
al diritto dello spettacolo.
Alla luce di questa prima considerazione, pare evidente che uno dei
primi problemi che il giurista deve porsi attiene proprio alla identifi-
cazione di quegli elementi in base ai quali è possibile affermare la pre-
senza di un contenuto artistico. Esistono, quindi, dei criteri ± magari
fissati in una disposizione normativa ± che possiamo qui indicare per
DJHYRODUHLOFRPSLWRGHOO¶RSHUDWRUH"
/DULVSRVWDDTXHVW¶XOWLPRLQWHUURgativo non può che essere negati-
va: nessuna norma, infatti, potrebbe fornirci dei criteri assoluti, certi
I. Fonti e principi del diritto dello spettacolo 37

HGLGRQHLQHOO¶RWWLFDGLDGGLYHQLUHDGXQDGHILQL]LRQHGHOFGFRQWHQu-
to artistico.
4XHVWD FRQFOXVLRQH GLVFHQGH GLUHWWDPHQWH GDOO¶HVHJHVL GHOO¶DUW 1
cost., norma generale che afferma il seguente principio: tutti possono
manifestare il proprio pensiero con la parola, lo scritto ed ogni altro
mezzo. Come si evince dal testo della disposizione appena riportato,
O¶DUW  FRVW KD XQD IRUPXOD]LRQH WDQWR ampia da ricomprendere le
più svariate situazioni e, non a caso, si chiude proprio con una clauso-
la generale, in grado di assicurare una copertura costituzionale anche
ai pensieri manifestati attraverso mezzi di diffusione del pensiero che
non erano noti aOWHPSRGHOO¶HQWUDWDLQYLJRUHGHOOD&RVWLWX]LRQH,&o-
stituenti sul punto furono veramente lungimiranti e, soprattutto al fine
di evitare quelle limitazioni della libertà di manifestazione del pensie-
ro che, purtroppo, erano assai frequenti durante il periodo fascista, de-
cisero di ampliare notevolmente i margini dello spazio riservato a que-
sto diritto. Ovviamente tale ampiezza non si è tradotta in alcun modo
in una sorta di diritto senza limiti, come dimostra il fatto che è lo stes-
so art. 21 cost., al suo sesto comma, a fissare il limite del buon costu-
me, su cui tanto è stato detto in sede dottrinale e giurisprudenziale.
Il giurista, dunque, non può dire, in maniera aprioristica, cosa sia lo
spettacolo, senza arrogarsi un compito che è proprio di altri studiosi
(per esempio, dei critici di arte e di spettacolo). Da ciò discende che lo
Stato ± e, in termini più generali, il soggetto pubblico ± non può in al-
FXQ PRGR DIIHUPDUH R QHJDUH LO FDUDWWHUH DUWLVWLFR GL XQ¶RSHUD VHQ]D
compiere quella indebita intromissioQH QHOO¶HVHUFL]LR GHOOD OLEHUWj GL
manifestazione del pensiero del soggetto che va sotto il nome di cen-
sura.
$TXHVWRSXQWRVLFRPSUHQGHSHUFKpO¶DUWFRVWUDSSUHVHQWLXQ
baluardo di fondamentale importanza, anche nel diritto dello spettaco-
lo: in buonDVRVWDQ]DTXHVWDQRUPDJDUDQWLVFHDOO¶DUWLVWDODSRVVLELOLWj
di esprimere le proprie idee anche qualora esse siano disapprovate dal
soggetto pubblico, come avviene nel tipico esempio della satira politi-
ca. Esprime, dunque, un principio generale, la cui portata, come ve-
dremo anche in prosieguo, viene dettagliata in altre norme costituzio-
nali (in primisQHOO¶DUWFRVW 
Unico limite alla manifestazione del pensiero è rappresentato dal
buon costume, terminologia impiegata in Costituzione per evitare la
38 Manuale di diritto delle arti e dello spettacolo

diffusione di idee che possano suscitare una riprovazione da parte dei


consociati. Ancora una volta, è interessante notare il fatto che i Costi-
tuenti scelsero una clausola generale: non abbiamo, infatti, possibilità
alcuna di definire in maniera univoca cosa sia il buon costume neppu-
re se tentassimo di ricostruire integralmente il percorso seguito dalla
giurisprudenza di merito e di legittimità. Questo concetto è stato va-
riamente inteso da parte dei giudici chiamati a decidere circa la puni-
bilità o meno di determinate condotte astrattamente ascrivibili
DOO¶DPELWR RJJHWWLYR GL FXLDOO¶DW  FRG SHQ LQ WHPD GL SXEEOLFa-
zione e spettacoli osceni.
Tale scelta può essere intesa in due modi. In base ad una prima
considerazione, si potrebbe ritenere che il Costituente abbia errato
QHOO¶DIILGDUVLHFFHVVLYDPHQWHDOODVHQVLELOLWjGHLJLXGLFLLQXQDPDWHULD
così delicata. La presenza di una clausola generale impone, per defini-
]LRQH XQ¶DWWLYLWj GL ULHPSLPHQWR GL VLJQLILFDWR GD SDUWH GHO JLXGLFH
che, secondo questa primo modo di impostare il problema, potrebbe
VFHJOLHUHO¶LQWHUSUHWD]LRQHSLUHVWULWWLYDGHOODOLEHUWjGLPDQLIHVWD]Lo-
ne del pensiero.
A questa impostazione, tuttavia, si potrebbe obiettare, anche alla
luce di un ragionamento che tenga nel giusto conto il merito delle de-
cisioni assunte da parte della giurisprudenza maggioritaria, che pro-
prio la presenza della clausola generale riportata nel sesto comma
GHOO¶DUWFRVWKDSHUPHVVRGLDPSOLDUHLPDUJLQLGLWXWHODGHOODOi-
bertà di manifestazione del pensiero: a ben vedere, infatti, la formula-
zione della disposizione è stata adeguata rispetto alla finalità di garan-
WLUHXQ¶LQWHUSUHWD]LRQHFRHUHQWHFRQODVHQVLELOLWjGLIIXVDDOPRPHQWR
di applicazione della normativa: non di rado, lo stesso fatto è stato ri-
tenuto punibile in un determinato momento storico, per poi essere
considerato del tutto irrilevante ± da un punto di vista penale ± in un
momento successivo. Ciò conferma il fatto che il buon costume rap-
presenti un concetto elastico, la cui peculiarità principale consiste pro-
SULRQHOO¶DGHJXDUVLDOOHHYROX]LRQLGHOODVHQVLELOLWjJLXULGLFD
Infine, per concludere sul tema, è interessante ricordare che esisto-
no forme di manifestazione del pensiero artistico che possono anche
avere una ± diretta o indiretta ± influenza su altri diritti costituzionali.
In questa sede, intendiamo rifarci allo specifico caso che si realizza
TXDQGRO¶DUWLVWDGHFLGHGLYHLFRODUHDWWUDYHUVRODSURSULDPDQLIHVWD]Lo-
I. Fonti e principi del diritto dello spettacolo 39

ne del pensiero idee o programmi che potrebbero, ad esempio, assu-


mere una valHQ]D SROLWLFD &RVD VXFFHGH VH XQ¶DUWLVWD GXUDQWH L VXRL
spettacoli, inizia a fare propaganda elettorale? Continuano a trovare
applicazione le norme ascrivibili al diritto dello spettacolo oppure si
LPSRQHO¶HVLJHQ]DGLDSSOLFDUHLSULQFLSLLQPDWHULDGL diritti politici?
La questione non è affatto secondaria e, non a caso, si è recentemente
verificata proprio nel nostro ordinamento giuridico con la discesa in
FDPSRGLXQPRYLPHQWRSROLWLFRQDWRJUD]LHDOO¶DSSRUWRGLXQRGHLSL
noti comici italiani. Le questioni sono davvero tante ma, per economia
del presente lavoro, intendiamo riportare un unico esempio. Poniamo
il seguente interrogativo: cosa succede durante la campagna elettorale,
periodo che, come è noto, è caratterizzato da stringenti regole volte a
garantire la massima partecipazione dei soggetti politici al dibattito
SXEEOLFR" /¶DUWLVWD FKH QHO FRQWHPSR VYROJH XQ¶DWWLYLWj lato sensu
politica deve rispettare i limiti di tempo imposti dalle alcune fonti del
diritto ± ad esempio, dai regolamenti dell¶$XWRULWjSHUOH*DUDQ]LHQHl-
le Comunicazioni riguardanti gli operatori privati ± volti a garantire il
pluralismo a cui accennavamo in precedenza? Oppure una tale limita-
zione è da escludere in ragione del fatto che si debba ritenere preva-
lente il profilo artistico su quello politico? Ad avviso di chi scrive,
questo caso va risolto garantendo la piena applicazione della normati-
va sulla par condicio, assicurando, dunque, il medesimo livello di vi-
sibilità a tutti i soggetti politici coinvolti nella contesa elettorale, a
prescindere dalle forme in cui si sviluppa la campagna elettorale. Per-
tanto, la forma artistica della propaganda politica, in casi simili a quel-
lo qui ricordato, non può influire sulla reale portata del contenuto della
manifestazione del pensierRFKHYLHQHLQULOLHYRTXHVW¶XOWLPDLQIDWWL
conserva il carattere politico, la cui presenza è elemento di indubbio
ULOLHYR DO ILQH FRQFOXGHUH FLUFD O¶DSSOLFD]LRQH GHOOD QRUPDWLYD VXOOD
par condicio. Se dessimo, invece, importanza alla sola forma artistica,
si potrebbe giungere alla configurazione di un regime giuridico fonda-
WR VX XQD DVVROXWDPHQWH LQJLXVWLILFDWD  HVHQ]LRQH GDOO¶DSSOLFD]LRQH
della normativa sulla par condicio, con conseguente ed evidente alte-
razione dei rapporti tra le forze politiche impegnate nella contesa elet-
torale.
40 Manuale di diritto delle arti e dello spettacolo

1.3.2. /¶DUWGHOOD&RVWLWX]LRQHTXDOHUXRORSHUOD5HSXEEOLFD"

/¶DUWGHOOD&RVWLWX]LRQHFRQWLHQHXQSULQFLSLRGLIRQGDPHQWDOHLm-
portanza per la materia che qui ci impegna. La norma in esso contenu-
ta, inoltre, rappresenta un elemento di forte discontinuità rispetto alla
SUHFHGHQWHWUDGL]LRQHJLXULGLFDFRPHGLPRVWUDFKLDUDPHQWHO¶DVVHQ]D
GLXQDQRUPDGLDQDORJRWHQRUHQHOO¶DPELWRGHOOR6WDWXWRDOEHUWLQR
I primi commentatori di questa disposizione hanno più volte messo
in luce lo scarso livello di approfondimento che i Costituenti hanno
dedicato al tema della valorizzazione del patrimonio artistico e cultu-
UDOH /¶DWWHQWDDQDOLVL GHL ODYRUL GHOO¶$VVHPEOHD &RVWLWXHQWH LQ SDUWi-
FRODUH HYLGHQ]LD FKH O¶DWWHQ]LRQH IX ULvolta quasi esclusivamente al
FRQWHQXWRGHOO¶DWWXDOHVHFRQGRFRPPDGHOO¶DUWFRVWODSULPDYHr-
VLRQH GHOO¶DWWXDOH SULPR FRPPD ± a mente del quale la Repubblica
promuove lo sviluppo della cultura e la ricerca scientifica e tecnica ±
comparve solo alla fine della discussione in Assemblea plenaria, fu
approvata senza alcun dibattito e subì determinanti modifiche ancora
GXUDQWHOHIDVLILQDOLGHOO¶DSSURYD]LRQH
Lo scarso interesse mostrato dalla Assemblea Costituente in sede di
UHGD]LRQH GHOO¶DUW  FRVW q stata forse la principale causa della ten-
denza, assai diffusa tra i costituzionalisti, volta a svalutare la portata
normativa di tale disposizione. In alcuni commenti si legge che la di-
sposizione non ospita precetti normativi, dato che accoglie solo di-
chiarazioni aventi valore etico e politico, che per loro natura sono pri-
ve di qualunque effetto vincolante; in alcuni casi, si giunge perfino a
reputare superflua la disposizione sul paesaggio e il patrimonio stori-
co-artistico, ritenuta meramente ripetitiva del principio enunciato al
primo comma.
Un serio e circostanziato processo di rivalutazione della norma si
ebbe solo a partire dalla seconda metà degli anni Settanta, grazie al
FRQWULEXWRGLDOFXQLVWXGLRVLGHOO¶HSRFDTXHVWRULQQRYDWRLQWHUHVVHQHL
confrontLGHOO¶DUWFRVWWRFFzODYLVLRQHJHQHUDOHGHOODQRUPDULWHQu-
ta ormai un punto di riferimento obbligato per la reale comprensione
di istituti essenziali per la caratterizzazione del nostro ordinamento
giuridico. Il diffondersi di queste idee fu di fondamentale importanza
perché permise di comprendere quale fosse il vero ruolo della cultura
QHOO¶DPELWRGLXQVLVWHPDFKHDVSLULDOODSLHQDUHDOL]]D]LRQHGHLYDORUL
I. Fonti e principi del diritto dello spettacolo 41

democratici: si apre così una nuova stagione volta a prendere nella


giusta considerazione la c.d. funzione sociale dei fenomeni culturali.
Il discorso sin qui sviluppato lascia sullo sfondo la assai controver-
sa distinzione tra norme programmatiche e norme precettive, avallata
HG LPSLHJDWD LQDOFXQH VHQWHQ]H LPPHGLDWDPHQWH VHJXHQWLDOO¶HQWUDWD
in vigore della Costituzione. In base a tale teoria ± che è ormai stata
ampiamente superata dalla giurisprudenza, grazie alle interessanti ri-
flessioni della dottrina ± non tutte le norme contenute nella Costitu-
zione avrebbero potuto trovare immediata applicazione in assenza di
un precedente intervento del legislatore: in particolare, le norme (me-
ramente) programmatiche non sarebbero direttamente applicabili (sia
da parte dei giudici, sia da parte delle Pubbliche Amministrazioni) da-
to che il loro destinatario sarebbe il legislatore, chiamato a predisporre
gli strumenti necessari per raggiungere gli obiettivi fissati nelle norme
(programmatiche) costituzionali. I sostenitori di questa teoria, inoltre,
affermavano che le norme costituzionali precettive fossero numerica-
mente inferiori rispetto a quelle programmatiche. Ad esempio, anche
O¶DUWFRVWHUDDQQRYHUDWRWUDOHGLVSRVL]LRQLDYHQWLSRUWDWDPHUDPHn-
te programmatica.
3DVVDQGRDOO¶DQDOLVLGHOFRQWHQXWRGLTXHVWDGLVSRVL]LRQHqLQWHUHs-
sante notare che la sua formulazione impone un intervento attivo del
soggetto pubblico volto a garantire la promozione dello sviluppo della
FXOWXUD$QWLFLSDQGRDOFXQLFRQFHWWLFKHULSUHQGHUHPRQHOO¶DPELWRGHl-
le conclusioni di questo capitolo, possiamo affermare già in questa se-
de che è compito dello Stato (rectius: della Repubblica, ambito sog-
JHWWLYR SL DPSLR FKH q EHQ GHOLQHDWR QHOO¶DUW  FRVW DWWUDYHUVR
O¶HOHQFD]LRQHGHLVHJXHQWLVRJJHWWL&RPXQL3URYLQFH&LWWjPHWURSo-
litane, Regioni e Stato) intervenire per assicurare un incremento
GHOO¶DWWXDOHOLYHOORGLFXOWXUDGDRIIULUHDLFRQVRFLDWL/HFRQVHJXHQ]H
di questa idea sono molteplici e di immediata rilevanza per il diritto
GHOORVSHWWDFRORO¶DFFRVWDPHQWRGHLWHUPLQL³SURPXRYH´H³VYLOXSSR´
qGXQTXHVLQWRPDWLFRGHOO¶HVLJenza ± imposta a livello costituzionale
± di un serio processo di investimenti, anche pubblici, nel settore della
cultura e della ricerca.
Prima di concludere sul punto, ci si vuole soffermare sulla contrad-
GL]LRQHFKHGLVFHQGHUHEEHGDOO¶DFFRVWDPHQWRGHLGXe commi di cui si
FRPSRQHO¶DUWFRVWPHVVDLQOXFHGDSDUWHGLTXHJOL$XWRULFKHUi-
42 Manuale di diritto delle arti e dello spettacolo

tengono utile distinguere due logiche di fondo: secondo questa impo-


VWD]LRQHLOSULPRFRPPDGHOO¶DUWFRVWVYLOXSSHUHEEHXQDORJLFDFKH
può essere definita dinamica, particolarmente evidente se si considera
la funzione promozionale cui la Repubblica sarebbe impegnata per
sviluppare la cultura e la ricerca; il secondo comma, invece, seguireb-
be la logica opposta, definita statica dai sostenitori di questa tesi, resa
palese dalla funzione conservativa YROWD D SUHVHUYDUH O¶LQWHJULWj GHO
paesaggio e del patrimonio storico e artistico.
Tuttavia, la dottrina più recente, confermata dalla giurisprudenza
costituzionale, ha contribuito al superamento di questa rigida visione,
elaborando una lettura unitaria delle due disposizioni fondata sulla
giusta valorizzazione delle evidenti e reciproche interferenze tra le due
disposizioni. Questo approccio ± fondato anche sulla corretta interpre-
tazione di altre norme costituzionali, id est: artt. 2 e 3 cost. ± persegue
O¶HVLJHQ]D GL DVVLFXUDUH LO SURJUHVVR FXOWXUDOH GHOOD SHUVRQD XPDQD H
della intera comunità civile attraverso il positivo riconoscimento della
valenza primaria della disposizione in esame.
Alla luce di questa considerazione, VLDIIHUPDTXLQGLFKHO¶DUW
cost. contiene un principio fondamentale per il nostro ordinamento co-
stituzionale, con la conseguenza che deve essere considerata falsa ed
arbitraria la distinzione tra la parte dinamica e quella statica; al contra-
rio, la norma esprime in maniera unitaria quale sia il ruolo della Re-
pubblica, sia in ordine alla tutela che alla valorizzazione incessante
delle esperienze culturali: entrambi gli aspetti, infatti, rappresentano
strumenti indispensabili per consentire il pieno sviluppo della persona
XPDQDSUHVXSSRVWRSHUXQ¶HIIHWWLYDSDUWHFLSD]LRQHGLWXWWLLODYRUDWRUL
DOO¶RUJDQL]]D]LRQHSROLWLFDHFRQRPLFDHVRFLDOHGHO3DHVH
3HUWDQWRODORJLFDVRWWHVDDOO¶DUWFRVWqGLDPHWUDOPHQWHRSSRVWD
a quella sopra ricordata e lo dimostra il fatto che la peculiarità di tale
norma risiede proprio nella stretta connessione tra i due commi che lo
compongono, di talché sviluppo, ricerca, cultura e patrimonio artistico
contribuiscono, ognuno per la propria parte, al soddisfacimento delle
istanze personalistiche che animano la Costituzione.
I. Fonti e principi del diritto dello spettacolo 43

1.3.3. 'DOODOLEHUWjGLLQVHJQDPHQWRDOOD³&KLDPDWDDOOHDUWL´

Uno degli aspetti più innovativi della Costituzione è rappresentato dal-


la scelta di inserire delle norme specifiche con riguardo alla libertà di
LQVHJQDPHQWR DPELWR  SUHVR LQ FRQVLGHUD]LRQH QHOO¶DUW  FRVW D
PHQWH GHO TXDOH O¶DUWH H OD VFLHQ]D VRQR OLEHUH H OLEHUR QH q
O¶LQVHJQDPHQWR SULPRFRPPD 
A ben vedere, lo Statuto albertino non contemplava alcuna previ-
sione normativa circa la OLEHUWjGHOO¶DUWHGHOODVFLHQ]DQpWDQWRPHQR
in materia di libertà di istruzione e di insegnamento: in epoca pre-
repubblicana, infatti, la disciplina degli ordinamenti scolastici era con-
siderata appartenente alla materia amministrativa e, pertanto, trovava
collocazione esclusivamente nelle fonti di rango legislativo. Da ciò
WUDLDPRXQDXOWHULRUHFRQIHUPDGHOIDWWRFKHVHFRQGRO¶LPSRVWD]LRQH
OLEHUDOHHERUJKHVHODWXWHODGHOO¶DUWHGHOODULFHUFDVFLHQWLILFDHGHOOD
OLEHUWj G¶LQVHJQDPHQWR QRQ GRYHVVHUR Hssere considerate materie di
rilievo costituzionale.
/¶$VVHPEOHD&RVWLWXHQWHLQYHFHPDQLIHVWzXQYLYDFHLQWHUHVVHQHL
confronti di questo tema. In particolare, il partito comunista e alcuni
esponenti della democrazia cristiana diedero un importante contributo
SHUO¶DIIHUPD]LRQHGHOODOLEHUWjGLLQVHJQDPHQWR
,QSULPROXRJRO¶DUWFRVWULFRQRVFHODSRVVLELOLWjGLHVSULPHUH
in forma artistica il proprio pensiero. Nella relativa parte, dunque, esso
rappresenta una sorta di specificazione del principio generale enuclea-
WRQHOO¶DUWFRVWJLjDQDOL]]DWRLQSUHFHGHQ]D
In questa sede, ci soffermeremo esclusivamente sulla libertà di in-
VHJQDPHQWREHQFRQVDSHYROLGHOIDWWRFKHODOLEHUWjGHOO¶DUWHFRVWLWXi-
sce il presupposto indefettibile per il suo reale e positivo riconosci-
mento.
I tratti costitutivi della libertà di insegnamento sono generalmente
WUDFFLDWL GDOOD GRWWULQD JLXULGLFD SDUWHQGR GDOO¶HOHPHQWR FG
personalistico: dalla configurazione in senso personalistico della
libertà di insegnamento, infatti, conseguono altri fattori (in primis, la
natura dinamica della stessa, la quale può essere realmente compresa
se si tengono nella giusta considerazione i processi di maturazione ed
HYROX]LRQH FKH KDQQR ULJXDUGDWR O¶DSSURFFLR GLGDWWLFR GHJOL XOWLPL
secoli).
44 Manuale di diritto delle arti e dello spettacolo

7XWWDYLD DFFDQWR DOOD FRQQRWD]LRQH SHUVRQDOLVWLFD GHOO¶DWWLYLWj GHO


docente, è necessario sottolineare che la Costituzione attribuisce a
TXHVW¶XOWLPR XQ UXROR VRFLDOH GDWR FKH FKLDUDPHQWH DIIHUPD OD
funzionalizzazione della libertà di insegnamento a fini di istruzione.
La funzionalizzazione è stata variamente intesa dalla dottrina. In
particolare, in questa sede, si ritiene opportuno ricordare la tesi
secondo cui la libertà di insegnamento sarebbe garantita e tutelata non
WDQWR QHOO¶LQWHUHVVH GHL VLQJRli docenti quanto piuttosto a vantaggio
GHOO¶LQVHJQDPHQWRLQVpGHLGLVFHQWLHLQXOWLPDDQDOLVLQHOO¶LQWHUHVVH
GL WXWWD OD VRFLHWj 7DOH WHVL DFFHQWXDWD GDOO¶LQWURGX]LRQH
GHOO¶DXWRQRPLD VFRODVWLFD H GDOOD QHFHVVLWj GL XQD HODERUD]LRQH
collegiale del pURJHWWRIRUPDWLYRHFXOWXUDOHFKHFDUDWWHUL]]DO¶RIIHUWD
GL FLDVFXQD VFXROD QHO QXRYR VLVWHPD GHOO¶LVWUX]LRQH QRQ q DQGDWD
esente da critiche, posto che svilisce oltre ogni modo il riferimento
specifico alla figura del titolare del diritto, che è e resta il docente.
/D OLEHUWj GL LQVHJQDPHQWR JDUDQWLWD GDOO¶DUW  FRVW FRSUH RJQL
tipo di insegnamento, a prescindere dal grado della istituzione presso
cui il docente presta la propria attività professionale: come è stato
giustamente osservato, tra insegnamento elementare e quelli di grado
VXSHULRUH LQFOXVR TXHOOR XQLYHUVLWDULR QRQ Y¶q DOFXQD GLIIHUHQ]D LQ
punto di tutela del docente.
Una conferma del fatto che soggetto attivo della libertà di cui
DOO¶DUW  FRVW VLD LO GRFHQWH VL ULQYLHQH LQ DOFXQH QRUPH di rango
primario e, in particolare, in quelle che prendono in considerazione
proprio lo status giuridico degli insegnanti: esse hanno ad oggetto sia
la carriera che il trattamento retributivo, il cui riconoscimento è volto
ad assicurare una effettiva condizione di indipendenza dei docenti,
funzionalmente orientata alla garanzia della libertà in esame.
Anche la libertà di insegnamento ± al pari di tutte le libertà
costituzionali ± non è priva di limiti. A tal riguardo sono davvero
svariate le tesi sostenute in dottrina. Secondo alcuni Autori, ad
esempio, la garanzia della piena libertà di insegnamento non può
equivalere ad una libertà di propaganda e di proselitismo, la quale,
seppure generalmente ammessa, deve ritenersi esclusa per i docenti,
che sono comunque chiamati a svolgere una pubblica funzione, seppur
nel circoscritto ambito scolastico; altri Autori, invece, richiamano il
limite del buon costume, fissato proprio nella disposizione riguardante
I. Fonti e principi del diritto dello spettacolo 45

la libertà di manifestazione del pensiero.


Ad ogni buon conto, la libertà di insegnamento costituisce un
baluardo del nostro sistema ed è questa la ragione per cui pare davvero
urgente la necessità di tornare ad occuparsi ± con la dovuta attenzione
± GHLSUREOHPLFRQQHVVLDOO¶LVWUX]LRQHVRSUDWWXWWRDUWLVWLFDH musicale.
'¶DOWURQGHDOFXQLVHJQDOLGLLQWHUHVVHQHLFRQIURQWLGHOWHPDVRQRVWDWL
manifestati, anche di recente: prima di chiudere il ragionamento sul
punto, infatti, riteniamo utile ricordare che alla fine del 2014 è stato
presentato un corposo documentR GHO 0LQLVWHUR GHOO¶,VWUX]LRQH
GHOO¶8QLYHUVLWj H GHOOD 5LFHUFD ± LQWLWRODWR ³&KLDPDWD DOOH DUWL´ ±
interamente dedicato al settore della (alta) formazione di artisti e
musicisti.
I temi toccati nel documento sono davvero molteplici e tutti di
grande interesse ed è per questa ragione che si auspica un loro
ulteriore approfondimento nella competente sede parlamentare, anche
al fine di rendere effettivo il principio della libertà di insegnamento.

1.3.4. ,OGLULWWRFRVWLWX]LRQDOHGHOO¶DUWLVWDDOODUHWULEX]LRne

Prima di chiudere la ricostruzione dei principi costituzionali in materia


GLWXWHODGHOO¶DUWHHGHOO¶DUWLVWDULWHQLDPRLQGLVSHQVDELOHULFRUGDUHFKH
D QRUPD GHOO¶DUW  FRVW Ll lavoratore ha diritto ad una retribuzione
proporzionata alla quantità e qualità del suo lavoro e in ogni caso suf-
ILFLHQWHDGDVVLFXUDUHDVpHDOODIDPLJOLDXQ¶HVLVWHQ]DOLEHUDHGLJQLWo-
sa.
Tale norma trova immediata applicazione anche nello specifico set-
tore del diritto dello spettacolo ed è diretta conseguenza del fatto che
gli artisti impegnati nella produzione di un evento svolgono una pre-
stazione professionale assimilabile in tutto e per tutto a quella realiz-
zata da professionisti operanti in altri settori. In buona sostanza, come
vedremo nella parte dedicata ai rapporti di ODYRURO¶DUWLVWDqXQODYRUa-
tore e, come tale, ha il diritto (costituzionale) a ricevere la giusta re-
munerazione per la propria opera professionale.
46 Manuale di diritto delle arti e dello spettacolo

/¶LQWUHFFLRWUDOLEHUWjQHJDWLYHHSRVLWLYHQHOGLULWWRGHOOHDUWL
e dello spettacolo

/¶HOHQFD]Lone delle situazioni giuridiche soggettive appena fornita in-


duce a concludere il discorso indugiando su una riflessione che prenda
in considerazione il diverso ruolo che il soggetto pubblico è chiamato
a svolgere per rendere effettive tali libertà. Per affrontare il tema, rite-
niamo particolarmente utile riferirci alla tradizionale impostazione
della dottrina costituzionalistica fondata sulla dicotomia libertà nega-
tive vs. libertà positive.
Secondo questo approccio, una libertà è negativa quando è prescrit-
ta la totale astensione del soggetto pubblico, il cui intervento, si osser-
va, potrebbe essere causa di un qualche effetto negativo per il soggetto
WLWRODUHGHOODOLEHUWjFRQVLGHUDWD4XLQGLO¶DJJHWWLYR³QHJDWLYR´QRQq
riferito al contenuto della libertà, che è e resta positivo per il titolare:
esso, infatti, è convenzionalmente utilizzato solo per sottolineare che
la libertà è salvaguardata dalla astensione del soggetto pubblico, il cui
LQWHUYHQWRFRPSRUWHUHEEHXQ¶DXWRPDWLFDFRPSUHVVLRQHGHOODVLWXD]Lo-
ne soggettiva del privato.
Gli esempi per meglio spiegare questo concetto potrebbero essere
molteplici ma, ratione materiæ, riteniamo utile riferirci ad un solo e
specifico caso riguardante il diritto dello spettacolo. Come abbiamo
GHWWRDLVHQVLGHOO¶DUW FRVWO¶DUWLVWDqOLEHURGLPDQLIHVWDUHLOSUo-
prio pensiero ± avente contenuto artistico ± secondo forme e modi che
non possono essere oggetto di alcuna valutazione da parte del soggetto
pubblico (la quale, a ben vedere, assumerebbe inevitabilmente un ca-
rDWWHUHFHQVRULR /¶DUWHqOLEHUDHSHUWDQWROLEHURqO¶DUWLVWDFKHYo-
glia esprimere il proprio pensiero in presenza di un pubblico interessa-
WRDIUXLUHGHOSURGRWWRFXOWXUDOHRIIHUWR/¶DUWFRVWGXQTXHVRt-
tintende un chiaro esempio di libertà negativa proprio perché in questo
caso, come in altri, la libertà è pienamente garantita e soddisfatta at-
traverso la più ampia astensione del soggetto pubblico: a ben vedere,
infatti, qualsiasi (indebita) intromissione del soggetto pubblico nella
manifestazione del pensiero artistico altrui comporterebbe una insop-
portabile compressione della libertà costituzionale de qua, rendendo
così vano il precetto costituzionale. Per questa ragione, non si deve
dubitare della illegittimità costituzionale delle normative che pongono
I. Fonti e principi del diritto dello spettacolo 47

OLPLWLFRQWUDVWDQWLFRQO¶DUWFRVWRGHOLQHDQRVLVWHPLGLFRQWUROORLQ
FRQWUDVWRFRQTXHVW¶XOWLPDQRUPD
Discorso diverso può essere fatto con riguardo alle cc.dd. libertà
positive, in relazione alle quali non può dirsi soddisfatto il diritto in
assenza di un intervento attivo dello Stato. Esse iniziano a diffondersi
QHOO¶DPELWRGLXQPRGHOORVWDWXDOHGLYHUVRGDTXHOORLQFXLVLVYLOXp-
pano le libertà negative e, segnatamente, rappresentano la più vistosa
evoluzione del c.d. stato sociale. UQHVHPSLRHPEOHPDWLFRDQFK¶HVVR
tratto dal diritto dello spettacolo, è rappresentato dal principio di cui
DOO¶DUW  FRVW QRUPD FKH FRPH DEELDPR YLVWR LPSRQH DO VRJJHWWR
pubblico di intervenire nel settore della cultura. Le forme di intervento
possono essere le più svariate, anche se è indubbio che quelle econo-
miche siano tra le più importanti per attuare il principio appena ricor-
dato. Pertanto, in casi analoghi a quello qui considerato si vuole evita-
UHO¶DVWHQVLRQHGHOOR6WDWRFKHqLOSULQFLSDOHVRJgetto chiamato a ren-
dere effettivi i diritti sociali fissati in Costituzione, anche in presenza
di interessanti forme di partecipazione dei privati: infatti, la presenza
di finanziamenti provenienti da soggetti privati ± associazioni, fonda-
zioni o singoli mecenati ± non esonera lo Stato dal compiere quelle at-
tività prescritte dalle norme costituzionali, con la conseguenza che
O¶RPHVVRLQWHUYHQWRSRWUj HGRYUj HVVHUHVDQ]LRQDWRQHOOHSLRSSRr-
tune forme e sedi.
Questa dicotomia è qui richiamata perché ci permette di affermare
con chiarezza che il diritto delle arti e dello spettacolo costituisce un
settore in cui libertà negative e libertà positive coesistono pur conser-
vando le rispettive peculiarità. Un sistema coerente con i principi co-
stituzionali che abbiamo più volte richiamato non può tollerare intro-
missioni nella manifestazione artistica dei consociati, così come non
SXzDFFHWWDUHDOFXQDIRUPDGLDVWHQVLRQHGDOO¶REEOLJRGLLPSOHPHQWDUH
quelle politiche atte a favorire il progresso culturale, in modo da con-
tribuire positivamente al pieno sviluppo della personalità umana.
Capitolo II

,OIHQRPHQRDUWLVWLFR8QDYLVLRQHG¶LQVLHPH

di ILARIA GUARNACCIA

2.1. Introduzione

/¶HVSUHVVLRQH³IHQRPHQRDUWLVWLFR´ULXQLVFHLQVpOHDUWLILJXUDWLYHH
le arti dello spettacolo: musica, teatro, danza, cinema e arti circensi.
Il termine spettacolo deriva dal latino spectaculum che indica lo
VSHWWDFRORFKHVLVYROJHYDQHOO¶DQWLFD5RPDHFKHKDODVWHVVDUDGLFH
del verbo specto (guardare, contemplare; considerare; giudicare; esa-
minare, mettere alla prova).
Il termine latino e, di conseguenza, anche quello italiano, focaliz-
]DQR O¶DWWHQ]LRQH VXO GHVWLQDWDULR RYYHUR LO SXEEOLFR FRQ LO TXDOH
O¶DUWLVWDSXzFRQWUDUUHXQDUHOD]LRQHGLDQWDJRQLVPR,OSXEEOLFRRVVHr-
vD FRQVLGHUD JLXGLFD PHWWHQGR DOOD SURYD LO SURGXWWRUH H O¶LGHDWRUH
dello spettacolo.
In inglese, invece, il verbo to show mette genericamente in eviden-
]DFKHO¶DUWLVWDVLHVSULPHPDQLIHVWDQGRLOSURSULRSHQVLHURDGDOWUL,Q
francese, oltre a show e a spectacle, viene usato il termine divertisse-
ment, che invece si concentra su che cosa viene espresso e su quale sia
la sua funzione principale. Il termine inglese e quello francese diver-
tissement GHILQLVFRQR OH GXH QDWXUH FKH FRQYLYRQR DOO¶LQWHUQR GHOOR
spettacolo: quella di manifestazione in senso lato e quella di intratte-
nimento.
/RVSHWWDFRORULHQWUDQHOO¶LQVLHPHGHOOHPDQLIHVWD]LRQLLQVLHPHDOOH
rappresentazioni e agli intrattenimenti. Nelle rappresentazioni si veri-

49
50 Manuale di diritto delle arti e dello spettacolo

fica la manifestazione di messaggi in forme artistiche con varie finali-


tà che possono solo in parte coincidere con quelle dello spettacolo; in-
fatti possono essere soggette a valutazione da parte di una giuria, ad
esempio, per il conseguimento di un premio o di un lavoro. Gli intrat-
tenimenti invece sono manifestazioni di messaggi che possono non
avere contenuto artistico ma che hanno un aspetto comune con gli
VSHWWDFROLRYYHURO¶LQWHQWRGLGLYHUWLUHLOSXEEOLFR
Lo spettacolo è un fenomeno complesso perché vi intervengono va-
ULVRJJHWWL O¶DUWLVta-autore, il SXEEOLFRO¶RUJDQL]]DWRUH), perché è una
forma di comunicazione in cui il ricevente è costituito da una pluralità
di individui, perché è un prodotto commerciale e i suoi costi vengono
gestiti sulla base delle leggi economiche del bilancio tra introiti ed
uscite e perché svolge una importante funzione sociale in quanto può
costituire una forma di svago, di divertimento, di condivisione di valo-
ri e di idee, di divulgazione ed arricchimento culturale.

2.2. Il punto di vista giuridico

2.2.1. La nozione di spettacolo

Sono stati molti i tentativi di definire il concetto di spettacolo in ambi-


to giuridico con esaurienza e scientificità. Questo si è reso necessario
SHUODQDVFLWDHORVYLOXSSRVHPSUHPDJJLRUHGHOO¶LQGXVWULDGHOORVSHt-
tacolo: come prima conseguenza, ad esempio, si è imposta con parti-
colare urgenza la necessità di regolamentare la situazione giuridica e
contributiva dei lavoratori in tale ambito, soprattutto a seguito
GHOO¶LVWLWX]LRQHGHOO¶(13$/6 (QWH1D]LRQDOHGL3UHYLGHQ]DHGL$VVi-
stenza per i Lavoratori dello Spettacolo, soppresso, come vedremo in
seguito, nel 2011).
Alcuni autori intendono per spettacolo una rappresentazione (ovve-
URODPDQLIHVWD]LRQHGLXQSHQVLHURGLXQ¶LGHRORJLD RXQHYHQWRFXl-
turale, al quale lo spettatore assiste in modo prevalentemente passivo
VHFRQGRO¶HWLPRORJLDGHOYHUERODWLQRspectare).
Il legislatore non ha fornito una definizione, ma si è limitato ad
HQXPHUDUHXQDFDVLVWLFDGLSRVVLELOLODYRUDWRULQHOO¶DPELWRGHOORVSHt-
tacolo.
II. ,OIHQRPHQRDUWLVWLFR8QDYLVLRQHG¶LQVLHPH 51

Una definizione potrebbe essere la seguente: manifestazione di un


pensiero in forme artistiche in presenza di un pubblico, con la finalità
di intrattenerlo e/o di educarlo.

2.2.2. La nozione di arte

1RQHVLVWHXQDGHILQL]LRQHGHOO¶DUWHQHOODOHWWHUDWXUDJLXULGLFD/DFRn-
cretezza e pragmaticità del linguaggio giuridico non è adatta a definire
questo ampio concetto, vista la varietà delle sue interpretazioni e delle
forme in cui può presentarsi.
,QDVVHQ]DGLXQDQR]LRQHQRUPDWLYDGLRSHUDG¶DUWHqSRVVLELOHUi-
scontrare che l¶RUGLQDPHQWRLWDOLDQRILVVDXQTXDGURJLXULGLFRGLULIe-
rimento fondato su un doppio livello:
a) le norme costituzionali;
b) le fonti primarie: in particolare, la legislazione sullo spettacolo
dal vivo, OHQRUPDWLYHULJXDUGDQWLLOGLULWWRG¶DXWRUHHODWXWHODH
conservazione dei beni culturali e del paesaggio.
7UDOHRSHUHWXWHODWHGDOGLULWWRG¶DXWRUHULHQWUDQRFDWHJRULHFKHQRQ
hanno nulla D FKH YHGHUH FRQ O¶DPELWR GHO IDUH VSHWWDFROR FRPH OH
opere della scultura e delle arti figurative, quelle fotografiche, i soft-
ware e le banche dati, ed altre, invece, riconducibili a tale ambito, qua-
li: opere letterarie, musicali, pantomimiche e coreografiche, audiovisi-
ve e cinematografiche.
Come già detto, le disposizioni della Costituzione individuano il
ruolo che lo Stato deve assumere rispetto allo sviluppo ed alla promo-
zione della cultura nel nostro Paese. Lo Stato ha una funzione attiva di
promozione e tutela del patrimonio artistico, paesaggistico e scientifi-
co, ed una passiva di non intervento rispetto alla scoperta e divulga-
]LRQHGLQXRYLFRQWHQXWLLQYLUWGHOODOLEHUWjGHOO¶DUWHHGHOODVFLHQ]D
6XOOD EDVH GHOO¶DUW  FRVW VHFRQGR LO TXDOH ³La Repubblica pro-
muove lo sviluppo della cultura e la ricerca scientifica e tecnica; tutela
il paesaggio e il patrimonio stoULFRHDUWLVWLFRGHOOD1D]LRQH´ è stato
istituito in Italia nel 1974, per iniziativa congiunta del presidente Aldo
Moro e del ministro Spadolini, un Ministero per i Beni culturali e
Ambientali, che si basava, in parte, sulla Convenzione internazionale
delO¶$MDGHO
52 Manuale di diritto delle arti e dello spettacolo

2.2.3. La nozione di bene culturale

Una prima definizione di bene culturale venne fornita dalla Commis-


VLRQH)UDQFHVFKLQLFRQODOHJJHDSULOHQ³sono beni cul-
WXUDOLTXHOOLG¶LQWHUHVVHVWRULFRDUFKHRORJLFRDUWLVWLFRDPELHntale, ar-
chivistico, librario, nonché ± più in generale ± qualsiasi altro bene che
FRVWLWXLVFDWHVWLPRQLDQ]DPDWHULDOHDYHQWHYDORUHGLFLYLOWj´/HOHJJL
ed i decreti precedenti (1904, 1909, 1939) avevano tentato di definire
il concetto attraverso elenchi, criterio che si era rivelato inefficace con
LOWHPSRYLVWDODVXDOLPLWDWH]]DULVSHWWRDOO¶DPSLH]]DHDOODFRPSOHVVi-
WjGHOO¶DPELWRGDGHILQLUH/DOVHJQzXQ¶LPSRUWDQWHVYROWD
per la tutela dei beni culturali e testimoniò un approccio più aperto e
VWRULFLVWLFRGRYXWRDGXQDFRQFH]LRQHPXWDWDGHOO¶DUWH/HSULPHOHJJL
in materia si basavano infatti su un criterio estetico e disponevano la
tutela di quei determinati oggetti artistici che rientravano in canoni
SUHVWDELOLWL,OFRQFHWWRGLRSHUDG¶Drte nel periodo post-bellico acquisì
quindi un senso di universalità e storicità.
Come vedremo con maggior dettaglio nel prosieguo, nel d.lgs.
112/1998 VLGHILQLVFRQREHQLFXOWXUDOL³TXHOOLFKHFRPSRQJRQRLOSa-
trimonio storico, artistico, monumentale, demoetnoantropologico, ar-
cheologico, archivistico e librario e gli altri che costituiscono testimo-
QLDQ]D DYHQWH YDORUH GL FLYLOWj´ ,O WHUPLQH ³GHPRHWQRDQWURSRORJLFR´
arricchisce molto la definizione, spostando il concetto di bene cultura-
OH GDOO¶DPELWR DUWLVWLco-estetico a quello etnico ed antropologico. La
QR]LRQH GL FXOWXUD SHUWDQWR VL DSUH DQFKH DOO¶HVSUHVVLRQH GHOOD WUDGi-
zione dei vari popoli.
Nel 2004, infine, è stato emanato il codice dei beni culturali e del
paesaggio in cui si raccolgono tutte le norme sulla materia; anche in
questo caso, è interessante notare, non è stata fornita una definizione
di bene culturale ma sono stati inseriti degli elenchi.
Secondo tali normative esistono due coppie di tipologie di beni cul-
turali: i beni materiali ed immateriali, i beni mobili ed immobili.
Tra i beni materiali sono compresi beni mobili o immobili di gran-
de importanza per il patrimonio culturale dei popoli, come monumenti
architettonici, artistici, storici, siti archeologici; libri, manoscritti di
interesse artistico e/o storico culturale. Inoltre rientrano nella categoria
dei beni materiali quegli edifici destinati a raccogliere ed esporre i be-
II. ,OIHQRPHQRDUWLVWLFR8QDYLVLRQHG¶LQVLHPH 53

ni culturali già citati, come i musei, le biblioteche, gli archivi ed i cen-


tri che riuniscono un elevato numero di beni culturali.
Per beni immateriali si intendono invece le pratiche, le rappresen-
tazioni, le espressioni, le conoscenze, le abilità ± così come gli stru-
menti, gli oggetti, gli artefatti e gli spazi culturali ad essi associati ±
che comunità, gruppi e, in certi casi, individui, riconoscono come par-
te del loro patrimonio culturale. Anche lo spettacolo, in quanto rappre-
sentazione di un pensiero in forme artistiche, rientra in questa seconda
categoria e può essere definito come bene culturale.
Definire che cosa siDO¶DUWHQRQVSHWWDDOODJLXULVSUXGHQ]a, ma piut-
WRVWRDOODILORVRILDO¶DSSURFFLRILORVRILFRLQIDWWLconsente di riflettere
apertamente sul tema valorizzando il punto di vista storico ed interdi-
sciplinare, indispensabile per comprendere O¶HYROX]LRQH QHOOa storia
GHOO¶DUWHGHOO¶HVWHWLFDHGHOOHILORVRILHGHOO¶DUWH

2.3. Il punto di vista storico-estetico

Ê LPSRVVLELOH IRUQLUH XQ¶XQLFD GHILQL]LRQH GL DUWH YDOLGD XQLYHUVDl-


mente. In relazione al contesto storico-culturale e alla società, la con-
cezione delO¶RSHUDG¶DUWHKDVXELWRPXWDPHQWLFKHDORURYROWDKDQQR
GHWHUPLQDWRYDULD]LRQLQHOODILJXUDHQHOUXRORVRFLDOHGHOO¶DUWLVWD8QD
GHOOHGLVFLSOLQHFKHVLRFFXSDGLVWXGLDUHO¶DUWHHGLOVXRVLJQLILFDWRq
O¶HVWHWLFDXQDEUDQFDGHOODILORVRILDDQFK¶HVVD di difficile definizione
LQTXDQWRKDPXWDWRO¶DSSURFFLRHGLOSXQWRGLYLVWD ILORVRILFRVRFLo-
logico, poetico) a seconda del periodo storico di riferimento. Ad ogni
modo, il termine nasce nel 1750, coniato dal filosofo tedesco A.G.
Baumgarten con il sigQLILFDWRGL³VFLHQ]DGHOODSHUIH]LRQHGHOODFRQo-
VFHQ]DVHQVLELOHFRPHWDOH´RYYHURGHOODEHOOH]]DLQWHVDFRPHSHUIe-
zione percepita intuitivamente attraverso i sensi. Nasce infatti in que-
VWR VHFROR OD FRQFH]LRQH GHOO¶DUWH LQ IXQ]LRQH LPLWDWLYD GHOOD QDWXUD,
considerata modello di perfezione e bellezza. Nel Settecento quasi
VFRPSDUH O¶DFFH]LRQH GHO WHUPLQH DUWH FRPH DELOLWj VFLHQ]D SUDWLFD
FKH KD FRPH VFRSR OD SURGX]LRQH GHOO¶RJJHWWR DUWLVWLFR DFFH]LRQH
SURSULDGHOO¶DQWLFKLWjHVRSUDWWXWWRGHO0HGLRHYRLQ cui il termine lati-
no ars (e prima ancora quello greco di techne LQGLFDYDQRXQ¶DWWLYLWj
VRSUDWWXWWRSUDWLFDDVVLPLODELOHDTXHOODGHOO¶DUWLJLDQR/¶DUWLVWDLQIDt-
54 Manuale di diritto delle arti e dello spettacolo

ti, inizia ad emanciparsi a partire dal XV sec. dalla pura manualità, di-
venendo, nel Rinascimento, scienziato oltre che artigiano. Artisti come
Michelangelo, Piero della Francesca, Masaccio, ma soprattutto Leon
Battista Alberti e Leonardo erano anche dei veri e propri scienziati: ar-
tisti in quanto le loro opere imitano la realtà e la natura, scienziati per-
ché lo hanno fatto con un metodo geometrico-matematico.
La distinzione tra scienza ed arte si svilupperà alla fine del XVII
secolo, in occasione della querelle des anciennes e des modernes. La
querelle nacque in Francia dapprima come polemica letteraria; riguar-
dava il tema della superiorità o meno delle lingue e letterature classi-
che rispetto a quelle moderne. Ma ben presto si trasformò in un dibat-
tito assai più ampio che si estendeva a tutti i campi del sapere. In par-
ticolare, a seguito della rivoluzione scientifica del Seicento, tale dispu-
ta articolò un paragone sistematico tra il sapere raggiunto dagli antichi
e quello dei moderni, partendo da una definizione di progresso. Perciò
si sostenne che effettivamente le scienze e le conoscenze nel campo
matematico e del calcolo avevano avuto un grande sviluppo ed il pri-
mato fu accordato ai moderni. Tuttavia la questione per altri ambiti si
pose in modo più problematico, in particolare per quello artistico, in
cui non era possibile dimostrare il concetto di progresso. Si riconobbe
FKHQHOO¶DUWHROWUHDOO¶DSSOLFD]LRQHGLUHJROHROHJJLSHUODVXDUHDOLz-
zazione materiale, erano indispensabili il genio ed il gusto.
6LGLIIXVHFRVuO¶LGHDFKHDOFXQHDWWLYLWjFRPHOHDUWLQRQSRWHVVHUR
partecipare a quel tipo di progresso che caratterizza invece le scienze.
E ciò a causa di certi loro caratteri interni: la non cumulabilità,
O¶LUULGXFLELOLWjDUHJROHGDYYHURHVDXULHQWLO¶LQYHQWLYDHODOLEHUDVRg-
gettività. Si riconobbe, quindi, la distinzione tra scienza ed arte. Fu un
PRPHQWR IRQGDPHQWDOH FKH YLGH ULFRQRVFHUH DOO¶DUWH O¶HVFOXVLYD So-
tenzialità di riprodurre la bellezza e la perfezione della natura e che
FRUULVSRVHFRQODQDVFLWDGHOO¶HVWHWLFDPRGHUQD
$QFKHOD³&ULWLFDGHOJLXGL]LR´GL.DQWqXQRVFULWWRdi capitale im-
portanza filosofico-estetica per la definizione del concetto di arte e per
il fatto di testimoniare la nascita di una nuova e moderna sensibilità
estetica. Il filosofo si riferisce al giudizio estetico come prodotto del
libero gioco delle facROWj GHOO¶LPPDJLQD]LRQH H GHOO¶LQWHOOHWWR DOOu-
GHQGR QHO VXR VLVWHPD HSLVWHPRORJLFR DOO¶DUWHHDO EHOOR QDWXUDOH ,O
giudizio estetico non ha funzione conoscitiva né è funzionale a guida-
II. ,OIHQRPHQRDUWLVWLFR8QDYLVLRQHG¶LQVLHPH 55

UH VHFRQGR PRUDOH O¶D]LRQH XPDQD PD KD FDUDWWHUH HVFOXVLYDPHQWH


contemplativo. Quindi è fine a sé stesso.
1HO FRUVR GHOO¶2WWRFHQWR LO GLYDULR WUD DUWH H VFLHQ]D VL ID VHPSUH
più grande: la nascita del movimento artistico del Romanticismo com-
porta la rivalutazione della componente irrazionale come forza ispira-
trice del genLR DUWLVWLFR /¶DUWH YLHQH HVDOWDWD FRVu FRPH OD ILJXUD
GHOO¶DUWLVWDHPDQFLSDWRVL GDO SRWHUH SROLWLFR H UHOLJLRVR /¶RULJLQDOLWj
GHOO¶RSHUD GLYHQWD XQD FRPSRQHQWH HVVHQ]LDOH SHU LO ULFRQRVFLPHQWR
GHOVXRYDORUHDUWLVWLFRHGHOOHFDSDFLWjFUHDWLYHGHOO¶DUtista. Questa è
OD SURYD GHOOD FUHVFHQWH LPSRUWDQ]D GDWD DOO¶LQWHULRULWj GHOO¶DUWLVWD H
GHOODQXRYDFRQVDSHYROH]]DURPDQWLFDGHOO¶HPHUJHUHGHOO¶,RFUHDWRUH
Il concetto di arte come rappresentazione o espressione di certi ca-
noni estetici riferibili alla perfezione e alla bellezza cade a partire dal-
ODILQHGHOO¶2WWRFHQWRPRPHQWRVWRULFRLQFXLLQL]LDDPDQLIHVWDUVLXQD
rivoluzione socio-culturale che si riSHUFXRWH DQFKH VXOO¶estetica. Na-
scono nuove arti grazie alla introduzione di innovazioni tecnologiche,
come la macchina fotografica ed il cinematografo, e arti come la mu-
sica diventano riproducibili per mezzo della radio e del grammofono.
La nascita di nuove arti come la fotografia, capace di riproporre molto
più fedelmente di qualsiasi altro pittore la copia del reale, e la riprodu-
cibilità del prodotto artistico, determinarono una rivoluzione che si ri-
VSHFFKLzQHOO¶DPELWRFXOWXUDOHHVWHWLFRHGDUWLVWLFRROWUHRYYLDPHQWH
FKHVRFLDOH,OFLQHPDVRSUDWWXWWRHUDXQ¶DUWHSHUWXWWLSHUOHPDVVHH
la radio e i giradischi affermarono una fruizione globale. Queste inno-
vazioni contribuirono alla mercificazione del prodotto artistico, che
divenne così anche prodotto commerciale.
I cambiamenti tecnologici e socio-culturali determinarono la nasci-
ta di correnti artiVWLFKH G¶DYDQJXDUGLD FKH PRGLILFDURQR OD QR]LRQH
HVWHWLFDGLRSHUDG¶DUWH4XHVW¶XOWLPDIXHVSUHVVDQHOOHIRUPHSLYDULH
dalle diverse correnti, alla ricerca di nuove vie di espressione di con-
cetti ed emozioni.
Gli espressionisti imprimevano la loro soggettività a ciò che rap-
presentavano in modo estremamente personale attraverso tratti e colo-
ri; i cubisti scomponevano gli spazi e gli oggetti in figure geometri-
che, i futuristi esaltavano il movimento e la velocità, emblemi del pro-
gresso tecnologico e delle FDSDFLWjGHOO¶XRPRLGDGDLVWLPHWWHYDQRLQ
56 Manuale di diritto delle arti e dello spettacolo

discussione il concetto di arte, esponendo un orinatoio e una ruota di


ELFLFOHWWDLQXQDJDOOHULDG¶DUWH
Resta pertanto impossibile definire univocamente e con lo stesso
insieme di attributi tutte le opere artiVWLFKH(VLVWHSLXWWRVWRXQD³Ia-
PLJOLD´ GL FDUDWWHULVWLFKH LQ FXL ULHQWUD RJQL RSHUD DUWLVWLFD FKH QRQ
sono però comuni a tutte.
Non esiste alcun criterio rigoroso che definisca in modo necessario
H VXIILFLHQWH TXDOL RSHUH VRQR FRPSUHVHDOO¶LQWHUQR GHOOa classe delle
RSHUHG¶DUWH /DIDPLJOLDqLQROWUHLQHVSDQVLRQHGHYHHVVHUHDJJLRr-
naWDLQ UHOD]LRQH DOO¶DUWHFKH YLHQH SODVPDWD GDOOH WUDVIRUPD]LRQL Vo-
cio-culturali.
6LFXUDPHQWH O¶RSHUD G¶DUWH HVSULPH XQ¶LGHD XQ SHQVLHUR
XQ¶HPR]LRQH DWWUDYHUVR IRUPH FKe devono essere decriptate ed inter-
SUHWDWH GRSR DYHUQH FRPSUHVR LO OLQJXDJJLR $QFKH O¶DUWH q GL IDWWR
comunicazione.

2.4. Lo spettacolo come prodotto culturale

Il marketing culturale evidenzia che lo spettacolo è un fenomeno mol-


to complesso che richiede una debita preparazione e coordinazione tra
L VRJJHWWL LQ SDUWLFRODUH WUDO¶DUWLVWD H LOPDQDJHU 4XHVW¶XOWLPR KD LO
compito di stendere un progetto e di occuparsi degli aspetti organizza-
tivi. In particolare, è tenuto a stabilire in linea di massima i costi
GHOO¶HYHQWRVRJJHWWLDYDULD]LRQHDVHFRQGDGHOODWLSRORJLDGHOtarget,
del luogo scelto, degli artisti-interpreti e in base a tutti i parametri
connessi direttamente ed indirettamente con la realizzazione dello
spettacolo. In base alla stima dei costi LO PDQDJHU R O¶RUJDQL]]DWRUH
può attivarsi per reperire finanziamenti, che sono di solito messi a di-
sposizione dai cosiddetti sponsor. Lo sponsor può essere concesso da
XQ¶LVWLWX]LRQH SXEEOLFD come il Comune, la Regione, un Ministero,
oppure da un ente privato, come avviene nel caso degli sponsor posti
in essere dalle associazioni (giova ricordare, a tal proposito, che i fi-
nanziamenti possono essere messi a disposizione anche da una banca
RGDXQ¶DWWLYLWjFRPPHUFLDOH interessata ad avere un ritorno di imma-
gine).
II. ,OIHQRPHQRDUWLVWLFR8QDYLVLRQHG¶LQVLHPH 57

La cosiddetta fase di fundraising costituisce un momento essenzia-


le nella progettazione di un evento pubblico, in quanto permette di or-
JDQL]]DUHO¶HYHQWRVXOODEDVHGHOOHrisorse a disposizione e perché con-
sente di stabilire il costo del biglietto da far pagare al pubblico. Questa
seconda fase, detta pricing, permette al manager o al soggetto orga-
nizzatore di pareggiare le spese necessarie. Il pareggio di bilancio è
uno degli obiettivi per chi organizza uno spettacolo. Ovviamente non
qO¶XQLFR: anche per il manager è importante che lo spettacolo sia di
buona qualità, ma soprattutto adatto alla tipologia di pubblico.
Lo spettacolo è quindi un vero e proprio prodotto culturale, il cui
buon esito non dipende soltanto dalla qualità della rappresentazione e
dalla presenza di un numeroso pubblico. È anche necessario, infatti,
che si riscontri almeno un pareggio tra finanziamenti ed investimenti.
Nel budget dovranno rientrare le spese per il pagamento degli arti-
sti, dei tecnici delle luci, del suono, dHOO¶DIILWWRGHOOXRJRSUHVFHOWRPD
anche della realizzazione di pubblicità e della sua diffusione per pro-
muovere lo spettacolo.
3HU VLQWHWL]]DUH L FRQFHWWL VRSUD HVSUHVVL O¶HVLWR GL XQR VSHWWDFROR
dipende da tre variabili strettamente interconnesse: qualità e adegua-
tezza dei contenuti rispetto alla tipologia di pubblico, presenza del
pubblico (determinata dal fattore qualità/adeguatezza e dalla conve-
nienza del prezzo del biglietto), pareggio di bilancio. Queste tre varia-
bili possono essere espresse in tre sintetici obiettivi:
a) qualità dei contenuti;
b) efficacia;
c) efficienza.

2.5. Tipologie di spettacolo

È possibile operare una classificazione sulla base del contenuto artisti-


co, del luogo di rappresentazione o del mezzo di diffusione (dal vivo,
in teatro, in un cinema, in tv) e dei costi di realizzazione e di adesione
degli spettatori.
Per contenuto, si distinguono spettacoli musicali, coreografici, tea-
WUDOL UDSSUHVHQWD]LRQH GL XQ¶RSHUD WHDWUDOH OHWWHUDULD R OLEHUDPHQWH
ispirata; lettura ad alta voce/reFLWD]LRQHGLXQ¶RSHUDOHWWHUDULDRSRHWi-
58 Manuale di diritto delle arti e dello spettacolo

ca), operistici, comico-satirici (questi potrebbero rientrare tra gli spet-


tacoli teatrali, ma non necessariamente si svolgono a teatro), cinema-
WRJUDILFL H GL FLUFR /¶attività circense è quella svolta da XQ¶LPSUHVD
cKH³VRWWRLOWHQGRQHGLFXLKDODGLVSRQLELOLWjLQXQDRSLSLVWHRv-
YHURQHOOHDUHQHSULYHGLWHQGRQHRSSXUHDOO¶LQWHUQRGLLGRQHHVWUXWWu-
re stabili, presenta al pubblico uno spettacolo nel quale si esibiscono
clown, ginnasti, acrobati, trapezisti, prestigiatori, animali esotici o
GRPHVWLFL DPPDHVWUDWL´ DUW  GP  OXJOLR   3HU TXDQWR Ui-
JXDUGDOHIRUPHGLVSHWWDFRORYLDJJLDQWHVLLQWHQGRQR³DWWLYLWjVSHWWa-
colari, trattenimenti e attrazioni, allestite mediante attrezzature mobili,
o installate VWDELOPHQWHDOO¶DSHUWRRDOFKLXVRRYYHURLQSDUFKLGLGi-
YHUWLPHQWR´4XHVW¶XOWLPDWLSRORJLDQRQULHQWUDQHOFRQFHWWRGLVSHWWa-
colo nel senso in cui è stato considerato in questo capitolo, in quanto
QRQVLWUDWWDGHOO¶HVSUHVVLRQHGLXQSHQVLHURDUWLVWLFR, ma piuttosto, di
un trattenimento. Tuttavia, il MiBACT (Ministero dei Beni e delle At-
tività Culturali e del Turismo) considera questa tipologia tra le forme
di spettacolo dal vivo. Non rientrano nella categoria di spettacolo, in-
vece, le esposizioni di arte figurativa e delle arti plastiche e le opere
architettoniche, dato che la manifestazione del pensiero di contenuto
artistico non avviene in presenza di un pubblico e non ha il carattere di
evento.
Per mezzo di diffusione, si distinguono spettacoli dal vivo e spetta-
coli trasmessi, in diretta o in via differita, attraverso mezzi di diffusio-
ne e comunicazione analogici o digitali. Gli eventi musicali dal vivo si
svolgono a teatro, in una sala, in un auditorium, in un parco, in uno
stadio, in un locale o in un club; possono essere trasmessi via radio,
via Internet e in tv. Gli spettacoli coreografici e pantomimici dal vivo
sono rappresentati generalmente a teatro e possono essere trasmessi in
tv, via Internet, al cinema, come anche gli eventi teatrali, satirici ed
operistici, che però possono essere trasmessi anche via radio. Gli spet-
tacoli cinematografici sono un caso particolare perché si svolgono so-
lo al cinema.
Il rapporto tra gli attori ed il pubblico di un film è completamente
differente da quello che invece si instaura a teatro: citando il filosofo
Walter Benjamin il cinema è una di quelle arti moderne che hanno
FRPSRUWDWR OD SHUGLWD GHOO¶DXUD FRPSRQHQWH FDUDWWHULVWLFD GHOO¶RSHUD
G¶DUWHSULPDGHOODULYROX]LRQHWHFQRORJLFD
II. ,OIHQRPHQRDUWLVWLFR8QDYLVLRQHG¶LQVLHPH 59

/¶DXUDSURSULDGLXQ¶RSHUDG¶DUWHDIILGDDTXHVW¶XOWLPDLQYLUWGHl-
la sua originalità e della sua presenza, un valore quasi sacro e spiritua-
le che comporta un atteggiamento di ammirazione estatica nel fruitore.
4XHVW¶DXUDVHFRQGR%HQMDPLQqYHQXWDPHQRQHOPRPHQWRLQFXLq
cambiaWD OD IUXL]LRQH GHOO¶DUWH D FDXVD GHOO¶HYROX]LRQH WHFQRORJLFD
che ha determinato la possibilità di riprodurre copie delle opere origi-
nali (questo per quanto riguarda sia le arti visive che per la musica).
Questo fenomeno è chiamato riproducibilità tecnica GHOO¶RSHUDG¶DUWH
,QEDVHDOODWLSRORJLDGLSXEEOLFRHDOSUH]]RGHOO¶HYHQWRSRVVLDPR
GLVWLQJXHUH VSHWWDFROL DFFHVVLELOL DG XQ¶DPSLD IDVFLD, in ragione dei
prezzi contenuti, ed eventi riservati ad un pubblico benestante.

2.6. La funzione sociale

Parlare di funzione in senso stretto per un oggetto artistico è abbastan-


]D LPSURSULR O¶DUWH q VHPSUH LO SURGRWWR GL XQ¶LQWHOOLJHQ]D H GL XQD
VHQVLELOLWj GLVLQWHUHVVDWH Ê DOWUHWWDQWR YHUR SHUz FKH O¶DUWH GLUHWWa-
mente o indirettamente, acquista una funzione nella società, che si ri-
flette nel diritto: ad esempio, esiste un Ministero per la conservazione
dei Beni culturali e artistici e alcune opere sono considerate patrimo-
QLRGHOO¶XPDQLWj
/DIXQ]LRQHVRFLDOHGHOO¶DUWHGLSHQGHVRSUDWWXWWRGDOSHULRGRVWRULFR
considerato. Sarebbe interessante ripercorrere una panoramica storica
sugli sviluppi paralleli tra arte e società. Se pensiamo ad esempio a tre
diversi periodi storici, quali il Medioevo, il Rinascimento e
O¶2WWRFHQWRSRVVLDPRRVVHUYDUHFKHODILJXUDGHOO¶DUWLVWDVLqDIIUDQFa-
ta nel corso dei secoli dal potere religioso o politico ed è riuscita a
conquistare la libertà di manifestazione di pensiero. Di conseguenza,
O¶DUWLVWDha rivestito un ruolo sociale sempre diverso.
/¶DUWHqXQSDWULPRQLRLPPDWHULDOH FKHKDXQDIXQ]LRQH³XPDQLz-
]DQWH´SRLFKpVFDWXULVFHGDOFRQQXELRGLDSROOLQHRHGLRQLVLDFRORJi-
ca e irrazionalità, autocoscienza e inconsapevolezza, ci rende umani e
consapevoli di esserlo. Inoltre ci avvicina ai posteri, ma anche agli ar-
WLVWLGLXQ¶DOWUa epoca che, pur avendo vissuto in un contesto sociale e
politico diversissimo, hanno provato emozioni simili alle nostre. La
60 Manuale di diritto delle arti e dello spettacolo

IXQ]LRQHVRFLDOHGHOO¶DUWHqTXLQGLXQDIXQ]LRQHHGXFDWLYDFKHFLLn-
VHJQDO¶HPSDWLD

2.7. Conclusioni

Lo spettacolo è una risorsa culturale, sociale ed economica. Data la


sua complessità e la necessità di una buona organizzazione in vari set-
tori, da quello manageriale a quello pubblicitario, può garantire un
buon numero di occupazioni ed occasioni lavorative.
3HUO¶DUWLVWDRO¶Lnterprete, lo spettacolo rappresenta una piattaforma
polifunzionale per esprimere nuove idee, rendere nota e condividere la
propria ricerca artistica e far conoscere la propria figura ed immagine
al pubblico, alla critica e ai manager, in vista di proposte lavorative fu-
WXUH /¶HVSUHVVLRQH H OD FRQGLYLVLRQH GHO SHQVLHUR LQ IRUPH DUWLVWLFKH
arricchiscono la società, animano i luoghi in cui questa vive ed opera,
valorizzano gli spazi che appartengono alla collettività, evitando che
vadano incontro al degrado e DOO¶DEEDQGRQR
Lo spettacolo, quindi, è un mezzo per aumentare il senso di cittadi-
nanza e sviluppare il rispetto verso le istituzioni e le cose pubbliche ed
è fondamentale per ogni autonomia politica caratterizzata da un de-
terminato patrimonio artistico-culturale, perché contribuisce alla so-
cializzazione, ma anche allo scambio e alla circolazione delle idee. Per
questo motivo è tutelato e promosso dallo Stato.
Capitolo III

Soggetti e persone giuridiche


nel mondo dello spettacolo

di CATERINA BARONTINI

/¶DUWLVWD

3.1.1. Definizione e ruoli

Il concetto di artista è centrale nella storia della filosofia, nella storia


GHOO¶DUWHHQHOODULIOHVVLRQHHVWHWLFDPDVLSUHVHQWDDQFKHLQDOWULFDPSL
G¶LQGDJLQHFRPHRJJHWWRGLVWXGLRGHOO¶DQWURSRORJLD e della psicologia,
come categoria sociologica in continua trasformazione e come figura
professionale esaminata dai giuristi, in particolare dai cultori del dirit-
to dello spettacolo, ma anche dagli esperti di management o di marke-
ting culturale e dai consXOHQWLG¶LPPDJLQH
'DOSXQWRGLYLVWDILORVRILFRDSDUHUHGLFKLVFULYHO¶DUWLVWDqFROXL
che esprime nelle sue opere la propria visione del mondo attraverso un
linguaggio originale che scaturisce dalla fusione creativa di intuizione
ed elaborazione formale.
Da un punto di vista antropologico si osserva che questa figura è
nata nelle prime società umane e nel corso dei secoli si è trasformata
insieme alla società. Tuttavia si fonda su un concetto di lavoro immu-
tabile e ancestrale, tanto significativo da poter essere considerato pa-
radigma psico-cognitivo, strumento di sviluppo culturale e, in certe si-
tuazioni storiche, motore di un impegno sociale e politico.
/¶81(6&2 United Nations Educational, Scientific and Cultural Or-

61
62 Manuale di diritto delle arti e dello spettacolo

ganization), Organizzazione Internazionale fondata il 16 novembre


1945 per promuovere educazione, scienza, cultura e comunicazione
tra gli Stati membri delle Nazioni Unite, considera il lavoro
GHOO¶DUWLVWD³un importante contributo allo sviluppo della società e per
la creazione di legami sociali tra i cittadini, ed essendo anche un lavo-
ro intellettuale, consente al singolo di acquisire conoscenze e benesse-
UHPRUDOH´7DOHODYRURSXzHVVHUHLQGLFDWRFRQO¶HVSUHVVLRQH³LQYHn-
]LRQHDUWLVWLFD´SLSURSULDGL³FUHD]LRQHDUWLVWLFD´GDOPRPHQWRFKe
O¶XRPRQRQSXz³FUHDUH´ IDUHGDOQXOOD /¶DUWLVWDq³LQYHQWRUH´ GDO
latino invenio, trovo) perché trova TXDOFRVDFKHJLjF¶q: una realtà ma-
teriale e spirituale insieme, osservata con gli occhi della mente e inda-
gata con la mediazione del vissuto soggettivo.
/¶DSSURFFLR GHOOD SVLFRORJLD SRVLWLYD HYLGHQ]LD FKH OD SHUVRQDOLWj
creativa è una personalità complessa (come emerge in particolare da
UHFHQWLVWXGLGHOO¶XQJKHUHVH0LKDO\&VLNV]HQWPLKDO\L PHQWUHTXHOOR
della psicologia cognitiva mostra che esercita un pensiero in grado di
coordinare più intelligenze (si ricorda la teoria del neuropsicologo
Gardner, che enumera dieci tipologie di intelligenza: logico-
matematica, linguistica, spaziale, musicale, cinestetica, intrapersonale,
interpersonale, naturalistica, esistenziale, etica).
&RPHXQRVFLHQ]LDWRO¶DUWLVWDSXzHVFODPDUH³(XUHND´DOPRPHn-
WRGHOO¶LQWXL]LRQHFKHVLYHULILFDDVHJXLWRGLXQ¶HVSHULHQ]DVHQVLELOH
FRQVLGHUDWDVLJQLILFDWLYD/RVFLHQ]LDWRHVDPLQDTXHVW¶XOWLPDTXDOHIe-
nomeno oggettivo per pHUYHQLUHDYHULWjVFLHQWLILFKHO¶DUWLVWDLQYHFHOD
utilizza per porsi in relazione con la realtà, in primis con quella del
suo mondo interiore, e per elaborare messaggi in grado di sintetizzare
in astratto la sua riflessione sul mondo, la natura umana, la felicità.
Edgar Morin afferma in un famoso scritto FKH³LQRJQLJUDQGHRSHUD
della letteratura, del cinema, della poesia, della musica, della pittura,
GHOODVFXOWXUDF¶qXQSHQVLHURSURIRQGRVXOODFRQGL]LRQHXPDQD´
/¶DUWLVWD RVVHUYD VL SRQH GRPDQGH H lavora: anche questi aspetti
rievocano il metodo sperimentale di Galileo Galilei. Tuttavia,
O¶LQYHQ]LRQHDUWLVWLFDSRQHVXOORVWHVVRSLDQRSHQVLHURORJLFRHLPSXOVL
LUUD]LRQDOLQHOODULFHUFDGHOODYHULWjSRUWDQGRODSHUVRQD VLDO¶DXWRUH
che il fruitore) ad affermare la sua unità psicosomatica, a viverla e a
goderne (piacere estetico) ad un livello di consapevolezza significati-
vo.
III. Soggetti e persone giuridiche nel mondo dello spettacolo 63

/¶XQLWjULWURYDWDVSLQJHDOODFRQGLYLVLRQHHVLDSUHDOODFROOHWWLYLWj
SHUULPDQHUHVDOGDHIHFRQGD/¶DUWHLQIDWWLqILQDOL]]Dta per sua natura
a creare rapporti sociali in grado di realizzare pienamente e sviluppare
le facoltà umane.
Dal complesso dei fenomeni sociali legati alla fruizione artistica
GHULYDLOUDGLFDPHQWRGLTXHVW¶XOWLPDQHOYDVWRFDPSRG¶LQWHUHVVHHQHO
raggio d¶D]LRQHGHOGLULWWRYROWRDWXWHODUHLGLULWWLGHOO¶XRPRQHOODVo-
cietà.
3HUFKp L GLULWWL VRJJHWWLYL GHOO¶DUWLVWD VLDQR WXWHODWL VL SRQH
O¶HVLJHQ]DGLXQULFRQRVFLPHQWRJLXULGLFRGHOODILJXUDGHOO¶DUWLVWDRv-
vero di una definizione giuridica. Un documento di riferimento a ri-
JXDUGRqOD³5DFFRPDQGD]LRQHUHODWLYDDOODFRQGL]LRQHGLDUWLVWD´Dp-
SURYDWDLORWWREUHGDOOD&RQIHUHQ]DJHQHUDOHGHOO¶81(6&2,O
documento riconosce ODQHFHVVLWjSHULJRYHUQLGL³FUHDUHHPDQWHQHUH
non solo un clima incoraggiante la libertà di espressione artistica, ma
anche le condizioni materiali che agevolino la liberazione di questo
talento creativo´ 3UHOLPLQDUPHQWH DG RJQL LPSHJQR FRQFUHWR FRQVi-
derare la definizione di artista mira a ³UHQGHUHSRVVLELOHSHUJOLDUWLVWL
di godere della stima necessaria per il pieno svolgimento del loro la-
voro e fornire loro le garanzie economiche a cui hanno diritto in quan-
WRSHUVRQHDWWLYDPHQWHLPSHJQDWHLQDWWLYLWjFXOWXUDOL´
/D GHILQL]LRQH q OD VHJXHQWH O¶DUWLVWD q ³XQD SHUVRQD FKH FUHD o
partecipa con la sua interpretazione alla creazione o al rifacimento di
RSHUH G¶DUWH FKH ULWLHQH OD FUHD]LRQH DUWLVWLFD FRPH XQ HOHPHQWR Hs-
senziale della sua vita, che contribuisce in tal modo allo sviluppo
GHOO¶DUWH H GHOODFXOWXUDFKHq ULFRQRVFLXWD in quanto artista indipen-
GHQWHPHQWHGDOIDWWRGLHVVHUHRQROHJDWDDGXQYLQFRORGLODYRUR´

3.1.2. Artista e pubblico

Esempi paradigmatici di diritti la cui tutela spetta agli artisti in quanto


SHUVRQHILVLFKHVRQRORSVHXGRQLPRLOQRPHG¶DUWHHO¶LPmagine.
Poiché ogni artista acquista col suo lavoro una nuova identità, può
avere bisogno di assumere un altro nome per concretizzarla agli occhi
del pubblico.
Lo pseudonimo, usato di frequente da compositori e autori in gene-
re, sostituisce a tutti gli effetti il nome (composto da prenome e co-
64 Manuale di diritto delle arti e dello spettacolo

gnomeFRPHDIIHUPDO¶DUWFRGFLY KDYDORUHJLXULGLFRHGqXQGi-
ritto meritevole di WXWHODLQIRU]DGHOO¶DUW 9 cod. civ., che richiama a
sua volta il principio della tutela del diritto DOQRPHHQXQFLDWRQHOO¶DUt.
7 cod. civ.
,OQRPHG¶DUWHXVDWRLQJHQHUHGDDUWLVWLLQWHUSUHWLRHVHFXWRULQRQ
KDLOYDORUHJLXULGLFRGHOORSVHXGRQLPRSHUFXLO¶DUWLVWDFKHORDVVXPH
GHYHVSHFLILFDUHLOOHJDPHWUDGDWLDQDJUDILFLHQRPHG¶DUWHFRQORFu-
]LRQLFRPH³LQDUWH«´³GHWWR«´HVLPLOL4XDORUDO¶LQWHUSUHWHVLDDn-
che autore, la SIAE può avere interesse a coQRVFHUHLOQRPHG¶DUWHPD
non assume alcuna responsabilità in merito.
In caso di violazione da parte di terzi del diritto al nome, allo pseu-
GRQLPRHDOQRPHG¶DUWHO¶RUGLnamento prevede una tutela ex post at-
WUDYHUVRO¶LQWHUYHQWRGLXQJLXGLFHLQIRU]DGHJOLDUWWHFRGFLY
Per proteggere ex ante LOSURSULRSVHXGRQLPRRQRPHG¶DUWHGDXWi-
lizzi impropri o tali da vanificarne il potere identificativo è possibile
rivolgersi al Servizio Associati e Mandanti e Ufficio per le Relazioni
con il Pubblico della SIAE.
Lo pseudonimo è considerato meritevole di tutela solo per gli asso-
ciati SIAE che abbiano presentato apposito modulo di domanda ed al-
legato la ricevuta del versDPHQWRGL¼ ,9$LQFOXVD 
La SIAE accetta di riconoscere lo pseudonimo di un autore solo se
si verificano condizioni volte ad evitare eventuali confusioni: ad
esempio, deve consistere in una sola parola e non deve essere stato
utilizzato in precedenza né confondersi con cognomi o altri pseudo-
nimi. Una volta accettato, il soggetto può indifferentemente usare il
cognome o lo pseudonimo in tutte le circostanze pubbliche.
,OQRPHG¶DUWHqWXWHODELOHVRORVHQRWRULDPHQWHFRQRVFLXWRHGHYH
essere soltanto comunicato alla SIAE, non riconosciuto dalla stessa.
La SIAE prenderà nota della comunicazione solo se proviene da un
VXRDVVRFLDWRFKHDEELDSUHVHQWDWRO¶DSSRVLWRPRGXORHGDOOHJDWRODUi-
cevuta del versamenWRGL¼ FRPSUHQVLYRGL,9$ HODGo-
FXPHQWD]LRQHFRPSURYDQWHO¶DFTXLVLWDQRWRULHWjDOSXEEOLFRGHOQRPH
G¶DUWH4XHVWDGRFXPHQWD]LRQHSXzLQFOXGHUHORFDQGLQHFRYHUGL&'
ritagli di giornale e pagine web.
,OGLULWWRDOO¶LPPDJLQHqWXWHODWRVLDGDOO¶DUWGHOFRGLFHFLYLOHVLD
GDJOLDUWWHGHOODOHJJHDSULOHQ/¶LPPDJLQHGL
un artista, e in generale di una persona fisica, può essere esposta o
III. Soggetti e persone giuridiche nel mondo dello spettacolo 65

pubblicata soltanto con la sua approvazione.


Nei casi in cui la persona sia nota o ricopra pubblici uffici, oppure
se la riproduzione è legata a necessità di giustizia o di polizia, a scopi
scientifici, didattici o culturali, oppure ad avvenimenti pubblici,
O¶LPPDJLQH SXz HVVHUH HVSRVWD D SDWWR GL QRQ UHFDUH SUHJLXGL]LR
DOO¶RQRUHDOOD reputazione o al decoro della persona.
,Q FDVR GL OHVLRQH GHO GLULWWRDOO¶LPPDJLQH O¶LQWHUHVVDWR SXz ULYRl-
JHUVLDOO¶DXWRULWjJLXGL]LDULDSHUFKpGLVSRQJDODFHVVD]LRQHGHOO¶DEXVR
salvo il risarcimento del danno.

3.1.3. Classificazione

$OO¶LQWHUQRGHOOD grande categoria degli artisti è possibile operare una


classificazione secondo due criteri.
Il primo distingue gli artisti in base al linguaggio: pittura e arti gra-
fiche, scultura, architettura, letteratura, poesia, teatro, musica, danza,
cinema, fotografia, fumetto e linguaggi multimediali. Questi ultimi, di
recente origine e diffusione, comprendono:
a) multivisione (che abbina foto e musica);
b) immagini in movimento, cortometraggi e lungometraggi;
c) poesia elettronica (testo poetico abbinato a video, installazioni,
ecc.);
d) video-performance;
e) video-sculture, installazioni interattive di vario genere, video-
ambienti.
Il secondo criterio si fonda sulla base della definizione di spettaco-
lo e distingue gli autori di un pensiero di contenuto artistico dagli in-
terpreti che lo manifestano in presenza di un pubblico. Abbiamo dun-
que due grandi categorie, trasversali in quanto a linguaggio artistico:
da una parte scrittori, poeti, compositori, trascrittori, arrangiatori, liri-
cisti, librettisti, autori teatrali e cinematograILFLFRUHRJUDILGDOO¶DOWUD
attori, musicisti, performer, danzatori, artisti del circo.
GOLDUWLVWLYLVLYLFRVWLWXLVFRQRXQ¶HFFH]LRQHSHUFKpQRQKDQQREi-
sogno di un interprete, ma nel momento stesso della loro invenzione
manifestano il proprio pensiero. 8Q¶HVSRVL]LRQHQRQqXQRVSHWWDFROR
perché la manifestazione del pensiero non avviene in presenza del
pubblico, ma è precedente; inoltre non ha il carattere di evento poiché
66 Manuale di diritto delle arti e dello spettacolo

si prolunga nel tempo.


/¶HODERUD]LRQH H OD PDQLIHVWD]LRQH GHO SHQVLHUR SRVVRQR HVsere
svolti anche dalla stessa persona: in momenti distinti, come nel caso
del poeta che recita le proprie poesie o del compositore che interpreta
musiche proprie, oppure contemporaneamente, come nel caso
GHOO¶LPSURYYLVD]LRQHFKHSXzHVVHUHSRHWLFDWHDWUDle o musicale.

3.1.4. /¶DUWLVWDRJJL

/¶DUWLVWDRJJLYLYHXQDUHDOWjFXOWXUDOHPROWRFRPSOHVVDFKHVLSUHVHn-
WDVHFRQGR8PEHUWR(FRFRPH³VLQFUHWLVPRWRWDOH´(Fo afferma che
OHGLVWLQ]LRQLWUDDUWHGLSURYRFD]LRQHHDUWHGLFRQVXPRWUDDUWH³FRl-
WD´HDUWH³SRSRODUH´VLDVVRWWLJOLDQRVRWWRO¶LQIOXVVRGHLPDVVPHGLDH
di Internet che non presentano alcun modello unificato, alcun ideale
HVWHWLFRXQLFR/¶DUWLVWDDOORUDDFFRJOLHOD³VILGDGHOODFRPSOHVVLWj´GL
cui parla Edgar Morin e conserva la missione peGDJRJLFDXQD³PLs-
VLRQHGLWUDVPLVVLRQH´LQJUDGRGLWUDVIRUPDUHO¶DQDUFKLDLQGHPRFUa-
]LD FRJQLWLYD PD KD ELVRJQR GL RULHQWDUVL QHOO¶DOWUHWWDQWR FRPSOHVVD
realtà sociale e giuridica. Per questo può avvalersi della collaborazio-
ne del proprio manager, figura professionale che si occupa degli aspet-
ti organizzativi, legali e burocratici della sua attività creativa.

3.2. Il manager dello spettacolo

3.2.1. Definizione e ruoli

Il termine manager GHULYDGDOO¶LQJOHVHto manage, che significa ammi-


nistrare, dirigere, gestire, trattare. Il manager dello spettacolo è una fi-
JXUDSURIHVVLRQDOHLQJUDGRGLFRQVLGHUDUHWXWWLJOLDVSHWWLGHOO¶DWWLYLWj
GHOO¶DUWLVWDHGLULVROYHUHOHSUREOHPDWLFKHOHJDWHDOODSURJHWWD]LRQHH
alla realizzazione di un evento di spettacolo, inteso come prodotto cul-
turale concepito specialmente per una porzione della società (target).
Il manager infatti innanzitutto analizza la domanda e individua il tar-
getLQVHJXLWRFROODERUDQGRFRQO¶DUWLVWDVYROJHXQDVRUWDGLPHGLa-
zione tra le esigenze GLTXHVW¶XOWLPRHTXHOOHGHOODVRFLHWj
/¶HVSUHVVLRQH management dello spettacolo indica un settore pro-
III. Soggetti e persone giuridiche nel mondo dello spettacolo 67

fessionale recente, dinamico ed eterogeneo che conta già varie specia-


lizzazioni: project management, legal management, direzione di pro-
duzione, direzione artistica, direzione creativa, stage management, so-
ORSHUFLWDUQHDOFXQH4XHVWLDPELWLVRQRGLVWLQWLDOO¶LQWHUQRGHOOHFRm-
plesse macchine organizzative legate ad artisti, festival, manifestazio-
ni, istituzioni di rilievo nazionale o internazionale; nella maggior parte
GHL FDVL WXWWDYLD VRQR ULXQLWL LQ XQ¶XQLFD ILJXUD LO PDQDJHU LQ VHQVR
VWUHWWR VHQ]D DOWUL DJJHWWLYL  FKH VL RFFXSD GHOO¶DPPLQLVWUD]LRQH GL
uno o più clienti per valorizzarne il lavoro creativo e gestirne la carrie-
ra.
Le attività svolte dal manager si possono raggruppare in due ambi-
ti. Il primo ha ad oggetto OH SUREOHPDWLFKH JHVWLRQDOL GHOO¶HYHQWR
GDOO¶LGHD]LRQHDOODUHDOL]]D]LRQHHFRPSUHQGH
a) concept GHOO¶HYHQWRGLVSHWWDFROR± aspetti artistici e culturali;
b) raccolta fondi (fundraising) ± aspetti amministrativi e finanziari;
c) allestimento dello spettacolo ± aspetti tecnici, operativi e produt-
tivi;
d) fissazione del prezzo (pricing) ± aspetti economici;
e) FRQVXOHQ]D G¶LPPDJLQH VSHVVR LOPDQDJHU q DQFKHLO personal
stylist GHOO¶DUWLVWD  DOOHVWLPento di una campagna pubblicitaria
SHUODSURPR]LRQHHODGLIIXVLRQHGHOO¶HYHQWR± aspetti di marke-
ting e di comunicazione.
Generalmente, il fundraising non è necessario quando il prodotto
culturale è commissionato da un ente pubblico o privato, poiché il
committente provvede al finanziamento; è invece necessario per i pro-
getti che sono proposti ad un ente. Esistono due modi per raccogliere
fondi:
a) cercare sponsor, ovvero associazioni, club, aziende, organizza-
zioni che possono avere vantaggi dalla partecipazione economi-
ca al progetto (segnalazione sulla brochure e sulla locandina, al-
lestimento di stand); anche un privato cittadino può sponsorizza-
re un evento di spettacolo, cioè promuoverlo, sostenerlo con fi-
nanziamenti o con un contributo;
b) cercare di ottenere contributi da fondazioni bancarie o da enti
pubblici. In particolare, i bandi di finanziamento sono emanati
dagli enti locali (Regioni, Province, Comuni) e dal Ministero
della cultura (in Italia denominato Ministero dei Beni e delle At-
68 Manuale di diritto delle arti e dello spettacolo

tività Culturali e GHO7XULVPRQRWRFRQO¶DFURQLPR0L%$&7 ,O


MiBACT eroga contributi FUS (Fondo Unico per lo Spettacolo,
istituito con la legge 30 aprile 1985, n. 163) per lo spettacolo dal
vivo, nei settori: musica, teatro, danza, circhi e spettacolo viag-
giante. Esistono anche bandi nazionali ed europei per eventi di
grande rilievo sociale e culturale. In tutti i casi menzionati il
manager R LQ VXD DVVHQ]D O¶DUWLVWD  è tenuto a presentare il
progetto compilando la modulistica generalmente disponibile
online.
Per la promozione dello spettacolo, il manager si avvale di un ad-
detto stampa, il quale SULPDGHOO¶HYHQWRVFULYHXQFRPXQLFDWRVWDPSD
che sintetizza in linguaggio giornalistico tutte le informazioni (spesso
unite a foto e ad altro materiale utile a costituire un press kit), e lo in-
via a giornalisti e/o ad esperti di comunicazione; si accerta per telefo-
QRGHOODFRPSDUVDGHOO¶DUWLFRORVXLJLRUQDOLRVXOweb con un certo an-
ticipo e il giorno prima; redige e cura la pubblicazione della rassegna
stampa, che raccoglie articoli e recensioni ed eventualmente post da
forum, blog e social network.
Nel secondo ambito di attivitàULHQWUDO¶DQDOLVLGHJOLDVSHWWLQRUPa-
tivi. Il manager affronta le problematiche giuridiche connesse alla rea-
OL]]D]LRQH GHOOR VSHWWDFROR GDOO¶DPPLQLVWrazione alla gestione delle
SUDWLFKH EXURFUDWLFKH SHU RWWHQHUH OD FHVVLRQH GL GLULWWL G¶DXWRUH SHr-
messi e autorizzazioni di vario genere e accordi con case produttrici.
I due versanti sono legati tra loro perché tutti gli aspetti della ge-
stione sono regolati da norme. Un manager consapevole ad esempio
può presentare la domanda per ottenere un patrocinio ministeriale, o
curare relazioni non solo con giornalisti e associazioni, ma anche con
il mondo politico, ovvero con le istituzioni pubbliche locali e naziona-
li e con le amministrazioni.
Dal punto di vista giuridico, il manager, generalmente, opera senza
VSHQGHUHLOQRPHGHOO¶DUWLVWD,QGLULWWRSULYDWRODVSHQGLWDGHOQRPHq
il criterio in base al quale un atto non è imputato al soggetto che lo ha
compiuto, ma al soggetto in nome del quale è stato compiuto. Il ma-
nager, quindi, QRQVSHQGHLOQRPHGHOO¶DUWLVWDRJQLDWWRqLPSXWDWRD
OXL VWHVVR 6L SXz TXLQGL DIIHUPDUH FKH RSHUD SHU FRQWR GHOO¶DUWLVWD
sotto la sua supervisione, ma non in suo nome: la rappresentanza è,
dunque, indiretta.
III. Soggetti e persone giuridiche nel mondo dello spettacolo 69

3.2.2. Formazione e lavoro

'DOO¶LQVLHPHGHOOHIXQ]LRQLFKHDGHPSLHLOPDQDJHUVLFRQQRWDFRPH
figura emblematica del rapporto tra arte e mercato e come segno della
complessità sociale e giuridica del nostro tempo. Questo ruolo richie-
de qualità umane di flessibilità e sensibilità, unite a competenze in
ambito artistico, tecnico, economico e giuridico.
I nuovi professionisti provengono dalle più diverse aree di studio
(economia, giurisprudenza, lettere, filosofia) o direttamente dal mondo
dello spettacolo (attori, musicisti) ma sono tenuti ad acquisire compe-
tenze specifiche sul campo per inserirsi in un mercato del lavoro mol-
to fluido, in cui la stabilità occupazionale è da considerarsi un obietti-
vo a lungo termine.
In Italia non esiste un percorso unificato per la formazione o
O¶DFFHVVR DOOD SURIHVVLRQH DQFKH VH LO PHUFDWR (pubblico e privato)
dello spettacolo richiede sempre più personale specializzato. Il corso
ELHQQDOHVSHULPHQWDOHGLVHFRQGROLYHOORLQ0DQDJHPHQWGHOO¶LPSresa
culturale e di spettacolo è stato attivato presso alcune Istituzioni
AFAM (quali i Conservatori di musica di Salerno (2010), Matera e
Venezia (2012), preceduto dal Biennio in Management musicale auto-
rizzato dal 2009 presso il Conservatorio di musica di Roma). Sono at-
tivi anche master post lauream, come quello in Comunicazione e ma-
nagement delle imprese culturali attivo presso il Conservatorio di Na-
poli e quello in Management dello spettacolo organizzato dalla SDA
Bocconi di Milano in collaborazione con O¶$FFDGHPLD7HDWURDOOD6Fa-
la e il Piccolo Teatro di Milano. $QFKHOD/8,66GL5RPDHO¶,VWLWXWR
superiore di studi musicali di Lucca hanno recentemente attivato per-
corsi formativi analoghi.
La professione può essere esercitata come dipendente o in forma
OLEHUD1HOSULPRFDVRLOPDQDJHUODYRUDSUHVVRXQ¶DJHQ]LDGLPDQa-
JHPHQWGHOORVSHWWDFRORRFRPHDGGHWWRDOO¶LQWHUQRGHOO¶XIILFLRVWDm-
SDXIILFLRSURGX]LRQHRXIILFLR6,$(GLXQWHDWURRGLXQ¶LVWLWX]LRQH
nel secondo caso lavora in proprio o presso lo studio di un artista.
Ad oggi, non esiste un albo che raccolga i nominativi dei manager
dello spettacolo.
70 Manuale di diritto delle arti e dello spettacolo

3.2.3. L¶KXPXV dello sviluppo culturale

Il fattore fondamentale dello sviluppo culturale consiste nella sinergia


tra artista e manager, entrambi operanti nel contesto sociale. Come af-
ferma Mariangela Franch, in un saggio assai circostanziato dedicato
alle frontiere manageriali per la valorizzazione della cultura e
dHOO¶DUWH, lo sviluppo culturale avviene quando le imprese incorporano
L³IDWWRULFXOWXUDHEHQLDUWLVWLFL´QHLORURSURFHVVLSURGXWWLYL$OOHLm-
prese bisogna aggiungere tutte le istituzioni e le organizzazioni che
SRQJRQRODIUXL]LRQHGHOO¶HVSHULHQ]DDUWLVWLFDHFXOWXUDOHFRPHRELHWWi-
vo primario della loro attività. Il lavoro gestionale del manager è fun-
zionale al riconoscimento del bene artistico come patrimonio culturale
da valorizzare e come capitale da conservare ed incrementare.

3.3. Formazioni sociali

3.3.1. Definizione e ruoli

Una formazione sociale è un raggruppamento di singoli in seno allo


Stato, generalmente XQ¶organizzazione collettiva costituitasi per per-
seguire interessi comuni. Nel linguaggio giuridico questa nozione si
ricollega a quella di ente, poiché tutte le formazioni sociali sono enti,
di natura pubblica o privata. InoltreVHFRQGRO¶DFFH]LRQHJHQHULFDGHO
WHUPLQHXQ¶LVWLWX]LRQHqXQJUXSSRRUJDQL]]DWRXQDSSDUDWRFKHSHr-
segue un particolare scopo in maniera sistematica, con regole e proce-
dure definite.
Se invece si cRQVLGHUDLOVHQVRVSHFLILFRGLTXHVW¶XOWLPRtermine, le
istituzioni pubbliche VRQRRUJDQLIRQGDPHQWDOLGHOO¶RUGLQDPHQWo costi-
tuzionale (il Parlamento, il Governo e il Presidente della Repubblica).
In questo senso si può affermare che le formazioni sociali sono corpi
intermedi tra il singolo e le istituzioni. Questo aspetto individua la
funzione delle organizzazioni collettive, significativa in ogni ambito
della vita sociale ed in particolare nel mondo dello spettacolo.
III. Soggetti e persone giuridiche nel mondo dello spettacolo 71

3.3.2. Classificazione

Enti con o senza personalità giuridica


Mentre tutti gli enti pubblici sono persone giuridiche, per cui pos-
siedono capacità illimitata e generale ed acquistano autonomia patri-
moniale perfetta, non tutti gli enti privati sono dotati di personalità
giuridica: il codice civile la attribuisce agli enti che abbiano ottenuto il
riconoscimento; inoltre gli enti lucrativi acquistano la personalità giu-
ULGLFDFRQO¶LVFUL]LRQHDOUHJLVWURGHOOHLPSUHVHPHQWUHJOLHQWLQRQOu-
crativi (come previsto dal d.P.R. 361/2000) devono iscriversi sul regi-
stro delle persone giuridiche della Prefettura, oppure della Regione se
RSHUDQRLQPDWHULHGLFRPSHWHQ]DUHJLRQDOH GLFXLDOO¶DUWG35
  3RLFKp OR VSHWWDFROR FKH ULHQWUD QHOO¶DPELWR LQGLYLGXDWR
GDOO¶DUWFRVWFRQO¶HVSUHVVLRQHvalorizzazione dei beni culturali e
ambientali e promozione e organizzazione di attività culturali) è mate-
ria di competenza concorrente in forza dello stesso art. 117 cost. (la
fissazione di principi in materia spetta allo SWDWRHO¶DGR]LRQHGLOHJJL
di dettaglio e dei regolamenti spetta alle Regioni), è bene che enti pri-
vati non lucrativi riconosciuti quali associazioni e fondazioni si iscri-
vano nel registro delle persone giuridiche presso le Regioni.
Gli enti privati senza personalità giuridica si definiscono enti di fat-
WRHVRQRGRWDWLGLXQ¶DXWonomia patrimoniale imperfetta: questo signi-
ILFDFKHODVHSDUD]LRQHWUDLOSDWULPRQLRGHOO¶HQWHHTXHOORGHLFRPSo-
nenti non è assoluta e che, in alcuni casi, i singoli soggetti possono es-
VHUH FKLDPDWL D ULVSRQGHUH GHL GHELWL GHOO¶HQWH $O FRQWUDULR quando
O¶DXWRQRPLD SDWULPRQLDOH è perfetta le persone giuridiche rispondono
con il proprio patrimonio che è nettamente separato da quello dei sin-
goli membri.
Persone giuridiche pubbliche e private
Mentre le persone giuridiche pubbliche non sono disciplinate da
una normativa generale, ma da regole dettate di volta in volta, e, per la
parte non regolamentata, da principi di diritto comune, quelle private
sono disciplinate dal diritto privato e assumono uno statuto che defini-
VFHJOLDVSHWWLUHJRODWLYLGHOO¶DWWLYLWj.
Enti pubblici autarchici ed economici
Mentre gli enti pubblici autarchici agiscono, generalmente, attra-
verso atti amministrativi in regime di diritto pubblico, gli enti pubblici
72 Manuale di diritto delle arti e dello spettacolo

economici agiscono con negozi giuridici in regime di diritto privato e


sono degli strumenti organizzativi, analogamente alle aziende auto-
QRPHHDOO¶D]LRQDULDWRGL6WDWR con cui le Pubbliche Amministrazioni
intervengono nel sistema economico.
Gli enti pubblici economici operano in regime di concorrenza con
gli imprenditori privati e si configurano come misti poiché derivati dal
concorso di imprese pubbliche e private, ma diversamente dalle im-
prese private realizzano fini pubblici e non trovano elemento essenzia-
le nello scopo GLOXFUR7XWWDYLDSHULOFULWHULRGHOO¶RELHWWLYDHFRQRPi-
FLWjKDQQRELVRJQRGLULFDYDUHGDOO¶DWWLYLWjDOPHQRTXDQWRRFFRUUHSHU
coprire i costi di produzione, perché non sono assoggettabili al falli-
PHQWR VRQR VRJJHWWL DOO¶LVFUL]LRQH QHO UHJLVWUR GHOOH LPSUHVH ex art.
2201 cod. civ. e alla redazione del bilancio consolidato.
Poiché lo spettacolo è un campo di produzione di servizi culturali e
di scambio di beni artistici che presuppone attività economiche, sog-
getti pubblici del settore sono enti economici. Tra gli enti pubblici non
economici, le scuole e le IstiWX]LRQL$)$0FKH³DILQLVWDWLVWLFL>«@
VRQRFRQVLGHUDWHXQLWjORFDOLGHO0LQLVWHURGHOO¶,VWUX]LRQH8QLYHUVLWj
H 5LFHUFD´ QHOO¶HOHQFR GHOOH $PPLQLVWUD]LRQi Pubbliche redatto
GDOO¶,67$7 pubblicato in Gazzetta Ufficiale, Serie Generale n. 210
del 10 settembre 2014, svolgono un ruolo didattico e divulgativo con
iniziative di cinema, teatro, musica e danza.
Enti privati lucrativi e non lucrativi
,QEDVHDGXQFULWHULRWHOHRORJLFRDOO¶LQWHUQRGHJOLHQWLSULYDWLGLVWLn-
guiamo tra enti non lucrativi (disciplinati dal Libro I cod. civ.; sono
fondazioni, associazioni e comitati) ed enti lucrativi, con lo scopo di
produrre utili da dividere fra i soci (enti disciplinati dal Libro V cod.
civ.: sono le società).
Enti privati a struttura associativa e istituzionale
In base ad un criterio strutturale, si distinguono enti a struttura as-
sociativa, detti anche a base personale, ed enti a struttura istituzionale,
detti anche a base reale. I primi sono le associazioni; i secondi, nati
per volontà di un costituente, comprendono fondazioni e comitati.
Le società si collocano a metà tra le due categorie: sono a base as-
sociativa poiché per definizione nascono da un contratto, secondo la
UHJRODJHQHUDOHFRQWHQXWDQHOO¶DUWFRGFLYanche se in casi ec-
cezionali possono nascere da un atto unilaterale.
III. Soggetti e persone giuridiche nel mondo dello spettacolo 73

3.3.3. /DFODVVLILFD]LRQHGHOO¶,67$7

/¶HOHQFRGHOOH$PPLQLVWUD]LRQL3XEEOLFKHLQVHULWHQHOFRQWRHFRQRPi-
co consolidato e inGLYLGXDWH DL VHQVL GHOO¶DUW 1, terzo comma, della
legge 31 dicembre 2009, n. 196 e ss.mm. (Legge di contabilità e di fi-
QDQ]DSXEEOLFD FRPSLODWRGDOO¶,67$7VXOODEDVHGHOOHQRUPHFODVVi-
ficatorie e definitorie del sistema statistico nazionale e comunitario
(Regolamento UE n. 549/2013 sul Sistema Europeo dei Conti Nazio-
QDOL H 5HJLRQDOL QHOO¶Unione europea ± SEC2010), si divide in due
JUDQGLVH]LRQLDPPLQLVWUD]LRQLFHQWUDOLHORFDOLDOO¶LQWHUQRGHOOHTXDOL
si individuano categorie di natura statistico-economica.
Le amministrazioni centrali del settore dello spettacolo rientrano in
XQ¶XQLFD categoria statistico-HFRQRPLFD GHQRPLQDWD ³(QWL SURGXWWRUL
GLVHUYL]LDVVLVWHQ]LDOLULFUHDWLYLHFXOWXUDOL´9LDSSDUWHQJRQRWUHHQWL
privati: il Centro sperimentale di cinematografia (CSC), la Fondazione
Festival dei Due Mondi di Spoleto e la Società per lo sviluppo
deOO¶DUWHGHOODFXOWXUDHGHOORVSHWWDFROR $UFXV6S$ 
Tra le amministrazioni locali troviamo le Fondazioni lirico-
VLQIRQLFKH´LTeatri stabili ad iniziativa pubblica e altre amministra-
zioni locali.
Le fondazioni lirico-sinfoniche sono organizzazioni pubbliche in
forma privata derivate dalla riforma degli enti lirici. Sul territorio na-
zionale sono: Fondazione Teatro Lirico di Cagliari, Fondazione Teatro
la Fenice di Venezia, Fondazione Teatro Massimo di Palermo, Fonda-
zione TeaWUR³&DUOR)HOLFH´GL*HQRYa, Fondazione Teatro di San Car-
lo di Napoli, Fondazione Teatro Comunale di Bologna, Fondazione
Teatro Maggio Musicale Fiorentino, Fondazione 7HDWURGHOO¶2SHUDGL
Roma, Fondazione Teatro Regio di Torino, Fondazione Teatro alla
Scala di Milano, Fondazione Teatro Lirico ³*LXVHSSH9HUGL´GL7ULe-
ste, Fondazione Accademia Nazionale Santa Cecilia di Roma, Fonda-
zione Lirico-6LQIRQLFD³3HWUX]]HOOLH7HDWULGL%DUL´
I teatri stabili ad iniziativa pubblica sono: Ente Teatro di Sicilia
Stabile di Catania, Ente autonomo Teatro Stabile di Genova, Fonda-
]LRQH 7HDWUR 6WDELOH GHOO¶8PEULD &HQWUR 7HDWUDOH %Uesciano, Teatro
%LRQGR6WDELOHGL3DOHUPR)RQGD]LRQH7HDWUR³0HWDVWDVLR´GL3UDWR
Teatro Stabile del Veneto Carlo Goldoni, Teatro Stabile di Bolzano,
Fondazione Piccolo Teatro di Milano ± 7HDWURG¶(XURSD$VVRFLD]Lo-
74 Manuale di diritto delle arti e dello spettacolo

ne Teatro di Roma, Teatro Stabile Sloveno, Teatro Stabile delle Mar-


che - )RQGD]LRQH³/HFLWWjGHO7HDWUR´(QWHWHDWUDOHUHJLRQDOH7HDWUR
6WDELOHG¶$EUX]]R)Rndazione del Teatro Stabile di Torino.
La categoria statistico-economica che va sotto il nome di altre am-
ministrazioni locali comprende: Associazione Arena Sferisterio-
Teatro di tradizione di Macerata, Associazione teatrale pistoiese,
Azienda Teatro del Giglio di Lucca, Azienda speciale servizi cultura
turismo e spettacolo Teatri di Civitanova, Ente autonomo regionale
Teatro di Messina, Ente regionale teatrale del Friuli Venezia-Giulia,
Fondazione Gioacchino Rossini di Pesaro, Fondazione i Pomeriggi
Musicali di Milano, Fondazione i Teatri di Reggio Emilia, Fondazione
musicale Santa Cecilia di Venezia, Fondazione Rossini Opera Festival
di Pesaro.

3.3.4. Le Istituzioni Concertistiche Orchestrali

Se consideriamo anche la categoria trasversale delle Istituzioni Con-


certistiche Orchestrali (ICO) osserviamo di nuovo una grande varietà
di declinazioni organizzative e istitutive.
Il MiBACT riconosce la qualifica di ICO con proprio decreto,
G¶DFFRUGR FRQ OD &RPPLVVLRQH FRQVXOWLYD DOOH LVWLWX]LRQL FRQ FRm-
plessi stabili o semistabili a carattere professionale che svolgono an-
nualmente almeno cinque mesi di attività (art. 28, legge 14 agosto
1967, n. 800).
Le ICO attualmente presenti sul territorio nazionale, riscontrabili
sul sito del MiBACT, sono 13, di cui nove fondazioni, due associa-
zioni e due enti pubblici: Fondazione Orchestra Regionale delle Mar-
che (Ancona); Istituzione Concertistico Orchestrale della Provincia di
%DUL)RQGD]LRQH2UFKHVWUD³+D\GQ´GL%RO]DQRH7UHQWR)RQGD]LRQH
Orchestra Regionale Toscana (Firenze); Istituzione Sinfonica Abruz-
]HVH /¶$TXLOD )RQGD]LRQH,&2³7LWR6FKLSD´ /HFFH ; Fondazione I
Pomeriggi Musicali (Milano); Associazione Orchestra di Padova e del
Veneto (Padova); Fondazione Orchestra Sinfonica Siciliana (Paler-
mo); )RQGD]LRQH ³$UWXUR 7RVFDQLQL´ 3DUPD ; )RQGD]LRQH ³2WWDYLR
=LLQR´2UFhestra di Roma e del Lazio (Roma); Fondazione Orchestra
Sinfonica di Sanremo; Associazione Orchestra della Magna Grecia
(Taranto).
III. Soggetti e persone giuridiche nel mondo dello spettacolo 75

3.3.5. Una prima conclusione

Il mondo dello spettacolo si divide idealmente in tre grandi categorie


di persone giuridiche:
a) enti pubblici, con le denominazioni di ente teatro, ente autono-
mo, ente autonomo regionale, ente regionale teatrale, azienda
autonoma;
b) organismi pubblici in forma privata;
c) enti privati.
La seconda e la terza categoria hanno in comune la veste giuridica
privata. Mentre però la seconda categoria comprende tutti gli enti
pubblici sottoposti a privatizzazione, la terza è costituita dalle istitu-
zioni private che si sono formate ex se, molte delle quali aventi rilievo
pubblico.

3.4. Enti privati

3.4.1. Società

1RUPDOPHQWHOHVRFLHWjSHUVHJXRQRORVFRSRGLOXFURDLVHQVLGHOO¶DUW
2247 cod. civ., norma che espressamente prevede la divisione degli
utili tra i soci. Tuttavia, ai soggetti operanti nel mondo dello spettaco-
lo costituiti in forma di impresa, nelle diverse articolazioni di genere e
di settori di attività cinematografiche, teatrali, musicali, di danza, di
circhi e di spettacoli viaggianti, è riconosciuta (art. 51 bis, d.l. n.
83/2012) la qualifica di micro, piccola e media impresa ai sensi della
disciSOLQD GHOO¶Unione europea vigente in materia. La qualifica per-
PHWWHORURGLXVXIUXLUHGHOOHDJHYROD]LRQLQD]LRQDOLHGHOO¶Unione eu-
ropea previste dalla normativa vigente per le piccole e medie imprese,
in attuazione del d.m. 18 aprile 2005.
Esistono poi, ed è bene ricordarlo, grandi società commerciali ope-
ranti nel nostro settore: si pensi, ad esempio, alle grandi case discogra-
fiche oppure alle case di produzione cinematografica.
76 Manuale di diritto delle arti e dello spettacolo

3.4.2. Comitati

I comitati sono gruppi di persone fisiche che si uniscono in forza


GHOO¶DUWFRGFLYSHUUDJJLXQJHUHXQRVFRSRFKHSXzFRQVLVWHUHDG
esempio nella promozione di opere pubbliche o nella realizzazione di
monumenti, esposizioni, manifestazioni, eventi di spettacolo.
,QIRU]DGHOO¶DUWFRGFLY³JOLRUJDQL]zatori e coloro che assu-
mono la gestione dei fondi raccolti sono responsabili personalmente e
solidalmente della conservazione dei fondi e della loro destinazione
aOORVFRSRDQQXQ]LDWR´,l comitato non è persona giuridica e, quindi,
sono responsabili (personalmente e solidalmente) tutti i componenti.
Raggiunti gli scopi, i comitati si estinguono. Gli altri enti non lu-
crativi si caratterizzano per durata tendenzialmente illimitata e sono
VFLROWLLQFDVLHFFH]LRQDOLTXDOLO¶LPSRVVLELOLWjGLUDJJLXQJHUHJOLscopi
VRFLDOLODGHOLEHUD]LRQHGHOO¶DVVHPEOHDVWUDRUGLQDULDGHJOLDVVRFLDWLR
la sopravvenuta mancanza di tutti gli associati, o per motivi previsti
dal codice civile o dalle leggi dello Stato vigenti in materia. La natura
giuridica delle associazioni e delle fondazioni culturali ed artistiche è
più complessa di quella dei comitati e di conseguenza modella realtà
sociali più radicate nel territorio e più incisive nel mondo dello spetta-
colo.

3.4.3. Associazioni

Le associazioni sono organizzazioni non lucrative che si distinguono


GDOOH IRQGD]LRQL SHU OD SUHYDOHQ]D GHOO¶HOHPHQWR SHUVRQDOH VX TXHOOR
patrimoniale e perché sono costituite con un contratto non unilaterale
ed istitutivo, ma plurilaterale e associativo, integrato allo statuto e
spesso stipulato nHOODIRUPDGHOO¶DWWRSXEEOLFR. Le associazioni cultu-
rali, in particolare, si occupano:
a) della programmazione di iniziative volte a promuovere lo svi-
luppo artistico e culturale e a valorizzare il territorio, di concerto
con gli enti locali;
b) della gestione di teatri locali, stabili o di tradizione;
c) della realizzazione di attività di spettacolo.
III. Soggetti e persone giuridiche nel mondo dello spettacolo 77

3.4.4. Fondazioni

Una fondazione è un ente privato senza scopo di lucro, con una pro-
pria sorgente di reddito che deriva normalmente da un patrimonio.
/¶HQWHqUHWWo da uno statuto ed è autonomo a livello giuridico, ammi-
nistrativo e finanziario; è istituito con un atto unilaterale di destina-
zione (tra vivi o a causa di morte) che vincola un patrimonio a scopi
educativi, culturali, religiosi o sociali. Nelle fondazioni culturali lo
scopo, che si identifica nella conservazione e nella promozione del pa-
trimonio storico-culturale, è perseguito attraverso:
a) O¶HURJD]LRQHGLSUHPLRERUVHGLVWXGLR VLKDQQRFRVuIRQGD]LRQL
per premi decidenti, che assegnano direttamente i premi, e fon-
dazioni per premi eroganti, che attribuiscono ad altri enti criteri
e poteri di assegnazione);
b) O¶HURJD]LRQHGLILQDQ]LDPHQWLGHVWLQDWLDGLVWLWX]LRQLRHYHQWLGL
spettacolo (fondazioni grant-making, tra cui le fondazioni ban-
carie);
c) O¶RUJDQL]]D]LRQH e la realizzazione di attività di spettacolo (fon-
dazioni operative);
d) la gestione di istituzioni come musei e teatri (fondazioni di frui-
zione, tipologia ibrida tra le due precedenti).
/HIRQGD]LRQLFXOWXUDOLVLVRQRGLIIXVHFRQO¶LQFULQDUVLGHOODFRQFe-
zione dello Stato quale unico artefice degli interventi per lo sviluppo
culturale e con il graduale radicamento del sistema del social commit-
ment, ovvero degli incentivi fiscali dello Stato ai privati.
Tra gli anni Ottanta e Novanta del secolo scorso si è verificata la
duplice tendenza del legislatore a trasformare enti pubblici in fonda-
zioni culturali e a istituire fondazioni ex lege. Il disegno di privatizza-
zione tratteggiato dalla politica economica degli ultimi venti anni ha
visto nella fondazione uno strumento efficace di raccordo tra interessi
FROOHWWLYLHSDUWLFRODULHO¶KDFRQVLGHUDWDFRPHO¶LQYROXFURSULYDWLVWLFR
ideale anche per gli enti pubblici, sulla base della convinzione che il
privato può provvedere allo sviluppo e alla valorizzazione dei beni
cXOWXUDOL FRQ XQ¶HFRQRPLFLWj IDFLOLWj GL JHVWLRQH GLQDPLFLWj H DWWHn-
zione alle ricadute sociali più incisive del pubblico.
In questo contesto gli enti autonomi lirici, già disciplinati come
persone giuridiche di diritto pubblico dalla legge 14 agosto 1967, n.
78 Manuale di diritto delle arti e dello spettacolo

800, hanno acquisito la personalità giuridica di diritto privato pren-


GHQGR LO QRPH GL ³IRQGD]LRQL OLULFR-VLQIRQLFKH´ VHFRQGR TXDQWR Gi-
sposto dal d.lgs. 367/1996; GDSSULPDLQDGHPSLHQWLDOO¶REEOLJRGLGHOi-
bera della trasformazione, gli enti lirici sono stati trasformati ope legis
in fondazioni dapprima dal d.lgs. 134/1998 ± poi dichiarato incostitu-
zionale per eccesso di delega ± e successivamente dal d.l. 345/2000,
convertito in legge 3 maggio 2001, n. 6, che ha riconfermato, richia-
mandole espressamente, molte delle disposizioni del d.lgs. 367/1996.
$OOD EDVH GHOO¶RSHUD]LRQH GL ULIRUPD GHO FKH FRQVLGHUDYD OH
procedure e gli effetti della privatizzazione degli enti del solo settore
musicale, vi era la necessità di coinvolgere i privati a partecipare al
patrimonio degli enti, e in particolare degli enti lirici, visti i problemi
di gestione in un settore caratterizzato da costi elevati e scarsi ritorni.
Questa normativa sancisce che gli apporti dei privati non devono esse-
re superiori al 40% del patrimonio stesso nel primo quadriennio.
A differenza di quanto potrebbe sembrare, la modifica è solo for-
PDOH SHUFKp KD ODVFLDWR LQYDULDWL O¶DWWLYLWj GHJOL HQWL H LO ORUR DVVHWWR
finanziario, che ancora dipende fondamentalmente da apporti dello
Stato o di altri enti pubblici ai sensi della l. 259/1958.
Il d.lgs. 367/1996 sottopone le neonate fondazioni lirico-sinfoniche
alla disciplina del codice civile solo per aspetti residuali e ne regola
O¶RUJDQL]]D]LRQH ULJLGDPHQWH ODVFLDQGR SRFR PDUJLQH DOO¶DXWRQRPLD
statutDULD O¶DWWLYLWjq VRJJHWWD DOOD YLJLODQ]D GHOO¶DXWRULWj GL JRYHUQR
FKHDVVXPHSRWHULDQFKHLVSHWWLYLHLQIRU]DGHOO¶DUWODJHVWLRQHIi-
nanziaria è soggetta al controllo della Corte dei Conti.
Il riordino delle fondazioni lirico-sinfoniche disposto dal legislatore
nel d.l. 64/2010 valorizza i principi di economicità e imprenditorialità
ed esalta la responsabilità delle figure manageriali a cui è affidata la
gestione economica e patrimoniale. Questa normativa prevede il rico-
noscimento di forme organizzative speciali a favore delle fondazioni
lirico-VLQIRQLFKHFKHKDQQRUDJJLXQWRHPDQWHQJRQRO¶³HTXLOLEULRHFo-
nomico-SDWULPRQLDOH´JUD]LHDOULOLHYRinternazionale o ad eccezionali
capacità produttive, per la rilevanza dei ricavi o dei finanziamenti pri-
vati continuativi. /¶DWWXD]LRQH VL q YHULILFDWD FRQ LO G35 
recante i criteri e le modalità del riconoscimento. Sono state così rico-
nosciute come fondazioni dotate di forme organizzative speciali la
Fondazione Teatro alla Scala di Milano (d.m. 16 aprile 2012) e la
III. Soggetti e persone giuridiche nel mondo dello spettacolo 79

Fondazione Accademia Nazionale di Santa Cecilia (d.m. 23 gennaio


2012).
Il citato d.lgs. 367/1996 che dispose la privatizzazione degli enti
pubblici del settore musicDOH LOFRPPDDGHOO¶DUW 2 indica come de-
stinatari gli enti autonomi lirici ed istituzioni concertistiche assimilate)
q VWDWR HVWHVR FRQ O¶DJJLXQWD GHO FRPPD  E DSSOLFDWD GDO GOJV
 DQFKH ³DG DOWUL HQWL RSHUDQWL QHO VHWWRUH GHOOD PXVLFD GHO
teatro e della danza, identificati sulla base di criteri previamente defi-
niti dal Ministro per i beni e le attività culturali, anche con riferimento
alle categorie previste dal titolo III della legge 14 agosto 1967, n. 800,
HVXFFHVVLYHPRGLILFD]LRQL´/¶HVWHQVLRQHGHOODtrasformazione in fon-
dazioni di diritto privato anche agli enti operanti negli ambiti del tea-
WURHGHOODGDQ]DKDUHVRTXHVW¶LQWHUYHQWROHJLVODWLYR un esempio para-
digmatico del carattere onnicomprensivo del fenomeno dello spettaco-
lo nel nostro ordinamento giuridico. Altri enti pubblici come il Centro
sperimeQWDOH GLFLQHPDWRJUDILD OD %LHQQDOH GL 9HQH]LD O¶,VWLWXWR Qa-
zionale per il dramma antico, la Triennale di Milano sono stati tra-
VIRUPDWLLQIRQGD]LRQLFRQO¶HPDQD]LRQHGLXQDVHULHGLGHFUHWLOHJLVOa-
WLYLRULJLQDWLGDOO¶DUWFRPPDEGHOODSULPDOHJge Bassanini (l.
59/1997), per i quali gli atti istitutivi derivano direttamente dalle rela-
tive leggi e gli statuti predisposti dal consiglio di amministrazione so-
QRVRJJHWWLDOO¶DSSURYD]LRQHJRYHUQDWLYD/¶DUWOKDGe-
legato il Governo ad individuare enti e organismi pubblici da trasfor-
PDUHLQVRFLHWjSHUD]LRQLRLQIRQGD]LRQLGLGLULWWRSULYDWR³DOILQHGL
conseguire gli obiettivi di stabilità e crescita, di ridurre il complesso
della spesa di funzionamento delle amministrazioni pubbliche, di in-
FUHPHQWDUHO¶HIILFLHQ]DHGLPLJOLRUDUHODTXDOLWjGHLVHUYL]L´
Un modello recente ed innovativo adottato sia dalle fondazioni cul-
turali di origine privata sia da quelle istituite da enti pubblici o deriva-
te dalla privatizzazione è quello della fondazione di partecipazione. Si
tratta di una categoria ibrida tra modello fondazionale puro e modello
associativo, poiché fondatori successivi si possono aggiungere a quelli
originari, dando luogo ad una pluralità di fondatori e, di conseguenza,
ad un patrimonio a struttura aperta che può crescere nel tempo; inoltre
i fondatori, originari e successivi, detengono rilevanti poteri in materia
di gestione. La fondazione di partecipazione, efficace strumento
G¶LQWHJUD]LRQHLVWLWX]LRQDOHWUDVRJJHWWLSXEEOLFLHSULvati che recente-
80 Manuale di diritto delle arti e dello spettacolo

mente si è diffuso anche in Italia, registra ampi riscontri in ambito cul-


WXUDOHWHDWUDOHHPXVLFDOHHLQWXWWLLVHWWRULLQFXLO¶D]LRQHFRQJLXQWDGL
pubblico e privato consente una piena realizzazione dello scopo in
tempi brevi. Tuttavia questo fenomeno giuridico deve essere codifica-
WRDOO¶LQWHUQRGLXQWHVWRQRUPDWLYRFKHDIIURQWLLQPDQLHUDRUGLQDWDH
sistematica la disciplina degli enti, valutandone le manifestazioni e gli
sviluppi più recenti.

3.5. Il pubblico

Il pubblico è soggetto del diritto dello spettacolo poiché si pone come


destinatario della comunicazione artistica.
La combinazione di digitalizzazione e diffusione di Internet ha
esteso la nozione di spettacolo anche alle manifestazioni artistiche tra-
smesse via web. Parallelamente la definizione di pubblico non si esau-
risce più in un insieme di spettatori raccolti in un luogo destinato alla
fruizione: ha acquistato il significato più complesso di utenza che par-
tecipa ad un evento da un luogo che può essere reale o virtuale.
CoPHDIIHUPD)DELR'HOO¶$YHUVDQD³,QWHUQHWUDSSUHVHQWDXQDUHWH
di comunicazione globale in grado di riunire contemporaneamente un
elevato numero di persone, con costi contenuti e, almeno potenzial-
PHQWH VHQ]D OLPLWD]LRQL WHPSRUDOL H JHRJUDILFKH´ 1HO PHULWo degli
HIIHWWLGHOO¶HYROX]LRQHWHFQRORJLFDHGL,QWHUQHW'HOO¶$YHUVDQDDIIHr-
PD FKH O¶XWHQWH SXz SURFHGHUH DO download del file musicale o del
contenuto audiovisivo, fruire di quel contenuto in modalità streaming
o condividerlo con altre persone.
In punto di diritto, la rapidità e la pervasività dei cambiamenti han-
no causato HVLJHQ]HQRUPDWLYHVWULQJHQWLLQPDWHULDGLGLULWWRG¶DXWRUH
tuttavia nel nostro ordinamento non si trova ancora una disciplina or-
ganica in grado di offrire una risposta ai tanti problemi sollevati dalla
prassi.
Così come i problemi organizzativi e gestionali del mondo dello
spettacolo sono risolti dai manager, è auspicabile che le problematiche
JLXULGLFKHVLDQRULVROWHGDOOHJLVODWRUHFRQO¶DXVLOLRGLULIOHVVLRQLFRPH
quelle raccolte in questo libro.
Capitolo IV

I contratti dello spettacolo: peculiarità e criticità

di ALESSANDRO PICARONE

4.1. Introduzione

Nella seguente trattazione analizzeremo i contratti maggiormente uti-


lizzati nel mondo dello spettacolo, cercando di evidenziarne gli ele-
menti di peculiarità rispetto alla disciplina di diritto comune e le più
frequenti criticità emerse nella prassi.
Prenderemo in considerazione innanzitutto il contratto di scrittura
artistica, individuandone sia le caratteristiche basilari, sia le problema-
tiche meno comuni: ci concentreremo, dunque, sul concetto di presta-
zione artistica, fornendone una definizione utile per ulteriori spunti di
riflessione. In particolar modo, evidenzieremo come fondamentale il
rapporto fiduciario tra committente ed artista, fattore ampiamente di-
PRVWUDWR GDOO¶LQWHUHVVDQWH GLEDWWLWR VRUWR VLD LQ UHOD]LRQH DOOD QDWXUD
del contratto di prestazione artistica, in cui ci si è chiesto se
TXHVW¶XOWLPR TXDOLILFD R PHQR XQ UDSSRUWR GL VXERUGLQD]LRQH VLD LQ
relazione alla clausola di protesta, clausola in virtù della quale il teatro
SXzULVROYHUHLOFRQWUDWWRSHUPDQLIHVWDLQDGHJXDWH]]DGHOO¶DUWLVWD
Relativamente al contratto di edizione ricostruiremo le caratteristi-
che principali del rapporto che si instaura tra autore ed editore. Questo
tipo di rapporto qualifica anche la natura del contratto di edizione,
aspetto che approfondiremo alla luce di diversi istituti previsti dalla
nostra disciplina civilistica. Analizzando gli obblighi degli autori,
inoltre, si affronterà il fenomeno del plagio.

81
82 Manuale di diritto delle arti e dello spettacolo

Alla luce della definizione di spettacolo già data in precedenza cer-


FKHUHPRGLFRPSUHQGHUHFRVDV¶LQWHQGDSHUUDSSUHVHQWD]LRQHSXEEOLFD
di un evento e di rispondere ad alcuni quesiti in materia.
La maggior parte delle questioni che affronteremo in merito al con-
tratto di sponsorizzazione riguarda la sua tipizzazione e la sua diffe-
renziazione, non sempre esplicita, rispetto alla pubblicità.
In ultima istanza, parleremo del manager, figura complessa che in-
terviene in relazione ad una serie articolata di rapporti contrattuali, tut-
ti codificati nel nostro ordinamento civilistico e tutti di grande rilievo
DLILQLGHOO¶DWWLYLWjDUWLVWLFD

4.2. Il contratto di scrittura artistica: quale tipo di rapporto?

&RQOHHVSUHVVLRQL³VFULWWXUHWHDWUDOL´H³VFULWWXUHDUWLVWLFKH´FLVLULIHUi-
sce ai contratti che legano gli artisti ai teatri, con i quali un artista si
obbliga a prestare la propria attività a favore di un committente verso
un corrispettivo e per un determinato periodo di tempo.
In questa sede è necessario richiamare il concetto di prestazione ar-
WLVWLFDFKHFRQVLVWHLQXQ¶DWWLYLWjFKHqIUXWWRGHOODVHQVLELOLWjHGHOOD
tecnica individuale di ciascun artista. Tale tipo di prestazione influisce
sulla natura del contratto: sicuramente è presente O¶intuitus personæ,
fondamentale caratteristica che consiste nella fiducia nelle particolari
TXDOLWj SHUVRQDOL GHOO¶DUWLVWD 4XHVWR DVSHWWR IDUHEEH SHQVDUH DG XQ
contratto di lavoro autonomo, ma non va dimenticato che per la buona
realizzazione delODSUHVWD]LRQHqDOWUHWWDQWRLPSRUWDQWHO¶RSHUDGLGLUe-
zione registica o comunque la direzione del committente. Non è pen-
sabile, difatti, che ogni artista possa decidere in totale autonomia ca-
lendario e durata delle prove.
In conseguenza di un dissidio tra artisti e regista potrebbe verificar-
VL O¶LQWHUUX]LRQH GHO UDSSRUWR ODYRUDWLYR LQ WDO FDVR q RSSRUWXQR Gi-
stinguere due casi.
6HO¶LQFRQFLOLDELOLWjGLRSLQLRQHGHULYDGDFRQYLQ]LRQLDUWLVWLFKHLQ
special modo quando queste si riflettono in scelte interpretative diffe-
UHQWL H WUD ORUR LQFRQFLOLDELOL YD ULFRUGDWR FKH O¶DUWLVWD OLPLWHUj SDr-
zialmente la propria libertà e quindi dovrà, per certi versi, sottostare
alle indicazioni del committente.
IV. I contratti dello spettacolo: peculiarità e criticità 83

Se, invece, ci si riferisce alle scelte morali, è opportuno far cenno


DOODOLFHLWjGHOODSUHVWD]LRQHGHOO¶DWWRUHex art. 1346 cod. civ., con par-
ticolare riferimento al concetto di oscenità della prestazione artistica.
È qui necessario solo rinviare al codice penale che qualifica, ex art.
FRPHRVFHQRTXHOO¶DWWRFhe offende il comune senso del pudore,
XQ FRQFHWWR YROXWDPHQWH HODVWLFR FRVu GD DGHJXDUVL DOO¶HYROYHUVL GHL
costumi. Tuttavia, ciò porta a confini non del tutto sicuri, con non po-
FKL SUREOHPL VH FRQVLGHULDPR DQFKH O¶DUW  FRG FLY QRUPD FKH
impone al GDWRUHGLODYRURO¶REEOLJRGLJDUDQWLUHOHPLVXUHQHFHVVDULHD
tutelare, tra le altre cose, la personalità morale dei prestatori di lavoro.
'LIIHUHQWHPHQWH GDO FDVR SUHFHGHQWH GXQTXH O¶DUWLVWD SXzOHJLWWLPa-
mente rifiutarsi di porre in essere rappresentazioni oscene, onde evita-
UHGLLQFRUUHUHQHOOHVDQ]LRQLSUHYLVWHGDOO¶DUWFRGSHQLQWHPDGL
spettacoli pubblici osceni.

4.2.1. Clausola di protesta

4XDORUDODGLULJHQ]DGHOWHDWURULWHQJDFKHO¶DUWLVWDQRQVLDDOO¶DOWH]]D
GHOO¶LQFDULFRFRQIHULWRJOi, può legittimamente interrompere il rapporto
ODYRUDWLYRLQYRFDQGRODFODXVRODGLSURWHVWD/¶intuitus personæ, infat-
ti, è un elemento fondamentale del contratto di scrittura artistica; se
viene a mancare, il rapporto lavorativo non può proseguire.
Il dibattito sulla natura della clausola in questione è molto vivace.
7DOXQLODDVVRFLDQRDGXQSDWWRGLSURYDFKHVXERUGLQDO¶DVVXQ]LRQH
GHILQLWLYDGHOODYRUDWRUHDOO¶HVLWRSRVLWLYRGLXQSHULRGRGLSURYDFo-
me previsto ex art. 2096 cod. civ., trascurando il fatto che la disciplina
FRGLFLVWLFDVXOWHPDVLULIHULVFHVLDDOO¶LPSUHQGLWRUHFKHDOSUHVWDWRUHGL
lavoro, mentre la clausola di protesta fa capo solo al datore di lavoro.
Altri considerano la clausola di protesta una forma di recesso ante
tempus per giusta causa, cioè in presenza di una causa che «non con-
senta la prosecuzione, anche provvisoria, del rapporto» (cfr. art. 2119
cod. civ.). Nel sostenere tale tesi ci si dimentica del fatto che il recesso
può essere esercitato in conseguenza di un inadempimento volontario
di una delle parti. Nella clausola di protesta invece le parti sono per-
fettamente adempienti, in presenza di risultati considerati scadenti. Per
questa ragione pare più adeguato parlare di condizione risolutiva, cioè
di un elemento accidentale del contratto che, verificatosi, produce la
84 Manuale di diritto delle arti e dello spettacolo

cessazione del rapporto contrattuale. Nella clausola di protesta un ri-


sultato ritenuto insufficiente è la condizione risolutiva che pone fine
agli effetti del contratto.
Sia in giurisprudenza che in dottrina, è stato evidenziato che la
clausola di protesta non può essere utilizzata per un mero capriccio del
WHDWURPDGHY¶HVVHUHDGHJXDWDPHQWHPRWLYDWDO¶DUWLVWDSURWHVWDWRLn-
fatti, può impugnare in sede giudiziale il provvedimento.
6HPSUHDWXWHODGHOO¶DUWLVWD va segnalato che la protesta, per essere
HIILFDFH GHY¶HVVHUH HVHUFLWDWD LPPHGLDWDPHQWH GRSR OR VSHWWDFROR H
prima delle successive rappresentazioni: in caso contrario si riterrà che
il committente abbia rinunciato al diritto di protesta per facta conclu-
dentia.
/¶DUWLVWDQRQSRWUjULFKLHGHUHDOFXQULVDUFLPHQWRQHOFDVRLQFXLLO
WHDWURLQYRFKLODULVROX]LRQHIRQGDQGRODVXXQ¶RJJHWWLYDVFDUVDSURIHs-
VLRQDOLWjRLQFDSDFLWjWHFQLFDGLULFRSULUHLOUXRORSHULOTXDOHO¶DUWLVWDq
stato ingaggiato: in questo casR VLDPR GL IURQWH DG XQ¶LSRWHVL GLLQa-
dempimento che legittima, come tale, la risoluzione del contratto.
Giova comunque ricordare che la clausola di protesta è solo una
possibilità estrema per il committente: innanzitutto è improbabile che
un artista venga protestato dopo le prove o dopo le prime rappresenta-
zioni, in quanto si presuppone che la scelta degli artisti sia ponderata,
a maggior ragione se la prestazione artistica sia di particolare rilievo.
In secondo luogo, è sensato ritenere che la scelta di esercitare il diritto
di protesta vada effettuata con molta parsimonia, onde evitare di pro-
GXUUHXQLQJLXVWRGDQQRDOODUHSXWD]LRQHGHOO¶DUWLVWD

4.3. I contratti di sponsorizzazione tra mecenatismo e pubblicità:


quale tipizzazione?

Il contratto di sponsorizzazione è il contratto con cui una parte ± lo


sponsor ± si obbliga ad una prestazione, in genere pecuniaria, nei con-
IURQWLGLXQ¶DOWUDSDUWH± lo sponsee ± che si obbliga a divulgare il no-
me o il marchio dello sponsor nelle varie proprie attività. Tale tipo di
contratto è identificabile come un contratto bilaterale sinallagmatico,
in quanto le due parti contrattuali assumono reciprocamente obblighi
specifici. Anche in ambito televisivo è possibile ritrovare una defini-
IV. I contratti dello spettacolo: peculiarità e criticità 85

zione analoga di sponsorizzazione: la legge Mammì (l. 223/1990), che


KDULIRUPDWRLOVLVWHPDUDGLRWHOHYLVLYRDOO¶DUWGRGLFHVLPRFRPPD
TXDOLILFD OD VSRQVRUL]]D]LRQH FRPH ©RJQL FRQWULEXWR GL XQ¶LPSUHVD
pubblica o privata, non impegnata in attività televisive o radiofoniche
o di produzione di opere audiovisive o radiofoniche, al finanziamento
di programmi, allo scopo di promuovere il suo nome, il suo marchio,
ODVXDLPPDJLQHOHVXHDWWLYLWjRLVXRLSURGRWWLªFRQO¶DYYHUWHQ]DFKH
«il contenuto e la programmazione di una trasmissione sponsorizzata
non possono essere in nessun caso influenzati dallo sponsor in manie-
UDWDOHGDOHGHUHODUHVSRQVDELOLWjRO¶DXWRQRPLDHGLWRULDOHGHLFRQFHs-
sionari privati o della concessionaria pubblica nei confronti delle tra-
smissioni».
È possibile distinguere la sponsorizzazione dalla pubblicità vera e
propria. Il messaggio pubblicitario veicolato tramite la sponsorizza-
zione si inserisce in contesti ed eventi che possono anche essere molto
GLYHUVLGDOO¶DPELWRRSHUDWLYRGHOORVSRQVRU SHUHVHPSLRXQDFDVDDu-
tomobilistica può essere sponsor di un torneo di calcio); invece, la
pubblicità vera e propria è separata dal contesto ed è veicolata per via
mediatica con la finalità esclusiva di esaltare le caratteristiche tipiche
del prodotto reclamizzato.
La distinzione linguistica che troviamo in inglese tra sponsorship
(la sponsorizzazione) e patronage (che indica il patrocinio) e in fran-
cese tra sponsoring e PpFpQDWG¶HQWHUSULVH si riflette anche nei fatti. I
patroni spesso sono persone molto ricche che donano parte delle loro
IRUWXQH SHUVRQDOL ,Q SDUWLFRODU PRGR QHO PHFHQDWLVPR G¶LPSUHVD
O¶LQWHUHVVHGHOPHFHQDWHqVHPSUHTXHOORGLIDUDSSDULUHLOSURSULRQo-
PHHGLGLYXOJDUHSUHVVRODVRFLHWjXQFHUWRWLSRG¶LPPDJLQH0DQFD
dunque, il carattere della commercialità del fenomeno, in quanto non
vi sono controprestazioni per la promozione del proprio nome.
È il caso di evidenziare anche le differenze con altri istituti civili-
VWLFL FXL OD VSRQVRUL]]D]LRQH q VWDWD DYYLFLQDWD /¶DVVLPLOD]LRQH GL
TXHVW¶XOWLPDDOO¶DSSDOWRqdavvero poco convincente, in quanto il con-
tratto di sponsorizzazione non obbliga lo sponsee DOO¶DGHPSLPHQWRGL
SUHVWD]LRQL YHUVR OR VSRQVRU O¶DUWLVWD R O¶HYHQWR VSRQVRUL]]DWR Go-
vranno in ogni caso adempiere verso altri soggetti.
Altro accostamento ± quasi unanimemente respinto ± è quello rela-
WLYRDOFRQWUDWWRG¶RSHUDLQTXDQWRO¶DUWFRGFLYVWDELOLVFHFKH
86 Manuale di diritto delle arti e dello spettacolo

TXHVW¶XOWLPRFRQWUDWWRqLGHQWLILFDELOH©TXDQGRXQDSHUVRQDVLREEOLJD
DFRPSLHUHYHUVRXQFRUULVSHWWLYRXQ¶RSHUDRXQVHUYL]LRFRQODYRUR
prevalentemente proprio e senza vincolo di subordinazione nei con-
fronti del committente». Va detto, inoltre, che la definizione di con-
WUDWWRG¶RSHUDHTXHOODGLFRQWUDWWRGLVSRQVRUL]]D]LRQHQRQVRQRSHr-
IHWWDPHQWHVRYUDSSRQLELOLLOFRQWUDWWRG¶RSHUDqXQFRQtratto che si ba-
VDVXOO¶intuitus personæ, caratteristica assente nel contratto di sponso-
UL]]D]LRQH,QROWUHLOFRQWUDWWRG¶RSHUDVRGGLVIDO¶LQWHUHVVHDOODUHDOLz-
zazione di un qualsiasi bene, mentre lo sponsorship prevede la realiz-
zazione di un bene specifico: la divulgazione di un certo nome o di un
certo marchio in connessione alla realizzazione di un evento artistico,
culturale o sportivo.
A differenza di quanto si ritiene in modo maggioritario, tuttavia,
QRQYDHVFOXVRFKHLOFRQWUDWWRG¶RSHUDQRQSRVVDfornire un utile con-
tributo per la tipizzazione di parte del contratto di sponsorizzazione: si
SHQVL DO IDWWR FKH O¶REEOLJR SULQFLSDOH DFDULFR GHOOR VSRQVRUq JHQe-
ralmente il pagamento di una somma di denaro concordata. In man-
FDQ]DGLXQ¶HVSOLFLWDILVVD]Lone, è possibile determinarla ricorrendo al
disposto ex DUWFRGFLYLQWHPDGLFRQWUDWWRG¶RSHUDLQEDVHDO
quale «il corrispettivo, se non è convenuto dalle parti e non può essere
determinato secondo le tariffe professionali o gli usi, è stabilito dal
giudice in relazione al risultato ottenuto e al lavoro normalmente ne-
cessario per ottenerlo». Si trascurano qui le ipotesi, per loro manifesta
infondatezza, che riconducevano la sponsorizzazione al contratto di
locazione, di vendita, di somministrazione e di mandato.
Non tutte le clausole possono ritenersi valide e giuridicamente vin-
colanti: tra queste vanno considerate le clausole che prevedono impe-
gni che potrebbero apparire contrari alla volontà dello sponsee, come
ad esempio quelle che gli impongono di nutrirsi esclusivamente con
determinati prodotti alimentari o dietetici forniti dallo sponsor.
In tema di adempimento contrattuale, è necessario ricordare che
O¶REEOLJD]LRQH GHOOR VSRQVRUL]]DWR q XQ¶REEOLJD]LRQH GL PH]]L H QRQ
di risultato, in quanto non si è tenuti a garantire un ritorno pubblicita-
rio al creditore della prestazione: qualora il ritorno pubblicitario non vi
IRVVHRQRQYLIRVVHQHOOHDVSHWWDWLYHGHOORVSRQVRUTXHVW¶XOWLPRQRQ
può chiedere la risoluzione del contratto né il risarcimento dei danni
allo sponsee.
IV. I contratti dello spettacolo: peculiarità e criticità 87

6XOO¶DUJRPHQWR DQFRUFKp LQ DPELWR GL PDQLIHVWD]LRQL VSRUWLYH q


LQWHUYHQXWDOD&RUWHGL&DVVD]LRQHQHOO¶HPEOHPDWLFRFDVRGHOOD7Hm-
porary: con la sentenza 8 aprile 2014, n. 8153 si è affermato che il dif-
fondersi di notizie clamorose, ancorché negative ed attinenti allo
sponsee, non ha necessariamente ed in ogni caso effetti negativi per lo
sponsor, «ove non rileva tanto che si parli bene, ma che si parli, di chi
vuol essere conosciuto e ricordato». A detta della Suprema Corte, è
pur vero che dal contratto di sponsorizzazione nasce un rapporto con
un forte carattere fiduciario, in cui gli obblighi di correttezza e buona
fede divengono fondamentali, ma le doglianze dello sponsor non de-
vono essere generiche. In sostanza, si sostiene che sia la mancanza di
buona fede e correttezza, sia il danno da risarcire siano da provare:
con ciò si evidenzia, sia per le cause di risoluzione del contratto sia
per il risarcimento danni, che se nel contratto di sponsorizzazione non
vi sono previsioni analitiche sulle questioni appena esposte, diventa
molto difficile provare ex post il nesso causale tra un risultato sciagu-
UDWRXQDULVVDVXOOHJUDGLQDWHRXQ¶HVWHUQD]LRQHLQIHOLFHGLXQGLULJHn-
te dello sponsee HLGDQQLSDWULPRQLDOLG¶LPPDJLQHVXELWLGallo spon-
sor.

4.4. Contratti di edizione: autonomia negoziale e tutela costituzio-


nale

Il sistema civilistico italiano prevede il concetto di autonomia nego-


ziale, ex art. 1322 cod. civ., in base al quale «le parti possono libera-
mente determinare il contenuto del contratto nei limiti imposti dalla
legge», prevedendo la possibilità per i contraenti di stipulare contratti
non esplicitamente tipizzati. Ne consegue che anche le opere
GHOO¶LQJHJQRSRVVRQRHVVHUHRJJHWWRGLFRQWUDWWRWUDSULYDWLLQWDOVHn-
so, SHUDOWURRSHUDHVSOLFLWDPHQWHO¶DUWFRGFLYUXEULFDWR³7Ua-
VIHULPHQWRGLGLULWWLGLXWLOL]]D]LRQH´
3HU TXDQWR ULJXDUGD OD OHJJH VXO GLULWWR G¶DXWRUH LQYHFH OD SDUWH
dedicata alla trasmissione dei diritti di utilizzazione comprende un
principio generale di massima libertà di disposizione, fatta salva
O¶DSSOLFD]LRQHGHOOHQRUPHDOO¶LQWHUQRGHOODOHJJHVWHVVD
88 Manuale di diritto delle arti e dello spettacolo

4.4.1. Il contratto di edizione

Il contratto di edizione è disciplinato dagli artt. 118 e ss. della legge


22 aprile 1941, n. 633 (legge sXO GLULWWR G¶DXWRUH RJJHWWR GL DPSLD
tratWD]LRQHQHLSURVVLPLFDSLWROL FRQWDOHFRQWUDWWRO¶DXWRUHFRQFHGH
DOO¶HGLWRUH O¶HVHUFL]LR GHO GLULWWR D SXEEOLFDUH O¶RSHUD SHU FRQWR
GHOO¶DXWRUH H D VSHVH GHOO¶HGLWRUH LO TXDOH DOWUHVu KD OD SRVVLELOLWj GL
esHJXLUHXQDRPROWHSOLFLHGL]LRQLQHLVXFFHVVLYLYHQW¶DQQLGDOODFRn-
VHJQDGHOO¶RSHUDFRPSOHWDHFRQDQQHVVDLQGLFD]LRQHGHOOHHGL]LRQLH
del numero di copie.
Il contratto di edizione si manifesta come un modo per attuare una
cooperazione tra autore ed editore per perseguire il loro comune inte-
UHVVH DOOD FLUFROD]LRQH QHJR]LDOH GHOOH RSHUH GHOO¶LQJHJQR ,Q TXHVWR
WLSR GL UDSSRUWROD GLVFLSOLQD LQHVDPH LQGLYLGXD O¶DXWRUH FRPH FRn-
traente debole, tutelandolo contro lo sfruttamento indebito della sua
RSHUDG¶LQJHJQRGDSDUWHGHOO¶HGLWRUHHYLWDQGRFKHTXHVW¶XOWLPRVLDv-
YDQWDJJL ROWUH L OLPLWL SDWWXLWL SHU HVHPSLR O¶DSSRVL]LRQH GL WHUPLQL
ex art. 119, l. 633/1941, fa sì che sia nullo il contratto «che abbia per
oggetto tutte le opere o categorie di opere che l¶DXWRUH SRVVD FUHDUH
senza limite di tempo». In buona sostanza, si vuole proteggere
O¶LQWHUHVVHGHOO¶DXWRUHDUHFXSHUDUHODSURSULDOLEHUWjG¶D]LRQHTXDORUD
GDOO¶DWWXD]LRQH GHO UDSSRUWR FRQ O¶HGLWRUH LO VXR LQWHUHVVH SHU
XQ¶RWWLPDOH GLIIXVLRQH GHOO¶RSHra non sia stato adeguatamente soddi-
sfatto.
Il contratto di edizione è a termine, ex art. 122, quinto comma, l.
 ,QEDVHTXHVWRDUWLFRORO¶DXWRUHFRQFHGHDOO¶HGLWRUHSHULO
periodo di vigenza del contratto che in ogni caso non deve essere su-
perLRUHDYHQW¶DQQLODIDFROWjGLHVHJXLUHHGL]LRQLVHQ]DOLPLWHQXPe-
rico, con il solo vincolo, a pena di nullità, di indicare il numero mini-
mo di esemplari da riprodurre per ogni edizione.
$OODVFDGHQ]DGHOWHUPLQHSDWWXLWRO¶HGLWRUHGRYUjFHVVDUHODULSUo-
duzione e la distribuzione degli esemplari realizzati, anche se, una vol-
ta decorsi i termini, le parti potranno pattuire la continuazione del rap-
porto contrattuale per un ulteriore periodo di tempo, con la possibilità
per entrambi anche di rinegoziare il contenuto del contratto.
6L LQVHULVFRQR QHO VROFR GHOOD WXWHOD GHOO¶DXWRUH LQWHVR FRPH FRn-
WUDHQWH GHEROH DQFKH DOWUH QRUPH GHOOD O  O¶DUW  FKH
IV. I contratti dello spettacolo: peculiarità e criticità 89

SUHYHGHLOUHFHVVRGHOO¶DXWRUHTXDORUDO¶HGLWRUHQRQSURYYHGDDOODQXo-
YDHGL]LRQHGHOO¶RSHUDO¶Drt. 128, che prevede la risoluzione del con-
WUDWWRSHUPDQFDWDSXEEOLFD]LRQHGHOO¶RSHUDQHOWHUPLQHSDWWXLWRLQIi-
QH O¶DUW  FKH SUHYHGH OD SUHOD]LRQH D EHQHILFLR GHOO¶DXWRUH
VXOO¶DFTXLVWRGHOOHFRSLHGHOO¶RSHUDGDVYHQGHUHRPDFHUDUH
La definizione del contratto di edizione ci consente di effettuare
XQDVHULHGLSUHFLVD]LRQL3HUTXDQWRULJXDUGDJOLREEOLJKLGHOO¶DXWRUH
TXHVWL GHYH FRQVHJQDUH O¶RSHUD JDUDQWHQGRQH OD SDWHUQLWj H OD OLEHUWj
GDRQHULHYLQFROL/¶HVLVWHQ]DGHOO¶REEOLJD]LRQHGLFRQVHJQDnon rile-
YD VXOOD SURSULHWj GHOO¶HVHPSODUH PHVVR D GLVSRVL]LRQH GHOO¶HGLWRUH
che in mancanza di una diversa disciplina contrattuale, permane in ca-
SRDOO¶DXWRUHLOSUREOHPDVLSRQHVSHFLDOPHQWHQHOFDVRGLRSHUHVFULt-
te o eseguite in unico esemplare, che presenta per sé un valore econo-
PLFRWDOYROWDLPSRUWDQWH/¶HGLWRUHLQWDOPRGRGHYHFRPSRUWDUVLVe-
condo le prescrizioni previste ex artt. 1766 e ss. cod. civ., e potrà dete-
nere le copie consegnategli finché sia necessario per eseguire la pub-
blicazione a sWDPSD GHOO¶RSHUD PHQWUH VXFFHVVLYDPHQWH GRYUj UHVWi-
WXLUOH DOO¶DXWRUH QHOOH PHGHVLPH FRQGL]LRQL QHOOH TXDOL YHUVDYDQR DO
momento della consegna.
,O WHPD GHOO¶RULJLQDOLWj GHOO¶RSHUD H GHO UHODWLYR GLYLHWR GL SODJLR
merita un approfondimento: la giurisprudenza di merito e di legittimi-
WjFRQIHULVFHDOO¶DXWRUHODSRVVLELOLWjGLSXEEOLFDUHXQ¶DOWUDRSHUDFKH
per argomento o materia, può far concorrenza ad una sua opera preesi-
VWHQWH3HUTXDQWRULJXDUGDLOSODJLRODUHVSRQVDELOLWjGHOO¶DXWRUHFRn-
sisterà solo se TXHVWLULSURGXUUjSDU]LDOPHQWHRWRWDOPHQWHLQXQ¶RSHUD
successiva, una sua opera già ad altri ceduta: in merito è necessario
soORULFRUGDUHFKHDOO¶LQL]LRGHO;;VHFRORLQXQSURJHWWRGLULIRUPD
GHOGLULWWRG¶DXWRUHSUHGLVSRVWRGDOODFRPPLVVLRQHPLQLVWeriale Polac-
co, si prevedeva (ex DUW O¶RSSRVWRULVSHWWRDTXDQWRSUHYLVWRGDOOD
normativa vigente, in quanto si mirava ad introdurre il divieto di edi-
zione di stampe che si proponessero in concorrenza con quella ceduta
precedentemente.
/¶HGLWRUHVRSSorterà le spese per la pubblicazione e per la diffusio-
QHGHOO¶RSHUD3URSULRLQFRQVLGHUD]LRQHGHOIDWWRFKHOHVSHVHGLSXb-
EOLFD]LRQHGHOO¶RSHUDFRQDQQHVVRULVFKLRLPSUHQGLWRULDOHIDQQRFDSR
DOO¶HGLWRUH TXHVW¶XOWLPR KD DQFKH OD IDFROWj GL VFHJOLHUH OD migliore
90 Manuale di diritto delle arti e dello spettacolo

VWUDWHJLDGLPHUFDWRHGLOPRPHQWRPLJOLRUHSHUODYHQGLWDGHOO¶RSHUD
VHQ]DFKHO¶DXWRUHSRVVDOHJLWWLPDPHQWHRSSRUVL
/DSXEEOLFD]LRQHGHOO¶RSHUD ± ex art. 127 della l. 633/1941 ± deve
DYYHQLUHQHOO¶DUFRGHOWHUPLQHSDWWXLWRFRQWUDWWXDOPHQWHH comunque,
D SHQD GL QXOOLWj QRQ ROWUH L GXH DQQL GDOO¶DGHPSLPHQWR GHOO¶DXWRUH
FLRq GDO ©JLRUQR GHOOD HIIHWWLYD FRQVHJQD DOO¶HGLWRUH GHOO¶HVHPSODUH
FRPSOHWRHGHILQLWLYRGHOO¶RSHUDªO¶HGLWRUHQHOFLWDWRELHQQLRSRWUHb-
be ad esempio avere interesse a scegliere un momento più redditizio
SHUSXEEOLFDUHO¶RSHUDRQGHIDYRULUHXQPDJJLRUVXFFHVVRHTXLQGLXQ
PDJJLRUJXDGDJQRSHUVpHGLQGLUHWWDPHQWHDQFKHSHUO¶DXWRUH
8QR GHJOL DVSHWWL GHO ULVFKLR LPSUHQGLWRULDOH GHOO¶HGLWRUH q LO FG Ui-
schio della qualità: da un lato, la Corte di Cassazione esclude che
O¶HGLWRUH SRVVD VLQGDFDUH ERQWj H YDORUL LQWULQVHFL GHOO¶RSHUD DVVu-
PHQGRVLLOULVFKLRGHOODTXDOLWjGDOO¶DOWURODWRO¶HGLWRUHSXzDQFKHYa-
lutare ± ex art. 2226 cod. civ. ± O¶RJJHWWLYDSXEEOLFDELOLWjGHOO¶RSHUDLQ
quanto esente da vizi, a maggior ragione se si sia riservato il preventi-
YR FRQWUROOR GHOO¶RSHUD FRPH ULVSRQGHQWH D TXDQWR SUHYLVWR GDO FRn-
tratto (la Corte di Cassazione ha affermato ciò a partire dal 1973). La
giurisprudenza non ha omesso di sottolineare che le parti possono
FRQVHQWLUH XQ VLQGDFDWR PDJJLRUH VXO PHULWR GHOO¶RSHUD GD SDUWH
GHOO¶HGLWRUHLQUHOD]LRQHVLDDLFRQWHQXWLVLDDLFULWHULGLUHGD]LRQH
La natura del contratto di edizione merita un certo approfondimen-
to per la compresenza di elementi tipici di altri istituti civilistici previ-
sti nel nostro ordinamento.
Talvolta la giurisprudenza ha individuato la causa del rapporto au-
tore-HGLWRUH FRPH XQD FROODERUD]LRQH DYDQ]DQGR O¶LGHD FKH SRWHVVH
essere un contratto di società. Non pare che possa avallarsi tale ipote-
si: nel rapporto societario tutti gli associati partecipano alla gestione
GHOO¶LPSUHVDPHQWUHQHOFDVRLQTXHVWLRQHVLqJLjHYLGHQ]LDWRFKHLO
ULVFKLRG¶LPSUHVDqVRORDFDULFRGHOO¶HGLWRUHHQRQDQFKHGHOO¶DXWRUH
In altri casi sono stati rilevati tipici aspetti del contratto di mandato,
nel quale il mandatario si obbliga a compiere uno o più atti per conto
del mandante (e anche in suo nome, nel caso sia un mandato con rap-
presentanza). Giurisprudenza di legittimità risalente ha ritenuto che
O¶HGLWRUHSXzLQWHUYHQLUHDWXWHODGHLGLULWWLSHUVRQDOLGHOO¶DXWRUHprocu-
ratorio nomine, potendo, altresì, agire in nome proprio in caso di uti-
OL]]D]LRQHDEXVLYDGHOO¶RSHUD
IV. I contratti dello spettacolo: peculiarità e criticità 91

Anteriormente al termine stabilito dalle parti, o dalla legge, il con-


tratto può essere sciolto per mutuo consenso, ex art. 1372 cod. civ., o
anche unilateralmente, ex art. 1373 cod. civ..
1HL FRQWUDWWL FKH SUHYHGDQR SL HGL]LRQL O¶DUW  GHOOD O
 SUHYHGH LQ FDSR DOO¶HGLWRUH OD SRVVLELOLWj GL VFLRJOLHUH Ll
YLQFRORFRQWUDWWXDOHRJQLYROWDFKHO¶HGL]LRQHLQFRUVRVLHVDXULVFDLQ
FDVRFRQWUDULRTXHVW¶XOWLPRGRYUjDYYHUWLUHO¶DXWRUHFKHLQWHQGHSURv-
vedere alla nuova edizione (in mancanza il contratto si ritiene risolto).
Il contratto di edizione si estingue, DL VHQVL GHOO¶DUW  GHOOD O
633/1941, per una serie di casi tassativamente previsti: il primo even-
to, appena analizzato, è quello della decorrenza del termine che di di-
ritto estingue il contratto. In secondo luogo si fa riferimento
DOO¶LQVXFFHVVRGHOO¶opera: il rimedio qui considerato potrà essere espe-
rito solo se, passato un periodo ragionevolmente ampio per valutare
O¶HVLWRFRPPHUFLDOHYLVLDXQDVSURSRU]LRQHWUDOHFRSLHLQYHQGXWHUi-
spetto alla tiratura programmata.
Un caso ulteriore è quello dellD PRUWH GHOO¶DXWRUH DQWHFHGHQWH DO
FRPSOHWDPHQWR GHOO¶RSHUD LQ WDO FDVR WXWWDYLD YD FRQVLGHUDWRDQFKH
O¶DUWGHOODOLOTXDOHGLFHFKH©VHO¶DXWRUHPXRUHRVL
WURYDQHOODLPSRVVLELOLWjGLFRQGXUUHO¶RSHUDDWHUPLQHGRSRFKHXQD
parte notHYROHHGDVpVWDQWHqVWDWDFRPSLXWDHFRQVHJQDWDO¶HGLWRUH
ha la scelta di considerare risoluto il contratto, oppure di considerarlo
compiuto per la parte consegnata, pagando un compenso proporziona-
WR VDOYR FKH O¶DXWRUH DEELD PDQLIHVWDWR R PDQLIHVWL OD volontà che
O¶RSHUDQRQVLDSXEEOLFDWDVHQRQFRPSLXWDLQWHUDPHQWHª
In ultimo, il contratto di edizione si considera estinto a seguito di
una decisione giudiziaria o di una disposizione di legge. Nel caso in
cui si vieta la divulgazione di opere altrimenti pubblicabili al momen-
WRGHOODVWLSXOD]LRQHGHOFRQWUDWWRTXHVW¶XOWLPRqULVROWRSHUVRSUDYYe-
nuta impossibilità. Nel caso opposto, se al momento della stipulazione
GHOFRQWUDWWRGLHGL]LRQHO¶RSHUDqJLjVWDWDFUHDWDHODSXEEOLFD]LRQH
GHOO¶RSHUDqYLHtata da una norma penale, il contratto è nullo ab origi-
ne ± ex art. 1346 cod. civ. ± SHULOOLFHLWjGHOO¶RJJHWWRRFRPXQTXHex
art. 1343 cod. civ. per illiceità della causa, in quanto già al momento
della sua stipulazione la prestazione pattuita era contra legem.
/DGLVFLSOLQDSUHYLVWDGDOODOHJJHLQWHPDGLIDOOLPHQWRGHOO¶HGLWRUH
PLUD D FRQWHPSHUDUH LO SL SRVVLELOH O¶LQWHUHVVH GHOO¶DXWRUH D JRGHUH
92 Manuale di diritto delle arti e dello spettacolo

con continuità della pubblicazione del suo lavoro e quello della massa
GHLFUHGLWRULGHOO¶HGLWRUHDYHGHUYalorizzati e liquidati, in modo ade-
JXDWRLGLULWWLGLVIUXWWDPHQWRHFRQRPLFRGHOO¶RSHUD$WDOILQHVLVWa-
ELOLVFH FKH O¶DVVRJJHWWDPHQWR GHOO¶HGLWRUH DOOD SURFHGXUD IDOOLPHQWDUH
non sciolga automaticamente il rapporto generato dal contratto di edi-
zione. Entro un anno dalla dichiarazione di fallimento il curatore deve
decidere se continuare i contratti di edizione in corso di esecuzione
QHOO¶DPELWRGLXQSLDPSLRHVHUFL]LRSURYYLVRULRGHOO¶LPSUHVDHGLWo-
riale, se cedere uno o più tra questi contratti oppure O¶LQWHUD D]LHQGD
editoriale, o risolvere tutti i contratti qui considerati.

4.4.2. Il contratto di edizione musicale: tutele e particolarità

Con il contratto di edizione musicale, il compositore cede i diritti di


XWLOL]]D]LRQHHFRQRPLFDGHOO¶RSHUDDOO¶HGitore che, di norma, è in gra-
GRGLSRWHUGLIIRQGHUHDOPHJOLRO¶RSHUDVXOPHUFDWRVIUXWWDQGRODHFo-
nomicamente il più possibile.
Rientrano nella protezione della l. 633/1941 le opere musicali, con
o senza parole, le opere drammatico-musicali e le variazioni musicali
dotate di originalità e creatività. Taluni autori in dottrina si sono chie-
VWLDQDOL]]DQGRODGLVFLSOLQDJHQHUDOHVXOGLULWWRG¶DXWRUHHVSHFLILFa-
PHQWH O¶DUW  O  VH LO FRQWUDWWR SHU HGL]LRQH YDOJD VROR
per la stampa o anche per le edizioni musicali: a tale domanda ha ri-
VSRVWRQHJDWLYDPHQWHOD&RUWHG¶$SSHOORGL%RORJQDFRQVHQWHQ]DGHO
14 giugno 1976, sostenendo che «il contratto col quale viene trasmes-
VRLOGLULWWRGLULSURGX]LRQHGHOO¶RSHUD>«@qFHUWDPHQWHXQFRQWUDWWR
tipico dLGXUDWDRDGHVHFX]LRQHFRQWLQXDWDª'¶DOWURFDQWRO¶DUWO
qFKLDURQHOORVSHFLILFDUH©O¶HVHUFL]LRGHOGLULWWRGLSXEEOi-
care per le stampe»: nel 1998, la Corte di Cassazione, con sentenza 23
giugno 1998, n. 6239 (nello stesso senso depone anche altra giuri-
sprudenza di legittimità), ha riaffrontato la tematica, sottolineando
FRPH ©O¶HVSUHVVLRQH ³SHUODVWDPSD´ILQLVFHFRQO¶DVVXPHUHLOYDORUH
di una metafora della pubblicazione tout court da parte di un editore»
ma «argomenti letterali e ragioni logiche consapevoli della attualità
del fenomeno da regolare, non consentono di estendere a tal punto la
espressione adoperata dal legislatore, e che le ragioni che militano a
IV. I contratti dello spettacolo: peculiarità e criticità 93

favore di una lettura della norma come ricomprendente solo la stampa


su caUWD>«@VLDQRWXWW¶RUDGDSUHIHULUVLª
La sentenza de qua HYLGHQ]LD SRL OD GLIIHUHQ]D WUD O¶DUW  O
633/1941, ed il codice civile, mettendo in risalto come il primo parla
di pubblicazione «per la stampa» mentre il secondo tutela il diritto
G¶DXWRUH indipendentemente dalle modalità di sfruttamento, ed altresì
ULFRUGDQGR FRPH O¶DUW  O  SUHFLVL FKH LO FRQWUDWWR SXz
avere ad oggetto «tutti i diritti di utilizzazione che spettano
DOO¶DXWRUHª/D&RUWHFRQFOXGHFKHLO©ULVXOWDWRHVHJHWLFRIa concludere
che nella mens legis esiste la pubblicazione per la stampa, ed esiste,
altresì, lo sfruttamento ulteriore a tale pubblicazione specificamente
TXDOLILFDWDGXQTXHVDOYRDSSRVLWDSDWWXL]LRQHFKHFRQVHQWDDOO¶HGLWRUH
uno sfruttamento anche ulteriore della stampa, il contratto di edizione
DELOLWDDOODVRODSXEEOLFD]LRQHFDUWDFHDªG¶DOWURQGHQRQqFDVXDOHFKH
O¶DUWGHOODOIDFFLDULIHULPHQWRHVSOLFLWRDOFRQWUDWWRGL
edizione musicale.
A conferma della peculiarità del contratto di edizione musicale, si
ricorda che costante giurisprudenza ritiene che la cessione dei diritti
QRQqVRJJHWWDDOODOLPLWD]LRQHWHPSRUDOHGHLYHQW¶DQQL ex art. 122 del-
la l. 633/1941, ma viene determinata contrattualmente secondo la di-
screzionalità delle parti: questa convinzione deriva dal fatto che la par-
WLFRODUHQDWXUDGHOO¶RSHUDPXVLFDOHGDXQODWRIDVuFKHODVWDPSDGHl-
ODSDUWLWXUDHGHJOLVSDUWLWLULYHVWDXQ¶LPSRUWDQ]DVHFRQGDULDULVSHWWRDO
FRPSOHVVRGHOO¶RSHUDHTXLQGLGHLGLULWWLGDFHGHUHG¶DOWUo canto con-
sente una migliore gestione dei cc.dd. evergreen. Di fatto, si verifica
FKHOHFHVVLRQLLQIDYRUHGHOO¶HGLWRUHVLDQRIDWWHsine die, senza che ciò
penalizzi gli autori, in considerazione del fatto che la ripartizione dei
diritti e dei proventi è affidata alle società di gestione collettiva.
Quando una composizione musicale è abbinata ad un testo, la fina-
OLWjSHUVHJXLWDFRLQFLGHFRQORVIUXWWDPHQWRGHOO¶RSHUDFRPSRVLWDFLa-
scuno dei soggetti che ha contribuito ha diritto di utilizzare separata-
mente ed indipendentemente la propria opera, a patto che siano decor-
VLLWHUPLQLSHUODSXEEOLFD]LRQHGHOO¶RSHUD/DOHJJHSUHVFULYHFKHOD
decorrenza dei termini parte dal momento in cui le parti ritengano
O¶RSHUDSURQWDSHUO¶HVHFX]LRQHRSHUODUDSSUHVHQWDzione. Inoltre, sia
la parte letteraria, sia la parte musicale, possono essere riutilizzate nel
FDVRLQFXLO¶RSHUDQRQYHQJDUDSSUHVHQWDWDRHVHJXLWDSHUGLHFLDQQL
94 Manuale di diritto delle arti e dello spettacolo

VHVLWUDWWDGLXQ¶RSHUDOLULFDGLXQSRHPDVLQIRQLFRRGLXQ¶RSHUHWWDH
per due anni nel caso di altre composizioni.

4.4.3. 3XEEOLFD]LRQHGLFDUWHJJLSULYDWLXQ¶DQDOLVLFRVWLWX]LRQDOPHQWH
orientata

Un caso del tutto peculiare è quello della pubblicazione di carteggi


privati, tematica che pone diversi problemi: in primo luogo, è oppor-
tuno richiamare il concetto di segretezza della corrispondenza, richia-
PDWR GDOOD &RVWLWX]LRQH UHSXEEOLFDQD DOO¶DUW  H TXDOLILFDWR FRPH
inviolabile. Affinché si possa parlare di segretezza della corrisponden-
za è necessario che sussista il carattere personale ed intersoggettivo
della comunicazione, costituito dalla determinatezza del destinatario e
GDOO¶LQWHQ]LRQHGHOPLWWHQWHGLFRPXQLFDUHFRQXQRRSLVRJJHWWLGe-
terminati (c.d. animus). La tutela costituzionale protegge la corrispon-
denza privata dalle interferenze esterne di ogni tipo, poiché questa si
caratterizza per il carattere confidenziale o intimo: in tal modo il mit-
tente ha deciso di manifestare liberamente le proprie opinioni, facendo
affidamento sulla riservatezza implicita nella forma del messaggio uti-
lizzato, oltre che su quel determinato destinatario.
Il diritto al segreto epistolare è bilaterale, in quanto il consenso alla
pubblicazione viene prestato sia dal mittente che dal destinatario: con-
seguentemente, il consenso di uno solo di essi non rende lecita la di-
vulgazione delle lettere. Tale diritto diviene plurilaterale quando nelle
missive si faccia riferimento a fatti relativi a terze persone che potreb-
bero essere, legittimamente, contrarie alla loro divulgazione: in tale
ultima possibilità è necessario ottenere il consenso anche di tutte le
persone eventualmente coinvolte nelle lettere che si vuol pubblicare.
La tutela de qua viene meno sia per volontà espressa di mittente e
destinatario sia perché diminuisce con il passare del tempo, conferen-
do un valore affettivo o storico o letterario ma non beneficiando più
della tutela ex art. 15 cost./DOHJJHVXOGLULWWRG¶DXWRUHVLSRQHLQPa-
QLHUDFRQIRUPHFRQLOGHWWDWRFRVWLWX]LRQDOHLQTXDQWRO¶DUWVWDWXi-
sce che «le corrispondenze epistolari, gli epistolari, le memorie fami-
liari e personali e gli altri scritti della medesima natura, allorché ab-
biano carattere confidenziale o si riferiscano alla intimità della vita
privata, non possono essere pubblicati, riprodotti od in qualunque mo-
IV. I contratti dello spettacolo: peculiarità e criticità 95

do portati alODFRQRVFHQ]DGHOSXEEOLFRVHQ]DLOFRQVHQVRGHOO¶DXWRUH
e trattandosi di corrispondenze epistolari e di epistolari, anche del de-
stinatario».
$LILQLGHOO¶DFFHUWDPHQWRGHOODFRQILGHQ]LDOLWjGHOORVFULWWRLO7Ui-
bunale di Milano ± che nel 2004 ha deciso sul caso relativo alle lettere
VSHGLWHGD,WDOR&DOYLQRD(OVDGH¶*LRUJL± ha ritenuto che non ha im-
portanza il tema affrontato o il sentimento manifestato dallo scrivente:
a nulla rilevava, peraltro, la presenza di tematiche strettamente ricon-
GXFLELOL DOO¶LQWLPLWj SHUVRQDOH GHO &DOYLQR H GHOOD GH¶ *LRUJL H GHOOD
trattazione di profili attinenti alla produzione letteraria ed artistica del-
lo scrittore. A tal fine, il Tribunale decise di inibire in via cautelativa
la pubblicazione ulteriore delle lettere senza il consenso degli eredi
delle parti.
&DVRGLYHUVRFKHVIXJJHDOODWXWHODGHOO¶DUWHDOODWXWHODFRVWLWu-
zionale, è quello del rapporto epistolare inventato: la Pretura di Roma,
nel 1987, revocò il provvedimento inibitorio relativo ad un epistolario
pubblicato in un libro, in quanto risultava evidente che tali lettere era-
QRRSHUDGLIDQWDVLDGHOO¶DXWRUHHQRQXQYHURFDUWHJJLR
8QDVSHWWRULOHYDQWHGHOFRQVHQVRqFKHTXHVW¶XOWLPRYLHQHFRQVLGe-
rato da alcuni autori in dottrina come irrevocabile: si sostiene, anche
con una certa coerenza, che una volta pubblicato il contenuto delle let-
tere decade ciò che si vuole tutelare, cioè il segreto su taluni fatti.
'¶DOWURFDQWRXQDYROWDUHVRQRWRXQIDWWRDSSDUHPROWRGLIILFLOHIDUVu
che su di esso ritorni il segreto, anche se può porsi rimedio, in ogni
FDVRULWLUDQGRGDOFRPPHUFLRO¶RSHUD ex art. 142), di fatto limitando-
ne la diffusione.
Nel caso in cui il mittente o il destinatario delle lettere sono morti,
gli eredi assumono su di loro il diritto di conferire, o meno, il consen-
VRDOODSXEEOLFD]LRQHGHOFDUWHJJLRHSLVWRODUHG¶DOWUDSDUWHFRQVROLGa-
ta giurisprudenza ricorda che «la pubblicazione postuma di brani di un
epistolario di carattere confidenziale, senza il consenso degli aventi
GLULWWR >«@FRVWLWXLsce violazione del diritto alla riservatezza tutelato
DOO¶DUW  GHOOD OHJJH D SURWH]LRQH GHO GLULWWR G¶DXWRUHH Gj GLULWWR DO
risarcimento del danno morale».
96 Manuale di diritto delle arti e dello spettacolo

4.5. Rappresentazioni pubbliche

4.5.1. Il contratto di rappresentazione e di esecuzione

La OHJJHVXOGLULWWRG¶DXWRUHFRQIHULVFHDOO¶DXWRUHHDLVXRLDYHQWLFDu-
sa (eredi, cessionari e concessionari) il diritto di rappresentare pubbli-
camente qualunque opera destinata alla rappresentazione, concetto che
FRQVLVWH QHOOD FRPXQLFD]LRQH GHOO¶RSHUD LQ pubblico, senza aggiunte,
tagli o variazioni non consentite (cfr. art. 138 della l. 633/1941).
Il contratto di rappresentazione e di esecuzione in pubblico è disci-
plinato dagli artt. 136 e ss. della l. 633/1941 e la sua peculiarità è che
non ha effetti trDVODWLYLDYHQGRDGRJJHWWRODGLYXOJD]LRQHGHOO¶RSHUD
FRQLOFRQVHQVRGHOO¶DXWRUHLQXQGHWHUPLQDWRDPELWRLQWHUSUHWDWLYRR
esecutivo.
Secondariamente, occorre stabilire quando una rappresentazione (o
XQ¶HVHFX]LRQH VLULWHQJRQRHIIHWWXDWHLQSXEEOLFR A tal fine ci soccor-
UHO¶DUWOFKHVRVWLHQHDOVXRVHFRQGRFRPPDFKH©QRQq
considerata pubblica la esecuzione, rappresentazione o recitazione
GHOO¶RSHUDHQWURODFHUFKLDRUGLQDULDGHOODIDPLJOLDGHOFRQYLWWRGHOOD
VFXRODRGHOO¶LVWLWXWRGi ricovero, purché non effettuata a scopo di lu-
cro» mentre al suo terzo comma aggiunge che «non è altresì conside-
UDWD SXEEOLFD O¶HVHFX]LRQH UDSSUHVHQWD]LRQH R UHFLWD]LRQH GHOO¶RSHUD
QHOO¶DPELWR QRUPDOH GHL FHQWUL VRFLDOL R GHJOL LVWLWXWL GL DVVLVWHQ]D
formalmente istituiti, nonché delle associazioni di volontariato, purché
destinata ai soli soci ed invitati e sempre che non venga effettuata a
scopo di lucro».
Per quanto riguarda, invece, gli obblighi del concessionario richia-
PLDPRO¶DUWGHOODO1941: al già citato obbligo di rappresen-
tazione senza aggiunte, tagli o variazioni non consentite va solo ag-
giunto che la mancata applicazione di tale norma comporta, a carico
GHO FRQFHVVLRQDULR O¶DWWULEX]LRQH GHOOD UHVSRQVDELOLWj FRQWUDWWXDOH
Come ricorGDWRGDOOD&RUWHG¶$SSHOORGL0LODQR©qPDQLIHVWRFKHGD
XQDDOWHUD]LRQHDUELWUDULDGHOFRQWHQXWRGHOO¶RSHUDSRVVDGHULYDUH>«@
anche un danno patrimoniale, quando le modificazioni, incidendo su
TXDOLWjLQWULQVHFKHGHOO¶RSHUDPHGHVLPDILQLVVHURFRQLOUHnderla me-
no gradita al pubblico, con conseguente inevitabile minore affluenza
di spettatori alle rappresentazioni».
IV. I contratti dello spettacolo: peculiarità e criticità 97

Secondo obbligo del concessionario è quello di «lasciare invigilare


ODUDSSUHVHQWD]LRQHGHOO¶DXWRUHªVSHFLDOPHQWHLQFDVRGLRSHUHQXRYH
in SULPDUDSSUHVHQWD]LRQHVLULFRQRVFHO¶LQWHUHVVHROWUHFKHGHOFRn-
FHVVLRQDULRDQFKHGHOO¶DXWRUHDFRQWUROODUHODUHDOL]]D]LRQHGHOO¶RSHUD
Ultimo obbligo a carico del concessionario, ex art. 138, a meno che
QRQYLVLDDFFRUGRFRQO¶DXWRUHqTXHOORFKH lo impegna a non mutare,
VHQRQSHUJUDYLPRWLYLLSULQFLSDOLLQWHUSUHWLGHOO¶RSHUDHLGLUHWWRULGL
orchestra e dei cori.
/¶HVHFX]LRQHGDSDUWHGHJOLLQWHUSUHWLqHOHPHQWRIRQGDPHQWDOHGHl-
OD UDSSUHVHQWD]LRQH LQ SXEEOLFR GL XQ¶RSHUD DQFKH VH O¶DWWLYLWj
GHOO¶LQWHUSUHWHRHVHFXWRUHHVSUHVVLRQHLQRJQLFDVRGLODYRURLQWHOOHt-
WXDOH QRQ SXz GHILQLUVL HTXLSDUDELOH DOO¶DWWLYLWj DXWRUDOH O¶LQWHUSUHWH
Gj XQ DSSRUWR VX XQ¶RSHUDFRPSLXWD SRQHQGRVL FRPH DQHOOR GL FRn-
giunzione tra autore e pubblico e se ciò non aFFDGHVVHO¶RSHUDVDUHEEH
ugualmente compiuta e con una vita propria; in caso contrario,
O¶LQWHUSUHWH VDUHEEH GD FRQVLGHUDUVL XQ FRDXWRUH GHOO¶RSHUD H QRQ XQ
semplice interprete.
&RQ ULJXDUGR DOO¶HVHFX]LRQH VFDGHQWH GHOO¶RSHUD YD SUHFLVDWR FKH
non pone in essere, in sé, una violazione del diritto morale ex art. 20
della l. 633/1941, salvo che non si rechi pregiudizio alla reputazione
GHOO¶DXWRUHPDSRVVLDPRIDUULIHULPHQWRDOOHQRUPHFLYLOLVWLFKHUHODWi-
YH DOO¶DGHPSLPHQWR GHOOH REEOLJD]LRQL LQQDQ]LWXWWR va fatto riferi-
PHQWRDOODGLOLJHQ]DQHOO¶DGHPSLPHQWR ex art. 1176 cod. civ., che va
inteso come impegno adeguato di energia e mezzi per il soddisfaci-
mento del creditore della prestazione. In mancanza, ex art. 1218 cod.
civ., si può configurare la responsabilità contrattuale, per cui «il debi-
tore che non esegue correttamente la prestazione dovuta è tenuto al ri-
VDUFLPHQWRGHOGDQQRVHQRQSURYDFKHO¶LQDGHPSLPHQWRRLOULWDUGRq
stato determinato da impossibilità della prestazione derivante da causa
a lui non addebitabile».
6HPSUHLQWHPDGLUDSSUHVHQWD]LRQHGHOO¶RSHUDqLOFDVRGLGDUFRn-
WR DQFKH GHOOH FODXVROH ULVROXWLYH QHO FDVR LQ FXL O¶RSHUD QRQ YHQJD
portata in scena: qualora la mancata rappresentazione dipenda da cau-
se di forza maggiore, il contratto si considererà risolto a meno che la
rappresentazione non possa essere effettuata altrove. In caso contrario,
cioè qualora non siano motivi di forza maggiore ad impedire la rap-
presentazione, ed in mancanza di una espressa previsione contrattuale,
98 Manuale di diritto delle arti e dello spettacolo

è possibile individuare una responsabilità contrattuale del teatro per


PDQFDWRDGHPSLPHQWRGHOO¶REEOLJRGLSRUWDUHLQVFHQDO¶RSHUDSUHYi-
sta.

4.5.2. &RPPHUFLDOL]]D]LRQHGHOO¶RSHUDFLQHPDWRJUDILFD

La cessione, nella disciplina italiana, non ha termine di durata, ma


VXVVLVWRQRIRUWLOLPLWD]LRQLTXDORUDLOVRJJHWWRVLDXQ¶RSHUDJLjSXEEOi-
FDWD SHU OH VWDPSH QRUPDOPHQWH LQ WDO FDVR O¶HGLWRUH DYUj DFTXLVLWR
anche i cc.dd. diritti secondari, finalizzati alla realizzazione ed alla
FRPPHUFLDOL]]D]LRQH GHOO¶HGL]LRQH SHU le stampe. Ne consegue che
colui che vorrà acquisire un soggetto edito ± ergo il produttore cine-
matografico ± FRQWUDWWHUj VLD FRQ O¶DXWRUH FKH FRQ O¶HGLWRUH 4XDQGR
XQ¶RSHUDOHWWHUDULDKDVXFFHVVRGLSXEEOLFRDXWRPDWLFDPHQWHGLYLHQH
LQWHUHVVDQWHSHUO¶LQdustria cinematografica che avrà interesse a sfrut-
tarne la popolarità.
/¶DUWOVWDELOLVFHFKHO¶HVHUFL]LRGHLGLULWWLGLXWLOLz-
zazione economica ha per oggetto lo sfruttamento cinematografico
GHOO¶RSHUDSURGRWWDFRVWLWXHQGRFRVuXQDVRUWDdi monopolio legale sui
diritti di utilizzazione. Le maggiori possibilità di sfruttamento delle
RSHUHFLQHPDWRJUDILFKHQRQFRUULVSRQGRQRDGXQ¶DGHJXDWDLQQRYD]Lo-
ne legislativa: nonostante sforzi continui di dottrina e giurisprudenza
per provare ad adeguare una norma superata a nuove condizioni,
O¶XQLFRFRPSRUWDPHQWRFKHLQVHGHFRQWUDWWXDOHSDUHDGHJXDWRqTXHOOR
di prevedere esplicitamente quali siano le forme di sfruttamento del
film per le quali si intende acquistare i diritti.
Il soggetto di un film puzGLVFHQGHUHVLDGDXQ¶RSHUDHVLVWHQWHVLD
HVVHUHDSSRVLWDPHQWHFUHDWRQHOO¶DWWRGLFHVVLRQHGHLGLULWWLVXOVRJJHt-
to il produttore cinematografico si assicura tutti i diritti necessari alla
realizzazione del film ed al suo sfruttamento in ogni possibilità, maga-
ri in varie lingue per sfruttare mercati diversi, o per generare versioni
multimediali, spin off o sequel.
La sceneggiatura (altrimenti definito anche script) del film è lo
strumento necessario a dettagliare quanto descritto nel soggetto: lo
sceneggiatore è titolare dei diritti esclusivi sulla sceneggiatura, opera
che per legge è comunque da tutelare, anche se la sua unica forma di
sfruttamento è il film in senso stretto.
IV. I contratti dello spettacolo: peculiarità e criticità 99

6XOWHPDqEHQHULFKLDPDUHO¶DUWOFKHVWDELOLVFHFKH
«se il SURGXWWRUHQRQSRUWDDFRPSLPHQWRO¶RSHUDFLQHPDWRJUDILFDQHO
termine di tre anni dal giorno della consegna della parte letteraria o
PXVLFDOHRQRQIDSURLHWWDUHO¶RSHUDFRPSLXWDHQWURWUHDQQLGDOFRm-
pimento, gli autori di dette parti hanno diritto di disporre liberamente
GHOO¶RSHUDVWHVVDª3HUFRPSUHQGHUHDGHJXDWDPHQWHTXHVWDGLVSRVL]Lo-
QHYDULFRUGDWRO¶DUWFKHGLVWLQJXHHVSOLFLWDPHQWHO¶DXWRUHGHOVRg-
JHWWRGDOO¶DXWRUHGHOODVFHQHJJLDWXUDFRQVLGHUDQGROLFRPHGXHFRQWUi-
buti diversi: posto questo, occorre capire a quale dei due contributi,
QHOO¶DUWFLVLULIHULVFDYLVWRFKHODQRUPDQRQORHVSOLFLWD/DORJi-
ca da applicare a questa differenza viene ravvisata nel fatto che il sog-
JHWWRFRPHG¶DOWURQGHLOFRQWULEXWRPXVLFDOHSXzHVVHUHSHUIHWWDPen-
te autonomo rispetto al restante contesto del film di cui sono parte,
mentre la sceneggiatura è un collegamento imprescindibile dal sogget-
to.
2JJLQRQqUDURLOFDVRLQFXLVLSDVVLGLUHWWDPHQWHGDOO¶RSHUDOHWWe-
raria alla sceneggiatura, saltando la fase di scrittura del soggetto e
riassumendo parzialmente il contributo tipico del soggettista.

4.6. Il management: profili negoziali

Il mondo dello spettacolo presenta molteplici caratteristiche, talvolta


atipiche: per questo è opportuno qui menzionare anche i contratti che
UHJRODPHQWDQRWXWWHOHDWWLYLWjGHJOLDUWLVWL'¶DOWURFDQWRO¶DWWLYLWjSUo-
fessionale, la gestione economica nei confronti dei soggetti terzi e gli
stessi contratti degli artisti da noi analizzati in questa sede sono spesso
gestiti e sWLSXODWLGDPDQDJHUO¶DSSDUL]LRQHGLXQFDQWDQWHLQXQDWUa-
VPLVVLRQH WHOHYLVLYD LQYHFH FKH LQ XQ¶DOWUD XQ VHUYL]LR IRWRJUDILFR R
XQ¶LQWHUYLVWDUHVDDGXQGHWHUPLQDWRJLRUQDOHVRQRHVHPSLFKHGLPo-
strano il forte impatto GHOO¶DWWLYLWjdei manager, non solo sotto il profi-
lo della gestione, ma anche sotto il profilo contrattuale. Questa realtà
giuridica coinvolge una notevole massa di interessi economici, e vale
la pena provare a schematizzarne gli aspetti formali più rilevanti.
Innanzitutto è opportuno chiarire quali siano gli obblighi del mana-
JHU YHUVR O¶DUWLVWDH i connessi profili civilistici. Senza dubbio è pre-
VHQWH O¶REEOLJR GL FXUDUH O¶LPPDJLQH GHOO¶DUWLVWD SURPXRYHQGROR H
100 Manuale di diritto delle arti e dello spettacolo

raccogliendo proposte contrattuali sulla sua attività. Il riferimento,


QHOO¶RUGLQDPHQWR FLYLOLVWLFR q DOO¶DUW  FRG FLY FKH IRUQLVFH OD
definizione di contratto di agenzia, statuendo che è quel contratto con
FXLXQDSDUWHDVVXPHVWDELOPHQWHO¶LQFDULFRGLSURPXRYHUHSHUFRQWR
GHOO¶DOWUD YHUVR UHWULEX]LRQH OD FRQFOXVLRQH GL FRntratti in una zona
determinata. Un compito analogo a quello descritto avviene allorché il
PDQDJHUVLDLQFDULFDWRGLFRPSLHUHDWWLJLXULGLFLSHUFRQWRGHOO¶DUWLVWD-
committente: in tal caso il riferimento alla disciplina del contratto di
mandato ± ex art. 1702 cod. civ. ± è evidente. In tal caso, il mandatario
si obbliga, verso compenso salvo patto contrario, a compiere uno o più
atti giuridici per conto del mandante. Il contratto può essere stipulato
con o senza rappresentanza: nel primo caso il mandatario agirà in no-
me e per conto del mandante, quindi gli effetti ricadranno direttamente
nella sfera giuridica del mandante, nel secondo caso il mandatario agi-
sce in nome proprio ma per conto del mandante.
È altresì opportuno ricordare, onde evitare di incorrere in equivoci,
che la definizione di agente si differenzia da quella di procacciatore
G¶DIIDUL TXHVW¶XOWLPR RSHUD LQ PRGR RFFDVLRQDOH H VHQ]D GLULWWR GL
esclusiva ± diritto che potrebbe essere pattuito nel contratto di agenzia
± e senza divenire un dipendeQWHGHOO¶LPSUHVDGDFXLULFHYHO¶LQFDULFR
né dovendone subire il potere direzionale.
Se il manager svolge anche attività di consulenza ± fornendo indi-
cazioni, consigli e suggerimenti per ottener successo ± si può richia-
PDUHVHQ]¶DOWURLOJLjFLWDWRFRQWUDWWRG¶RSHUDex art. 2222 cod. civ. che
± ribadiamo ± VLIRQGDVXOO¶intuitus personæ,OFRQWUDWWRG¶RSHUDqXQD
figura tipica ± ancorché residuale ± del rapporto di lavoro autonomo,
LQTXDQWRLOSUHVWDWRUHG¶RSHUDYHUVRXQSDJDPHQWRGLXQFRUULVSHWWi-
vo, cRPSLH©XQ¶RSHUDRXQVHUYL]LRFRQODYRURSUHYDOHQWHPHQWHSUo-
prio e senza vincolo di subordinazione nei confronti del committente».
Pare evidente che nello svolgimento di tali attività diviene preminente
il rapporto di fiducia tra artista e manager, il quale, peraltro, compirà
XQ¶DWWLYLWjGLQDWXUDLQWHOOHWWXDOH DOWURHOHPHQWRFDUDWWHUL]]DQWHLOFRn-
WUDWWRG¶RSHUD 
3HU TXDQWR ULJXDUGD LO FRPSHQVR GHOO¶DJHQWH ELVRJQD FKLHGHUVL VH
tale diritto sorga nel momento in cui viene concluso il contratto tra
O¶DUWLVWD HLOWHU]RRVROWDQWRQHOPRPHQWRLQFXLO¶DUWLVWDLQFDVVLHIIHt-
tivamente il suo compenso. Dottrina maggioritaria ritiene preferibile,
IV. I contratti dello spettacolo: peculiarità e criticità 101

laddove non vi sia espressa pattuizione, la seconda strada: la provvi-


gione a favore del manager, in genere, è ancorata al momento della
IDWWXUD]LRQH GD SDUWH GHOO¶DUWLVWD UDJLRQSHU FXL VL ULWLHQH FKH VRORLQ
questo momento sorga il diritto a ricevere il compenso in capo al ma-
nager.
/¶LVWLWXWRGHOO¶HVFOXVLYDqXQHOHPHQWRQDWXUDOHPDQRQHVVHQ]LDOH
del contratto di agenzia, ed è previsto dalla disciplina civilistica
QHOO¶DUW  FRG FLY FKH VDQFLVFH FKH GL UHJROD FLRq VDOYR SDWWR
contrario, «il preponente non può valersi contemporaneamente di più
DJHQWLQHOODVWHVVD]RQDHSHUORVWHVVRUDPRGLDWWLYLWjQpO¶DJHQWHSuò
DVVXPHUHO¶LQFDULFRGLWUDWWDUHQHOODVWHVVD]RQDHSHUORVWHVVRUDPRJOL
affari di più imprese in concorrenza tra loro».
'LVFRUVRDSDUWHqTXHOORGHOO¶LQWHUPHGLD]LRQHGLPDQRGRSHUDJe-
QHUDOPHQWHODPHGLD]LRQHDYYLHQHSHUIDYRULUHO¶LQFRQWURWUDGRPDnda
HRIIHUWDGLODYRUR/¶DUWOVXOO¶DYYLDPHQWRDOODYRURKD
YLHWDWRO¶HVHUFL]LRGHOODPHGLD]LRQHDQFKHJUDWXLWDQHOFROORFDPHQWR
qLOOHFLWDHVDQ]LRQDWDSHQDOPHQWHO¶DWWLYLWjGLLQWHUPHGLD]LRQHSHULn-
serire gli artisti alle dipendenze altrui. La giurisprudenza di merito,
DOPHQRFRQULIHULPHQWRDOO¶DWWLYLWjGLDWWRUHFLQHPDWRJUDILFRSDUWHQGR
GDO SUHVXSSRVWR FKH O¶DUWLVWD GHEED HVVHUH FRQVLGHUDWR ODYRUDWRUH Vu-
bordinato, ha dichiarato nulla la mediazione per illiceità della causa
per contrarietà alla legge.
Peraltro tale orientamento è stato duramente contestato, specie alla
luce della c.d. «sentenza delle indossatrici» resa dalla Pretura di Mila-
no il 29 aprile 1988. Alcune case di moda si erano avvalse
GHOO¶LQWHUPHGLD]LRQHGLXQDDJHQ]ia privata e la sentenza esclude che
il rapporto di lavoro abbia natura subordinata, con la conseguenza che
QRQRSHUDLOGLYLHWRGLFXLVRSUD/¶LPSRUWDQ]DGLTXHVWDSURQXQFLDVWD
nel fatto che rende evidente la possibilità di considerare o escludere la
violazione della l. 264/1949 solo dopo un esame concreto del rapporto
ODYRUDWLYRIDYRULWRGDOO¶DJHQ]LD/DQXOOLWjGHOUDSSRUWRGLDJHQ]LDUi-
correrà solo nel caso in cui i contratti conclusi saranno di natura su-
ERUGLQDWDPHQWUHO¶DWWLYLWjGLQDWXUDDXWRQRPD, comunque prevalente,
non subirà alcun tipo di sanzione.
Capitolo V

Il rapporto di lavoro nello spettacolo


di FEDERICA FIORE

5.1. Introduzione

/¶DQDOLVL GHOOH SHFXOLDULWj GHO ODYRUR QHOOR VSHWWDFROR GHYH


necessariamente partire dalla delimitazLRQH GHO FDPSR G¶LQGDJLQH H
precisamente, dal tentativo di individuare e selezionare tanto la
tipologia di prestazione a cui ci si riferisce quanto la categoria dei
lavoratori destinatari della disciplina speciale. La fitta ed intricata
trama di fonti normative, unitamente alla mancanza di una
GLVSRVL]LRQH JHQHUDOH GL QDWXUD GHILQLWRULD HG DOO¶LQWULQVHFD GLIILFROWj
di desumere elementi integrativi di chiarificazione dalla prassi
quotidiana, rendono il compito di interpreti e operatori
particolarmente difficile.
Ad un primo tentativo rivolto ad inquadrare nel tessuto
RUGLQDPHQWDOH LO ODYRUR QHO PRQGR GHOOR VSHWWDFROR H GHOO¶LQGXVWULD
GHOO¶LQWUDWWHQLPHQWRFL VL LPEDWWH LQ XQD FRPSDJLQH OHJLVODWLYD PROWR
settoriale, tale da indurre il fondato sospetto che in materia manchi un
sistema organico di norme, capace di regolamentare con principi
chiari ed uniformi i vari aspetti del fenomeno in esame.
Ciò è tanto più vero se si circoscrive, come nelle intenzioni di chi
scrive, il campo della ricerca al più ristretto ambito del rapporto di
lavoro artistico, dal momento che la produzione legislativa in materia
ha privilegiato e regolamentato con interventi puntuali, e non
sistematici, aspetti e problematiche specifici.
Infatti, mentre la dottrina ha finora trascurato di occuparsi di questa

103
104 Manuale di diritto delle arti e dello spettacolo

WHPDWLFD QHOO¶RWWLFD GL XQ¶DPSLD GLVFLSOLQD RUJDQLFD GHOOD PDWHULD H


ha appuntato il proprio interesse solo verso la qualificazione di
particolari, seppur diffuse, attività inerenti il lavoro artistico (ad
esempio: attori, cantanti, GLUHWWRUL G¶RUFKHVWUD  RYYHUR YHUVR DOFXQL
profili caratterizzanti della disciplina previdenziale, il legislatore ha
optato per un approccio eminentemente casistico, preferendo
enumerare una serie di figure professionali al fine di sottoporre coloro
che svolgono le attività ivi indicate, purché esse si espletino nel
VHWWRUHGHOORVSHWWDFRORDOO¶REEOLJRFRQWULEXWLYRQHLFRQIURQWLGHOO¶H[
ENPALS.
In un contesto in continua evoluzione un ruolo di primo piano
QHOO¶HODERUD]LRQH GL XQD QR]LRQH FKLDYH SHU O¶DSSOicazione dello
statuto particolare, specie previdenziale, è stato svolto invece
GDOO¶HUPHQHXWLFDGHOOHFRUWL6RSUDWWXWWRDSDUWLUHGDJOLLQL]LGHJOLDQQL
Novanta la qualità di lavoratori dello spettacolo è stata attribuita a
coloro che «stabilmente e professionalmente, ancorché con compiti
ausiliari, sono impegnati nella realizzazione di manifestazioni che
hanno propriamente il fine di rappresentare un testo letterario o
musicale o un evento visivo, con personale abilità degli interpreti,
rivolta a provocare il divertimento, in senso culturalmente ampio,
degli spettatori» (Cass. Civ., Sez. Lav., sentenza 29 agosto 2002, n.
12691).
/¶HYROX]LRQHVRFLDOHWHQGHRJJLDFDUDWWHUL]]DUHORVSHWWDFRORFRPH
qualsiasi forma di manifestazione la quale si sviluppi ed abbia luogo
dinanzi ad un determinato pubblico oppure con una qualche modalità
di concorso o di compartecipazione di esso favorita da moderni mezzi
di comunicazione; esso tende a caratterizzarsi come pubblico
intrattenimento, vale a dire come attività a carattere visivo o sonoro e
comunque basato sulla finzione scenica (teatro, cinema, radio,
WHOHYLVLRQH PXVLFD GDQ]D  RYYHUR GL JLRFR DG HVHPSLR O¶DWWLYLWj
calcistica). È importante allora sottolineare come dallo slittamento
della nozione di spettacolo verso un concetto sempre più ampio
consegua che anche ai lavoratori che non hanno un diretto contatto
con il pubblico (ad esempio, perché prestano la loro attività nelle sale
di registrazione) dovrebbe essere riconosciuto lo status di lavoratori
dello spettacolo.
Sul punto né la dottrina né la contrattazione collettiva peraltro
V. Il rapporto di lavoro nello spettacolo 105

forniscono un contributo chiarificatore ricalcando spesso espressioni


desunte dalla disciplina previdenziale ovvero mutuate dalla
stratificazione delle massime della giurisprudenza.
La questione presenta dunque caratteri di notevole complessità
poiché si tratta di individuare una categoria di lavoratori in un
contesto socio-economico sicuramente molto diverso rispetto a quello
avuto di mira dal legislatore del 1947, anno del primo significativo
intervento in materia, e nel quale «si assiste ad una ipertrofia dello
spettacolo, che, soprattutto tramite la diffusione della televisione,
tende ad insediarsi nelle sedi più disparate».

 /D SUHVWD]LRQH DUWLVWLFD QHOO¶DPELWR GHL UDSSRUWL VSHFiali di


lavoro

In via preliminare è necessario meglio specificare cosa si intenda per


prestazione artistica e come nel tempo si sia giunti alla attuale
regolamentazione.
,Q SDUWLFRODUH FRQ VSHFLILFR ULIHULPHQWR DOO¶HOHQFD]LRQH GL FXL
DOO¶DUW  GHOOD OHJge 8 gennaio 1979, n. 8, che si riferisce a registi,
VFHQRJUDIL FDQWDQWL GLUHWWRUL G¶RUFKHVWUD FRQFHUWLVWL FRUHRJUDIL H
ballerini solisti, la prestazione consiste in una attività che origina dal
senso artistico e dalla tecnica individuale propria e tipLFDGHOO¶DUWLVWD
/¶RSHUDDUWLVWLFDULVXOWDLQIDWWLFDUDWWHUL]]DWDGDDOFXQLWUDWWLSHFXOLDUL
non direttamente riconducibili né alle professioni intellettuali né alle
mere prestazioni fisiche che, nel tempo, non hanno agevolato
O¶LQTXDGUDPHQWR GHOOD SUHVWazione nei due tipici schemi contrattuali
del rapporto di lavoro autonomo e del rapporto di lavoro subordinato.
1HOO¶DUWLFRODWDHYROX]LRQHVWRULFDFKHKDFRQGRWWRDOODSURJUHVVLYD
GHILQL]LRQHGHOO¶DWWXDOHFRQIRUPD]LRQHGHOODGLVFLSOLQDGHOGLULWWRGHOOR
spettacolo frutto di un lungo e controverso dibattito sia dottrinale che
JLXULVSUXGHQ]LDOH DSSDUH RSSRUWXQR SRUUH O¶DWWHQ]LRQH VX GXH
significativi interventi del legislatore.
Il primo intervento legislativo nel settore previdenziale degli artisti
risale al 1947 ed è costituito dal d.lgs. C.P.S. n. 708, che trasformò la
Cassa nazionale di assistenza lavoratori dello spettacolo, istituita con
contratto collettivo nel 1934, in Ente nazionale di previdenza e
106 Manuale di diritto delle arti e dello spettacolo

assistenza per i lavoratori dello spettacolo, ENPALS. Questo ente


pubblico fu regolato con il d.P.R. n. 26 del 5 gennaio 1950 e
VXFFHVVLYDPHQWHQHOO¶DQQRTXDQGRIXSURPXOJDWDODSULPDOHJJH
di riforma organica delle attività musicali: la legge 14 agosto 1967, n.
 4XHVW¶XOWLPR WHVWR QRUPDWLYR QRWR come legge Corona,
disciplinò gli enti musicali del settore dello spettacolo, e cioè gli enti
lirici, i teatri di tradizione, le istituzioni concertistiche orchestrali, le
associazioni concertistiche, ecc., le modalità di erogazione dei
finanziamenti statali e soprattutto introdusse la disciplina del
collocamento dei lavoratori dello spettacolo. Tale importante riforma
SUHQGHYDDWWRGHOODIRQGDPHQWDOHIXQ]LRQHVRFLDOHFKHO¶DWWLYLWjOLULFD
H FRQFHUWLVWLFD VYROJH FRVWLWX]LRQDOPHQWH ULFRQRVFLXWD DOO¶DUW  Fhe
OHWWHUDOPHQWH UHFLWD ³/D 5HSXEEOLFD SURPXRYH OR VYLOXSSR GHOOD
cultura e la ricerca scientifica e tecnica. Tutela il paesaggio e il
SDWULPRQLRVWRULFRHDUWLVWLFRGHOOD1D]LRQH´
Nonostante i successivi interventi di riforma della legge Corona
che hanno inciso sul momento costitutivo del rapporto di lavoro, sulla
natura dei rapporti di lavoro e sulla tutela previdenziale del lavoratore
artista, in nessun caso il legislatore ha tentato però di dare una
definizione precisa di prestazione artistica.
In dottrina vi è chi con argomentazioni sufficientemente
convincenti suggerisce di far coincidere la definizione di prestazione
artistica con quella di esibizione di contenuto tecnico-artistico
finalizzata ad interpretare o rappresentare un determinato testo
letterario o musicale originario o derivato ed idonea a rendere una
funzione di educazione, diffusione o anche divertimento del pubblico
a cui si rivolge. Tuttavia tale concezione, sicuramente valida in
UHOD]LRQH DOO¶DWWLYLWj SURGXWWLYD GHOO¶DUWLVWD QHO VXR Pomento
intimistico si rivela incapace di definire i connotati del lavoro
artistico. Ciò che viene dedotto infatti nel rapporto di lavoro, anche ai
ILQL GHOO¶HVHUFL]LR GHO SRWHUH GLUHWWLYR GHO GDWRUH QRQ q O¶DWWLYLWj
interiore di interpretazione o di ispirD]LRQHSURSULDGHOO¶DUWLVWDTXDQWR
O¶HVHFX]LRQH R DWWLYLWj LQWHUSUHWDWLYD FKH VL HVWULQVHFD LQ XQ
determinato comportamento e che si inserisce in un contesto
aziendale.
Va infine qui ribadito che il lavoro artistico non può che essere
considerato un segmento del lavoro nello spettacolo che lo compone e
V. Il rapporto di lavoro nello spettacolo 107

caratterizza ma non lo esaurisce e questo sia perché esistono forme di


lavoro artistico non interpretative ma creative non indirizzate ad un
pubblico spettacolo (ad esempio, un pittore) sia perché la categoria di
lavoratori dello spettacolo accoglie anche professionalità che non
presentano i tratti del lavoro artistico. Non può essere considerato
artista ad esempio chi svolge un lavoro tecnico professionale nel
generico campo dello spettacolo eppure la disciplina contrattuale
DSSOLFDWD ULFDGH QHOO¶DPELWR GHO ODYRUR QHOOR VSHWWDFROR SHU OD
funzionalità della prestazione ad un complesso aziendale volto alla
produzione di eventi spettacolari.

5.3. I contratti di lavoro nello spettacolo tra autonomia,


subordinazione e parasubordinazione

Nel mondo dello spettacolo i rapporti di lavoro assumono


FDUDWWHULVWLFKH SHFXOLDUL SRLFKp DFFDQWR VXOO¶DSSOLFD]LRQH GL QRUPH
regolatrici delle varie tipologie contrattuali si innestano non poche
specificità legate alla natura del lavoro artistico.
Le parti del rapporto sono un datore di lavoro, tra cui a titolo
esemplificativo le fondazioni lirico-sinfoniche, i teatri, le compagnie
di prosa, le orchestre, le case di produzione ecc., e il lavoratore. Anche
nel mondo dello spettacolo è imprenditore colui che esercita
SURIHVVLRQDOPHQWH XQ¶DWWLYLWj HFRQRPLFD RUJDQL]]DWD YROWD DOOD
produzione di servizi e che assume personale artistico e tecnico per la
preparazione e produzione di spettacoli, sono invece semplici datori di
lavoro ma non imprenditori coloro che non pongono in essere
XQ¶DWWLYLWj HFRQRPLFD RUJDQL]]DWD R FKH QRQ OD VYROJRQR LQ PDQLHUD
professionale. Lavoratore è chi direttamente, indirettamente o
mediatamente fornisce il proprio contributo ad una rappresentazione
artistica.
Vale anche in tale contesto il principio di autonomia contrattuale
che affida alla parti il potere di disciplinare nelle forme più adeguate
la natura del vincolo lavorativo posto in essere. Occorre pertanto
fugare ogni dubbio in merito alla natura del contratto di lavoro nello
spettacolo chiarendo che tutti i rapporti di lavoro in questo ambito
possono essere regolati con contratti di tipo subordinato, autonomo e
108 Manuale di diritto delle arti e dello spettacolo

parasubordinato. Sono le parti a scegliere il modello contrattuale che


sia maggiormente idoneo a soddisfare pienamente i loro interessi.
In particolare, dottrina e giurisprudenza si sono soffermate ad
individuare nel tempo diversi criteri discriminanti in grado di rivelare
la sussistenza o meno del nesso di dipendenza tra datore di lavoro e
lavoratore, talvolta ricorrendo ai parametri quali ad esempio la
FROODERUD]LRQH OD FRQWLQXLWj GHOOD SUHVWD]LRQH O¶RUDULR GL ODYRUR OD
SHULRGLFLWj GHOOD UHWULEX]LRQH O¶DVVHQ]D GL XQD SURSULD VWUXWWXUD
G¶LPSUHVD LQ FDSR DO ODYRUDWRUH WDODOWUD DFFHQWXDQGR FRPH Hlemento
WLSL]]DQWHO¶DXWRQRPLDGHOUDSSRUWRGLODYRURO¶LQWHUHVVHDOODQRWRULHWj
GHOO¶DUWLVWD FKH VL WUDVIRQGHUHEEH DXWRPDWLFDPHQWH QHOOD VWUXWWXUD GHO
PHGHVLPR DWWULEXHQGR DOO¶DUWLVWD XQ GLULWWR DOO¶HVHFX]LRQH GHOOD
prestazione rendendolo compartecipe del rischio del buon esito della
SHUIRUPDQFHHGXQTXHGHOULVFKLRG¶LPSUHVD
Tuttavia la giurisprudenza non ha colto tali elementi di specialità e
ha piuttosto ripiegato nella tradizionale ricerca degli indici di
VXERUGLQD]LRQH YDORUL]]DQGR D WDOL ILQL O¶LQVerimento
QHOO¶RUJDQL]]D]LRQH D]LHQGDOH GHO GDWRUH GL ODYRUR LQ SDUWLFRODUH
quando si tratti di prestazioni scarsamente creative.
Pertanto ciò che ad oggi rileva ai fini della corretta individuazione
della natura contrattuale è che il rapporto realizzato nella pratica sia
rispondente alle finalità proprie dello strumento prescelto, al fine di
evitare che un uso improprio determini abusi che in sede contenziosa
possono tradursi nel riconoscimento di un rapporto di lavoro
subordinato a tempo indeterminato con conseguente applicazione
delle connesse tutele legali e contrattuali.
In linea astratta dunque non esistono preclusioni di forma legate al
contenuto della prestazione ma piuttosto esse dipendono dalle
concrete modalità di svolgimento della stessa. E, infatti,
giurisprudenza consolidata da tempo afferma che ogni attività umana
economicamente rilevante può essere espletata nelle forme del
rapporto di lavoro subordinato ovvero di quello autonomo, in
relazione alla scelta liberamente compiuta dalle parti, sicché ai fini
GHOOD TXDOLILFD]LRQH q QHFHVVDULR SURFHGHUH DOO¶LQGLYLGXD]LRQH GHOOD
comune intenzione delle parti onde accertare se esse hanno voluto
O¶LQVHULPHQWRGHOSUHVWDWRUHGLODYRURQHOO¶RUJDQL]]D]LRQHGHOGDWRUHGL
lavoro con conseguente assoggettamento del primo al potere
V. Il rapporto di lavoro nello spettacolo 109

organizzativo, direttivo e disciplinare del secondo. Tale situazione,


LQIDWWL UDSSUHVHQWD O¶HOHPHQWR FDUDWWHULVWLFR GHO UDSSRUWR GL ODYRUR
subordinato. Peraltro, la valutazione degli elementi di fatto idonei nel
caso concreto a ricondXUUHLOUDSSRUWRQHOO¶DPELWRGHOO¶XQRRGHOO¶DOWUR
dei due predetti schemi contrattuali è riservata al giudice di merito,
rimanendo censurabile in sede di legittimità solo la violazione dei
generali ed astratti criteri distintivi.
6HQ]¶DOWURTXLQGLDQFKH le prestazioni artistiche possono dar luogo
a rapporti di natura subordinata. Infatti, non è il tipo di attività o la
natura del datore di lavoro che determina la scelta della tipologia
contrattuale, ma le modalità con cui le attività vengono svolte.
Neppure è determinante il nomen juris, ovvero la qualificazione
formale che le parti hanno attribuito al rapporto, bensì assume valore
decisivo il suo concreto atteggiarsi, cioè le modalità di svolgimento.

5.4. Il lavoro subordinato

/¶DUWFRGFLYGLspone che è prestatore di lavoro subordinato chi


VLREEOLJDPHGLDQWHUHWULEX]LRQHDFROODERUDUHQHOO¶LPSUHVDSUHVWDQGR
il proprio lavoro intellettuale e manuale alle dipendenze e sotto la
GLUH]LRQHGHOO¶LPSUHQGLWRUH.
Nel rapporto di lavoro subordinato il lavoratore si obbliga a
prestare la propria opera alle dipendenze e sotto la direzione del
proprio datore di lavoro in cambio di una determinata retribuzione,
che può essere liberamente stabilita dalle parti ma, in ogni caso, non
inferiore ai minimi stabiliti dai contratti collettivi nazionali di lavoro
(CCNL).
/¶HOHPHQWRFKHFRQWUDGGLVWLQJXHLOODYRURVXERUGLQDWRSHUWDQWRq
O¶DVVRJJHWWDPHQWR GHO ODYRUDWRUH DO SRWHUH GLUHWWLYR RUJDQL]]DWLYR H
JHUDUFKLFR GHO GDWRUH GL ODYRUR FKH VL HVSOLFD QHOO¶HPDQD]LRQe di
RUGLQL VSHFLILFL ROWUH FKH QHOO¶HVHUFL]LR GL XQD DVVLGXD DWWLYLWj GL
YLJLODQ]D H FRQWUROOR VXOO¶HVHFX]LRQH GHOOD SUHVWD]LRQH ODYRUDWLYD
3URSULRSHUODGLIILFROWjGLUDYYLVDUHO¶HOHPHQWRGHOODVXERUGLQD]LRQH
la giurisprudenza ha identificato una serie di indici che, se riscontrati,
sono rilevatori della natura subordinata, pur dovendo essere apprezzati
nel complesso del rapporto di lavoro e, in particolare, delle sue
110 Manuale di diritto delle arti e dello spettacolo

concrete modalità di esecuzione. Per cui se un lavoratore è tenuto ad


osservare un orario fisso non è detto che sia necessariamente
subordinato, assumendo tale elemento natura sussidiaria e non
GHFLVLYDPD VH ROWUH DO ULVSHWWR GHOO¶RUDULR GL ODYRUR ULFHYH SUHFLVH
direttive sulle modalità di svolgimento della prestazione ed è soggetto
al potere di controllo e disciplinare del datore di lavoro, che si esplica
in ordini continui, dettagliati e vincolanti allora sarà difficilmente
contestabile la natura subordinata.

5.4.1. Il contratto a termine

Premesso che nel nostro ordinamento la forma comune di un rapporto


di lavoro subordinato dovrebbe essere a tempo indeterminato, le parti
possono apporre un termine iniziale alla durata del contratto a
condizione che sussistano determinate ragioni di carattere tecnico,
produttivo, organizzativo o sostLWXWLYR DQFKH ULIHULELOL DOO¶RUGLQDULD
attività del datore di lavoro.
1HOO¶DPELWR GL WDOH SUHYLVLRQH ULHQWUDQR WXWWH TXHOOH VLWXD]LRQL GL
natura temporanea (quantomeno che siano tali al momento della
stipula del contratto) che determinano la necessità di forza lavoro per
un periodo limitato onde far fronte, ad esempio, a particolari situazioni
di mercato.
A tal riguardo, e con riferimento al settore propriamente artistico, è
VWDWRSUHFLVDWRFKH³che la stipulazione di un contratto a termine per la
produzione di un singolo spettacolo o per una o più stagioni teatrali o
liriche ± eventi destinati ad esaurirsi in un arco temporale determinato
o comunque determinabile ± costituisca una valida ragione di tipo
RUJDQL]]DWLYR R SURGXWWLYR OHJLWWLPDQWH O¶DSSRVL]LRQH del termine
pattuito, ex art. 1, comma 2, d.lgs. n. 368/2001; ciò anche a
SUHVFLQGHUHGDXQDVSHFLILFDSUHYLVLRQHGHOOHFRQWUDWWD]LRQHFROOHWWLYD´
(Cass. Civ., Sez. Lav., sentenza 25 settembre 2008, n. 24049).
Le ragioni, in ogni caso devono essere specificatamente indicate
SHU LVFULWWR FRVu FRPH O¶LQGLFD]LRQH GHO WHUPLQH D SHQD GL
trasformazione del rapporto da tempo determinato a indeterminato.
La l. 92/2012, c.d. riforma Fornero, ha introdotto la possibilità di
poter stipulare contratti acausali. Per i contratti stipulati a decorrere
GDOPDU]RYLHQHPHQRO¶REEOLJRGLVSHFLILFDUHODFDXVDOHGHO
V. Il rapporto di lavoro nello spettacolo 111

ricorso, prima prevista unicamente per il primo rapporto di lavoro tra


datore di lavoro e lavoratore.
Il contratto acausale ± comprensivo di rinnovi e proroghe ± non
può superare i 36 mesi di durata. Resta ferma la disposizione di cui
DOO¶DUW  FRPPD  bis, d.lgs. 368/2001, che consente alle parti ±
raggiunto il limite dei 36 mesi ± di stipulare un ulteriore successivo
contratto a termine, a condizione che la stipula avvenga presso la
GLUH]LRQHWHUULWRULDOHGLODYRUR '7/ FRPSHWHQWHHFRQO¶DVVLVWHQ]DGL
un rappresentante delle organizzazioni sindacali comparativamente
rappresentative a livello nazionale. È comunque vietato assumere con
contratto a termine per la sostituzione di lavoratori che esercitano il
diritto di sciopero.
La legge fissa al 20% del personale assunto a tempo indeterminato
LQIRU]DDOƒJHQQDLRGHOO¶DQQRGLDVVXQ]LRQHLOQXPHURFRPSOHVVLYR
di contratti a tempo determinato stipulati da ciascun datore di lavoro.
Restano ferme le diverse disposizioni della contrattazione collettiva.
Per i datori di lavoro che occupano fino a cinque dipendenti è sempre
possibile stipulare un contratto di lavoro a tempo determinato. Aspetto
molto rilevante della disciplina del contratto a termine concerne la
riassunzione. Le legge impone il rispetto di determinati intervalli
temporali a pena di conversione in contratto a tempo indeterminato.
In generale tali termini sono di 60 e 90 giorni a seconda che il
contratto a termine scaduto abbia avuto una durata superiore o
inferiore a 6 mesi.
È prevista comunque una deroga, 20 e 30 giorni, per le attività
stagionali definite dalla legge o individuate da avvisi comuni o dai
CCNL stipulati dalle Organizzazioni sindacali e associazioni datoriali
comparativamente più rappresentativi. Pertanto, allo stato, anche in
assenza di una previsione contrattuale, i termini ridotti si applicano
per le attività di preparazione e produzione di spettacoli per il
personale non menzionaWR QHOOD OHWWHUD H  GHOO¶DUW  GHOOD OHJJH 
aprile 1962, n. 230, addetto a singoli spettacoli o serie di spettacoli
consecutivi di durata prestabilita.
La legge prevede anche una durata massima dei contratti di lavoro
a termine stipulabili, 36 mesi, comprensive di proroghe e rinnovi.
Anche in questo caso, inoltre, la legge consente una deroga per le
attività stagionali come sopra indicate e per quelle indicate dalla
112 Manuale di diritto delle arti e dello spettacolo

contrattazione collettiva.

5.4.2. Il contratto di lavoro intermittente

Con la stipulazione di contratto intermittente (c.d. lavoro a chiamata)


il lavoratore si rende disponibile allo svolgimento della prestazione su
chiamata del datore di lavoro il quale, pur nel rispetto dei limiti e con
le modalità prescritte dalla legge, può liberamente decidere se e
quando procedere.
Tale tipologia, introdotta dalla legge Biagi, è stata oggetto di
contraddittori interventi da parte del legislatore ed oggi, anche a
seguito delle modifiche di cui alla legge Fornero, è legittimamente
utilizzabile solo in relazione a ipotesi definite. La prima riguarda le
prestazioni di carattere discontinuo o intermittente. Al fine di dare
concretezza a tale definizione, la legge ha demandato alla
contrattazione collettiva il compito di definire le esigenze che
legittimano il ricorso al lavoro intermittente, ivi comprese
O¶LQGLFD]LRQH GHL SHULRGL LQ FXL OD SUHVWD]LRQH SXz HVVHUH VYROWD $
IURQWH SHUz GHOO¶LQHU]LD PRVWUDWD GDOOH SDUWL VRFLDOL LO 0LQLVWHUR q
intervenuto riconoscendo la possibilità di stipulare contratti di lavoro
LQWHUPLWWHQWH SHU TXHOOH WLSRORJLH GL ODYRUL JLj GHILQLWL ³GLVFRQWLQXL´
GDOODQRUPDWLYDVXOO¶RUDULRGLODYRUR
Dunque, in particolare nel settore dello spettacolo, anche in assenza
di una regolamentazione collettiva, è ammessa la stipula di contratti di
ODYRUR LQWHUPLWWHQWH FRQ ³Artisti dipendenti da imprese teatrali,
cinematografiche e televisive; operai addetti agli spettacoli teatrali,
cinematografici e televisivi; cineoperatori, cameramen-recording o
teleoperatori da ripresa, fotografi e intervistatori occupati in imprese
dello spettacolo in genere ed in campo documentario, anche per fini
GLGDWWLFL´
La seconda ipotesi si riferisce a soggetti di età inferiore a 24 anni e
superiore a 55 anni per lo svolgimento di qualunque tipo di mansione,
quindi indipendentemente dal riferimento alla nozione di discontinuità
GLFXLDOO¶LSRWHVLSUHFHGHQWH1HOULQYLDUHDOOHGLVSRVL]LRQLOHJLVODWLYH
regolatrici della materia tutto quello che riguarda i profili pratici (ivi
FRPSUHVR O¶REEOLJR GL FRPXQLFD]LRQH DOOD '7/ H le modalità della
stessa), in tale sede pare opportuno precisare che:
V. Il rapporto di lavoro nello spettacolo 113

a) in alcuni casi il ricorso al lavoro intermittente è vietato;


b) il contratto di lavoro intermittente può essere stipulato a tempo
determinato e a tempo indeterminato;
c) se stipulato a tempo determinato non si applica la disciplina
restrittiva del contratto a termine relativa al rispetto degli
intervalli o del periodo massimo di 36 mesi;
d) secondo le indicazioni ministeriali, il rispetto del termine di
successione non è necessario neanche nel caso di un contratto a
tempo a termine che segue un contratto intermittente.
Il trattamento economico-normativo riconosciuto al lavoratore non
deve essere comunque inferiore a quello complessivamente attribuito
ai lavoratori impiegati in mansioni analoghe e deve essere
riconosciuto solo nei periodi di impiego, mentre nulla è dovuto nei
periodi in cui rimane a disposizione del datore di lavoro, a condizione
che le parti non abbiano inserito nel contratto la clausola di
disponibilità.
In tal caso, infatti, il datore di lavoro eroga una specifica indennità,
pari al 20% della normale retribuzione, che obbliga contrattualmente il
lavoratore a rispondere alla chiamata.
3HUWDQWRDIURQWHGLXQFRVWRILVVRO¶D]LHQGDVLDVVLFXUDODULVSRVWDDOOD
chiamata cui, in mancanza, non ha diritto. Il lavoratore, infatti,
potrebbe, in assenza di tale corresponsione, legittimamente stipulare
più contratti a chiamata con datori di lavoro diversi e non rendersi
disponibile.

5.5. Il lavoro autonomo

Il rapporto di lavoro autonomo, locatio operis, si costituisce attraverso


ODVWLSXOD]LRQHGLXQFRQWUDWWRG¶RSHUD
4XHVW¶XOWLPRqGLVFLSOLQDWRGDJOLDUWWHVVFRGFLYDLVHQVL
GHO TXDOH FRQ LO FRQWUDWWR G¶RSHUD XQD SHUVRQD O¶DUWLVWD  VL REEOLJDD
compiere verso un corrispettLYR XQ¶RSHUD R XQ VHUYL]LR FRQ ODYRUR
prevalentemente proprio e senza vincolo di subordinazione verso il
committente.
/HFDUDWWHULVWLFKHGHOFRQWUDWWRG¶RSHUDSHUWDQWRVRQR
a) ODSUHVWD]LRQHGHGRWWDQHOFRQWUDWWRGHYHFRQVLVWHUHLQXQ¶RSHUD
114 Manuale di diritto delle arti e dello spettacolo

o servizio;
b) la SUHYDOHQ]D H QRQ O¶HVFOXVLYLWj FRPH DYYLHQH QHO ODYRUR
subordinato) della prestazione personale: il lavoratore autonomo
può servirsi di altri collaboratori e di una propria struttura
organizzata;
c) la prestazione deve svolgersi senza vincoli di subordinazione e,
in particolare, senza che il committente possa fornire direttive
tecniche circa le modalità di svolgimento della prestazione e
possa esercitare un potere di controllo e disciplinare.
6H LO FRQWUDWWR G¶RSHUD KD FRPH FRQWHQXWR OR VYROJLPHQWR GL
XQ¶DWWività di natura artistica si caratterizza anche per il carattere
intellettuale del lavoro.
Sul punto la riforma Fornero ha introdotto una presunzione di
FROODERUD]LRQH FRRUGLQDWD FRQWLQXDWLYD DOORUFKp QHOO¶DPELWR GL XQ
rapporto instaurato con il titolare di partita iva ricorrano alcuni
specifici presupposti, tra i quali:
a) il rapporto ha una durata superiore a 8 mesi nel corso di un
anno;
b) LOFRUULVSHWWLYRSHUFHSLWRqVXSHULRUHDOO¶GLTXDQWRSHUFHSLWR
GDOFROODERUDWRUHQHOFRUVRGHOO¶DQQR
c) il committente ha fornito al collaboratore una postazione fissa
presso una delle proprie sedi.
Qualora ricorrano almeno due di tali presupposti e la prestazione
non sia caratterizzata per competenze tecniche di grado elevato o sia
svolta da un soggetto titolare di un reddito annuo da lavoro autonomo
non inferiore a 1,25 volte il livello minimo imponibile ai fini del
versamento dei contributi dovuti dagli artigiani e commercianti,
ovvero infine non si tratti di prestazioni professionali per il cui
HVHUFL]LR q ULFKLHVWD O¶LVcrizione in appositi albi professionali, sono
considerate collaborazioni coordinate e continuative, con la
FRQVHJXHQ]D FKH TXDORUD QRQ VLD UDYYLVDELOH O¶HVLVWHQ]D GL XQR
specifico progetto, si applichi la tutela sanzionatoria prevista dalla
legge.
È sempre ammessa per il committente la possibilità di fornire prova
contraria.
V. Il rapporto di lavoro nello spettacolo 115

5.5.1. Le collaborazioni coordinate e continuative

Quando si parla di collaborazioni coordinate e continuative si è fuori


GDOO¶DPELWRGHOODVXERUGLQD]LRQH,OFROODERUDWRUHLQIDWWi, a differenza
del lavoratore subordinato non si obbliga solamente e mettere a
disposizione le proprie energie lavorative bensì proprio alla
realizzazione di un determinato risultato. Egli, pertanto, è autonomo
circa tempi e modalità di esecuzione della prestazione. Sotto questo
profilo tale tipologia non si differenzia in maniera sostanziale dalla
prestazioni di lavoro autonomo. Ciò che le caratterizza, però, come
indica la loro stessa denominazione, è anche la continuità ed il
FRRUGLQDPHQWR FRQ O¶DWWLYLWà del committente, ovvero la presenza di
alcuni elementi propri del lavoro subordinato (si parla infatti di
parasubordinazione).
7XWWRFLzVLJQLILFDFKHODSUHVWD]LRQHQRQVLHVDXULVFHLQXQ¶XQLFD
occasione, come nel lavoro autonomo, ma, pur essendo a termine,
perdura per un certo tempo e deve svolgersi secondo le direttive del
FRPPLWWHQWH WHVH QHO ULVSHWWR GHOO¶DXWRQRPLD GHO FROODERUDWRUH D
rendere la prestazione coerente con la propria struttura organizzativa.
Secondo la previsione della legge, le collaborazioni continuative e
coordinate devono essere ricondotte a uno o più progetti specifici
individuati dal committente e sviluppati autonomamente dal
collaboratore in funzione del risultato.
La riforma Fornero ha - eliminato la previsione relativa ai
programmi di lavoro o fasi di esso che aveva causato profonde
incertezze da parte degli operatori nella sua applicazione pratica.
Oggi le collaborazioni coordinate e continuative nella maggioranza
dei casi devono ricollegarsi alla realizzazione di un progetto
liberamente determinato dal committente che si deve caratterizzare per
requisiti positivi e negativi.
Dal primo punto di vista la legge prevede che il progetto debba
essere funzionalmente rivolto ad un determinato risultato finale e deve
essere verificabile, ben individuabile ed idoneo a realizzare un
interesse determinato del committente. Requisiti negativi del contratto
D SURJHWWR LQHULVFRQR LQ SDUWLFRODUH DOOD QHFHVVLWj FKH O¶HVHFX]LRQH
della prestazione non si concreti nello svolgimento di compiti
meramente esecuti e ripetitivi, e quindi senza alcuna autonomia da
116 Manuale di diritto delle arti e dello spettacolo

parte del collaboratore seppur nel rispetto del coordinamento.


Infine, in via assolutamente residuale rispetto alla disciplina del
lavoro a progetto, è ammessa la stipula di contratti di collaborazione
VHQ]D SURJHWWR LQ FXL VLD SHU O¶HVLJXLWj GHO FRUULVSHWWLYR GRYXWR VLD
GHOOD EUHYH GXUDWD ULVXOWL SRFR SUREDELOH O¶DJJLUDPHQWR GHOOD
normativa. A tal fine si parla di collaborazioni marginali, di natura
occasionale e della durata complessiva non superiore a trenta giorni
QHOFRUVRGHOO¶DQQRVRODUHHSHUFRPSHQVLLQIHULRULDLHXURFRQ
lo stesso committente.

5.5.2. Il contratto di scrittura artistica

Una peculiare tipologia di contratto di lavoro nello spettacolo è la


scrittura artistica. Con essa O¶DUWLVWD VL REEOLJD D SUHVWDUH OD SURSULD
opera nelle rispettive qualità e competenze - in favore di un ente
organizzatore di spettacoli, fondazioni liriche, teatri di tradizione,
associazioni teatrali, instaurando un rapporto di lavoro autonomo a
fronte di un compenso, definito cachet, e, con specifico riferimento
agli artisti interpreti, anche stabilendo un determinato numero di
recite.
Tale tipologia di contratto, che figura nello schema del contratto
G¶RSHUDYLQFRODO¶DUWLVWDDUHQGHUHODSURSULa prestazione nel giorno e
QHOO¶RUD SDWWXLWL D IURQWH GL XQ FRPSHQVR PD DOOR VWHVVR WHPSR OR
obbliga a restare a disposizione del teatro per un determinato periodo
di tempo.
Quanto appena descritto evidenzia un elemento di atipicità del
contratto di scrittura artistica, che se da un lato certamente configura
XQD SUHVWD]LRQH DXWRQRPD GDOO¶DOWUD PDQLIHVWD WXWWDYLD JOL HOHPHQWL
propri di un rapporto di lavoro subordinato. Questa peculiarità è il
risultato di una stratificazione di usi e consuetudini che hanno nel
tempo modellato la disciplina della scrittura artistica, rendendola un
FRQWUDWWRG¶RSHUDSHFXOLDUHHDWLSLFR. Pertanto la prestazione artistica è
UHJRODWD GD XQ YHUR H SURSULR FRQWUDWWR G¶RSHUD LQWHJUDWR GDOOD
disciplina speciale sviluppatasi a tutela dei diritti dei lavoratori dello
spettacolo. Infatti, in particolare si osserva che un elemento
IRQGDPHQWDOH GHO UDSSRUWR q O¶intuitus personæ, la fiducia nelle
particolari qualità, anche fisiche, che rappresenta una componente
V. Il rapporto di lavoro nello spettacolo 117

essenziale per la buona riuscita della prestazione, al punto che,


WURYDQGRVL OH SDUWL LQ SRVL]LRQH DVVROXWDPHQWH SDULWHWLFD O¶DUWLVWD VL
assume personalmente il rischio, in caso di malattia o altro
LPSHGLPHQWR FKH GHWHUPLQDQR O¶LPSRVVLELOLWj GHOOD SUHVWD]LRQH SHU
motivi indipendenti dal teatro. Infine il cachet viene commisurato non
LQEDVHDOO¶RUDULRGLODYRURPDDOODSUHVWD]LRQHUHVD

5.6. La specialità del rapporto di lavoro nello spettacolo

/¶HVHFX]LRQH GHO UDSSRUWR GL ODYRUR QHO PRQGR GHOOR VSHWWDFROR VL
caratterizza per molteplici tratti di specialità che allontanano questo
modello dal paradigma tracciato dal tipico regime di disciplina del
lavoro subordinato.
/¶RUDULRGLODYRURGHOSHUVRQDOHGHOORVSHWWDFRORYLHQHGLVFLSOLQDWR
dettagliatamente dalla contrattazione collettLYD $L VHQVL GHOO¶DUW 
d.lgs. 8 aprile 2003, n. 66, non sono soggetti ai limiti della durata
settimanale della prestazione lavorativa i lavoratori addetti a mansioni
discontinue di attesa e custodia di cui al r.d. 10 settembre 1923, n.
1955. Tra le figure contemplate in questa lista sono compresi gli artisti
dipendenti da imprese teatrali, cinematografiche o televisive, gli
operai addetti agli spettacoli teatrali cinematografici o televisivi ed i
cineoperatori, cameraman o teleoperatori da ripresa, i fotografi e gli
intervistatori occupati in imprese dello spettacolo anche per fini
didattici. Questi lavoratori dunque ex lege, pur rimanendo soggetti ai
OLPLWL GL GXUDWD PDVVLPD GHOOD SUHVWD]LRQH ODYRUDWLYD GL FXL DOO¶DUW 
del d.lgs. 66/2003, sono sottratti al limite delle 40 ore settimanali di
FXL DOO¶DUW  GHO PHGHVLPR WHVWR QRUPDWLYR &RQ ULIHULPHQWR DO
personale addetto agli spettacoli e divertimenti pubblici incluso quello
GLSHQGHQWHGDD]LHQGHFKHSURYYHGRQRDOO¶DOOHVWLPHQWRHGDLPDWHULDOL
necessari per gli spettacoli, il riposo settimanale può anche non essere
coincidente con la domenica.
La specialità del rapporto di lavoro nello spettacolo si fa
particolarmente evidente nel momento in cui è necessario acquisire
una specifica documentazione obbligatoria (in particolare il certificato
di agibilità) oltre alla normale tenuta dei libri obbligatori di lavoro
(libro matricola, libro paga e registro degli infortuni).
118 Manuale di diritto delle arti e dello spettacolo

Il legislatore del 1947 ha ritenuto necessario, in considerazione


della specialità del settore dello spettacolo, predisporre una particolare
tutela per i lavoratori artistici e tecnici attraverso il cosiddetto
certificato di agibilità il cui rilascio è comunque subordinato ad un
accertamento preventivo (effettivo e non presuntivo) da parte GHOO¶HQWH
previdenziale circa la regolarità contributiva. Mediante il rilascio di
WDOH FHUWLILFDWR O¶HQWH q LQ JUDGR GL FRQWUROODUH SUHYHQWLYDPHQWH OD
UHJRODULWjGHJOLDGHPSLPHQWLFRQWULEXWLYLGHOO¶LPSUHVDULFKLHGHQWH
Uno degli istituti che maggiormente si caratterizzano per
O¶DSSOLFDELOLWj DL UDSSRUWL GL ODYRUR QHO VHWWRUH GHOOR VSHWWDFROR H
segnatamente al lavoro artistico è il cosiddetto diritto di protesta. Tale
istituto, originariamente nato da una consuetudine vigente nel settore
musicale ed estesosi ad altre parti del settore artistico costituisce una
forma di cessazione del rapporto disciplinata dai contratti collettivi.
6HFRQGRWDOHFODXVRODO¶LPSUHQGLWRUHKDIDFROWjGLULVROYHUHLOUDSSRUWR
FRQ O¶DUWLVWD TXDQGR TXHVWL SHU PRWLYDWR FRQYLQFLPHQWR
GHOO¶LPSUHQGLWRUH VWHVVR LQ UHOD]LRQH DO ULVXOWDWR GHOO¶HVHFX]LRQH GHO
giudizio del direttore artistico o del pubblico, sia inidoneo a sostenere
le parti affidategli. La natura giuridica di tale istituto è molto
controversa: si sostiene che possa trattarsi di un patto di prova ovvero
possa assumere le forme di una condizione sospensiva o palesare un
caso di una giusta causa di recesso o di una condizione risolutiva o
ancora di impossibilità sopravvenuta della prestazione ex art. 1256
cod. civ., ovvero di inutilità della medesima.
3DULPHQWL q GL IUHTXHQWH DSSOLFD]LRQH QHOO¶DPELWR GHO ODYRUR
artistico il cosiddetto patto di esclusiva. Esso nasce dalla specifica
HVLJHQ]DGLDVVLFXUDUVLODSUHVWD]LRQHGHOO¶DUWLVWDSHUXQFHUWRSHULRGR
di tempo obbligandosi questi a rendere la propria prestazione
unicamente in favore di uno stesso datore di lavoro o committente per
un determinato periodo di tempo.

5.7. La tutela previdenziale, assistenziale e assicurativa

La tutela assistenziale e previdenziale nel settore dello spettacolo era


SULPD GHPDQGDWD DOO¶(13$/6 SHU TXDQWR ULJXDUGDYD O¶DVVLFXUD]LRQH
GHOO¶LQYDOLGLWj OD YHFFKLDLD HG L VXSHUVWLWL HG L UHODWLYL WUDWWDPHQWL
V. Il rapporto di lavoro nello spettacolo 119

pensionistici dei lavoratori dello spettacolo, sia di nazionalità italiana


FKHVWUDQLHUDHDOO¶,VWLtuto nazionale della previdenza sociale (INPS)
SHU OH FRQWULEX]LRQL PLQRUL RVVLD O¶DVVLFXUD]LRQH FRQWUR OD
GLVRFFXSD]LRQH OD WXEHUFRORVL O¶DVVHJQR SHU LO QXFOHR IDPLOLDUH OD
malattia, la maternità ed il fondo di garanzia del trattamento di fine
rapportR 7)5  QRQFKp O¶DVVLFXUD]LRQH JHQHUDOH REEOLJDWRULD  SHU L
lavoratori comuni operanti nel settore dello spettacolo.
2JJL D VHJXLWR GHOOD VRSSUHVVLRQH GHOO¶(13$/6 GLVSRVWD FRQ LO
decreto legge 6 dicembre 2011, n. 201, convertito con modificazioni
con la legge 23 dicembre 2011, n. 214, le funzioni previdenziali ed
DVVLVWHQ]LDOLVRQRVWDWHDWWULEXLWHDOO¶,136± Gestione ex ENPALS.
/¶REEOLJRDVVLFXUDWLYRQHOORVSHWWDFRORLQVRUJHLQFDSRDOVRJJHWWR
che si avvale della prestazione lavorativa per effetto del mero
svolgimento di una delle attività artistiche, tecniche o amministrative
DQDOLWLFDPHQWH ULSRUWDWH GHO WHVWR GL OHJJH FKH UHJROD O¶DVVLFXUD]LRQH
ivs (invalidità, vecchiaia, superstiti) dello spettacolo (legge istitutiva
del soppresso ENPALS, d.lgs. del Capo Provvisorio dello Stato n.
708/1947 e s.m.i.), non assumendo rilievo, peraltro, la natura
GHOO¶DWWLYLWjVYROWDGDOGDWRUHGLODYRUR
Detto obbligo è generalizzato, nel senso che non presuppone
QHFHVVDULDPHQWH O¶HVLVWHQ]D GL XQ UDSSRUWR GL ODYRUR VXERUdinato,
estendendosi, al contrario, sia a coloro che svolgono attività di tipo
autonomo, sia a coloro che svolgono attività di tipo subordinato,
incluse forme di lavoro flessibile e atipico, a prescindere, pertanto,
dalla natura del rapporto di lavoro instauratosi.
/¶DPELWR GL FRUUHWWD RSHUDWLYLWj GHOOD WXWHOD QHFHVVLWD VHPSUH LO
contemporaneo verificarsi di due requisiti: uno soggettivo, costituito
DSSXQWRGDOO¶DSSDUWHQHQ]DGHOO¶DWWLYLWjFRQFUHWDDGXQDGHOOHFDWHJRULH
WDVVDWLYDPHQWHGHVFULWWHO¶DOWURRJJettivo integrato con la destinazione
HIIHWWLYD GL TXHOO¶DWWLYLWj DOOD UHDOL]]D]LRQH GL XQR VSHWWDFROR 7UD OH
categorie indicate accanto a figure tradizionalmente appartenenti al
settore dello spettacolo ve ne sono altre che potrebbero svolgere la
propria opera in settori diversi e la cui inclusione nella tutela gestita
GDOO¶(13$/6 VL FRPSUHQGH VROR TXDORUD HG LQ TXDQWR OH VWHVVH
ULVXOWLQRFDODWHQHOFRQWHVWRGLXQ¶DWWLYLWjSURGXWWLYDGLXQRVSHWWDFROR
Va inoltre segnalato il decreto del Ministero del Lavoro 15 marzo
 UHFDQWH ³$GHJXDPHQWR GHOOHFDWHJRULH GHL ODYRUDWRULDVVLFXUDWL
120 Manuale di diritto delle arti e dello spettacolo

REEOLJDWRULDPHQWHSUHVVRO¶(13$/6´ FKHKDULYLVLWDWRDPSOLDQGROD
O¶HOHQFD]LRQH GL FXL DOO¶DUW  FR  GHO GOJV &36 Q  DO
ILQHGLDGHJXDUODDOO¶HYROX]LRQHGelle professionalità e delle forme di
regolazione collettiva dei rapporti di lavoro nel settore di cui si tratta.
'XQTXH LQ VHJXLWR DOO¶HQWUDWD LQ YLJRUH GHO FLWDWR GHFUHWR QXRYH
figure professionali dello spettacolo e dello sport (anche non
professionistico) sono iscritte al Fondo pensione lavoratori dello
spettacolo (FPLS). Tra queste si possono indicare senza pretese di
esaustività nuove figure artistiche come lo story board artist, il
creatore di fumetti, illustrazioni e disegni animati, il bozzettista, lo
stunt man, il location manager, il casting director, il video-assist, il
consulente assistente musicale, il sound designer, il tecnico addetto
agli effetti speciali e i dipendenti da sale scommesse e da sale giochi.
Ai fini del calcolo dei contributi e delle prestazioni di pertinenza
GHOO¶H[ ENPALS L ODYRUDWRUL GHOOR VSHWWDFROR LVFULWWL DOO¶HQWH VRQR
classificati in tre gruppi, indipendentemente dalla qualificazione del
rapporto di lavoro in autonomo o subordinato e a seconda che:
prestino attività artistica o tecnica a tempo determinato direttamente
connessa alla produzione e la realizzazione degli spettacoli (gruppo
A); prestino a tempo determinato attività al di fuori delle ipotesi di cui
al primo raggruppamento (gruppo B); prestino attività con rapporto di
lavoro a tempo indeterminato (gruppo C). I gruppi vengono poi
DJJLRUQDWL DWWUDYHUVR O¶HPDQD]LRQH GL GHFUHWL LQWHUPLQLVWHULDOL  /D
corretta individuazione del raggruppamento di appartenenza è
fondamentale per il lavoratore dello spettacolo, dal momento che la
ripartizione in gruppi è rilevante ai fini della maturazione del diritto
DOOH SUHVWD]LRQL ,QIDWWL LO UHTXLVLWR GHOO¶DQQXDOLWj GL FRQWULEX]LRQH
richiesto per il sorgere del predetto diritto, si considera soddisfatto con
riferimento a un numero di giornate lavorative che varia secondo il
gruppo di appartenenza del lavoratore:
a) 120 giornate lavorative per i soggetti appartenenti al primo
gruppo;
b) 260 giornate lavorative per i soggetti appartenenti al secondo
gruppo;
c) 312 giornate lavorative per i soggetti appartenenti al terzo
gruppo.
/DWXWHODDVVLFXUDWLYDqLQYHFHGLFRPSHWHQ]DGHOO¶,VWLWXWRQD]LRQDOH
V. Il rapporto di lavoro nello spettacolo 121

SHU O¶DVVLFXUD]LRQH FRQWUR JOL LQIRUWXQL VXO ODYRUR ,1$,/  SHU WXWWL L
soggetti nei confronti dei quali opera la disciplina in materia di
infortuni sul lavoro e malattie professionali.
Ê SUHYLVWD O¶DVVLFXUD]LRQH REEOLJDWRULD SHU TXDQWL DOOHVWLVFRQR
provano o eseguono pubblici spettacoli, in particolare per gli addetti
ad apparecchi ed impianti elettrici che svolgano attività manuale o che
sovraintendano alla stessa. In particolare alla luce della circolare INPS
n. 19 del 27 marzo 1995 si è ammessa anche la copertura dei ballerini
e degli orchestrali, laddove questi usino apparecchiature elettriche o
FROODERULQRDOO¶LPSLDQWRRDOWUDVSRUWRGHOOHPHGHsime.
3ULPD GHOO¶LQL]LR GHL ODYRUL L GDWRUL GL ODYRUR GHYRQR GHQXQFLDUH
DOO¶,1$,/ODQDWXUDGHLODYRULVWHVVLHGLQSDUWLFRODUHOHODYRUD]LRQLH
le attività previste.
'XQTXH DL ILQL GHOO¶REEOLJR GL DVVLFXUD]LRQH JOL HOHPHQWL
imprescindibili risultano eVVHUH O¶HVLVWHQ]D GL XQ UDSSRUWR GL ODYRUR
dipendente, non sorgendo alcun obbligo INAIL per il lavoratore
autonomo dello spettacolo, il rischio ambientale o potenziale, la
PDQXDOLWjHO¶DSSDUWHQHQ]DGHOODYRUDWRUHDOODFDWHJRULDGHOSHUVRQDOH
artistico sia nei rapporti di lavoro a tempo determinato che in quelli a
tempo indeterminato.
Tale regime si segnala per diverse peculiarità. È un regime speciale
perché assolve alla funzione di garantire ai lavoratori dello spettacolo
una tutela previdenziale in grado di ovviare al fatto che, in questo
settore, i rapporti di lavoro sono tendenzialmente precari, ossia
necessariamente limitati alla tutela dello spettacolo, ed aleatori, in
FRQVLGHUD]LRQH GHOO¶LQFHUWH]]D GHOOH VFULWWXUH LQ UHOD]LRQH DJOL XPRUL
del pubblico e degli impresari.

5.8. Conclusioni

Dopo aver analizzato i tratti tipologici maggiormente significativi che


informano il lavoro nello spettacolo appare opportuno indugiare su
qualche considerazione di natura sistematica. Si fa riferimento a quella
diffusa tendenza alla deframmentazione e diversificazione dei rapporti
di lavoro che ripropone il dibattito su cosa debba intendersi per
rapporto speciale.
122 Manuale di diritto delle arti e dello spettacolo

Nel moderno contesto sociale, il fenomeno artistico non solo ha


mutato le proprie tradizionali caratterizzazioni, ma ha dato origine ad
una molteplicità di processi a cui si sono accompagnati, sul piano
giuridico, sporadici interventi legislativi, dispute dottrinali, e
orientamenti giurisprudenziali, che impongono un approccio
interpretativo, nello studio del rapporto di lavoro in tale ambito,
capace di diversificarsi rispetto ai consueti schemi di indagine sul
rapporto di lavoro generalmente inteso, ponendo maggior enfasi su
quegli aspetti chiave che ne condizionano la natura e ne evidenziano
le specificità che qui brevemente si è tentato di illustrare.
Alla luce di quanto rilevato è corretto riconoscere ai rapporti di
lavoro nello spettacolo una definizione di specialità intesa come
integrazione, e non deroga, alla disciplina generale dei rapporti di
lavoro subordinato o autonomo in considerazione dei particolari tratti
che ne delineano i contorni e che maggiormente si rinvengono in
quella porzione di lavoro dello spettacolo qualificata come lavoro
artistico. In questo caso infatti non si tratta solo di enucleare una
disciplina applicabile diversa da quella generalmente prevista ma
prendere atto che aspetti fondamentali del rapporto di lavoro (ad
esempio istituti quali la retribuzione e lo scioglimento del rapporto)
divergono in maniera significativa dallo statuto tipico applicabile al
lavoratore subordinato.
,QILQH RFFRUUH ULEDGLUH O¶LPSRUWDQ]D GHO ULFRQRVFLPHQWR GL XQD
disciplina speciale, sebbene frammentata, orientata a perseguire la più
ampia tutela e la piena salvaguardia dei diritti di lavoratori che, con la
propria opera diretta o indiretta, contribuiscono allo sviluppo e alla
FUHVFLWD GHOOD OLEHUWj GHOO¶DUWH H GHOODFXOWXUD LQYLRODELOL IRQGDPHQWD
dello spirito democratico del nostro Paese.
Capitolo VI

Le autorizzazioni amministrative
in materia di pubblico spettacolo
di NICOLA DEL PIANO

6.1. La nozione di spettacolo nel diritto pubblico

Uno dei fini principali di una creazione artistica è quello di giungere


ad un numero possibilmente indefinito di persone, tramutandosi da
mero atto interiore, appartenente alle corde della mente e del cuore, in
D]LRQLSXEEOLFKHRULHQWDWHYHUVRO¶HVWHUQRGLVp/DFUHD]LRQHDUWLVWLFD
GDSDUWHGLVpGLYLHQHULFFKH]]DSHUO¶DOWUR
Uno spettacolo, dunque, nel momento in cui si presenta nella realtà
fattuale e si presenta a coloro i quali di quello spettacolo devono es-
VHUQHLIUXLWRULSXzDVVXPHUHLOFDUDWWHUHGL³SXEEOLFR´2FFRUUHWXt-
WDYLD WHQWDUH GL GDUH XQD GHILQL]LRQH DOTXDQWR SUHFLVD GL ³SXEEOLFR
VSHWWDFROR´
Questo capitolo non sarà dedicato ad enucleare il concetto unitario
giuridicamente rilevante di spettacolo, che potrà trovarsi altrove
DOO¶LQWHUQR GHO OLEUR 7XWWDYLD QRQ GREELDPR WHPHUH GL ULSHWHUH H
dunque, di inquadrare tale nozione, sotto la luce del primo comma
GHOO¶DUWGHOOD&DUWDFRVWLWX]ionale, dove la proclamazione della li-
EHUWjGHOO¶DUWHHGHOODVFLHQ]DGHOODPDQLIHVWD]LRQHGHOSHQVLHURFRQOD
parola, lo scritto ed altri mezzi di diffusione, ne costituisce il fonda-
mento di garanzia.
In questo senso lo spettacolo, ancorché avente carattere culturale,
ricreativo od artistico, può costituire veicolo di informazioni, di idee e

123
124 Manuale di diritto delle arti e dello spettacolo

di costume, nonché di convinzioni politiche ed ideologiche, connotan-


dosi attraverso diversi caratteri ed elementi.
Dunque, per spettacoli e/o trattenimenti, possono intendersi tutti
quei divertimenti, distrazioni, amenità, intenzionalmente offerti al
SXEEOLFRLQUDSSRUWRDLTXDOLVLSURVSHWWDO¶HVLJHQ]DFKHODSRWHVWjWu-
WULFHGHOODSXEEOLFDDXWRULWjLQWHUYHQJDSHUJDUDQWLUHO¶LQFROXPLWjSXb-
EOLFDO¶RUGLQHODPRUDOLWj e il buon costume (artt. 70 e 80 del Testo
8QLFRGHOOHOHJJLGLSXEEOLFDVLFXUH]]D /DGLIIHUHQ]DWUD³VSHWWDFROL´
H ³WUDWWHQLPHQWL´ FRQVLVWH HVVHQ]LDOPHQWH QHO IDWWR FKH JOL VSHWWDFROL
sono divertimenti cui il pubblico assiste in forma più passiva (ad
esempio, cinema, teatro), mentre i trattenimenti sono divertimenti cui
il pubblico partecipa più attivamente (ad esempio, feste da ballo, gio-
stre, baracconi di tiro a segno).
A conferma di ciò, secondo quanto affermato dal Ministero delle
Finanze, nella circolare n. 165 E del 7 settembre 2000, avente per og-
JHWWR³5LIRUPDGHOODGLVFLSOLQDILVFDOHUHODWLYDDOOHDWWLYLWjGLLQWUDWWe-
QLPHQWRHGLVSHWWDFROR´ORVSHWWDFRORqFDUDWWHUL]]DWRGDOFRQFHWWRGL
rappresentazione e comporta prevalentemente una partecipazione pas-
VLYD RYH OR VSHWWDWRUH DVVLVWH DO IHQRPHQR JXDUGDQGR O¶HYHQWR FRVu
come gli è rappresentato. Per intrattenimento, invece, prosegue il Mi-
QLVWHUR QHOOD FLWDWD FLUFRODUH VL GHYH LQWHQGHUH ³FLz FKH q FDJLRQH GL
GLYHUWLPHQWR´HFKHLPSOLFDODSDUWHFLSD]LRQHDWWLYDDOO¶HYHQWR
Pertanto, la disciplina dei pubblici spettacoli e dei trattenimenti che
si svolgono in luoghi pubblici o aperti o esposti al pubblico è prevista,
LQSDUWLFRODUHGDOO¶DUWGHO7HVWR8QLFRGHOOHOHJJLGLSXEEOLFDVLFu-
rezza (Tulps).

6.2. Le autorizzazioni in diritto amministrativo

/¶DXWRUL]]D]LRQH DPPLQLVWUDWLYD q TXHO SURYYHGLPHQWR FKH rimuove


OLPLWLDOO¶HVHUFL]LRGLDWWLYLWj che formano oggetto di diritti soggettivi
o di potestà pubbliche preesistenti. Le autorizzazioni amministrative si
configurano, dunque, come provvedimenti ampliativi della sfera giu-
ridica del privato FKH FRQGL]LRQDQR O¶HVHUFL]LR GL WDOXQL VXRL GLULWWL
6RQR ILJXUH DQDORJKH DOO¶DXWRUL]]D]LRQH DPPLQLVWUDWLYD OH OLFHQ]H
(presupponenti la preesistenza di un diritto soggettivo
VI. Le autorizzazioni amministrative in materia di pubblico spettacolo 125

GHOO¶LQWHUHVVDWR  OH DELOLWD]LRQL H OH UHJLVWUD]LRQL L QXOOD RVWD OH Gi-


spense e le approvazioni.
5HFHQWHPHQWH OD GLVFLSOLQD GHOO¶autorizzazione amministrativa e
quella relativa al potere autorizzatorio della Pubblica Amministrazio-
ne VSHVVRULFRUGDWDFRQO¶DEEUHYLD]LRQH3$ hanno subìto una pro-
IRQGDLQQRYD]LRQHGDSDUWHGHOOHJLVODWRUHFRQO¶LQWURGX]LRQHGLPHc-
canismi snelli per il conseguimento delle autorizzazioni amministrati-
ve (in particolare, attraverso il meccanismo della dichiarazione di ini-
zio attività FRQULIHULPHQWRDOOHDXWRUL]]D]LRQLYLQFRODWHGLFXLDOO¶DUW
19, OHLOPHFFDQLVPRGLFXLDOO¶art. 20 del silenzio assenso
con riferimento alle autorizzazioni discrezionali).
/D ILJXUD GLVFLSOLQDWD QHOO¶DUW  FLWDto ha, dunque, subìto
XQ¶HYROX]LRQHGLVFLSOLQDUHFKHSXzHVVHUHGLVWLQWDLQWUHIDVL
Nella prima fase, veniva originariamente denominata come denun-
cia in luogo di autorizzazione. Trattandosi di un istituto innovativo nel
panorama legislativo nazionale che non aveva rilevanti precedenti, es-
so venne in un primo momento applicato alle sole autorizzazioni vin-
FRODWHRPHJOLRDTXHOOHFKHGLSHQGHYDQRGDOO¶DFFHUWDPHQWRSULYRGL
discrezionalità, in ordine alla presenza dei presupposti e dei requisiti
di legge.
La seconda fase inizia con la l. 537/1993, recante interventi corret-
tivi di finanza pubblica; attraverso questa innovazione normativa,
O¶LVWLWXWR YHQLYD ULGLVHJQDWR FRPSOHWDPHQWH HVWHQGHQGRQH QRWHYRl-
PHQWH L PDUJLQL 0HQWUH RULJLQDULDPHQWH O¶LQGLYLGXD]LRQH, in forma
WDVVDWLYDGHLVHWWRULOLEHUDOL]]DWLHUDULPHVVDDOO¶LQWHUYHQWRGLXQDVXc-
cessiva statuizione regolamentare, con questa legge, invece, si ribalta
OD GLVFLSOLQD O¶LQL]LDWLYD HFRQRPLFD SULYDWD ULVXOWD VXVFHWWLELOH GL Ln-
condizionata ed immediata esplicazione e si affida allo strumento re-
golamentare la definizione delle ipotesi di esclusione.
La terza e più recente fase inizia con O¶DUW 3, d.l. 35/2005 (decreto
legge sulla competitività), convertito in l. 80/2005. Le innovazioni più
importanti riguDUGDQRO¶DPSOLDPHQWRGHOODVIHUDGLRSHUDWLYLWjGHOO¶DUW
19, primo comma, l. 241/1990 (si ampliano sensibilmente le ipotesi in
FXL XQD VHPSOLFH GLFKLDUD]LRQH GHOO¶LQWHUHVVDWR FLWWDGLQR R LPSUHVD
può sostituire i provvedimenti abilitativi della P.A.). Anche i presup-
SRVWLGLRSHUDWLYLWjGHOO¶DUWVRQRPRGLILFDWLDWWUDYHUVRODSUHYLVLo-
ne secondo cui il rilascio dei provvedimenti dipende esclusivamente
126 Manuale di diritto delle arti e dello spettacolo

GDOO¶DFFHUWDPHQWR GHL UHTXLVLWL R SUHVXSSRVWL GL OHJJH R DWWL DPPLQi-


strativi a carattere generale; inoltre, non sono più previsti limiti o spe-
cifici strumenti di programmazione settoriale per il rilascio degli stes-
si.
Infine, la disciplina della dichiarazione di inizio attività di cui
DOO¶DUWOQRQVLDSSOLFDDLSURFHGLPHQWLLQPDWHULDGLsi-
curezza pubblica, di immigrazione, di difesa nazionale, di tutela della
VDOXWHGHOSDHVDJJLRGHOO¶DPELHQWHQRQFKpLQPDWHULDGLDPPLQLVWUa-
zione della giustizia e delle finanze e in materia di atti imposti dalla
normativa comunitaria.
/¶DUWGHOODO241/1990 disciplina, invece, sempre in materia di
autorizzazioni amministrative, il silenzio assenso, stabilendo che nei
procedimenti ad istanza di parte, volti al conseguimento di un deter-
PLQDWRSURYYHGLPHQWRDPPLQLVWUDWLYRO¶LQHU]LDGHOOD3$FKHVLSUo-
WUDJJDROWUHLWHUPLQLGLFXLDOO¶DUWsecondo e terzo comma, assume
il significato implicito di DFFRJOLPHQWRGHOO¶LVWDQ]D. Anche in tema di
silenzio assenso, valgono le HFFH]LRQLSHUPDWHULDGLFXLDOO¶DUW.
'XQTXHDIURQWHGLXQ¶LVWDQ]DYROWDDO conseguimento di un prov-
vedimento amministrativo, la P.A. può, entro il termine di cui ai
FRPPL  H  GHOO¶DUW  O  HPHWWHUH XQ provvedimento
espresso di diniego ovvero indire una conferenza di servizi impedendo
la formazione del provvedimento LPSOLFLWRG¶DVVHQVRLQGLIHWWRSRWUj
esclusivamente agire in forma di autotutela non potendo, in ogni caso,
adottare il provvedimento di diniego tardivamente né comportarsi co-
PH VH O¶DXWRUL]]D]LRQH LPSOLFLWD FRQ ORVSLUDUH GHO WHUPLQH GL FXL DL
commi 2 HGHOO¶DUWOQRQYLVLDVWDWD

6.3. La materia del pubblico spettacolo

Esaminata brevemente la vasta e complessa materia delle autorizza-


]LRQLLQGLULWWRDPPLQLVWUDWLYRRFFRUUHILQDOL]]DUHO¶DWWHQ]LRQHVXOGi-
ritto dello spettacolo.
Preliminarmente, va ricordato che la materia dei controlli sullo
spettacolo investe direttamente la pubblica sicurezza. Gli spettacoli,
infatti, in quanto comportano la presenza di un pubblico, dunque di un
VI. Le autorizzazioni amministrative in materia di pubblico spettacolo 127

numero indeterminato di persone contemporaneamente in uno stesso


SRVWRLQWDQWRVRQRFRQVLGHUDWL³PDQLIHVWD]LRQLSHULFRORVH´
Tendenzialmente, allorquando gli spettacoli pubblici assumono le
FDUDWWHULVWLFKHGHOO¶LPSUHQGLWRULDOLWjqQHFHVVDULDODOLFHQ]D ex art. 68
Tulps. In particolare, il pubblico spettacolo costituisce attività prima-
ria esercitata da un soggetto od un ente con i caratteri
GHOO¶LPSUHQGLWRULDOLWjLQSUHVHQ]DGLHOHPHQWLVLQWRPDWLFLTXDOLLOSa-
JDPHQWR GL XQ ELJOLHWWR G¶LQJUHVVR OD FRPSOHVVLWj GL VWUXPHQWD]LRQH
tecnica e di dotazioni eOHWWULFKHDVHUYL]LRGHOO¶LQWUDWWHQLPHQWRPXVLFa-
le; la previsione dello svolgimento di attività danzante, anche occasio-
nale e sporadica; la partecipazione di complessi musicali di fama;
O¶DPSLDSXEEOLFL]]D]LRQHGHOO¶DWWLYLWjPXVLFDOHRIIHUWD
E, del resto, SURSULRLOFDUDWWHUHGHOO¶LPSUHQGLWRULDOLWjYLHQHDFDUDt-
WHUL]]DUHLOFDUDWWHUHGL³SXEEOLFR´ULVSHWWRDTXHOORGL³SULYDWR´LQUe-
lazione ad un locale. A tal fine, sembra opportuno richiamare il prin-
cipio ricavato dalla sentenza della Corte Costituzionale n. 56 del 9
aprile 1970, secondo cui ad un determinato locale va in genere attri-
EXLWRLOFDUDWWHUHGLORFDOH³SXEEOLFR´TXDQGRVLDFFHUWLFRQXQJLXGi-
zio sintetico e induttivo, che in esso si svolga una attività professio-
nalmente organizzata a scopo di lucro, diretta allo scambio o alla pro-
duzione di beni o servizi. Deve trattarsi, in altri termini, di attività
svolta da un imprenditore (sulla cui nozione si rinvia agli artt. 2082 e
2083 cod. civ.).
In correlazione al suesposto principio, la giurisprudenza della Su-
prema Corte di Cassazione ha enucleato parametri più analitici e rife-
rimenti sintomatici più concreti, sulla scorta dei quali devono ritenersi
assoggettabili alla normativa sugli spettacoli e trattenimenti pubblici i
locali che, ancorché asseriti FRPH ³SULYDWL´ SUHVHQWLQR TXHL UHTXLVLWL
SURSULGHOO¶LPSUHQGLWRULDOLWjGLFXLVRSUD
Ne consegue che, ove ricorrano le circostanze succitate, i circoli
privati che intendano svolgere rappresentazioni dovranno munirsi di
licenza ed essere sottoposti alle prescrizioni generalmente previste per
lo svolgimento in pubblico delle suddette attività.
&LzGHWWRqLQWHUYHQXWDUHFHQWHPHQWHXQ¶LPSRUWDQWHPRGLILFDDJOL
articoli 68, 69 e 71 del Tulps che disciplinano la materia. In data 8 ot-
tobre 2013 è stata pubblicata, infatti, la legge 7 ottobre 2013, n. 112
recane la ³&RQYHUVLRQHLQOHJJHFRQPRGLILFD]LRQLGHOGHFUHWR-legge
128 Manuale di diritto delle arti e dello spettacolo

8 agosto 2013, n. 9, recante disposizioni urgenti per la tutela, la valo-


rizzazione e il rilancio dei beni e delle attività culturali e del tuULVPR´
Questa legge introduce, per la prima volta in questo testo unico, la
SCIA (segnalazione certificata di inizio di attività, ex art. 19, l.
241/1990) che sostituisce le licenze di pubblico spettacolo e intratte-
nimento, in presenza di determinate condizioni: la SCIA diviene uti-
lizzabile per i soli eventi fino ad un massimo di duecento partecipanti
e che si svolgono entro le ore 24 del giorno di inizio, e fermo restando
DQFKHLQTXHVWDLSRWHVLO¶RVVHUYDQ]DGHOO¶DUW7XOSV
In tutte le altre occasioni, è necessario il rilascio delle licenze ex
artt. 68 e 69 Tulps.
Secondo il nuovo testo, quindi, le licenze previste dagli artt. 68 e
69 del Tulps vengono dunque sostituite dalla SCIA in presenza delle
seguenti condizioni: a) FKHDOO¶HYHQWRSDUWHFLSLQRILno ad un massimo
di duecento persone; b) FKHO¶HYHQWRVLVYROJDHQWUROHRUHGHOJLRr-
no di inizio.
È da tenere, però, in considerazione che sXVVLVWHO¶REEOLJRGHOODve-
ULILFDGLVLFXUH]]DSUHYLVWDGDOO¶DUW7XOSVGDRSHUDUVLWUDPLWHDSSo-
sita commissione tecnica (Commissione provinciale o comunale di vi-
gilanza dei locali di pubblico spettacolo).
Sembrerebbe quindi necessario corredare la SCIA con la relazione
tecnica di un professionista.
Tale lettura, oltre ad essere più attenta, non si scontrerebbe con
O¶DUWGHOUHJRODPHQWRDO7XOSVFKHDO secondo comma, prevede:
³3HULORFDOLHJOLLPSLDQWLFRQFDSLHQ]DFRPSOHVVLYDSDULRLQIHULRUHD
SHUVRQHOHYHULILFKHHJOLDFFHUWDPHQWL>«@VRQRVRVWLWXLWLIHUPH
restando le disposizioni sanitarie vigenti, da una relazione tecnica di
XQSURIHVVLRQLVWDLVFULWWRQHOO¶DOERGHJOLLQJHJQHULRQHOO¶DOERGHJOLDr-
FKLWHWWL R QHOO¶DOER GHL SHULWL LQGXVWULDOL R QHOO¶DOER GHL JHRPHWUL FKH
DWWHVWD OD ULVSRQGHQ]D GHO ORFDOH R GHOO¶LPSLDQWR DOOH UHJROH WHFQLFKH
stabiliWH FRQ GHFUHWR GHO 0LQLVWUR GHOO¶,QWHUQR´ &RVu SURFHGHQGR VL
VDUHEEH GL IURQWH DG XQD 6&,$ ³FRQGL]LRQDWD´ FKH FRQVHQWLUHEEH GL
godere delle scorciatoie burocratiche previste dagli artt. 68 e 69 del
7XOSV LQ XQ¶RWWLFD FRHUHQWH FRO TXDGUR FRPSOHVVLYR GHOLneato dalla
normativa in subiecta materia.
VI. Le autorizzazioni amministrative in materia di pubblico spettacolo 129

È bene, giunti a questo punto della trattazione, concentrare


O¶DWWHQ]LRQHHSUHFLVDUHOD ratio GHOO¶DUWGHO7XOSVHTXLQGLGHOOD
verifica di sicurezza.
Detta verifica, LQTXDQWRHIIHWWXDWDQHOO¶LQWHUHVVHGHlla pubblica in-
columità, deve essere svolta a prescindere dalle finalità imprenditoriali
o meno del trattenimento. L¶DUWGHO7XOSVSUHYHGHFKHO¶DXWRULWjGL
SXEEOLFD VLFXUH]]D QRQ SXzFRQFHGHUH OD OLFHQ]D SHUO¶DSHUWXUD GL XQ
teatro o di un luogo di pubblico spettacolo, prima di aver fatto verifi-
FDUHGDXQDFRPPLVVLRQHWHFQLFDODVROLGLWjHODVLFXUH]]DGHOO¶HGLILFLR
HO¶HVLVWHQ]DGLXVFLWHSLHQDPHQWHDGDWWHDVJRPEUDUORSURQWDPHQWHQHO
FDVRGLLQFHQGLR/HVSHVHGHOO¶LVSH]LRQHHTXHOOHSHULVHUYL]LGL pre-
venzione contro gli incendi sono a carico di chi domanda la licenza.
6RQRVWDWLULWHQXWLHVHQWLGDOODGLVFLSOLQDQRUPDWLYDGLFXLDOO¶DUW
citato gli spettacoli e trattenimenti organizzati in pubblici esercizi allo
scopo di attirare la clientela, senza per ciò aumentare il prezzo della
FRQVXPD]LRQHHVHQ]DFKHFLVLDQHOORFDOHO¶DSSUHVWDPHQWRGLHOHPHn-
ti tali da configurarne una trasformazione.
Al contrario, sono tenuti a munirsi della dichiarazione di agibilità i
gestori che esercitano attività di spettacolo e trattenimento ai sensi
GHOO¶DUW  O  DWWLYLWj GL VRPPLQLVWUD]LRQH QHOOH TXDOL VLD
SUHYDOHQWH O¶DWWLYLWj FRQJLXQWD GL WUDWWHQLPHQWR H VYDJR  H TXDQGR OD
verifica sulla solidità e la sicurezza della struttura sia riferita a pedane,
camerini degli artisti, allestimenti scenici, uscite di sicurezza o oggetti
analoghi.
/¶DUW  GXQTXH QHOO¶LQWHUSUHWD]LRQHFKH QH q VWDWD IDWWD GDO 'i-
partimento della Pubblica Sicurezza e dalla giurisprudenza prevalente,
non deve essere applicato quando si svolgono trattenimenti musicali
allestiti occasionalmente e temporaneamente in locali pubblici dove
O¶DWWLYLWj SULQFLSDOH q OD ULVWRUD]LRQH H OR VSHWWDFROR UDSSUHVHQWD VROR
una attività complementare.
Infine, per quanto riguarda la giurisdizione, questa prevede la sua
declinazione esclusiva nei confronti del giudice amministrativo, al
TXDOHVRQRDWWULEXLWHWXWWHOHFRQWURYHUVLHUHODWLYHDOO¶DSSOLFD]LRQHGHl-
le disposizioni contenute nelle norme che sono state sin qui esaminate.
Il motivo è dato dalla commistione tra diritti soggettivi ed interessi le-
JLWWLPL RYYHUR WUD LO GLULWWR VRJJHWWLYR GHO SULYDWR DOO¶HVHUFL]LR
130 Manuale di diritto delle arti e dello spettacolo

GHOO¶DWWLYLWjHO¶LQWHUHVVHOHJLWWLPRVFDWXUHQWHGDOO¶DWWLYLWjGLFRQWUROORH
UHSUHVVLRQHGHOO¶DWWLYLWjGDSDUWHGHOOD3$

6.4. La giurisdizione esclusiva del giudice amministrativo

La giustizia amministrativa italiana è organizzata secondo il sistema


della doppia giurisdizione. Tale principio è enunciato dalla Costitu-
zione (artt. 24, 103 e 113), la quale ± sostanzialmente recependo la
passata disciplina ± fonda il riparto delle controversie tra giudice ordi-
nario e giudice amministrativo sulla c.d. causa petendi, ovvero la na-
tura della situazione giuridica soggettiva lesa (rispettivamente diritto
VRJJHWWLYRHLQWHUHVVHOHJLWWLPR FRQO¶HFFezione dei casi di giurisdi-
zione esclusiva, in cui al giudice amministrativo compete la cognizio-
QH³DQFKH´ FRVuO¶DUWFRVW GHLGLULWWLVRJJHWWLYL ,QWDOVHQVRq
intervenuta, tra le altre, la sentenza delle Sezioni Unite della Corte di
Cassazione 14 aprile 2011, n. 8487, ove si afferma che anche al giudi-
FHRUGLQDULRq³FRQVHQWLWRGLFRQRVFHUHGLLQWHUHVVLOHJLWWLPLGLFRQo-
scere ed eventualmente annullare un atto della P.A., di incidere conse-
guentemente sui rapporti sottostanti secondo le diverse tipologie di in-
WHUYHQWRJLXULVGL]LRQDOHSUHYLVWH´
Esistono, inoltre, giurisdizioni amministrative speciali come la Cor-
te dei conti e il Tribunale superiore delle acque pubbliche.
Il tema del riparto delle giurisdizioni è stato a lungo oggetto di ag-
giustamenti normativi, di interventi creativi della giurisprudenza, di
riflessioni dottrinali. Il punto di approdo di tale processo di sistema-
zione della materia è rappresentato attualmente dal codice del proces-
so amministrativo, il d.lgs. 2 luglio 2010, n. 104, il quale ha fonda-
mentalmente mantenuto inalterati le caratteristiche e i limiti della giu-
risdizione del giudice amministrativo (dal criterio di riparto in base al-
la situazione giuridica soggettiva ± previsto invero, come detto, dalla
Costituzione ± alla tutela risarcitoria dei danni causati dalla lesione
GHOO¶LQWHUHVVH OHJLWWLPR DOOD HVFOXVLRQH GHOOD JLXULVGL]LRQH VXJOL DWWL
HPDQDWLGDO*RYHUQRQHOO¶HVHUFL]LRGHOSRWHUHSROLWLFRHFRVuYLD 
,OFRGLFHFRQIHUPDO¶DUWLFROD]LRQHGHOODJLXULVGL]LRQHDPPLQLVtrati-
va (ovvero dei vari poteri di cognizione e di decisione del giudice
VI. Le autorizzazioni amministrative in materia di pubblico spettacolo 131

amministrativo) in giurisdizione generale di legittimità, esclusiva ed


estesa al merito.
In questo paragrafo, verrà analizzata in particolare la giurisdizione
esclusiva, ovvero quella che più da vicino riguarda le autorizzazioni
amministrative.
/¶DUW  FRG SURF DPP LQQDQ]LWXWWR GHYROYH DOOD JLXULVGL]LRQH
DPPLQLVWUDWLYD³OHFRQWURYHUVLHQHOOHTXDOLVLIDFFLDTXHVWLRQHGLLQWe-
ressi legittimi e, nelle particolari materie indicate dalla legge, di diritti
VRJJHWWLYL´ primo comma). La Corte costituzionale ha più volte af-
fermato che, nella definizione dei confini della giurisdizione esclusiva,
è necessario, in primo luogo, che la controversia involga situazioni
giuridiche di diritto soggettivo e di interesse legittimo strettamente
connesse (sentenza n. 204/2004). Ma la stessa Corte ha di recente ag-
JLXQWR FKH VH q SXU YHUR LQ OLQHD FRQ OH UDJLRQL VWRULFKH DOO¶RULJLQH
della configurazione di tale giurisdizione, che è normalmente necessa-
ULD OD VXVVLVWHQ]D GL XQ LQWUHFFLR GL SRVL]LRQL JLXULGLFKH QHOO¶DPELWR
del quale risulti difficile individuare i connotati identificativi delle
singole situazioni soggettive, non può escludersi che la cognizione del
giudice amministrativo possa avere ad oggetto anche soltanto diritti
VRJJHWWLYLSXUFKpO¶DPPLQLVWUD]LRQHDJLVFDFRPHDXWRULWjHFLRqDWWUa-
verso la spendita di poteri amministrativi che possono essere esercitati
sia mediante atti unilaterali e autoritativi sia mediante moduli consen-
suali, sia infine mediante comportamenti (sentenze n. 259 del 2009 e
n. 35 del 2010).
Nel suo complesso, la giurisdizione amministrativa è dunque con-
nessa al potere delle pubbliche amministrazioni, nelle quali il codice
ULFRPSUHQGH³DQFKHLVRJJHWWLDGHVVHHTXLSDUDWL o comunque tenuti al
ULVSHWWRGHLSULQFLSLGHOSURFHGLPHQWRDPPLQLVWUDWLYR´
Ciò è esplicitato dal medesimo art. 7, primo comma, cod. proc.
amm., a tenore del quale le controversie devolute alla giurisdizione
DPPLQLVWUDWLYDVRQRTXHOOH³FRQFHUQHQWLO¶HVHUcizio o il mancato eser-
FL]LRGHOSRWHUHDPPLQLVWUDWLYR´(VVHLQROWUH³ULJXDUGDQRSURYYHGi-
menti, atti, accordi o comportamenti riconducibili anche mediatamen-
WHDOO¶HVHUFL]LRGLWDOHSRWHUHSRVWLLQHVVHUHGDSXEEOLFKHDPPLQLVWUa-
]LRQL´WUDWWDVLGLFODXVola generale tesa a spiegare la ratio delle diver-
se ipotesi di giurisdizione amministrativa in termini unitari. Si spiega
FRVu FKH VH ³VRQR DWWULEXLWH DOOD JLXULVGL]LRQH JHQHUDOH GL OHJLWWLPLWj
132 Manuale di diritto delle arti e dello spettacolo

del giudice amministrativo le controversie relative ad atti, provvedi-


menti o omissioni delle pubbliche DPPLQLVWUD]LRQL´ DUW  TXDUWR
comma) e i casi di giurisdizione di merito sono indicati dalla legge e
GDOO¶DUW4 cod. proc. amm. (art. 7, sesto comma JOL³DFFRUGL´HL
³FRPSRUWDPHQWL´ULHQWUDQRQHOODVRODJLurisdizione esclusiva.
6HQRQHVLVWRQRPROWHLQFHUWH]]HFLUFDODULFRQGX]LRQHGHOO¶DWWLYLWj
FRQVHQVXDOH DFFRUGL  DOO¶HVHUFLzio del potere autoritativo (art. 11, l.
  OD TXHVWLRQH GHL³FRPSRUWDPHQWL´q VHPSUHDSSDUVDDVVDL
più delicata e complessa. La Corte costituzionale ha, infine, operato la
distinzione ± ora recepita dal codice ± tra controversie relative a
³FRPSRUWDPHQWL FROOHJDWL DOO¶HVHUFL]LR SXU VH LOOHJLWWLPR GL XQ SXb-
EOLFR SRWHUH´ H ³FRPSRUWDPHQWL´ SRVWL LQ HVVHUH LQ FDUHQ]D GL SRWHUH
ovvero in via di mero fatto, per i quali è da ritenersi costituzionalmen-
te illegittima la relativa devoluzione alla giurisdizione esclusiva (sen-
tenza n. 204 del 2004 e sentenza n. 191 del 2006).
Come già accennato, in alcune specifiche materie previste dalla
legge, tra le quali anche quella relative alle autorizzazioni amministra-
tive, le controversie sono riservate alla competenza esclusiva del giu-
dice amministrativo.
/¶DPELWR GHOOD JLXULVGL]LRQH HVFOXVLYD q VWDWR GHILQLWR GD VXVVe-
guenti interventi legislativi (in particolare, artt. 33 e 34 del d.lgs. n. 80
GHOVRVWLWXLWLGDOO¶DUWGHOODO PDIRQGDPHQWDOPHQWH
ridisegnato dalla giurisprudenza costituzionale, i cui principi si trova-
no ora recepiti nel codice, insieme ad una ricognizione organica (art.
FRGSURFDPP DQFRUFKpQRQWDVVDWLYD VRQRIDWWHVDOYH³XOWe-
ULRUL SUHYLVLRQL GL OHJJH´  GHOOH GLYHUVHH PROWR QXPHURVH LSRWHVL LQ
cui tale giurisdizione ricorre.
,O OHJLVODWRUH GHO  KD GXQTXH FRQIHUPDWR OD ³SLHQD JLXULVGi-
zione´GHOgiudice amministrativo, al quale spettano in primo luogo i
SRWHULLVWUXWWRULSUHYLVWLRUDGDOO¶DUWFRGSURFDPPHLSRWHULGe-
FLVRULJLjULFRQRVFLXWLGDOODSUHFHGHQWHGLVFLSOLQDHDGHVVRGDOO¶DUW
cod. proc. amm., al primo e al quinto comma, (il giudice amministra-
tivo conosce, pure ai fini risarcitori, anche delle controversie nelle
quali si faccia questione di diritti soggettivi), al settimo comma (il
principio di effettività è realizzato attraverso la concentrazione davanti
al giudice amministrativo di ogni forma di tutela degli interessi legit-
VI. Le autorizzazioni amministrative in materia di pubblico spettacolo 133

timi e, nelle particolari materie indicate dalla legge, dei diritti sogget-
tivi).
6L UDPPHQWL LQROWUH FKH O¶DUW  secondo comma, cod. proc.
amm., dopo aver previsto, tanto per la giurisdizione di legittimità che
SHU OH PDWHULH GL JLXULVGL]LRQH HVFOXVLYD FKH ³SXz HVVHUH FKLHVWD OD
FRQGDQQDDOULVDUFLPHQWRGHOGDQQRLQJLXVWRGHULYDQWHGDOO¶LOOHJLWWLPR
HVHUFL]LRGHOO¶DWWLYLWjDPPLQLVWUDWLYDRGDOPDQFDWRHVHUFL]LRGLTXHOOD
REEOLJDWRULD´ DJJLXQJH FKH ³QHL FDVL GL JLXULVGL]LRQH HVFOXVLYD SXz
altresì essere chiesto il risarcimento del danno da lesione di diritti
VRJJHWWLYL´ H DQFRUD ULIHUHQGRVL DG HQWUDPEH OH JLXULVGL]LRQL FKH
³VXVVLVWHQGRLSUHVXSSRVWLSUHYLVWLGDOO¶DUWLFRORGHOFRGLFHFLYLOH,
SXzHVVHUHFKLHVWRLOULVDUFLPHQWRGHOGDQQRLQIRUPDVSHFLILFD´
Si può notare, per concludere sul punto, come le novità più signifi-
cative apportate dal codice del processo amministrativo abbiano inte-
ressato la giurisdizione generale di legittimità, piuttosto che quella
esclusiva, e che le due tendano sostanzialmente ad allinearsi, sebbene
non sia stato del tutto realizzato quel modello unico processuale della
giurisdizione piena che ci si aspettava e la giurisdizione generale di
legittimità non abbia perso del tutto il suo originario carattere impu-
gnatorio-cassatorio.

6.5. I concetti di moralità pubblica e buon costume

Oltre i casi indicati dalla legge, il Questore può sospendere la licenza


di un esercizio nel quale siano avvenuti tumulti o gravi disordini, o
che sia abituale ritrovo di persone pregiudicate o pericolose o che,
FRPXQTXHFRVWLWXLVFDXQSHULFRORSHUO¶RUGLQHSXEEOLFRSHUODPRUDOi-
tà pubblica e il buon costume o per la sicurezza dei cittadini. Qualora
si ripetano i fatti che hanno determinata la sospensione, la licenza può
essere revocata (FRVuUHFLWDO¶DUWGHO7XOSV).
0HQWUH L FRQFHWWL GL ³RUGLQH SXEEOLFR´ H ³VLFXUH]]D´ GHL FLWWDGLQL
appaiono teleologicamente orientati e rispondenti alla natura stessa del
tema che qui stiamo analizzando, più difficile risulta essere la com-
SUHQVLRQHGHJOLDOWULGXHFRQFHWWLUHODWLYLDOOD³PRUDOLWjSXEEOLFD´HGDO
³EXRQFRVWXPH´
134 Manuale di diritto delle arti e dello spettacolo

Tra i tanti interrogativi, ci si chiede fino a quando il buon costume


SXz ULVXOWDUH XQ YDOLGR IUHQR DOO¶RSHUD GHO VRJJHWWo nella tutela
GHOO¶LQWHUHVVHSXEEOLFRHQRQSLXWWRVWRXQGHOLEHUDWRVWUXPHQWRGLFHn-
sura.
Il problema principale posto dalla questione consiste nella delimi-
tazione della nozione costituzionale di buon costume, dal momento
che, nella legislazione ordinaria vigente, a tale concetto si rifanno pre-
visioni molto differenti.
Una nozione molto ampia di buon costume è, ad esempio, quella
XWLOL]]DWD QHOO¶DUW  FRG FLY FKH VDQFLVFH OD LOOLFHLWj GHOla causa
del contratto che sia contraria a norme imperative, alO¶RUdine pubblico
o al buon costume (ad esempio, il contratto avente ad oggetto lo
VFDPELRGLSUHVWD]LRQLVHVVXDOLRLOJLRFRG¶D]]DUGR LQWDOHDFFH]LRQH
il buon costume VLLGHQWLILFDFRQO¶LQVLHPHGHLSULQFLSLHWLFLGRPLQDQWL
in un certo momento storico, ovvero col concetto di pubblica moralità.
8QD FRQFH]LRQH DVVDL SL UHVWULWWLYD q TXHOOD D FXL ULPDQGD O¶DUW
529 cod. pen., che definisce osceni, agli effetti della legge penale, gli
atti e gli oggetti che, secondo il comune sentimento, offendono il pu-
dore: in tale prospettiva il buon costume si traduce nel comune senti-
mento del pudore, cioè in quella particolare forma di riserbo che ac-
compagna le manifestazioni della sessualità, e che fa sì che la colletti-
vità si ritenga offesa dalla pubblica esposizione di parti del corpo, dal-
la rappresentazione o dalla descrizione di atti inerenti alla vita sessuale
che possono provocare fastidio, imbarazzo, disagio, e talvolta anche
forme più gravi di turbamento, specie laddove lo spettatore sia perso-
na minore di età.
La tutela penale non è però circoscritta alla sfera del solo pudore
sessuale, essendo sanzionate, pure se in forma più lieve, anche altre
manifestazioni che possono tuttavia turbare negativamente la sensibi-
lità dello spettatore, come accade quando si punisce il commercio di
scritti, disegni o altri oggetti contrari alla pubblica decenza (art. 725
cod. pen.) o ancora le pubblicazioni a contenuto impressionante o rac-
capricciante (art. 15, l. 47/1948).
Nel corso degli anni traspare comunque un orientamento della Cor-
te costituzionale che rifiuta nettamente le letture estensive, che tendo-
no a far coincidere il buon costume con le concezioni etiche dominanti
in un determinato momento, e sin dalla sentenza n. 9 del 1965 afferma
VI. Le autorizzazioni amministrative in materia di pubblico spettacolo 135

chiaramente la pertinenza della morale alla sfera interiore


GHOO¶LQGLYLGXR H O¶LPSRVVLELOLWj GL LPSRUUH XQD FRQFH]LRQH HWLFD FRQ
strumenti giuridici; allo stesso tempo, però, essa sembra riluttante an-
che ad aderire alla concezione più restrittiva, che restringe la sfera
GHOO¶LOOHFLWR DOOD UDSpresentazione di atti ed oggetti attinenti alla ses-
sualità.
Si può dire che per la Corte esiste una nozione costituzionale di
buon costume, autonoma e distinta da quelle desumibili dalla legisla-
zione ordinaria: ma la Corte si è sempre guardata bene dal fornirne de-
ILQL]LRQLSUHFLVHIRUVHDQFKHSHUODFRQVDSHYROH]]DGHOO¶RSSRUWXQLWjGL
mantenere in capo al concetto quel tanto di elasticità che consenta ai
JLXGLFLGLDGDWWDUORDOO¶HYROX]LRQHGHOVHQWLUHVRFLDOH
In questa prospettiva, il collegamento con i valori di fondo della
Costituzione sembra dover essere ricercato, secondo la Corte, non tan-
WRQHOOHQRUPHVXOODOLEHUWjSHUVRQDOHRVXOODSURWH]LRQHGHOO¶LQIDQ]LD
PDQHOO¶DQFRUDSLDPSLRHVRWWRVWDQWHFRQFHWWRGL©SHUVRQDXPDQDª
la cui promozione la Costituzione (art. 2) pone tra i compiti principali
della Repubblica.
6H LO FROOHJDPHQWR FRQ O¶DUW  FRVW H FRQ LO FRQFHWWR GL GLJQLWj
umana è presente sin dalle prime pronunce delOD&RUWHVXOO¶DUJRPHQWR
questa impostazione assume una rilevanza assolutamente decisiva nel-
la sentenza n. 293 del 2000: in quella occasione, la norma sottoposta
DOO¶HVDPHGHOOD&RUWHQRQFROSLYDODUDSSUHVHQWD]LRQHGLDWWLRRJJHWWL
attinenti alla vita sessuale, bensì la pubblicazione di immagini racca-
priccianti o impressionanti tali da turbare ± così si dice nella fattispe-
cie incriminatrice ± LOFRPXQHVHQWLPHQWRGHOODPRUDOHHO¶RUGLQHIa-
miOLDUH 6LDPR SHUWDQWR IXRUL GDOOD SUREOHPDWLFD GHOO¶RVFHQR GL FXL
DOO¶DUWFRGSHQLQJLRFRQRQqTXLLOVHQWLPHQWRGHOSXGRUHVHs-
suale, ma la morale, sia pure mediata col riferimento al comune sen-
timento, sicché sembrerebbe riproporsi il collegamento tra buon co-
stume e morale dominante.
La Corte, invece, esclude nettamente qualsiasi riferimento ad una
morale maggioritaria o dominante, adRWWDQGR XQ¶LQWHUSUHWD]LRQe
GHOO¶HVSUHVVLRQH comune sentimento della morale tale da consentirne
O¶XWLOL]]R LQ XQD VRFLHWj SOXUDOLVWD H ODLFD SHU OD &RUWH LQIDWWL
O¶HVSUHVVLRQHVi riferisce a ciò che è comune alla pluralità delle conce-
zioni etiche che convivono nella società contemporanea; una sorta di
136 Manuale di diritto delle arti e dello spettacolo

minimo comune denominatore, che sarebbe condiviso da qualsiasi


possibile concezione etica, che viene ravvisato nel valore supremo
delODGLJQLWjGHOODSHUVRQDXPDQDGLFXLDOO¶DUWGHOOD&RVWLWX]LRQH
In quHVWRPRGRVLFRQVHQWHXQ¶HVWHQVLRQHGHOFRQFHWWRGLEXRQFo-
stume che va al di là della sfera del pudore sessuale, senza per ciò solo
VFDGHUH QHOO¶DUELWULR GHO JLXGLFH R DFFUHGLWDUH O¶LGHD GHOOD VXSHULRULWj
di una concezione etica (magari perché maggioritaria) sulle altre. Non
VL VFDGH QHOO¶DUELWULR GHO JLXGLFHDG DYYLVR GHOOD &RUWH SHUFKp QHOOD
valutazione di ciò che appare atto a turbare il comune sentimento della
morale LOJLXGLFHGRYUHEEHDGRWWDUHXQ¶LQWHUSUHWD]LRQHPLQLPDOHGHOOD
nozione, in modo da colpire solo quegli atti che appaiano incompatibi-
li con qualsiasi concezione etica presente nella società contemporanea:
e ciò finirebbe per restringere a tal punto la sfera del penalmente ille-
cito da rendere irrilevante il rischio di arbitrii da parte del giudice.
1RQVLDFFUHGLWDO¶LGHDGHOO¶HVLVWHQ]DGLXQDPRUDOHFROOHWWLYDRGHOOD
superiorità di una concezione etica sulle altre, in quanto ciò che è pu-
nito non è ± e non può essere ± contrario ad una sola concezione etica,
ma deve essere tale da ledere la dignità non di un singolo spettatore o
soggetto rappresentato, ma ± dice opportunamente la Corte ± di ogni
essere umano.
Appare, dunque, particolarmente difficile e di non semplice risolu-
zione la scelta discrezionalHLQFDSRDOO¶DXWRULWjLQTXHVWRFDVR il Que-
store, chiamato a valutare di volta in volta la possibilità di sospendere
la licenza di un esercizio che costituisca un pericolo legato alla mora-
lità pubblica ed al buon costume ex art. 100 Tulps.
Capitolo VII

,UHJLPLILVFDOLHO¶LPSRVWDVXJOLspettacoli
di ANGELICA LAMA

7.1. I regimi fiscali ordinario e semplificato

La disciplina fiscale per i professionisti che operano nel settore dello


spettacolo è variegata e multiforme.
Il ventaglio di opzioni previste dal legislatore è riepilogabile in due
grandi gruppi. Il primo comprende tre regimi fiscali: ordinario, sem-
plificato ed agevolato; il secondo comprende il regime dei minimi, ad
oggi sostituito dal nuovo regime forfetario.
,Q VHGH GL FRPXQLFD]LRQH GHOO¶LQL]LR GHOO¶DWWLYLWj O¶DUWLVWD KD
O¶RQHUHGLLQGLFDUHLOUHJLPHILVFDOHGDDGRWWDUH
Sia il regime fiscale ordinario che quello semplificato richiedono
O¶REEOLJRGLWHQXWDGHOODFRQWDELOLWj
Secondo il regime ordinario la contabilità deve essere registrata con
la tenuta di un libro cronologico dei componenti di reddito e dei mo-
vimenti finanziari, nonché di un libro dei beni ammortizzabili e da un
duplice registro IVA DFURQLPRLPSLHJDWRSHUULIHULUVLDOO¶LPSRVWDVXO
valore aggiunto) finalizzato a raccogliere le fatture emesse e ricevute
(in alternativa, è possibile sostituire libro e registro IVA con specifi-
che annotazioni integrative al libro cronologico).
Secondo il regime semplificato si rende necessaria con la tenuta del
registro IVA acquisti e vendite, nonché del registro incassi e paga-
menti e del libro dei beni ammortizzabili (anche questi ultimi due so-
stituibili con apposite annotazioni sul registro IVA).

137
138 Manuale di diritto delle arti e dello spettacolo

6FRSRGHOODFRQWDELOLWjqTXHOORGLGHWHUPLQDUHLOUHGGLWRGHOO¶DUWLVWD
al fine di calcolare le imposte dirette attraverso la rilevazione dei
FRPSHQVLSHUFHSLWLHGHOOHVSHVHVRVWHQXWHQHOO¶DQQRG¶HVHUFL]LRQRn-
FKpGLHIIHWWXDUHLOFDOFRORSHULRGLFRGHOVDOGRWUDO¶,9$LQFDVVDWDGDL
FRPPLWWHQWL H O¶,9$ SDJDWD DL IRUQLWRUL FRQ O¶REEOLJR GL YHUVDUH
O¶HYHQWXDOHVDOGRSRVLWLYRDOO¶(UDULR.
Il regime ordinario e quello semplificato prevedono altresì
O¶REEOLJR GHOOD OLTXLGD]LRQH SHULRGLFD GHO YHUVDPHQWR SHULRGLFR GL
GLFKLDUD]LRQH DQQXDOH GHOO¶,9$ H GHOOD UHGD]LRQH GL DSSRVLWL TXDGUL
GHOOD GLFKLDUD]LRQH DQQXDOH GHL UHGGLWL 4XHVW¶XOWLPD q Falcolata sul
c.d. criterio di cassa in base al quale i proventi conseguiti e le spese
sostenute concorrono alla formazione del risultato economico nel
momento del loro effettivo incasso e pagamento.
1HO ULVSHWWR GHOOD GLVFLSOLQD FRQWHQXWD QHOO¶DUW  GHO d.P.R. n.
917/1986, per scomputare le spese sostenute dai compensi conseguiti,
O¶DUWLVWDLQTXDOLWjGLODYRUDWRUHDXWRQRPRqWHQXWRDGRFXPHQWDUHWDOL
VSHVHSXUFKpVLDQRDWWLQHQWLDOO¶DWWLYLWjVYROWD /DGHWHUPLQD]LRQHGHO
reddito di lavoro autonomo cosi operata deve poi essere riportata nel
quadro RE in sede di dichiarazione annuale dei redditi. Il reddito
FRPSOHVVLYR GHOO¶DUWLVWD GHWHUPLQDWR GDO UHGGLWR GL ODYRUR DXWRQRPR
più altri redditi eventuali) è così sRJJHWWRDOFDOFRORGHOO¶,53() im-
posta sul reddito delle persone fisiche). Si ricordi che per soggetti che
risiedono in Italia ma che percepiscono proventi per attività svolte
DOO¶HVWHUR YLJH O¶REEOLJR GL GLFKLDUD]LRQH GL WXWWL L UHGGLWL SHUFHSLWL
QHOO¶DQQRVRODUHLQFOXVLTXHOOLSURGRWWLDOO¶HVWHUR

7.2. Il regime fiscale agevolato

/¶DUW  GHOOD O Q  SUHYHGHYD XQ UHJLPH ILVFDOH DJHYRODWR
c.d. forfetario per le nuove iniziative imprenditoriali e di lavoro auto-
QRPR 4XHVW¶XOWLPR q VWDWR GHILQLWLYDPHQWH DEURJDWR GDOOD OHWWHUD D 
del comma GHOO¶DUWOGLFHPEUHQDGHFRUUHUHGDO
1° gennaio 2015. Tuttavia la medesima legge al comma 86 chiarisce
che LVRJJHWWLFKHQHOSHULRGRG¶LPSRVWDLQFRUVRDOGLFHPEUH
si avvalgono del regime fiscaOHDJHYRODWRGLFXLDOO¶DUW 13 della legge
23 dicembre 2000, n. 388, applicano il regime agevolato (fatta salva
VII. ,UHJLPLILVFDOLHO¶LPSRVWDVXJOLVSHWWDFROL 139

O¶RS]LRQH SHU O¶DSSOLFD]LRQH GHOO¶LPSRVWD VXO YDORUH DJJLXQWR H GHOOH


LPSRVWHVXOUHGGLWRQHLPRGLRUGLQDUL VHQHOO¶DQQRSUHFHGHQWH
a) hanno conseguito ricavi, ovvero hanno percepito compensi,
ragguagliati ad anno, non superiori ai limiti indicati ex lege,
diversi a seconda del codice ATECO che contraddistingue
O¶DWWLYLWjesercitata;
b) hanno sostenuto spese per un ammontare complessivamente non
superiore ad euro 5.000 lordi per lavoro accessorio
specificamente disciplinato;
c) il costo complessivo, al lordo degli ammortamenti, dei beni
VWUXPHQWDOLDOODFKLXVXUDGHOO¶Hsercizio non supera 20.000 euro;
d) L UHGGLWL FRQVHJXLWL QHOO¶DWWLYLWj G¶LPSUHVD GHOO¶DUWH R GHOOD
professione sono in misura prevalente rispetto a quelli
eventualmente percepiti come redditi di lavoro dipendente e
redditi assimilati a quelli di lavoro dipendente. La verifica della
suddetta prevalenza non è, comunque, rilevante se il rapporto di
lavoro è cessato o la sommD GHL UHGGLWL G¶LPSUHVD GHOO¶DUWH R
professione e di lavoro dipendente o assimilato non eccede
O¶LPSRUWRGLHXUR
Gli artisti che adottano questo regime sono esonerati dalla tenuta
GHOOHVFULWWXUHFRQWDELOLGDOO¶HIIHWWXD]LRQHGHOOHUHJLVWUD]LRQLFontabili
e dalla liquidazione e dai versamenti periodici ai fini IVA, ed il loro
UHGGLWRQRQqVRJJHWWRDULWHQXWHG¶DFFRQWR
Sono tuttavia tenuti alla conservazione dei documenti contabili, a
fatturare i compensi, a certificare i corrispettivi, al versamento IVA,
alla determinazione del reddito imponibile in modo analitico, ad as-
soggettare ad imposta sostitutiva del 10% il reddito netto.

7.3. Il nuovo regime forfetario ex legge di stabilità 2015

Con la legge di stabilità 2015, il regime c.d. dei minimi, risultato per
molto tempo particolarmente conveniente, è stato sostituito da un
nuovo regime forfetario per gli imprenditori individuali e gli esercenti
arti e professioni. Le disposizioni in materia tuttavia ancora consento-
no ai soggetti che nel 2014 hanno applicato il regime dei minimi, che
lo ritengano ad oggi ancora il regime più conveniente, di continuare a
140 Manuale di diritto delle arti e dello spettacolo

fruirne in luogo di quello forfetario. Consentono inoltre, ai soggetti


FKH KDQQRLQWUDSUHVR QXRYH DWWLYLWj SURGXWWLYH GL UHGGLWL G¶LPSUHVD R
di lavoro autonomo nel 2013 o nel 2014 ed applicato i precedenti re-
gimi di favore, di fruire della riduzione di un terzo del reddito per i so-
OLSHULRGLG¶LPSRVWDFKHUHVLGXDQRDOFRPSOHWDPHQWRGHOWULHQQLRDJe-
volato. Ma vediamo nello specifico come la nuova normativa discipli-
na tale regime fiscale.
,FRPPLGDDGGHOO¶DUWGHOODOHJJHGLVWDELOLWjSHULO
hanno regolamentato in modo dettagliato un nuovo regime forfetario
di determinazione del reddito degli esercenti attività artistiche, che in
sostituzione alle imposte dovute (IRPEF, relative addizionali ed
IRAP, acronimo di imposta regionale sulle attività produttive) viene
DVVRJJHWWDWRDGXQ¶XQLFDLPSRVWDVRVWLWXWLYDSDULDO,OUHGGLWRGD
DVVRJJHWWDUH DOOD GHWWD LPSRVWD VRVWLWXWLYD QHOO¶DQQR GL inizio della
stessa e nei due successivi è ridotto di un terzo se viene intrapresa una
nuova attività.
I professionisti che si avvalgono di tale regime sono esonerati dalla
tenuta delle scritture contabili ai fini delle imposte sui redditi e
GHOO¶,9$ GDJOi obblighi di rivalsa e detrazione, di liquidazione, ver-
samento e presentazione delle dichiarazioni e comunicazioni annuali
DLILQLGHOO¶,9$ SHUPDQHVROWDQWRO¶REEOLJRGLFRQVHUYD]LRQHGLTXe-
ste ultime).
Con il nuovo regime forfetario gli studi di settore e dei parametri
QRQ VRQR DSSOLFDWL DOO¶DUWLVWD ODYRUDWRUH DXWRQRPR LO TXDOH q HVHQWH
GDOO¶REEOLJR GL HIIHWWXDUH FRPXQLFD]LRQL WHOHPDWLFKH FLUFD OH RSHUa-
zioni effettuate nei confronti di operatori economici aventi sede, resi-
denza o domicilio nei Paesi delle black list ed alle dichiarazioni
G¶LQWHQWR ULFHYXWH HG LQROWUH QRQ VXELVFH O¶REEOLJR GL SUHVHQWa-
re comunicazioni relative al c.d. spesometro. I contribuenti che appli-
cano il regime forfetario, inoltre, non rivestono la qualifica di sostituti
G¶LPSRVWDed i compensi o ricavi da essi conseguiti non sono assogget-
WDWLDULWHQXWDG¶DFFRQWR
Obiettivo della nuova disciplina è certamente quello di rendere più
coerente il sistema di tassazione delle piccole imprese e più semplice
O¶DSSOLFD]LRQHGHOOHQRUPHHOD determinazione delle basi imponibili,
riducendo i costi di adempimento per i contribuenti.
VII. ,UHJLPLILVFDOLHO¶LPSRVWDVXJOLVSHWWDFROL 141

Il nuovo regime si applica a decorrere dal periodo di imposta suc-


cessivo a quello in corso al 31 dicembre 2014. Possono fruire del re-
gime forfetario coloro che esercitano arti e professioni non in forma
associata, indipendentemente dal fatto che abbiano svolto le attività
SURGXWWLYHGLUHGGLWLGLODYRURDXWRQRPRRG¶LPSUHVDDQWHULRUPHQWHDO
2015, in tale anno o in quelli successivi. Ai professionisti in possesso
dei requisiti richiesti, questo regime si applica senza dover effettuare
alcuna scelta espressa.
Possono usufruire del regime forfetario i soggetti che risiedono in
,WDOLD LQ XQR GHJOL 6WDWL PHPEUL GHOO¶Unione europea oppure in uno
6WDWRDGHUHQWHDOO¶$FFRUGR sullo Spazio economico europeo che assi-
FXUL XQ DGHJXDWR VFDPELR GL LQIRUPD]LRQL FRQ O¶,WDOLD H FKH SURGXFD
nel territorio dello Stato italiano redditi uguali o superiori al 75% del
reddito complessivamente prodotto. Non possono avvalersi del regime
forfetario, oltre ai soggetti non residenti in uno degli Stati sopra indi-
cati, i soggetti che non rispettano le seguenti condizioni:
a) le persone fisiche che si avvalgono di regimi speciali ai fini
GHOO¶IVA o di regimi forfetari di determinazione del reddito;
b) i soggetti che in via esclusiva o prevalente effettuano cessioni di
fabbricati o porzioni di fabbricato, di terreni edificabili di cui
DOO¶DUW 10, primo comma, numero 8), del d.P.R. n. 633/1972 o di
PH]]LGLWUDVSRUWRQXRYLGLFXLDOO¶art. 53, primo comma, del d.l.
30 agosto 1993, n. 331, convertito dalla l. 29 ottobre 1993, n.
427;
c) JOLHVHUFHQWLDWWLYLWjG¶LPSUHVDDUWLRSURIHVVLRQLFKHSartecipa-
no, contemporaneamente DOO¶HVHUFL]LR GHOO¶DWWLYLWj D VRFLHWj GL
SHUVRQHRDVVRFLD]LRQLGLFXLDOO¶art. 5 del Testo Unico delle im-
poste sui redditi (TUIR) ovvero a società a responsabilità limita-
ta a ristretta base proprietaria che hanno optato per il regime del-
la trasparenzDILVFDOHGLFXLDOO¶art. 116 del TUIR.
4XHVW¶XOWLPD GLVSRVL]LRQHq YROWDDG HYLWDUH che i redditi apparte-
QHQWLDOODVWHVVDFDWHJRULDG¶LPSUHVDRGLODYRURDXtonomo, conseguiti
QHOORVWHVVRSHULRGRG¶LPSRVWDHGLPSXWDELOLDOPHGHVLPRFRQWULEXHn-
te, siano assoggettati a due diversi regimi di tassazione (risoluzione n.
146/E del 9 giugno 2009 GHOO¶$JHQ]LDGHOOH(QWUDWH).
Si rammenti che le cause di esclusione devono essere riferite al
PRPHQWR GL DSSOLFD]LRQH GHO UHJLPH H QRQ DOO¶DQQR DQWHFHGHQWH
142 Manuale di diritto delle arti e dello spettacolo

DOO¶LQJUHVVR QHO PHGHVLPR ,O YHULILFDUVL GL XQD GHOOH SUHGHWWH FDXVH
QHOO¶DQQR SUHFHGHQWH DOO¶DFFHVVR, infatti, non è di impedimento
DOO¶DSSOLFD]LRQHGHOUHJLPHTXDORUDOe stesse siano venute meno prima
GHOO¶LQL]LRGLWDOHDQQR
Il regime forfetario presenta certamente molti punti di analogia con
il regime dei minimi, così come del resto evidenziato nella relazione
illustrativa alla legge che introduce il regime fiscale in analisi, nella
quale si afferma che il regime forfetario ha alcuni punti in comune con
il precedente regime fiscale di vantaggio ± cosiddetto dei minimi ± ma
tiene comunque conto della evoluzione normativa che ha caratterizza-
to il sistema tributario negli XOWLPLDQQLHGHOO¶RELHWWLYRGLXQDDQFRU
più accentuata esigenza di semplificazione che ha riguardato, in primo
luogo, la determinazione del reddito in modo forfetario, in coerenza
con i criteri direttivi presenti nella legge delega.
Pur costando di notevoli similitudini tuttavia i due regimi differen-
ziano tra loro in due aspetti fondamentali:
a) inesistenza di un limite temporale di applicazione del regime
forfetario, che, di conseguenza, trova applicazione anche dopo i
primi cinque anni di attività;
b) insussLVWHQ]DGLXQOLPLWHG¶HWjLOQXRYRUHJLPHGLVFLSOLQDWRGDl-
la legge di stabilità 2015 non si limita al compimento del 35°
anno di età.
Il nuovo regime forfetario può pertanto ritenersi un incentivo di ca-
rattere strutturale, che non è limitato alle attività in fase di start up.
La soglia dei compensi o ricavi che non deve essere superata per
fruire del regime forfetario non è più stabilita nella misura fissa di
30.000 euro, uguale per tutte le attività esercitate: sono stati stabiliti
limiti diversi a seconda del codice Ateco che contraddistingue
O¶DWWLYLWj
,QILQHO¶DOLTXRWDGHOO¶LPSRVWDVRVWLWXWLYDVDOHGDODOHGRYUj
calcolarsi sul reddito imponibile determinato applicando
DOO¶DPPRQWDUHGHLULFDYLRFRPSHQVLSHUFHSLWLXQFRHIILFLHQWHGLUHGGi-
tività, FKHYDULDLQEDVHDOO¶DWWLYLWjVYROWD
VII. ,UHJLPLILVFDOLHO¶LPSRVWDVXJOLVSHWWDFROL 143

7.4. /¶LPSRVL]LRQHILVFDOHVXconcerti vocali e strumentali

Ai sensi del G35  LVWLWXWLYR GHOO¶,9$ LQ DSSOLFD]LRQH GHOOD


Tabella A, parte III, gli spettacoli teatrali di qualsiasi tipo, compresi
opere liriche, balletto, prosa, operetta, commedia musicale, nonché i
concerti vocali e strumentali sono VRJJHWWL DOO¶DOLTXRWD DJHYRODWD GHO
3HUWDQWRTXHVW¶DOLTXRWDGHYHHVVHUHDSSOLFDWDGDgli operatori del
settore sui FRQWUDWWLGLVFULWWXUDUHODWLYLDOO¶HVHcuzione di concerti voca-
li e strumentali.
8Q¶DQQRVD TXHVWLRQH KD DYXWR RULJLQH LQ PDWHULDD VHJXLWR GL XQD
ULVROX]LRQHGHOO¶$JHQ]LDGHOOH(QWUDWHQ(GHOLQULVSRVWDDG
LQWHUSHOORGLXQ¶RUFKHVWUDPXVLFDOHFKHVRVWHQHYDFKHLFRQFHUWLYRFDOL
e sWUXPHQWDOL IRVVHUR VRJJHWWL DOO¶DOLTXRWD RUGLQDULD GHO  H FKH
O¶,9$DJHYRODWa si dovesse applicare solo ai contratti di scrittura con-
nessi agli spettacoli teatrali per il fatto che i concerti vocali e strumen-
tali, nella voce 123, risultano separati da un punto e virgola dagli spet-
tacoli teatrali di qualsiasi tipo. Tuttavia già nel corso del 2006, con
due distinte sentenze, le Commissioni Tributarie di Parma e Firenze
ULFRQRVFHYDQR YDOLGD O¶DOLTXRWD ,9$ GHO  VXL FRQFHUWL Yocali e
strumentali, eccependo al d.lgs. 60/19 VXOOD EDVH GHOO¶DUW  GHOOD
&RVWLWX]LRQH OD OHJLWWLPLWj GL GHOHJD ULVSHWWR DOO¶XOWLPD OHJJH GHOHJD
288/1998 il cui testo riportava la voce 123 assolutamente identica ai
WHVWL SUHYLJHQWL SURYD QH q DQFRUD QHO  O¶HOHQFD]LRQH GHO 123
che la circolare 165/E-2000 del Ministero delle Finanze fornisce nella
VWHVXUDG¶RULJLQH.
A fare definitiva chiarezza in materia è poi intervenuta la legge fi-
nanziaria del 2007 che con interpretazione autentica del d.P.R. 633/72
ha ribadito che i concerti vocali e strumentali sono soggetti
DOO¶DOLTXRWDDJHYRODWDGHO

7.5. Il divieto di doppia imposizione fiscale

Al fine di evitare doppie imposizioni sul reddito e sul patrimonio o di


HOXGHUHLVLVWHPLILVFDOLQD]LRQDOLO¶2UJDQL]]D]LRQHSHUODFRoperazio-
ne e lo sviluppo economico (OCSE) ha ritenuto opportuno disciplinare
un criterio di imponibilità che in deroga a quanto previsto per altri
144 Manuale di diritto delle arti e dello spettacolo

professionisti, con particolare riguardo ad artisti e sportivi, ha previsto


FKH ³L UHGGLWL FKH XQ UHVLVWHQWH di uno Stato contraente, in qualità di
SURIHVVLRQLVWD GHOOR VSHWWDFROR >«@ ULWUDH GDOOH VXH DWWLYLWj SHUVRQDOL
HVHUFLWDWH QHOO¶DOWUR 6WDWR FRQWUDHQWH VRQ LPSRQLELOL LQ GHWWR 6WDWR
Qualora i redditi relativi a prestazioni personali effettuate da un artista
>«@ VLDQR FRUULVSRVWL QRQDOO¶DUWLVWD PDDG XQ¶DOWUD SHUVRQD GHWWD Ue-
PXQHUD]LRQH q >«@ LPSRQLELOH QHOOR 6WDWR FRQWUDHQWH QHO TXDOH OH
SUHVWD]LRQLGHOO¶DUWLVWDRGHOORVSRUWLYRVRQRHVHUFLWDWH´&LzqTXDQWR
HQXFOHDWRDOO¶DUWGHOFGPRGHOOR2&6(FKHGLVFLSOLQDO¶LSRWHVLGL
UHGGLWLGHULYDQWLGDOO¶DWWLYLWjSHUVRQDOHSUHVWDWDQHOO¶DPELWRGLXQUDp-
porto di lavoro dipendente o indipendente, percepiti dai professionisti
GHOORVSHWWDFRORPXVLFLVWLHVSRUWLYL/DSHFXOLDULWjGHOO¶DWWLYLWjVYROWD
da questi ultimi infatti porta tali professionisti non residenti a rimanere
QHOWHUULWRULRGHOOR6WDWRSHULOEUHYHWHPSRQHFHVVDULRDOO¶HVHFX]LRQH
della prestazione programmata, senza disporre generalmente di alcuna
base fissa in uno Stato diverso da quello di residenza percependo red-
diti di notevoli importi. Pertanto, pur in assenza di una sede fissa o di
un periodo minimo di permanenza nello Stato della fonte, i redditi
conseguiti dagli artisti sono imponibili nello Stato in cui viene svolta
O¶DWWLYLWjGDFXLWUDggono origine anziché nello Stato di residenza del
percettore.
Nella pratica possono manifestarsi situazioni in cui apparirà diffici-
OHVWDELOLUHVHO¶DWWLYLWjVYROWDGDXQGHWHUPLQDWRVRJJHWWRSRVVDHVVHU
qualificata come attività di un professionista dello spettacolo, un mu-
sicista o se invece sia estranea a tale nozione. Il requisito della profes-
VLRQDOLWjqWDVVDWLYRDLILQLGHOO¶DSSOLFDELOLWjGHOO¶DUWHQRQSRWUjHs-
VHUHVRVWLWXLWRDYHQGRULJXDUGRDOO¶DELWXDOLWjGHOO¶DWWLYLWjVYROWDHGDOOD
presenza di una remunerazione.
1RQqVHPSUHVHPSOLFHLQGLYLGXDUHLVRJJHWWLFKHQHOO¶DPELWRGHOOD
realizzazione di uno spettacolo svolgono attività di contenuto artistico
LQVHQVRFRQIRUPHDTXDQWRVWDELOLWRDOO¶DUW/DYDULHWjGHOOHILJXUH
che orbitano intorno allo spettacolo potrebbe portar erroneamente ad
HVWHQGHUHLO WUDWWDPHQWR SUHYLVWR DOO¶DUW DQFKH D VRJJHWWL FKH SXU
QRQDSSDUHQGRGLUHWWDPHQWHVRQRDQFK¶HVVLDUWHILFLGHOO¶HYHQWR SHFu-
liare esempio è quello del regista). Risulta problematica anche la ge-
stione fiscale per coloro i quali rivestono nel medesimo spettacolo più
attività percependo per entrambe un unico compenso (si pensi
VII. ,UHJLPLILVFDOLHO¶LPSRVWDVXJOLVSHWWDFROL 145

DOO¶LSRWHVLGHOPXVLFLVWDFKHVYROJDDQFKHDWWLYLWjGLGLUHWWRUHDUWLVWLFR
GHOO¶HYHQWR ,QTXHVWLFDVLqHVVHQ]LDOHVFLQdere il compenso percepito
oppure stabilire quale delle due attività sia quella predominante e per-
tanto sottoporla al relativo regime di tassazione.
A livello OCSE si è altresì posto il problema di stabilire se ricom-
prendere nei corrispettivi a tassazione ex art. 17 solo quelli percepiti
TXDOL UHGGLWL GHULYDQWL GDOO¶DWWLYLWj DUWLVWLFD LQ VHQVR VWUHWWR R ULFRm-
SUHQGHUHDQFKHTXHOOLSHUFHSLWLDGDOWURWLWROR/¶RULHQWDPHQWRVHSSXU
non espressamente disciplinato, tende ad esser piuttosto restrittivo e
tende ad DVVRJJHWWDUH DO UHJLPH VSHFLDOH SUHYLVWR GDOO¶DUW  VROR L
UHGGLWLGHULYDQWLGDOODSDUWHFLSD]LRQHDGXQ¶HVLEL]LRQHDUWLVWLFDRVSRr-
tiva, escludendo altre fattispecie reddituali che dovranno pertanto es-
ser ricondotte alle norme convenzionali ad esse specificamente appli-
cabili.
Va sottolineato che il modello OCSE (né il Commentario) non con-
tiene alcuna indicazione circa le modalità di determinazione del reddi-
WR LPSRQLELOH GHULYDQWH GDOO¶DWWLYLWj DUWLVWLFD H GHOOH DOLTXRWH DG HVVR
applicabili rimandando cosi alle disposizioni previste dalla normativa
interna degli Stati contraenti. Le norme interne possono pertanto isti-
tuire forme di imposizione diverse, prevedendo oneri deducibili ed
aliquote variabili di Stato in Stato. È possibile inoltre, in conformità
alOHGLVSRVL]LRQL2&6(FKHJOL6WDWLHVFOXGDQRO¶DSSOLFDELOLWjGHOO¶DUW
17 per i redditi conseguiti da artisti in dipendenza della partecipazione
ad eventi finanziati con denaro pubblico.

7.6. Il Fondo Unico per lo Spettacolo

Il Fondo Unico per lo SpetWDFRORQRWRFRQO¶DFURQLPRGL)86qVWDWR


istituito nel sistema italiano con la legge n. 163/1985 con lo scopo di
sostenere, attraverso un sistema di finanziamento pubblico rigidamen-
te normativizzato, i settori del mondo dello spettacolo nonché per
promuRYHUHLQ,WDOLDRDOO¶HVWHURLQL]LDWLYHLQWDOVHWWRUH
Come la medesima legge chiarisce il Fondo unico per lo spettacolo
è ripartito annualmente tra i diversi settori in ragione di quote non in-
feriori al 45% per le attività musicali e di danza, al 25% per quelle ci-
QHPDWRJUDILFKHDOSHUTXHOOHGHOWHDWURGLSURVDHGDOO¶ % per
146 Manuale di diritto delle arti e dello spettacolo

quelle circensi e dello spettacolo viaggiante; la quota residuale andrà a


costituire fondo di riserva per far fronte ad eventuali interventi inte-
grativi in base alle esigenze dei singoli settori.
Il Ministero dei beni e delle attività culturali e del turismo ha indi-
cato nel d.m. 1 luglio 2014 i nuovi criteri per la liquidazione e
O¶DQWLFLSD]LRQHGLFRQWULEXWLDOORVSHWWDFRORGDOYLYRDQGDQGRDGLVFi-
plinare le modalità di concessione dei contributi FUS a partire
GDOO¶HVHUFL]LR
Requisito indispensabile di accesso ai contributi FUS è il compro-
YDWRVYROJLPHQWRSURIHVVLRQDOHGHOO¶DWWLYLWjHGLQSDUWLFRODUHSHUOHDt-
tività tersicoree e musicali i soggetti istanti non devono perseguire
scopo di lucro.
3HUSRWHUXVXIUXLUHGLWDOLIRQGLO¶DUWLVWDGRYUjSUHVHQWDUHGRPDQGD
telematica corredata della documentazione richiesta ex art. 3, secondo
comma, del summenzionato d.m. che in particolare richiede la presen-
tazione:
a) copia conforme all¶RULJLQDOHGHOO¶DWWRFRVWLWXWLYRHGHOORVWDWXWR
in forma di atto pubblico o di scrittura privata registrata, nonché
elenco dei soci, qualora tali atti non siano già in possesso
GHOO¶$PPLQLVWUD]LRQH
b) dichiaraziRQH UHVD DL VHQVL GHOO¶DUW 46 del d.P.R. 28 dicembre
2000, n. 445, e successive modificazioni, con la quale si rappre-
sentano eventuali variazioni dei dati risultanti dagli atti di cui al-
la lettera a);
c) progetto artistico triennale, ovvero di durata massima di diciotto
mesi nel caso di tournée DOO¶HVWero, redatto secondo gli appositi
PRGHOOLSUHGLVSRVWLGDOO¶$PPLQLVWUD]LRQH
d) SURJUDPPDDQQXDOHFRQWHQHQWHSHUO¶DQQRGLULIHULPHQWRLGDWL
e gli elementi relativi alla qualità artistica, alla qualità indicizza-
ta e alla dimensione quantitativa del progetto, nonché relativo
bilancio preventivo, redatti secondo gli appositi modelli predi-
VSRVWLGDOO¶$PPLQLVWUD]LRQH,OELODQFLRSUHYHQWLYRGHYHLQGLFa-
re chiaramente i ricavi diretti, nonché i costi ammissibili del
SURJHWWRDLVHQVLGHOO¶DUW 1, quarto comma, del decreto, ed evi-
GHQ]LDUH LO UHODWLYR GHILFLW /¶DGHPSLPHQWR GL FXL DOOD SUHVHQWH
OHWWHUDGHY¶HVVHUHUHLWHUDWRQHLGXHVXFFHVVLYLDQQLGHOWULHQQLR
e) autodichiDUD]LRQH DL VHQVL GHOO¶DUW 47 del decreto n. 445 del
VII. ,UHJLPLILVFDOLHO¶LPSRVWDVXJOLVSHWWDFROL 147

2000, redatta secondo gli appositi modelli predisposti


GDOO¶$PPLQLVWUD]LRQH DWWHVWDQWH O¶LPSHJQR DO UDJJLXQJLPHQWR
dei requisiti minimi di attività e il rispetto delle altre condizioni
previste, per il settore di riferimento della domanda, per
O¶DPPLVVLRQHDOFRQWULEXWR
f) dichiarazione di osservanza dei contratti collettivi nazionali di
ODYRURTXDORUDVXVVLVWDQRSHUOHFDWHJRULHLPSLHJDWHQHOO¶DWWLYLWj
sovvenzionata, nonché della correlata regolarità contributiva;
g) dichiarazione, effettuata ai sensi del d.P.R. n. 445 del 2000, di
impegno ad acquisirH HG LQYLDUH DOO¶$PPLQLVWUD]LRQH LO FHUWLIi-
caWRGLDJLELOLWjULODVFLDWRGDOO¶,136 JHVWLRQHH[(13$/6FRQ
VSHFLILFDPDWULFRODSHUO¶DWWLYLWjSHUODTXDOHqFKLHVWRLOFRQWUi-
EXWRqDPPHVVDDOFRQWULEXWRXQLFDPHQWHO¶DWWLYLWjVYROWDLQFo-
stanza del possesso del certificato di agibilità INPS gestione ex
ENPALS intestato al soggetto richiedente; inoltre, in caso di
ospitalità, è richiesta analoga dichiarazione attestante utilizza-
zione di soggetti in possesso di certificato di agibilità INPS ge-
stione ex ENPALS intestato ai medesimi;
h) LQGLFD]LRQHGHOODUHJLRQHLQFXLLOVRJJHWWRVYROJHO¶DWWLYLWjSUe-
valente, ove diversa dalla regione della propria sede legale;
i) per i soggetti di cui agli artt. 33 e 34 del decreto, oltre a quanto
appena indicato, la documentazione di cui alle citate disposizio-
ni;
j) per i soggetti di cui al Capo V, Titolo III, del decreto, oltre a
quanto richiesto dalle lettere a), b), f), g) ed h), la documenta-
zione richiesta ai sensi degli articoli di cui al medesimo Titolo.
Le domande, che in caso di progetti triennali dovranno essere pre-
sentate entro il termine perentorio del 31 gennaio di ogni prima annua-
lità di ciascun triennio, possono esser presentate per i seguenti ambiti:
a) teatro;
b) musica;
c) danza;
d) circhi e spettacolo viaggiante;
e) progetti multidisciplinari;
f) azioni trasversali.
,QSDUWLFRODUHSHUTXHOFKHLQWHUHVVDVSHFLILFDPHQWHO¶DPELWRPXVi-
cale questo include teatri di tradizione, istituzioni concertistico-
148 Manuale di diritto delle arti e dello spettacolo

orchestrali, attività liriche ordinarie, complessi strumentali e comples-


si strumentali giovanili, circuiti regionali, programmazione di attività
FRQFHUWLVWLFKH H FRUDOL IHVWLYDO /¶DUWLVWD ULFKLHGHQWH SXz presentare
ILQRDGXHGRPDQGHSHUVHWWRULGLYHUVLDOO¶LQWHUQRGHOSURSULRDPELWR
RSSXUHSHULOVRORVHWWRUH³SURPR]LRQH´QHOO¶DPELWR³D]LRQL trasversa-
OL´,QROWUHLVRJJHWWLULFKLHGHQWLSHUO¶DPELWR³PXVLFD´VHWWRUH³WHDWUL
GL WUDGL]LRQH´ SRVVRQR SUHVHQWDUH XQD GRPDQGD DQFKH SHU O¶DPELWR
³GDQ]D´UHODWLYDPHQWHDOVHWWRUH³IHVWLYDOHUDVVHJQH´RSHUO¶DPELWR
³SURJHWWLPXOWLGLVFLSOLQDUL´UHODWLYDPHQWHDOVHWWRUH³IHVWLYDOPXOWLGi-
VFLSOLQDUL´
La domanda così presentata verrà successivamente valutata con
precisi parametri di classificazione prestabiliti.
Superata la fase di valutazione e una volta decretata O¶DVVHJQD]LRQH
del contributo finanzLDULRGDSDUWHGHOO¶$PPLQLVWUD]LRQHTXHVW¶XOWLPD
SXz HURJDUH XQD DQWLFLSD]LRQH QHOOD PLVXUD GHOO¶ GHO FRQWULEXWR
PHGHVLPR RSSXUH VX LVWDQ]D GHOO¶LQWHUHVVDWR FKH DEELD RWWHQXWR
O¶LQWHUYHQWRGDDOPHQRWUHDQQLHFKHDEELDUHJRODUPHQWHGRFXPHQWDWR
O¶DWWLvità, può erogare una anticipazione sui contributi ancora da asse-
JQDUHILQRDGXQPDVVLPRGHOGHOO¶XOWLPRFRQWULEXWRRWWHQXWR
In seguito onere del professionista sarà quello di presentare an-
QXDOPHQWH XQD UHOD]LRQH FRQVXQWLYD DOO¶$PPLQLVWUD]LRQH FKH GHve
contenere tra le altre:
a) LO ELODQFLR GL SURJHWWR UHODWLYR DOO¶DWWLYLWj VYROWD UHFDQWH L GDWL
economico-finanziari, imputati con pertinenza alle attività sov-
YHQ]LRQDWHGDOO¶$PPLQLVWUD]LRQH
b) XQDGHWWDJOLDWDUHOD]LRQHDUWLVWLFDUHODWLYDDOO¶DWWLYLWjVYROWa, con-
tenente i riferimenti anche al progetto artistico GHOO¶DQQR, com-
prensiva di dichiarazione di aver rispettato i requisiti minimi di
accesso per singolo settore.
/¶$PPLQLVWUD]LRQHSRWUjLQTXDOVLDVLPRPHQWRSURFHGHUHDYHULIi-
che amministrativo-contabili, al fine di accertare la regolarità degli atti
ULJXDUGDQWLO¶DWWLYLWjVRYYHQ]LRQDWD
Capitolo VIII

Il diritto dello spettacolo nella normativa


internazionale e comunitaria
di ANNALISA KORINTHIOS

8.1. Profili introduttivi e indicazioni metodologiche

,O GLULWWR G¶DXWRUH H GHOOR VSHWWDFROR ULQYLHQH OD SURSULD GLVFLSOLQD LQ
molteplici fonti, nazionali e sovranazionali. Si tratta, come è noto, di
una materia trasversale, che presenta interessanti profili di interferenza
con diversi settori, il che testimonia le evidenti difficoltà
QHOO¶DSSURFFLRDOODVWHVVDGDSDUWHGHJOLVWXGLRVL
Nel presente capitolo si circoscriverà il campo di indagine alla di-
sciplina internazionale e a quella comunitaria, soffermandosi sugli atti
vincolanti e anche su quelli a carattere non vincolante più rilevanti. In-
fine, si tenterà di trarre alcune considerazioni in merito alla evoluzione
della legislazione sovranazionale nel corso degli ultimi anni.
Questo lavoro di ricostruzione verrà condotto partendo dalle enun-
ciazioni di principio sulla libertà di espressione contenute nella Di-
FKLDUD]LRQH8QLYHUVDOHGHL'LULWWLGHOO¶8RPRSHUSRLVRIIHUPDUVLVXOOD
WXWHODGHOO¶DUWHQHOOD&DUWDGL1L]]DHGLQILQHDSSURIRQGLUHVXOSLDQR
UHJLRQDOH O¶DUW  GHOOD &RQYHQ]LRQH (XURSHD GHL 'LULWWL GHOO¶8RPR
(CEDU). Successivamente, si accennerà alla disciplina sul diritto
G¶DXWRUHFKHVLULQYLHQHQHOGLULWWRLQWHUQD]LRQDOHFRQYHQ]LRQDOH8QD
particolare attenzione sarà dedicata alla Convenzione di Berna,
DOO¶$FFRUGR75,36 Agreement on Trade Related Aspects of Intellec-
tual Property Rights, cioè Accordo sugli aspetti commerciali dei diritti

149
150 Manuale di diritto delle arti e dello spettacolo

GLSURSULHWjLQWHOOHWWXDOH HDOO¶$FFRUGRGHOO¶2UJDQL]]D]LRQHPRQGLDOH
per la proprietà intellettuale (OMPI). Infine, verrà analizzata la norma-
tiva comunitaria più rilevante, con particolare riguardo alle principali
direttive emanate in materia.

,OGLULWWR G¶DXWRUHHGHOORVSHWWDFRORQHOOD'LFKLDUD]LRQH8Qi-
YHUVDOHGHL'LULWWLGHOO¶8RPR

Come anticipato, si prenderanno le mosse dalla Dichiarazione Univer-


sDOHGHL'LULWWLGHOO¶8RPRGLFXLYHUUDQQRDQDOL]]DWLGLIIXVDPHQWHJOL
artt. 27 e 19, che si occupano di profili diversi, ma entrambi ugual-
mente importanti per il diritto dello spettacolo.
4XDQWR DO SULPR SURILOR O¶DUW  primo comma DIIHUPD ³2JQL
individuo ha diritto di prendere parte liberamente alla vita culturale
della comunità, di godere delle arti e di partecipare al progresso scien-
tifico ed ai suoi beneILFL´,OVHFRQGRFRPPD SUHYHGHFKH³2JQLLQGi-
viduo ha diritto alla protezione degli interessi morali e materiali deri-
vanti da ogni produzione scientifica, letteraria e artistica di cui egli sia
DXWRUH´
/¶DUWGHOOD'LFKLDUD]LRQHLQYHFHWXWHODODOLEHUWjGLRSLQLRQHH
di espressione e comprende il diritto di non essere molestati per la
propria opinione e quello di cercare, ricevere e divulgare informazioni
e idee con ogni mezzo e senza riguardo a frontiere.
È opportuno soffermarsi sulla portata di tali articoli, non prima, pe-
rò, di aver accennato brevemente al valore giuridico di tale Dichiara-
]LRQH4XHVW¶XOWLPDqSULYDGLYDORUHYLQFRODQWHHVVHQGRXQDVHPSOLFH
raccomandazione. Ciò nonostante, non può disconoscersi alla stessa
XQDFHUWDLPSRUWDQ]DLQTXDQWRFRP¶qQRWRODQRQYLQFRODWLYLWjGHOOH
raccomandazioni non implica che esse siano per ciò solo prive di
qualsivoglia valore giuridico. Queste, infatti, producono un effetto di
liceità, in virtù del quale è da considerarsi pienamente lecito un atto,
di per sé illecito, posto in essere per rispettare una raccomandazione.
Fatte le opportune precisazioni sulla portata della Dichiarazione
8QLYHUVDOH GHL 'LULWWL GHOO¶8RPR RFFRUUH RUD DQDOL]]DUH SL VSHFLIi-
camente la prima di tali norme. Essa proclama la necessità di tutelare
la creatività e la crescita culturale, artistica e scientifica, nella consa-
VIII. Il diritto dello spettacolo nella normativa internazionale e comunitaria 151

SHYROH]]DFKHHVVDqLPSRUWDQWHDOSDULGHOO¶LVWUX]LRQHLQVHQVRVWUHWWR
ai fini del progresso sociale. Non è certamente un caso che la norma
che qui si commenta sia immediatamente successiva a quella che tute-
ODLOGLULWWRDOO¶LVWUX]LRQHFKHGHOSDUL mira a promuovere lo sviluppo
della personalità umana.
$OO¶DUW  VL WXWHOD GXQTXH GD XQ ODWR LO GLULWWR GL JRGLPHQWR
GHOO¶DUWHHGHOODFXOWXUDQHOOHYDULHPDQLIHVWD]LRQLHGDOO¶DOWURLOGLULt-
WR G¶DXWRUH FKH YLHQH IRUPDOPHQWH ULFRQRVFLXWR FRPH GLULWWo fonda-
PHQWDOH GHOO¶LQGLYLGXR Inoltre, come rilevato dalla dottrina, da tale
norma si evince la necessità di contemperare due profili tra loro in-
VFLQGLELOPHQWHFRQQHVVLGDXQODWRODWXWHODDXWRUDOHGDOO¶DOWURLOGLULt-
to della collettività a non vedersi QHJDWR O¶DFFHVVR DOODFRQRVFHQ]DH
DOODFXOWXUDSHUYLDGHOOHHVFOXVLYHFRQFHVVHDOO¶DXWRUH
Si tratta, a ben vedere, del problema, ben noto agli studiosi del di-
ritto, che si pone ogni qual volta possono venire in rilievo diritti con-
trapposti (come ad esempio accade quando il diritto alla manifestazio-
ne del pensiero si scontra con il diritto alla riservatezza) e potenzial-
mente confliggenti, sicché anche in questo caso si rende necessario
procedere ad un bilanciamento degli stessi. Peraltro, la norma in que-
VWLRQHYDDQDOL]]DWDLQFRPELQDWRGLVSRVWRFRQO¶DUWFKHFRPHVLq
detto, tutela la libertà di opinione e di espressione.
/¶DUWHHORVSHWWDFRORLQYHURQRQVRQRDOWURFKHXQDPDQLIHVWD]Lo-
QH GHOOD OLEHUWj ULFRQRVFLXWD GDOO¶DUW  LQ TXDQWR DWWUDYHUVR O¶DUWH
O¶XRPRQRQIDFKHHVSULPHUHOHVXHLGHHHUHQGHUQHSDUWHFLSHODFROOHt-
tività, contribuendo al suo progresso sociale e culturale. Non può,
dunque, ipotizzarsi uno studio della norma che tutela da un lato le arti
HLOSURJUHVVRVFLHQWLILFRHGDOO¶DOWURLOGLULWWRG¶DXWRUHVHQ]DIDUHULIe-
ULPHQWRDQFKHDOODOLEHUWjGLHVSUHVVLRQHFKHDWWUDYHUVRO¶DUWHSUHQGH
forma e consistenza nel mondo esterno.

 /D OLEHUWj GL HVSUHVVLRQH LQ XQD SURVSHWWLYD UHJLRQDOH O¶DUW
10 della CEDU

Nella CEDU non è preVHQWHDOFXQDGLVSRVL]LRQHVXOO¶DUWH7XWWDYLDOR


VSHWWDFROR H O¶DUWH ULFHYRQR WXWHOD LQGLUHWWDPHQWH GDOO¶DUW  RYH q
proclamata la libertà di espressione. Al primo comma è precisato che
152 Manuale di diritto delle arti e dello spettacolo

³WDOH GLULWWR LQFOXGH ODOLEHUWj G¶RSLQLRQH H OD OLEHUWj GL ULFHYHre o di


comunicare informazioni o idee senza che vi possa essere ingerenza
GDSDUWHGHOOHDXWRULWjSXEEOLFKHHVHQ]DOLPLWLGLIURQWLHUD´
/D&RUWH(XURSHDGHLGLULWWLGHOO¶XRPRKDFRQLVXRLLQWHUYHQWLUi-
FRQGRWWR DOOD VIHUD GL JDUDQ]LD GL FXL DOO¶DUW 0 della Convenzione
ogni manifestazione del pensiero, indipendentemente dalla forma e
dallo specifico contenuto delle comunicazioni, che possono dunque
conFHUQHUHDQFKHOHHVSUHVVLRQLDUWLVWLFKHÊLQIDWWLLQGXEELRFKHO¶DUW
10, per la sua formulazione apparentemente generica, si presta ad es-
sere un contenitore molto ampio; ciò è evidentemente il frutto di una
scelta ragionata, onde consentire alla giurisprudenza di allargarne le
maglie per non sottrarre al suo campo di applicazione importanti setto-
ri di volta in volta emergenti. Non si potrebbe, invero, adeguatamente
tutelare la libertà di espressione se il suo contenuto fosse precisamente
definito, poiché si correrebbe il rischio di circoscriverla entro spazi
così delimitati da lasciare fuori tutte quelle manifestazioni della libertà
di espressione non puntualmente individuate.
Ê G¶DOWUD SDUWH FKLDUR FKH OD OLEHUWj GL HVSUHVVLRQH q XQ FRQFHWWR
soggetto al mutare dei tempi e dei costumi sociali, in quanto, ad
esempio, ciò che è arte oggi poteva non essere considerato tale in
XQ¶HSRFDVWRULFDSUHFHGHQWHHILQDQFKHVFRQILQDUHLQXQ¶RIIHVDDOEXRQ
costume o comunque assumere rilievo penale. Per quanto interessanti,
non è questa però la sede per approfondire gli eventuali profili penali-
stici eventualmente connessi ad una manifestazione artistica.
&RVuUDJLRQDQGRDOORUDVLFRJOLHO¶LPSRUWDQ]DGHOO¶RSHUDVYROWDQHO
corso del tempo dalla giurisprudenza della Corte Europea. Con mag-
JLRUHLPSHJQRHVSOLFDWLYRSXzGLUVLFKHHVVDKD³ULHPSLWR´HFRQWLQXD
tuttora a riempire la norma in commento.

/DWXWHODGHOO¶DUWHQHOOD&DUWDGL1L]]D

Ai fini del presente lavoro si rivela del pari imprescindibile soffermar-


VLVXOOD&DUWDGHLGLULWWLIRQGDPHQWDOLGHOO¶Unione europea, adottata al-
lo scopo di potenziare la tutela dei diritti fondamentali. Essa completa
ed aggiorna il catalogo dei diritti della CEDU, ragion per cui, per mo-
WLYLGLRUJDQLFLWjO¶HVDPHGHOOHVXHQRUPHQRQSXzFKHHVVHUHVXFFHs-
VIII. Il diritto dello spettacolo nella normativa internazionale e comunitaria 153

sivo a quello avente ad oggetto la Convenzione europea per la salva-


guardia dei diritti dell'uomo e delle libertà fondamentali, cui si è già
DFFHQQDWR1RQqTXHVWDSHUzO¶XQLFDUDJLRQHGLWDOHVFHOWDPHWRGROo-
gica.
$GLUHLOYHURO¶RUGLQHGLWUDWWD]LRQHFKHVLqYROXWRDGRWWDUHFRn-
VHQWHDQFKHGLFRPSUHQGHUHDOPHJOLRO¶HYROX]LRQHFKe ha interessato
la tutela della libertà di espressione, che si pone come filo conduttore
QHOO¶DQDOLVLGHOODGLVFLSOLQDLQWHUQD]LRQDOHHFRPXQLWDULDVXOGLULWWRGHl-
lo spettacolo. Dopo aver fatto tali precisazioni, occorre a questo punto
passare ad esaminare nello specifico le norme che ci interessano pre-
senti nella Carta di Nizza.
È appena il caso di precisare che, per effetto della entrata in vigore
del Trattato di Lisbona, nel 2009, la Carta ha assunto lo stesso valore
giuridico dei Trattati. Infatti, ai VHQVL GHOO¶DUW  § 1, Trattato
GHOO¶Unione europea (TUE), la Carta di Nizza è stata equiparata a que-
sti ultimi ed ha acquisito, pertanto, il rango primario.
Fondamentale, ai fini del presente lavoro, è una lettura ragionata
del capo II, interamente dedicato alle libertà, che comprende gli artt.
GDD,QSDUWLFRODUHRFFRUUHDSSURIRQGLUHLQSULPROXRJRO¶DUW
UXEULFDWR³OLEHUWjGLHVSUHVVLRQHHG¶LQIRUPD]LRQH´
Alla luce di tale disposizione, ogni individuo ha diritto alla libertà
di espressione. Tale diritto include la libertà di opinione e la libertà di
ricevere o di comunicare informazioni o idee senza che vi possa essere
ingerenza da parte delle autorità pubbliche e senza limiti di frontiera.
La libertà dei media e il loro pluralismo sono rispettati.
Come è stato autorevolmente evidenziato da Alfonso Celotto e
Giovanna Pistorio in un saggio dedicato all¶HIILFDFLD JLXULGLFD GHOOD
&DUWD GHL GLULWWL IRQGDPHQWDOL GHOO¶8QLRQH HXURSHD la tutela della li-
bertà dei media e del loro pluralismo, stabilito dal §  GHOO¶DUW 
UDSSUHVHQWD O¶DSSOLFD]LRQH DL PH]]L GL LQIRUPD]LRQH GHOOD OLEHUWà di
espressione affermata dal §  /¶DUW GHOOD &DUWD GHL GLULWWL IRQGa-
mentali, tutelando il diritto alla libertà di espressione e di informazio-
ne, comprende sia la libertà di opinione, sia la libertà di ricevere e
comunicare informazioni o idee. Di conseguenza, evidentemente, tale
norma va collegata al precedente art. 10, che proclama la libertà di
pensiero, oltre che di coscienza e di religione.
154 Manuale di diritto delle arti e dello spettacolo

Può dunque dirsi con XQDFHUWDVLFXUH]]DFKHO¶DUWFRQFHUQHLO


profilo squisitamente interno della libertà di pensiero, tutelando il di-
ULWWRGLHODERUDUHOLEHUDPHQWHOHSURSULHLGHHPHQWUHO¶DUWJDUDQWi-
VFHODOLEHUWjGLHVSULPHUHDOO¶HVWHUQROHSURSULHFRQYLQ]LRQL
UJXDOPHQWH GRYHURVR q XQ EUHYH FRPPHQWR DOO¶DUW  UXEULFDWR
³OLEHUWj GHOOH DUWL H GHOOH VFLHQ]H´ VHFRQGR FXL ³OH DUWL H OD ULFHUFD
VFLHQWLILFDVRQROLEHUH/DOLEHUWjDFFDGHPLFDqULVSHWWDWD´
La Carta di Nizza, dunque, dedica grande attenzione alla libertà di
HVSUHVVLRQH H DOOD WXWHOD GHOO¶DUWH SRQHQGR TXHVW¶XOWLPD VXOOR VWHVVR
piano della ricerca scientifica. Non a caso è stato adoperato il plurale
³DUWL´ TXDVL D YROHUFRQ IRU]D DIIHUPDUHFKH O¶DUWH SXzDVVXPHUH Gi-
verse sembianze e che in tutte le sue forme di manifestazione essa de-
YH HVVHUH FRQVLGHUDWD OLEHUD '¶DOWUR FDQWR RJQL IRUPD GL FHQVXUD
GHOO¶DUWHHTXLQGLGHJOLVSHWWDFROLVLSRQHSRWHQ]LDOPHQWHLQFRQWUDVWR
con la tutela della libertà di espressione.
'D WDOLFRQVLGHUD]LRQL HPHUJH XQ¶DSSUH]]abile evoluzione rispetto
DOODWXWHOD IRUQLWD GDOOD &('8 HVVHQGRVL RUD IRFDOL]]DWD O¶DWWHQ]LRQH
non più solamente sulla libertà di espressione ma anche, più specifi-
FDPHQWHVXOO¶DUWH
Anche qui, però, dalla formulazione della norma si evince una scel-
ta ben precisa dettata dalla necessità di non voler restringere eccessi-
vamente la sfera di operatività della libertà in commento. Questa at-
WHQ]LRQHGHOOD&DUWDGL1L]]DSHUO¶DUWHWHVWLPRQLDODFUHVFHQWHLPSRr-
tanza assunta dalle manifestazioni della libertà di espressione e soprat-
tutto da quelle artistiche nella più recente normativa internazionale.

,OGLULWWRG¶DXWRUHQHOGLULWWRLQWHUQD]LRQDOHFRQYHQ]LRQDOH

8.5.1. La Convenzione di Berna

La Convenzione di Berna rappresenta non solo il principale Trattato a


WXWHODGHOGLULWWRG¶DXWRUHPDDQFKHLOSLDQWLFR(VVRLQIDWWLIXVRt-
toscritto nel 1886 da Belgio, Francia, Germania, Haiti, Italia, Liberia,
Regno Unito, Spagna, Svizzera e Tunisia; il testo è stato sottoposto a
diverse modifiche nel corso deglL DQQL O¶XOWLPD GHOOH TXDOL DYYHQXWD
VIII. Il diritto dello spettacolo nella normativa internazionale e comunitaria 155

QHOFKHQRQQHKDQQRSHUzDOWHUDWRO¶LPSLDQWRRULJLQDULRPLUDn-
do piuttosto ad estendere il nucleo minimo dei diritti tutelati.
Procedendo per gradi, va preliminarmente indagata la ratio che è
alla base di tale Convenzione. Ebbene, essa va evidentemente ravvisa-
WDQHOO¶HVLJHQ]DGLDVVLFXUDUHXQDGLVFLSOLQDLQPDWHULDGLRSHUHOHWWHUa-
rie e artistiche che fosse il più possibile uniforme. Se questo è vero,
non può non riconoscersi al Trattato in commento una indubbia porta-
WDLQQRYDWLYDFRQVLGHUDQGRDQFKHO¶HSRFDLQFXLIXVRWWRVFULWWR
Passando ad esaminare la disciplina nel dettaglio, deve anzitutto
HVDPLQDUVL O¶DUW FKH IRUQLVFHOD GHILQL]LRQH GL ³RSHUHOHWWHUDULH HG
DUWLVWLFKH´ LQ FXL GHYRQR HVVHUH ULFRPSUHVH ³tutte le produzioni nel
campo letterario, scientifico e artistico, qualunque ne sia il modo o la
forma di espressione, come: i libri, gli opuscoli ed altri scritti; le con-
ferenze, allocuzioni, sermoni ed altre opere della stessa natura; le ope-
re drammatiche o drammatico-musicali; le opere coreografiche e pan-
tomimiche; le composizioni musicali con o senza parole; le opere ci-
nematografiche, alle quali sono assimilate le opere espresse mediante
un procedimento analogo alla cinematografia; le opere di disegno, pit-
tura, architettura, scultura, incisione e litografia; le opere fotografiche,
alle quali sono assimilate le opere espresse mediante un procedimento
analogo alla fotografia; le opere delle arti applicate; le illustrazioni, le
carte geografiche, i piani, schizzi e plastici relativi alla geografia, alla
WRSRJUDILDDOO¶DUFKLWHWWXUDRDOOHVFLHQ]H´
4XDQWR DOO¶DPELWR VRJJHWWLYR DL VHQVL GHOO¶DUW  VRQR WXWHODWH WUH
categorie di soggetti:
a) gli autori appartenentL D XQR GHL 3DHVL GHOO¶Unione, per le loro
opere, siano esse pubblicate oppure no;
b) JOLDXWRULQRQDSSDUWHQHQWLDGDOFXQRGHL3DHVLGHOO¶8QLRQHSHU
le opere che essi pubblicano per la prima volta in uno di tali
3DHVLRVLPXOWDQHDPHQWHLQXQ3DHVHHVWUDQHRDOO¶8QLRQHHLQXQ
3DHVHGHOO¶8QLRQH
c) gli autori non appartenenti ad alcuno dei Paesi firmatari ma
aventi la loro residenza abituale in uno di essi in quanto assimi-
ODWLDLILQLGHOO¶DSSOLFD]LRQHGHOOD Convenzione, agli autori ap-
partenenti al predetto Paese.
/D&RQYHQ]LRQHGL%HUQDGHWWDDOO¶DUWXQ principio fondamenta-
le, il c.d. principio di assimilazione o del trattamento nazionale. In vir-
156 Manuale di diritto delle arti e dello spettacolo

WGLWDOHSULQFLSLRQHL3DHVLGHOO¶8QLRQHGLYHUVLGDTXHOORGLRULJLQH
GHOO¶RSHUD JOL DXWRUL JRGRQR UHODWLYDPHQWH DOOH RSHUH SHU FXL VRQR
protetti dalla Convenzione, dei diritti che la legge nazionale assicura
ai propri cittadini oltre a quelli garantiti dalla Convenzione. La durata
GHOODSURWH]LRQHDFFRUGDWDqLQGLYLGXDWDGDOO¶DUW(VVDFRPSUHQGHOD
YLWDGHOO¶DXWRUHHFLQTXDQWDDQQLGRSRODVXDPRUWHVDOYo prevedere,
successivamente, alcune deroghe relative ad ipotesi specificamente
individuate.

8.5.2. /D&RQYHQ]LRQH8QLYHUVDOHSHULOGLULWWRG¶DXWRUH

Altra Convenzione rilevante in materia di diritto autorale è la Conven-


]LRQH 8QLYHUVDOH SHU LO GLULWWR G¶autore, firmata a Ginevra nel 1952.
Anche in questo caso, prima di soffermarsi sulle norme che, ad avviso
di chi scrive, appaiono più rilevanti ai fini del presente lavoro, si inda-
gherà in primis la ratio che è alla base di tale disciplina. Essa mira ad
assicurare in tutti i Paesi una efficace protezione del diritto di autore
sulle opere letterarie, scientifiche e artistiche, sul presupposto che un
regime di protezione espresso in una Convenzione universale, aggiun-
gendosi ai sistemi internazionali già in vigore, avrebbe permesso un
più rapido sviluppo delle lettere, delle scienze e delle arti e reso più
DJHYROHODGLIIXVLRQHGHOOHRSHUHGHOO¶LQJHJQR
$LVHQVLGHOO¶DUW. I, ogni Stato contraente si impegna ad adottare tut-
te le disposizioni necessarie per garantire una protezione sufficiente ed
efficace dei diritti degli autori e di ogni altro titolare di tali diritti sulle
opere letterarie, scientifiche e artistiche, quali gli scritti, le opere mu-
sicali, drammatiche e cinematografiche, le pitture, le incisioni e le
sculture.
La Convenzione dedica particolare attenzione ai diritti patrimoniali
VSHWWDQWL DOO¶DXWRUH SURFODPDQGR LO GLULWWR HVFOXVLYR GL DXWRUL]]DUH OD
riproduzione con qualsiasi mezzo, la rappresentazione e le esecuzioni
pubbliche e la radiodiffusione.
,QYHUR DOO¶DUW 9 YLHQH HVSOLFLWDPHQWH DIIHUPDWR FKH LO GLULWWR
G¶DXWRUHFRPSUHQGHLOGLULWWRHVFOXVLYRGLIDUHDXWRUL]]DUHDIDUHHD
pubblicare la traduzione delle opere.
VIII. Il diritto dello spettacolo nella normativa internazionale e comunitaria 157

È peraltro consentito agli Stati contraenti di restringere, per gli


scritti, il diritto di traduzione, purché ciò avvenga nel rispetto delle
condizioni individuate dal medesimo articolo.
$OO¶DUW 9, YLHQH IRUQLWD OD GHILQL]LRQH GL ³SXEEOLFD]LRQH´ LQWHVD
FRPH ³OD ULSURGX]LRQH LQ IRUPD PDWHULDOH H OD PHVVD D GLVSRVL]LRQH
del pubblicR GL HVHPSODUL GHOO¶RSHUD FKH SHUPHWWDQR GL OHJJHUOD R GL
SUHQGHUQHFRQRVFHQ]DYLVLYDPHQWH´

8.5.3. /¶Organizzazione Mondiale della Proprietà Intellettuale

/D &RQYHQ]LRQH LVWLWXWLYD GHOO¶2UJDQL]]D]LRQH 0RQGLDOH GHOOD 3Uo-


prietà Intellettuale (OMPI) è stata sottoscritta a Stoccolma il 14 luglio
1967.
Per quel che concerne la ratio, tale Convenzione mira a favorire
O¶DWWLYLWjFUHDWLYDDSURPXRYHUHODSURWH]LRQHGHOODSURSULHWjLQWHOOHt-
tuale nel mondo e, al contempo, ad incentivare la migliore collabora-
zione tra gli Stati.
Proprio per rendere possibile la realizzazione delle finalità così de-
OLQHDWHqVWDWDLVWLWXLWDO¶203,FKHFRPHVDQFLWRDOO¶DUWVLSUHILJJH
ORVFRSRGLDVVLFXUDUHIUDO¶DOWURODWXWHODGHOODSURSULHWjLQWHOOHWWXDOH
attraverso la coopHUD]LRQHWUDJOL6WDWLHO¶DXVLOLRGHOOHDOWUHRUJDQL]]a-
zioni internazionali.
/¶203,KDDVVXQWRLOFRRUGLQDPHQWRGHOOHDWWLYLWjGHOOHSUHHVLVWHn-
WL³8QLRQHLQWHUQD]LRQDOHSHUODSURWH]LRQHGHOODSURSULHWjLQGXVWULDOH´
H³8QLRQHLQWHUQD]LRQDOHSHUODSURWH]Lone delle opere letterarie e arti-
VWLFKH´GLFXLDOOH&RQYHQ]LRQLGL3DULJLGHOHGL%HUQDGHO
$OO¶DUWVRQRIRUQLWHOHGHILQL]LRQLULOHYDQWLDLILQLGHOOD&RQYHn-
zione. In particolare, rileva quella di proprietà intellettuale, che com-
prende i diritti relativi:
a) alle opere letterarie, artistiche e scientifiche;
b) alle interpretazioni degli artisti interpreti e alle esecuzioni degli
artisti esecutori, ai fonogrammi e alle emissioni di radiodiffu-
sione;
c) DOOHLQYHQ]LRQLLQWXWWLLFDPSLGHOO¶DWWLYLWjXmana;
d) alle scoperte scientifiche;
e) ai disegni e modelli industriali;
f) ai marchi di fabbrica, di commercio e di servizio, ai nomi com-
158 Manuale di diritto delle arti e dello spettacolo

merciali e alle denominazioni commerciali, alla protezione con-


tro la concorrenza sleale;
g) WXWWLJOLDOWULGLULWWLLQHUHQWLDOO¶attività intellettuale nei campi in-
dustriale, scientifico, letterario e artistico.

8.5.4. /¶$FFRUGR75,36

/¶Agreement on Trade Related Aspects of Intellectual Property Rights


(Accordo TRIPS) è stato firmato a Marrakesh il 15 aprile 1994 ed è
entrato in vigore il 1° gennaio 1995. Anche in questo caso, come di
consueto, si indagherà la ratio di tale Accordo, al fine di comprendere
più chiaramente anche le norme in esso trasfuse.
Ebbene, tale accordo vuole assicurare una più concreta tutela della
proprietà iQWHOOHWWXDOH DYHQGR JOL 6WDWL SUHVR DWWR GHOO¶LQDGHJXDWH]]D
dei precedenti trattati internazionali in materia dovuta anche alla man-
cata previsione di misure coattive in caso di violazioni. È proprio que-
VWRGXQTXHLOSURILORVXFXLO¶$FFRUGR75,36LQWHUYiene in maniera
più incisiva, prevedendo delle misure specifiche di tipo coattivo, agli
artt. 44 e seguenti.
Altrettanto importanti sono, da un lato, il riconoscimento esplicito
FKH L GLULWWL GL SURSULHWj LQWHOOHWWXDOH VRQR GLULWWL SULYDWL GDOO¶DOWUR
O¶Dcquisita consapevolezza della necessità di predisporre norme ade-
guate in materia di diritti di proprietà intellettuale attinenti al commer-
cio.
$LVHQVLGHOO¶DUW ³&LDVFXQ0HPEURDFFRUGDDLFLWWDGLQLGHJOLDl-
tri Membri un trattamento non meno favorevole di quello da esso ac-
cordato ai propri cittadini in materia di protezione della proprietà in-
tellettuale, fatte salve le deroghe già previste, rispettivamente, nella
Convenzione di Parigi (1967), nella Convenzione di Berna (1971),
nella Convenzione di Roma o nel Trattato sulla proprietà intellettuale
LQPDWHULDGLVHPLFRQGXWWRUL´
/¶DFFRUGRGHGLFDXQDDSSRVLWDVH]LRQHDOGLULWWRG¶DXWRUHHDLGLULWWL
FRQQHVVL DOO¶LQWHUQR GHOOD SDUWH ,, FRQFHUQHQWH ³QRUPH UHODWLYH
DOO¶HVLVWHQ]DDOO¶DPELWRHDOO¶HVHUFL]LRGHL diritti di proprietà intellet-
WXDOH´GHOLQHDQGRSHUILQRXQDGLVFLSOLQDGLUDFFRUGRFRQOD&RQYHn-
]LRQHGL%HUQDDOO¶DUW
VIII. Il diritto dello spettacolo nella normativa internazionale e comunitaria 159

Interessante, poi, è la precisazione, contenuta in tale disposizione,


FLUFD O¶DPELWR RJJHWWLYR GHOOD SURWH]LRQH IRUQLWD GDO GLULWWR G¶DXWRUH
FKH ³FRSUH OH HVSUHVVLRQL H QRQ OH LGHH L SURFHGLPHQWL L PHWRGL GL
IXQ]LRQDPHQWRRLFRQFHWWLPDWHPDWLFLLQTXDQWRWDOL´
/D SDUWH ,,, GHOO¶$FFRUGR ULJXDUGD OD WXWHOD GHL GLUitti di proprietà
intellettuale e si articola in cinque sezioni: la prima ha ad oggetto ob-
blighi generali; la seconda individua procedimenti e rimedi civili ed
amministrativi; la terza delinea misure provvisorie che possono rive-
larsi necessarie per impedire una violazione di un diritto di proprietà
intellettuale ovvero per preservare elementi di prova circa una presun-
ta violazione; vi è poi una quarta sezione che concerne alcune disposi-
zioni speciali in materia di misure alla frontiera; infine, la quinta se-
zione fornisce indicazioni in merito ai procedimenti penali e alle san-
zioni applicabili in casi di contraffazione internazionale di un marchio
RGLYLROD]LRQHGHOGLULWWRG¶DXWRUHVXVFDODFRPPHUFLDOH

/DQRUPDWLYDFRPXQLWDULDVXOGLULWWRG¶DXWRUH

/DPDWHULDGHOGLULWWRG¶DXWRUHqVWDWDRJJHWWRGLJUDQGHDWWHQ]LRQH sul
piano comunitario.
È appena il caso di precisare che sono diversi i documenti ufficiali
SXEEOLFDWLVXTXHVWRWHPDFRPHTXHOORGHOVXOGLULWWRG¶DXWRUHH
le sfide tecnologiche e quello del 1995, che si occupa del diritto
G¶DXWRUHHGHLGLULWWLFRQQHVVLQHOOD6RFLHWjGHOO¶,QIRUPD]LRQH,QTXe-
VWDVHGHSHUzVLIRFDOL]]HUjO¶DWWHQ]LRQHVXOOHGLUHWWLYHSLLPSRUWDQWL
ed anche su alcune decisioni.
Si analizzerà in primo luogo la direttiva 91/250/CEE in materia di
tutela giuridica del software.
La direWWLYDDOO¶DUWLQGLYLGXDO¶RJJHWWRGHOODWXWHODVWDELOHQGRFKH
³gli Stati membri tutelano i programmi per elaboratore, mediante dirit-
WRG¶DXWRUHFRPHRSHUHOHWWHUDULHDLVHQVLGHOODFRQYHQ]LRQHGL%HUQD
VXOODWXWHODGHOOHRSHUHOHWWHUDULHHDUWLVWLFKH´.
'HO SDUL ULOHYDQWL VRQRO¶DUW  FKH GHOLQHD O¶DPELWR VRJJHWWLYR GL
DSSOLFD]LRQHGHOODGLUHWWLYDSUHFLVDQGRFKH³la tutela è riconosciuta a
tutte le persone fisiche o giuridiche aventi i requisiti previsti dalla le-
160 Manuale di diritto delle arti e dello spettacolo

gislazione nazionale sul diritto di autore applicata alle opere lettera-


ULH´HO¶DUWFKHLQGLYLGXDOHDWWLYLWjULVHUYDWHDOWLWRODUH
/DWXWHODGXUDSHUWXWWDODYLWDGHOO¶DXWRUHHSHUFLQTXDQW¶DQQLGRSR
la sua morte, salva la possibilità per gli Stati di prevedere un periodo
di tutela superiore conformemente a quanWRSUHYLVWRGDOO¶DUWVHFRn-
do comma.
La direttiva 92/100/CE concerne il diritto di noleggio, il diritto di
SUHVWLWR H WDOXQL GLULWWL FRQQHVVL DO GLULWWR G¶DXWRUH LQ PDWHULD GL SUo-
prietà intellettuale. 1HOO¶DPELWR GHL GLULWWL Fonnessi, essa annovera il
diritto di fissazione (art. 6), il diritto di riproduzione (art. 7), la radio-
diffusione e comunicazione al pubblico (art. 8), nonché il diritto di di-
stribuzione (art. 9).
$QQRSURILFXRSHULOGLULWWRG¶DXWRUHqVWDWRLODOORrchè sono
VWDWH DGRWWDWH GXH GLUHWWLYH OD &( ³per il coordinamento di
DOFXQHQRUPHLQPDWHULDGLGLULWWRG¶DXWRUHHGLULWWLFRQQHVVLDSSOLFDELOL
DOOD UDGLRGLIIXVLRQH YLD VDWHOOLWH H DOOD ULWUDVPLVVLRQH YLD FDYR´ e la
1993/98/CE sulla ³DUPRQL]]D]ione della durata di protezione del dirit-
WRG¶DXWRUHHGLDOFXQLGLULWWLFRQQHVVL´.
La prima di tali direttive è interessante perché contiene una disci-
SOLQDSLXWWRVWRDUWLFRODWDVXOGLULWWRG¶DXWRUHHVRSUDWWXWWRVLVRIIHUPD
sulla radiodiffusione via satellite, dedicandovi un apposito capo. Il di-
ritto di radiodiffusione così disciplinato comprende il diritto
GHOO¶DXWRUH GL DXWRUL]]DUH OD FRPXQLFD]LRQH DO SXEEOLFR YLD VDWHOOLWH
GHOOHRSHUHSURWHWWHGDOGLULWWRG¶DXWRUH
Invece, la direttiva 1993/98/CE merita di essere ricordata in quanto
estende la durata del copyright per le opere a dopo 70 anni dalla morte
GHOO¶DXWRUHFRVuSRWHQ]LDQGRQRWHYROPHQWHODWXWHODDXWRUDOH
Nel 1996 è stata emanata la direttiva 96/9/CE. Tale direttiva tutela
le banche dati, vale a dire ogni ³UDFFROWDGLRSHUHGDWLRDOWULHOHPHQWL
indipendenti sistematicamente o metodicamente disposti ed indivi-
GXDOPHQWHDFFHVVLELOLJUD]LHDPH]]LHOHWWURQLFLRLQDOWURPRGR´
,PSRUWDQWHqO¶DUWFKHDIILGDDJOL6WDWLLOFRPSLWRGLSUHYHGHUH
adeguate sanzioni per il caso di violazione dei diritti tutelati dalla di-
rettiva.
Si inserisce in un disegno volto ad uniformare, per quanto possibi-
OH OD GLVFLSOLQD GHO GLULWWR G¶DXWRUH LQYHFH OD GLUHWWLYD &(
VIII. Il diritto dello spettacolo nella normativa internazionale e comunitaria 161

sulla armonizzazione di taluni aspettLGHOGLULWWRG¶DXWRUHHGHLGLULWWL


FRQQHVVLQHOODVRFLHWjGHOO¶LQIRUPD]LRQH
Come si legge nel quarto considerando, ³XQ TXDGUR JLXULGLFR Dr-
PRQL]]DWRLQPDWHULDGLGLULWWRG¶DXWRUHHGLGLULWWLFRQQHVVLFUHDQGR
una maggiore certezza del diritto e prevedendo un elevato livello di
protezione della proprietà intellettuale, promuoverà notevoli investi-
menti in attività creatrici ed innovatrici, segnatamente nelle infrastrut-
ture delle reti, e di conseguenza una crescita e una maggiore competi-
WLYLWjGHOO¶LQGXVWUia europea per quanto riguarda sia la fornitura di con-
WHQXWL FKH OH WHFQRORJLH GHOO¶LQIRUPD]LRQH QRQFKp SL LQ JHQHUDOH
numerosi settori industriali e culturali. Ciò salvaguarderà
O¶RFFXSD]LRQHHIDYRULUjODFUHD]LRQHGLQXRYLSRVWLGLODYRUR´
Tale direttiva si occupa di tre tematiche fondamentali: il diritto di
riproduzione, il diritto di comunicazione e il diritto di distribuzione.
Sempre nello stesso anno è stata emanata anche la direttiva del Par-
lamento Europeo e del Consiglio 2001/84/CE, relativa al diritto
GHOO¶DXWRUH GL XQ¶RSHUD G¶DUWH VXOOH VXFFHVVLYH YHQGLWH GHOO¶RULJLQDOH
Importante è, in particolare, il settimo considerando, che consente di
comprendere anche la ratio GLWDOHGLUHWWLYD³$lla luce del processo di
internazionalizzazione del mercDWRGHOO¶DUWHPRGHUQDHFRQWHPSRUDQHD
QHOOD &RPXQLWj FXL VWDQQR LPSULPHQGR XQ¶DFFHOHUD]LRQH JOL HIIHWWL
della cosiddetta nuova economia, e in un contesto normativo in cui
pochi PDHVLDOGLIXRULGHOO¶Unione europea, riconoscono il diritto sul-
le successivHYHQGLWHGLRSHUHG¶DUWHqHVVHQ]LDOHFKHOD&RPXQLWjHu-
ropea avvii negoziati, a livello internazionale, per sancire
O¶REEOLJDWRULHWjGHOO¶DUWLFRORter GHOODFRQYHQ]LRQHGL%HUQD´
È bene avvertire, però, che il diritto sulle successive vendite ri-
guaUGDXQLFDPHQWHO¶RSHUDG¶DUWHILJXUDWLYDFRPHSUHFLVDWRQHOprimo
considerando, e rappresenta un diritto incedibile ed inalienabile
GHOO¶DXWRUH
&RQPDJJLRUHSUHFLVLRQHO¶DUWVWDELOLVFHFKHOHRSHUHG¶DUWHFXL
si applica il diritto sulle successive vendite sono i quadri, i collages, i
dipinti, i disegni, le incisioni, le stampe, le litografie, le sculture, gli
arazzi, le ceramiche, le opere in vetro e le fotografie, purché si tratti di
FUHD]LRQL HVHJXLWH GDOO¶DUWLVWD VWHVVR R GL HVHPSODUL FRQVLGHUDWL Fome
RSHUHG¶DUWHe originali.
162 Manuale di diritto delle arti e dello spettacolo

La direttiva 2004/48/CE si concentra specificamente sugli aspetti


SURFHVVXDOLGHOODWXWHODGHOGLULWWRG¶DXWRUHFHUFDQGRGLDUPRQL]]DUHOH
legislazioni nazionali in materia di sanzioni.
Oltre a mirare a garantire un livello equivalente di protezione della
proprietà intellettuale negli Stati membri, tale direttiva si pone altri
DPEL]LRVLRELHWWLYLSURPXRYHUHO¶LQQRYD]LRQHHODFRPSHWLWLYLWjGHOOH
LPSUHVHWXWHODUHO¶RFFXSD]LRQHLQ(XURSDHYLWDUHOHSHUGLWHILVFDOLHOD
destabilizzazione dei mercati, tutelare i consumatori dai pericoli con-
nessi alla contraffazione e alla pirateria, garantire il mantenimento
GHOO¶RUGLQHSXEEOLFR
La direttiva 2006/116/CE riguarda specificamente la durata di pro-
WH]LRQHGHOGLULWWRG¶DXWRUHHGLalcuni diritti connessi.
/DGXUDWDGLSURWH]LRQHGLXQ¶RSHUDFLQHPDWRJUDILFDRDXGLRYLVLYD
YLHQH ILVVDWD LQ ³VHWWDQW¶DQQL GDOOD PRUWH GHOO¶XOWLPD SHUVRQD VRSUDv-
vissuta fra le seguenti persone, a prescindere dal fatto che esse siano o
meno riconosciute qualL FRDXWRUL LO UHJLVWD SULQFLSDOH O¶DXWRUH GHOOD
VFHQHJJLDWXUDO¶DXWRUHGHOGLDORJRHLOFRPSRVLWRUHGHOODPXVLFDVSe-
FLILFDPHQWH FUHDWD SHU HVVHUH XWLOL]]DWD QHOO¶RSHUD FLQHPDWRJUDILFD R
DXGLRYLVLYD´ (art. 2), mentre i diritti degli artisti interpreti o esecutori
VFDGRQRFLQTXDQW¶DQQLGRSRO¶HVHFX]LRQHHTXHOOLGHLSURGXWWRULGLIo-
QRJUDPPL VFDGRQR FLQTXDQW¶DQQL GRSR OD ILVVD]LRQH DUW   3UHPH
precisare che tale direttiva, come si vedrà in prosieguo, è stata succes-
sivamente modificata dalla direttiva 2011/77/CE.
La direttiva 2009/24/CE si propone di estendere la protezione del
GLULWWRG¶DXWRUHDOVRIWZDUH³FRPHRSHUDOHWWHUDULD´HGLDUPRQL]]DUHD
livello comunitario la normativa relativa alla tutela giuridica dei pro-
grammi per elaboratore.
Per quanto riJXDUGD LO FDPSR GL DSSOLFD]LRQH VRJJHWWLYR O¶DUW 
della direttiva 2009/24/CE riconosce la tutela a tutte le persone fisiche
o giuridiche aventi i requisiti previsti dalla legislazione nazionale sul
diritto di autore applicata alle opere letterarie.
Occorre soffermarsi anche sulla direttiva 2010/13/UE, relativa al
coordinamento di determinate disposizioni legislative, regolamentari e
amministrative degli Stati membri concernenti la fornitura di servizi di
media audiovisivi, anche nota come direttiva sui servizi di media au-
diovisivi.
VIII. Il diritto dello spettacolo nella normativa internazionale e comunitaria 163

Altra direttiva che merita di essere esaminata è la 2011/77/CE, en-


trata in vigore il 31 ottobre 2011.
Essa ha modificato la direttiva 2006/116/CE e ha esteso da 50 a 70
anni la durata dei diritti connessi degli artisti, interpreti ed esecutori
sulle interpretazioni musicali fissate in un fonogramma e dei produtto-
ri di fonogrammi.
Anche tale direttiva, dunque, rappresenta un passo avanti non tra-
VFXUDELOHSHUODWXWHODGHJOLDUWLVWLLQTXHVWRFDVRTXHOOLGHOO¶LQGXVWULD
musicale, garantendo loro uno sfruttamento economico ed artistico
delle proprie interpretazioni per un periodo più lungo, onde coprire
O¶LQWHUDYLWDGHJOLDUWLVWL
Più di recente, poi, è stata adottata la direttiva 2012/28/UE su taluni
utilizzi consentiti di opere orfane.
Nel quinto considerando YLHQH VRWWROLQHDWD O¶LPSRUWDQ]D DVVXQWD
QHOO¶HFRQRPLDPRGHUQDGDOGLULWWRG¶DXWRUHFRQVLGHUDWRDWXWWLJOLHf-
IHWWL³LOIRQGDPHQWRHFRQRPLFRGHOO¶LQGXVWULDFUHDWLYDGDWRFKHVWLPo-
ODO¶LQQRYD]LRQHODFUHD]LRQHJOLLQYHVtimenti e la produzione. La di-
gitalizzazione e la diffusione di massa delle opere sono pertanto un
PH]]RSHUWXWHODUHLOSDWULPRQLRFXOWXUDOHHXURSHR,OGLULWWRG¶DXWRUHq
uno strumento importante per garantire che il settore creativo sia re-
munerato per iOSURSULRODYRUR´
La direttiva in commento ha un campo di applicazione oggettivo
ben delimitato; infatti, ai sensi del § GHOO¶DUWHVVDVLDSSOLFD alle
seguenti categorie di opere SURWHWWH GDO GLULWWR G¶DXWRUH R GD GLULWWL
connessi, di prima pubblicazione in uno Stato membro o, in caso di
mancata pubblicazione, di prima trasmissione in uno Stato membro:
a) opere pubblicate sotto forma di libri, riviste, quotidiani, rotocal-
chi o altre pubblicazioni conservati nelle collezioni di bibliote-
che, istituti di istruzione o musei accessibili al pubblico, nonché
nelle collezioni di archivi o di istituti per il patrimonio cinema-
tografico o sonoro;
b) opere cinematografiche o audiovisive e fonogrammi conservati
nelle collezioni di biblioteche, istituti di istruzione o musei ac-
cessibili al pubblico, nonché nelle collezioni di archivi o di isti-
tuti per il patrimonio cinematografico o sonoro;
c) opere cinematografiche o audiovisive e fonogrammi, prodotti da
emittenti di servizio pubblico fino al 31 dicembre 2002 e che
164 Manuale di diritto delle arti e dello spettacolo

siano conservati nei loro archivi;


Nel §  GHOO¶DUW  VL OHJJH FKH OD GLUHWWLYD ³VL DSSOLFD DOWUHVu DOOH
opere e ai fonogrammi di cui al paragrafo 2 che non sono mai stati né
pubblicati né trasmessi, ma che sono stati resi pubblicamente accessi-
ELOL>«@FRQLOFRnsenso dei titolari dei diritti, se è ragionevole presu-
mere che i titolari dei diritti non si opporrebbero agli utilizzi di cui
DOO¶DUWLFROR´1HO§ qVSHFLILFDWRFKHODGLUHWWLYD³VLDSSOLFDDQFKH
alle opere e agli altri contenuti protetti che sono inclusi, incorporati o
che formano parte integrante delle opere o dei fonogrammi di cui ai
SDUDJUDILH´
4XDQWRDOFRQFHWWRGLRSHUDRUIDQDO¶DUWSUHFLVDFKHXQ¶RSHUDq
tale se nessuno dei titolari dei diritti su tale opera è stato individuato
ovvero se, pur essendo noto taluno di essi, non sia stato possibile rin-
tracciarlo.
È infine recentissima la direttiva 2014/26/UE sulla gestione collet-
tiva dei diritti e sulle licenze multiterritoriali riguardanti la musica on-
line. Tale direttiva fissa i requisiti per assicurare il buon funzionamen-
WRGHOODJHVWLRQHGHLGLULWWLG¶DXWRUHHGLULWWLFRQQHVVLGDSDUWHGHJOLRr-
ganismi di gestione collettiva e stabilisce i requisiti per la concessione
di licenze multiterritoriali riguardanti la musica online (art. 1).
PaVVDQGRDOO¶DQDOLVLGHOOHSULQFLSDOLGHFLVLRQLDGRWWDWHLQWDOHPDWe-
ria, non si può non accennare alla decisione del Consiglio 98/253/CE,
con la quale si è dato avvio ad un programma comunitario per realiz-
zare una società consapevole delle nuove possibilità che possono trarsi
dalle tecnologie. Gli obiettivi posti alla base di tale programma erano:
LQFHQWLYDUHODSDUWHFLSD]LRQHGHOOHSHUVRQHDOO¶HYROX]LRQHYHUVRODVo-
FLHWjGHOO¶LQIRUPD]LRQHVIUXWWDUHLEHQHILFLVRFLR-economici della so-
FLHWj GHOO¶LQIRUPD]LRQH DFFUHVFHUH OD YLVLELOLWj GHOO¶(XURSD
QHOO¶DPELWRGHOODVRFLHWjGHOO¶LQIRUPD]LRQH
Sulla stessa scia si inserisce, poi, la decisione del Parlamento Euro-
peo e del Consiglio n. 1639/2006/CE che ha istituito, per il periodo
dal 10 gennaio 2007 al 31 dicembre 2013, un programma quadro per
ODFRPSHWLWLYLWjHO¶LQQRYD]LRQHYROWRDGLQFHQWLYDUHO¶XVRGHOOHWHFQo-
ORJLHGHOO¶LQIRUPD]LRQH
Benché si tratti di atti non vincolanti, è infine importante richiama-
re due raccomandazioni della Commissione.
VIII. Il diritto dello spettacolo nella normativa internazionale e comunitaria 165

La prima è la raccomandazione del 18 maggio 2005, sulla gestione


FROOHWWLYDWUDQVIURQWDOLHUDGHOGLULWWRG¶DXWRUHHGHLGLULWWLFRQQHVVLQHO
settore dei servizi leciti di musica online(VVDSURSRQHO¶DGR]LRQHGL
misure volte a migliorare, a livello comunitario, la connessione sotto
OLFHQ]DGHOGLULWWRG¶DXWRUHSHULVHUYL]Lonline.
La seconda è la raccomandazione del 24 agosto 2006 sulla digita-
OL]]D]LRQH H O¶DFFHVVLELOLWj online del materiale culturale e sulla con-
servazione digitale, che invita gli Stati membri a promuovere la digita-
OL]]D]LRQHHO¶DFFHVVLELOLWjonline del materiale culturale nonché la sua
conservazione digitale.

8.7. Considerazioni conclusive

Questa breve disamina delle principali fonti internazionali e comunita-


rie sul diritto dello spettacolo e sul dLULWWRG¶DXWRUHFLFRQVHQWHGLWUDUUH
alcune considerazioni sulla crescente attenzione che tali fonti riserva-
no alla libertà di espressione e a quelle che ne rappresentano le più au-
WHQWLFKHPDQLIHVWD]LRQLRVVLDO¶DUWHHORVSHWWDFROR
È possibile, anzi, intravedere nella legislazione più recente un ap-
SUH]]DELOH LQFUHPHQWR GHOOH QRUPH D WXWHOD GHOO¶DUWH LQ WXWWH OH VXH
IRUPHHVXXQDOWURSLDQRDQFKHGHOGLULWWRG¶DXWRUHDFRQIHUPDGHO
fatto che ormai il diritto dello spettacolo è considerato a tutti gli effetti
XQDGLVFLSOLQDGRWDWDGLXQ¶DXWRQRPDGLJQLWjQHOSDQRUDPDLQWHUQD]Lo-
nale e comunitario.
Non è peraltro questa la sede, per ovvie ragioni, per addentrarsi nel
diritto comparato, ma è certamente auspicabile, a questo punto, che il
percorso così avviato sia completato nel più breve tempo possibile da
XQ¶RSHUDGLDUPRQL]]D]LRQHGHOOHGLVFLSOLQHQD]LRQDOL
Capitolo IX

,OGLULWWRG¶DXWRUH
di ENRICO BUONO e VALERIA MONTI*

9.1. Nozione, fonti e contenuto

Per comprendere la portata ed il conWHQXWR GHO GLULWWR G¶DXWRUH VRQR


necessarie delle osservazioni preliminari in tema di beni giuridici.
Il bene giuridico è quella entità rilevantHSHUO¶RUGLQDPHQWRJLXULGi-
co, da esso tutelata, che possa formare oggetto di diritti.
In tale concetto sono ricompresi sia i beni materiali che quelli im-
materiali; mentre i primi sono tradizionalmente oggetto del diritto di
SURSULHWjSHULVHFRQGLFLVLDYYDOHGLXQSLJHQHULFRFRQFHWWRGL³Dp-
SDUWHQHQ]D´LQFXLLOULIHULPHQWRWHUPLQRORJLFRDOOD³SURSULHWj´KDLO
VROR VFRSR GL HYRFDUH O¶LGHD GL HVFOXVLYLWj TXDOH SRVVLELOLWj ULFRQo-
sciuta al titolare di escludere chiunque altro dallo sfruttamento del be-
ne.
/¶HVSUHVVLRQH FRPXQHPHQWH XWLOL]]DWD GL ³SURSULHWjLQWHOOHWWXDOH´
vale, dunque, solo ad indicare genericamente le situazioni giuridiche
soggettive riconosciute in ordine allo sfruttamento di una data crea-
zione intellettuale.
4XHVW¶XOWLPDTXDOHEHQHLPPDWHULDOHSXzIRUPDUHRJJHWWRGHOGi-
ULWWRG¶DXWRUHRGHLGLULWWLVXOOHLQYHQ]LRQLLQGXVWULDOL

*
Il presente capitolo è frutto del lavoro congiunto di entrambi gli Autori. Tuttavia, la stesura
dei §§ 9.1., 9.2., 9.3. e 9.4. è da attribuire a Valeria Monti; la parte finale del contributo è stata
scritta da Enrico Buono.

167
168 Manuale di diritto delle arti e dello spettacolo

Il legislatore del 1942, non a caso, ha disciplinato le creazioni


GHOO¶LQJHJQRQHOOLEUR9del codice civile quasi a voler chiarire la lon-
tananza dei diritti riconosciuti in materia dal modello proprietario e a
considerare tali creazioni quale suprema espressione del lavoro.
/¶DWWHQ]LRQH DOOH FUHD]LRQL LQWHOOHWWXDOi è tuttavia precedente al
1942. Essa è testimoniata già nel codice civile del 1865, per il quale le
SURGX]LRQLGHOO¶LQJHJQRDSSDUWHQJRQRDLORURDXWRULVHFRQGROHQRrme
stabilite da leggi speciali.
È solo con la legge 22 aprile 1941, n. 633, recante le norme in tema
GL³3URWH]LRQHGHOGLULWWRG¶autore e di altri diritti connessi al suo eser-
cizio´ ULFRUGDWDWDOYROWDDQFKHFRPHOGD , però, che trova compiuta
GLVFLSOLQD LO GLULWWR G¶DXWRUH /D WXWHOD LYL SUHvista è stata poi estesa
con d.P.R. 8 gennaio 1979, n. 19 alle fotografie di carattere creativo;
con il d.lgs. 29 dicembre 1992, n. 518 ai programmi per elaboratore,
c.d. software; con il d.lgs. 6 maggio 1999, n. 169 alle banche dati; e
con il d.lgs. 95/2001 alle opere del disegno industriale.
$WWUDYHUVRLOGLULWWRG¶DXWRUHLQSDUWLFRODUHODOHJJHWXWHODOHRSHUH
GHOO¶LQJHJQR GL FDUDWWHUH FUHDWLYR FKH DSSDUWHQJRQR DOOH VFLHQ]HDOOD
OHWWHUDWXUDDOODPXVLFDDOOHDUWLILJXUDWLYHDOO¶DUFKLWHWWXUDDOWHDWro e
alla cinematografia, qualunque ne sia il modo o la forma di espressio-
ne (art. 2575 cod. civ. e art. 1, legge 22 aprile 1941, n. 633).
Ciò che viene tutelato, accordando al soggetto titolare diritti morali
e di utilizzazione economica, è qualunque creazione che sia manife-
stazione originale della personalità umana, indipendentemente dal suo
HIIHWWLYRYDORUHHFRQRPLFRQRQFKpDUWLVWLFRROHWWHUDULR/¶RULJLQDOLWj
peraltro, va riferita alla forma rappresentativa e di manifestazione, e
non alla problematicD R DOOD VLWXD]LRQH ULSURGRWWD '¶DOWUD SDUWH QRQ
YLHQHLQULOLHYRQHSSXUHO¶XWLOLWjSUDWLFDFKHODFUHD]LRQHSRVVDDYHUH
4XHVW¶XOWLPR DVSHWWR LQ SDUWLFRODUH VHJQD LO WUDWWR GLVWLQWLYR WUD OH
RSHUH GHOO¶LQJHJQR RJJHWWR GHO GLULWWR G¶DXWRUH H OH LQYHQ]Loni indu-
striali. Queste ultime sono dalla legge tutelate proprio in funzione del-
la loro utilità pratica; se manca la possibilità di applicazione industria-
le, manca ogni tutela giuridica, così come la tutela giuridica cessa, se
O¶DSSOLFD]LRQHLQGXVWULDOHLQ concreto non si verifica, a meno che non
si tratti di opere del disegno industriale che presentino di per sé carat-
tere creativo e valore artistico, le quali, proprio e solo in quanto tali,
VRQRSURWHWWHGDOODGLVFLSOLQDGHOGLULWWRG¶DXWRUH
IX. ,OGLULWWRG¶DXWRUH 169

Il fatto che O¶RSHUDULOHYLLQVpDSUHVFLQGHUHGDOODVXDXWLOLWjIDVu


FKHO¶DFTXLVWRGHOGLULWWRG¶DXWRUHDYYHQJDLPPHGLDWDPHQWHHDWLWROR
RULJLQDULRFRQODFUHD]LRQHGHOO¶RSHUDVWHVVD DUWFRGFLYHDUW
6, l. 633/1941). Non è dunque necessaria alcuna registrazione, prevista
dagli artt. 103 e ss., l. 633/1941, ai soli effetti amministrativi o proba-
tori.
La tutela giuridica accordata a tale diritto, fin dal momento del suo
acquisto, è temporanea, ma con una durata eccezionalmente lunga: es-
sa dura tutta la vLWDGHOO¶DXWRUHHVLQRDOWHUPLQHGHOVHWWDQWHVLPRDQQR
solare dopo la sua morte (art. 25, l. 633/1941 come modificato dalla l.
52/1996).
/¶RUGLQDPHQWRJLXULGLFRDWWUDYHUVRODVHULHGLQRUPHLQGLFDWDSUe-
GLVSRQHXQDWXWHODDOGLULWWRG¶DXWRUHFKHVLDWWXD essenzialmente me-
diante il riconoscimento di un diritto personale (c.d. diritto morale) e
di un diritto patrimoniale (cc.dd. diritti di utilizzazione economica).
Il diritto morale contempla a sua volta diverse facoltà:
a) il diritto di essere riconosciuto auWRUHGHOO¶RSHUDGLrivendicarne
la paternità rispetto ad eventuali plagi totali o parziali;
b) LOGLULWWRGLDQRQLPRLOGLULWWRFLRqGHOO¶DXWRUHGLQRQUilevarsi al
PRPHQWRGHOODSXEEOLFD]LRQHGHOO¶RSHUD
c) il diritto di inedito, il diritto cioè di impedire la divulgazione
GHOO¶RSHUDRGLULWLUDUODGDOFRPPHUFLRSHUPRWLYLPRUDOLJUDYL
indennizzando coloro che ne hanno acquistato i diritti patrimo-
niali;
d) il diritto di opporsi a qualsiasi deformazione, mutilazione o altra
PRGLILFD]LRQH GHOO¶RSHUD GHOO¶LQJHJQR Fhe possa essere di pre-
JLXGL]LRDOO¶RQRUHRDOODUHSXWD]LRQHGHOO¶DXWRUHWXWWDYLDO¶DXWRUH
che abbia conosciute ed accettate le modificazioni della propria
RSHUDQRQqSLDPPHVVRDGDJLUHSHULPSHGLUQHO¶HVHFX]LRQHR
per chiederne la soppressione (art. 22, comma 2, l. 633/1941).
Nei casi di opere collettive il diritto morale spetta a ciascuno dei
coautori.
Il diritto morale è un diritto a carattere personale ed è intrasmissibi-
le; WXWWDYLDGRSRODPRUWHGHOO¶DXWRUHqFRQVHQWLWRDLVRJJHWWLLQGLFDWL
DOO¶DUW LOGLULWWRGLULYHQGLFDUHODSDWHUQLWjGHOO¶RSHUDHGLRSSRUVL
alle deformazioni, mutilazioni o altre modificazioni. Si tratta in parti-
170 Manuale di diritto delle arti e dello spettacolo

colare di facoltà che tali soggetti esercitano iure proprio per ragioni
IRQGDWHVXOOHJDPHIDPLOLDUHFRQO¶DXWRUH
Il GLULWWRSDWULPRQLDOHG¶DXWRUHVLGLSDQDQHOOHIDFROWjGLSXEEOLFa-
zione, di riproduzione e di smercio.
/DIDFROWjGLSXEEOLFD]LRQHqLOSUHVXSSRVWRSHUO¶XWLOL]]D]LRQHHFo-
QRPLFDGHOO¶RSHUDHGqSHUWDQWRQRUPDOHFKHVLDULVHUYDWDDOVXRDXWo-
re. Mentre però il diritto di inedito, ossia il diritto di vietare la pubbli-
cazione, è esclusivamente rimesso ad esso, il contrapposto diritto di
pubblicazione è trasmissibile sia per atto tra vivi sia per successione a
causa di morte e deve ritenersi implicitamente trasmesso nel trasferi-
mento dei diritti di utilizzazione economica.
La facoltà di riproduzione comprende una serie ampia di ipotesi: la
moltiplicazione in copie, temporanea o permanente, in tutto o in parte,
in qualunque modo o forma (art. 13, l. 633/1941 come modificata dal
GOJV ODWUDVFUL]LRQH DUW O¶HVHFX]LRQHUDSSUHVHQWD]Lo-
ne e recitazione in pubblico (art. 15); la diffusione a distanza mediante
telegrafo, telefono, radio o televisione ed altri mezzi analoghi, com-
preso il satellite; la ritrasmissione via cavo; la traduzione in altra lin-
gua o dialetto; la modificazione e rielaborazione.
7UDWWDQGRVL GL IDFROWj HVFOXVLYD O¶DXWRUH SXz RSSRUVL D TXDOXQTXH
forma di riproduzione da parte dei terzi che non sia da lui autorizzata;
sono però previste talune eccezioni, per quelle utilizzazioni che la leg-
ge consente entro determinati liniti, come nel caso della riproduzione
ad uso personale.
/DIDFROWjGLVPHUFLRDWWLHQHDOODPHVVDLQFLUFROD]LRQHGHOO¶RSHUD
(compreso il noleggio) a scopo di lucro.
Per le arti figurative, LQFXLLOYDORUHGHOO¶RSHUDqLQVFLQGLELOPHQWH
OHJDWRDOO¶RULJLQDOH, la legge predispone un meccanismo volto ad assi-
FXUDUH OD SDUWHFLSD]LRQH GHOO¶DXWRUH DOOH DOLHQD]LRQL VXFFHVVLYH DUWW
144 e ss.).
Tutti i diritti di utilizzazione economica a differenza di quelli per-
sonali sono trasferibili.
,OGLULWWRG¶DXWRUHQHOODVXDVWUXWWXUDXQLWDULDFRPSUHQVLYDWDQWRGHO
diritto morale quanto dei diritti di utilizzazione economica, non può
essere ascritto al novero dei diritti della personaliWj VRWWR O¶DVSHWWR
JLXULGLFR WXWWDYLD O¶HOHPHQWR SHUVRQDOH q FHUWDPHQWH SUHPLQHQWH Ui-
VSHWWR DOO¶HOHPHQWR SDWULPRQLDOH ,O FRQVHJXLPHQWR GHL YDQWDJJL HFo-
IX. ,OGLULWWRG¶DXWRUH 171

nomici, infatti, viene a porsi soltanto come conseguenza indiretta e


non necessaria della posizione peUVRQDOH GHOO¶DXWRUH ULVSHWWR DOOD VXD
opera.
7LWRODUH GHO GLULWWR G¶DXWRUH q dunque, sempre il creatore della
opera e, per quanto riguarda i diritti patrimoniali, anche i suoi aventi
causa.

9.2. Opere in collaborazione

Quanto al caso di opera collettiYDO¶DUWGHOOD l. 633/1941, stabilisce


FKH³qFRQVLGHUDWRDXWRUHGHOO¶RSHUDFROOHWWLYD chi organizza e dirige la
FUHD]LRQH GHOO¶RSHUD VWHVVD Ê FRQVLGHUDWR DXWRUH GHOOH HODERUD]LRQL
O¶HODERUDWRUHQHLOLPLWLGHOVXRODYRUR´
/HLSRWHVLLQFXLO¶RSHUD GHOO¶LQJHJQRqLOULVXOWDWRGHOODFROODERUa-
zione di più persone sono tuttavia variegate e necessitano di
XQ¶XOWHULRUH VSHFLILFD]LRQH 'evono distinguersi, in particolare, dalle
RSHUHFROOHWWLYHLQFXLO¶RSHUDGLFLDVFXQDXWRUHqHVDWWDPHQWHLQGLYi-
duata e ha una sua autonomia, e in cui unico problema è quello di
FRRUGLQDUH O¶XWLOL]]D]LRQH HFRQRPLFD GHOO¶RSHUD FROOHWWLYD FRQ TXHOOD
delle singole parti (coordinamento regolato dagli artt. 38 e ss.), le ipo-
tesi di collaborazione in cui non sia possibile una distinzione di parti,
e che a loro volta si suddividono in ipotesi di collaborazione con atti-
vità omogenee, che danno vita a comunione pro indiviso (art. 10), e in
ipotesi di collaborazione con attività eterogenee, in cui sorge il pro-
blema di individuare i soJJHWWLGHOGLULWWRG¶DXWRUH
Ipotesi di collaborazione con attività eterogenee sono il film e il
melodramma.
3HU TXDQWR ULJXDUGD LO ILOP O¶DXWRUH GHO VRJJHWWR O¶DXWRUH GHOOD
VFHQHJJLDWXUDO¶DXWRUHGHOODPXVLFDHLOGLUHWWRUHDUWLVWLFRVRQRFRQVi-
derati coautori. A questi, tuttavia, la legge riconosce solo vantaggi di
carattere economico nonché il diritto morale di autore ma non
O¶HVHUFL]LRGHOODIDFROWjGLXWLOL]]D]LRQHGHOO¶RSHUDFKHYLHQHULVHUYDWR
in via esclusiva al produttore. Tale scissione si spieJDSHUFKpO¶DWWLYLWj
FUHDWLYD GHL FRDXWRUL VL DWWXD LQ IXQ]LRQH GHOO¶DWWLYLWj LQGXVWULDOH GHO
produttore, per cui i diritti di utilizzazione economica spettano a colui
QHOFXLLQWHUHVVHO¶DWWLYLWjFUHDWLYDqVYROWD
172 Manuale di diritto delle arti e dello spettacolo

Nel caso del melodramma i soggetti del GLULWWRG¶DXWRUHVRQRLOOi-


brettista e il musicista, essendo la loro opera rispettivamente indivi-
duabile nel libretto e nella musica.
Essi possono pertanto disporre separatamente della loro opera, sal-
YRLOLPLWLLPSRVWLDOO¶DXWRUHGHOOLEUHWWRGHOO¶RSHUDcompiuta in colla-
ERUD]LRQHFRQLOPXVLFLVWDHFLRqO¶LPSRVVLELOLWjGLXWLOL]]DUHLOOLEUHWWR
per altro testo musicale.
La legge pone il musicista in posizione di preminenza rispetto al li-
EUHWWLVWDDQFKHSHUTXDQWRULJXDUGDO¶XWLOL]]D]LRQHGHOO¶RSHUDFRPXne,
DWWULEXHQGRDOPXVLFLVWDO¶HVFOXVLYLWjGHOO¶HVHUFL]LRGHOODIDFROWjGLXWi-
lizzazione e riservando al musicista i tre quarti dei proventi
GHOO¶XWLOL]]D]LRQH DUW 
Come visto, in entrambe le ipotesi si realizza una scissione tra dirit-
ti morali e vantaggi economici da un lato e facoltà di utilizzazione
GHOO¶RSHUD GDOO¶DOWUR PHQWUH QHO FDVR GHO PHORGUDPPD OD WLWRODULWj
HVFOXVLYDGHOODIDFROWjGLXWLOL]]D]LRQHGHOO¶RSHUDLQFDSRDOPXVLFLVWD
qLOIUXWWRGLXQDFRQVLGHUD]LRQHGLSUHPLQHQ]DDOO¶LQWHUQRdel rapporto
tra i due coautori, nel caso del film, o più in generale in tutte le ipotesi
LQFXLODFUHD]LRQHGHOO¶RSHUDDYYHQJDVXLQFDULFRGLDOWURVRJJHWWROD
ratio GHOODVFLVVLRQHqODIXQ]LRQDOL]]D]LRQHGHOO¶RSHUDDOO¶LQWHUHVVHGHO
committente, il quDOH VDUj O¶XQLFR WLWRODUH GHO GLULWWR GL XWLOL]]D]LRQH
economica.
La questione maggiormente problematica che si pone in relazione
DOOHRSHUH³FRPPLVVLRQDWH´qFDSLUHVHO¶DFTXLVWRGHOGLULWWRGLXWLOLz-
zazione economica del committente sia a titolo originario, come per il
creatore, o a titolo derivativo.
Il problema non ha rilevanza esclusivamente teorica ma comporta
delle ripercussioni di carattere pratico.
In particolare solo optando per la tesi della natura derivativa del ti-
tolo emerge la possibilità di limitare il diritto di utilizzazione econo-
PLFDDOO¶DWWRGHOODVWLSXODGHOFRQWUDWWRGLFRPPLVVLRQHGHOO¶RSHUD
In sede interpretativa diversi sono stati gli argomenti proposti a fa-
YRUHGHOODQDWXUDGHULYDWLYDGHOO¶DFTXLVWRFKHKDQQRSRUWDWRDGHVFOu-
dere che il committente possa acquistare il diritto di utilizzazione
GHOO¶RSHUDDWLWRORRULJLQDULRDOSDULGLTXDQWRDFFDGHQHOFDVRGLDc-
quisto da parte del creatore.
IX. ,OGLULWWRG¶DXWRUH 173

,O SULPR DUJRPHQWR q GL FDUDWWHUH WHVWXDOH O¶DUW  FRG FLY H
O¶DUWOVLULIHULVFRQRHVFOXVLYDPHQWHDOOD³FUHD]LRQH´TXa-
le titolo di acquisto a carattere originario. Nel silenzio della legge,
quindi, qualunque altro titolo di acquisto non può che considerarsi a
titolo derivativo.
Il secondo argomento è di carattere logico: in mancanza di contrat-
WRGLFRPPLVVLRQHGHOO¶RSHUD RDQFKHLQFDVRGLVXDLQYDOLGLWj VLULe-
spanderebbe la portata operativa delle previsioni legislative (art. 2657
cod. civ. e art. 6, l. 633/1941) e il diritto di utilizzazione spetterebbe al
creatore. Si dHVXPHSHUWDQWRFKHO¶XQLFDIRQWHGHOGLULWWRGHOFRPPLt-
tente è il contratto di commissione.
Tali dati sono dunque dirimenti per affermare la natura derivativa
GHOO¶DFTXLVWR de quo.

9.3. Il caso della parodia

/H RSHUH SURWHWWH GDO GLULWWR G¶DXWRUH FRme visto, sono anche quelle
che affrontano problemi già conosciuti o considerano situazioni già
note, purché originale sia la forma rappresentativa e cioè la manifesta-
zione del pensiero.
/¶LQGLYLGXD]LRQH GHOOD OLQHD GL FRQILQH WUD PHUD ULSURGX]LRQH GL
XQ¶RSHUD JLj HVLVWHQWH H ULHODERUD]LRQH RULJLQDOH GHOO¶RSHUD SRQH QRQ
poche difficoltà.
Merita in particolare un maggiore approfondimento una particolare
IRUPDG¶DUWHFKHKDFRPHVXDHVVHQ]LDOHFDUDWWHULVWLFDTXHOODGLHVVHUH
riproduttiva di opere già esistenti: la parodia. Essa è la rielaborazione
in chiave comica o farsesca di opere specifiche destinata a essere rico-
nosciuta come tale.
/¶LPSRUWDQ]DGLLQGLYLGXDUHDTXDOLFRQGL]LRQLHLQTXDOLFDVLSRVVD
parlarsi di parodia deriva dal fatto che essa rientra tra gli atti che sono
HVHQWDWL DL VHQVL GHOO¶DUW. 5, § 3, lett. k), della direttiva 2001/29 del
Parlamento europeo e del Consiglio, dal diritto di riproduzione con cui
si riconosce agli autori il diritto esclusivo di autorizzare o vietare la
riproduzione diretta o indiretta, temporanea o permanente, in qualun-
que modo o forma, in tutto o in parte.
174 Manuale di diritto delle arti e dello spettacolo

Ciò è giustificato proprio dal fatto che la parodia rappresenta una


PDQLIHVWD]LRQH DXWRQRPD HG RULJLQDOH ULVSHWWR DOO¶RSHUD SDURGLDWD $
tal proposito la giurisprudenza ha recentemente chiarito quali sono i
FULWHULFKHGHYRQRRULHQWDUHO¶LQWHUSUHWHQHOO¶LQGLYLGXD]LRQHGHOFDPSR
di applicazione della parodia, pronunciandosi così nella controversia
in merito alla pubblicazione di un calendario in cui era stato riprodotto
e parodiato un disegno somigliante ad un altro che figurava sulla co-
pertina di un album di fumetti:

/¶DUWLFRORSDUDJUDIROHWWHUDN GHOODGLUHWWLYD&(GHOParlamen-
to HXURSHRHGHO&RQVLJOLRGHOPDJJLRVXOO¶DUPRQL]]D]LRQHGLWalu-
QL DVSHWWL GHO GLULWWR G¶DXWRUH H GHL GLULWWL FRQQHVVL QHOOD VRFLHWj
GHOO¶LQIRUPD]LRQHGHY¶HVVHUHLQWHUSUHWDWRQHOVHQVRFKHODQR]LRQHGL©SDUo-
dia» di cui a tale disposizione costituisce una nozione autonoma del diritto
GHOO¶8QLRQH O¶DUWLFROR  SDUDgrafo 3, lettera k), della direttiva 2001/29
GHY¶HVVHUH LQWHUSUHWDWR QHO VHQVR FKH OD SDURGLD KD FRPH FDUDWWHULVWLFKH Hs-
VHQ]LDOL GD XQ ODWR TXHOOD GL HYRFDUH XQ¶RSHUD HVLVWHQWH SXU SUHVHQWDQGR
SHUFHWWLELOLGLIIHUHQ]HULVSHWWRDTXHVW¶XOWLPDHGDOO¶DOWro, quella di costituire
un atto umoristico o canzonatorio. La nozione di «parodia», ai sensi di detta
disposizione, non è soggetta a condizioni in base alle quali la parodia do-
vrebbe mostrare un proprio carattere originale, diverso dalla presenza di per-
ceWWLELOLGLIIHUHQ]HULVSHWWRDOO¶RSHUDRULJLQDOHSDURGLDWDGRYUHEEHSRWHUHVVe-
UH UDJLRQHYROPHQWH DWWULEXLWD DG XQD SHUVRQD GLYHUVD GDOO¶DXWRUH VWHVVR
GHOO¶RSHUDRULJLQDOHGRYUHEEHHVVHUHLQFHQWUDWDSURSULRVXOO¶RSHUDRULJLQDOHR
dovrebbe indicare la fonte GHOO¶RSHUDSDURGLDWD&LzSUHPHVVRO¶DSSOLFD]LRQH
LQXQDVLWXD]LRQHFRQFUHWDGHOO¶HFFH]LRQHSHUSDURGLDDLVHQVLGHOO¶DUWLFROR
paragrafo 3, lettera k), della direttiva 2001/29, deve rispettare un giusto equi-
librio tra, da un lato, gli interessi e i diritti delle persone indicate agli articoli
 H  GL WDOH GLUHWWLYD H GDOO¶DOWUR OD OLEHUWj GL HVSUHVVLRQH GHOO¶XWHQWH GL
XQ¶RSHUDSURWHWWDLO TXDOH VLDYYDOJDGHOO¶HFFH]LRQHSHUSDURGLDDL VHQVLGHO
citato articolo 5, paragrafo 3, lettera k). Spetta al giudice del rinvio valutare,
alla luce di tutte le circostanze del caso di specie, se - partendo dal presuppo-
sto che il disegno di cui al procedimento principale presenti le suddette carat-
teristiche essenziali della parodia - O¶DSSOLFD]LRQHGHOO¶HFFH]LRne per parodia,
DLVHQVLGHOO¶DUWLFRORSDUDJUDIROHttera k), della direttiva 2001/29, rispetti
tale giusto equilibrio (Corte di Giustizia UE, Grande Sezione, sentenza 3 set-
tembre 2014, n. 201).
IX. ,OGLULWWRG¶DXWRUH 175

9.4. Atti di disposizione inter vivos GHOGLULWWRG¶autore

,O GLULWWR G¶DXWRUH SXz HVVHUH RJJHWWR GHOO¶DXWRQRPLD QHJR]LDOH GHOOH


parti per quanto attiene la componente economica.
7XWWLJOLDWWLGLGLVSRVL]LRQHGHOGLULWWRG¶DXWRUHinter vivos devono
essere provati per iscritto. Tra di essi merita una particolare considera-
zione il contratto di edizione.
6L WUDWWD GL XQ FRQWUDWWR D SUHVWD]LRQL FRUULVSHWWLYH LQ FXL O¶DXWRUH
FRQFHGHDG DOWUD SHUVRQD HGLWRUH  LO GLULWWR GL SXEEOLFDUHO¶RSHUD SHU
SURSULR FRQWR H D SURSULH VSHVH H O¶HGLWRUH VL REEOLJD D ULSURGXUUe
O¶RSHUDDPHWWHUODLQYHQGLWDHDSDJDUHLOFRPSHQVRSDWWXLWR&LzFKH
VLUHDOL]]DQRQqGXQTXHXQ¶DOLHQD]LRQHWUDVODWLYDGHOGLULWWRGLDXWRUH
QHOVXRFRPSOHVVRPDO¶DOLHQD]LRQHFRVWLWXWLYDGHOGLULWWRGLHGL]LRQH
RVVLDGHOGLULWWRDOO¶XWLOL]]D]LRQHHFRQRPLFDGHOO¶RSHUDQHLOLPLWLILVVDWL
dal contratto, quindi per la sola edizione o comunque a termine.
/¶HGLWRUHVLREEOLJDDJDUDQWLUHXQULVXOWDWRHFLRqODULSURGX]LRQHH
PHVVD LQ YHQGLWD GHOO¶RSHUD GDOOD TXDOHGLSHQGH OD UHDOL]]D]LRQH GHO
compensRGHOO¶DXWRUH
,O FRQWUDWWR GL HGL]LRQH SXz ULJXDUGDUH DQFKH XQ¶RSHUD IXWXUD
XQ¶RSHUDFLRqFKHO¶DXWRUHVLREEOLJKLDFRPSLHUHSHUTXHOGHWHUPLQDWR
HGLWRUHLQTXHVWRFDVRLOFRQWUDWWRVLHVWLQJXHVHO¶DXWRUHPXRUHSULPD
FKH O¶RSHUD VLD FRPSLXWD VDOYR Fhe una parte notevole e a se stante
GHOO¶RSHUDVLDJLjVWDWDFRQVHJQDWDQHOTXDOFDVRO¶HGLWRUHKDODVFHOWD
tra la pubblicazione della parte e la risoluzione del contratto.
/¶DXWRUHSXzFKLHGHUHODULVROX]LRQHGHOFRQWUDWWRVHO¶HGLWRUHQRQ
SXEEOLFKLO¶Rpera nel termine stabilito, e la risoluzione ha luogo di di-
ULWWRQHOFDVRLQFXLVLDQRSUHYLVWHQHOFRQWUDWWRSLHGL]LRQLHO¶HGLWRUH
dichiari di rinunziare alla nuova edizione o, avendo dichiarato di vo-
lervi procedere, non vi proceda nel termine di due anni.
Anche dopo la stipulazione del contratto di edizione è consentito
DOO¶DXWRUH SHU JUDYL PRWLYL PRUDOL GL ULWLUDUH GDO FRPPHUFLR O¶RSHUD
WHQHQGRLQGHQQHO¶HGLWRUH (art. 2582 cod. civ. e art. 142, l. 633/1941).
Per le opere drammatiche, drammatico-musicali, coreografiche e in
genere per le opere destinate alla rappresentazione, accanto al contrat-
to di edizione, e con prevalenza su questo, assume rilevanza il contrat-
WRGLUDSSUHVHQWD]LRQHFRQLOTXDOHO¶DXWRUHFRQFHGHTXHVWDSDUWLFRODUH
facoltà di riprodX]LRQHGHOO¶RSHUDHO¶DOWURFRQWUDHQWHDVVXPHO¶REEOLJR
176 Manuale di diritto delle arti e dello spettacolo

di farla rappresentare o eseguire in pubblico e di corrispondere


DOO¶DXWRUHXQFRPSHQVR3HUOHRSHUHPXVLFDOLLOFRQWUDWWRSUHQGHQo-
me di contratto di esecuzione.

9.5. La successione mortis causa

3ULPDGLVRIIHUPDUFLVXOO¶LQGDJLQHGHOODVRUWHGHLGLULWWLGLDXWRUHHGe-
gli altri diritti connessi al suo esercizio nel caso di morte del titolare,
si rende necessaria una breve disamina sul concetto stesso di succes-
sione e sulle varie tipologie di successione stessa, così come discipli-
nate dal nostro legislatore.
Il termine successione, nel suo più ampio significato, individua una
vicenda traslativa, in forza della quale un soggetto (successore o aven-
te causa) subentra nella posizione giuridica di un altro soggetto (autore
o dante causa).
Si tratta a ben vedere di un fenomeno non estintivo, bensì solo mo-
dificativo del profilo soggettivo di un rapporto giuridico: costituisce,
pertanto, un modo di acquisto del diritto a carattere derivativo.
Soffermandoci sul concetto di successione mortis causa, si suole
DIIHUPDUHFKHO¶DFTXLVWRqDFDXVDGLPRUWHTXDQGRDYYLHQHFRPHFRn-
seguenza della morte del titolare dei diritti interessati.
/DPRUWHGHWHUPLQDO¶HVWLQ]LRQHGHOODFDSDFLWjJLXULGLFDGHOVRJJHt-
to defunto e parallelamente dei diritti personali, ma non anche dei di-
ritti patrimoniali e degli altri diritti trasmissibili; anzi al riguardo il le-
gislatore si preoccupa di individuare dei soggetti che subentrino nella
titolarità di questi ultimi, onde scongiurare la venuta ad esistenza di
res nullius.
Il concetto di successione a causa di morte ha una portata molto
ampia tale da comprendere diverse ipotesi, infatti vi rientrano non solo
gli acquisti traslativi e gli acquisti traslativi di tipo costitutivo (uno su
tutti il legato di usufrutto), ma anche ogni specie di acquisto che ritro-
va nella morte di un soggetto la propria ragione giustificativa, tanto se
dipendenti dalla volontà del defunto o dalla volontà della legge, pur-
ché derivanti dal patrimonio del soggetto deceduto (un esempio è rap-
presentato dai diritti agli alimenti del coniuge separato con addebito).
In tutti questi casi si verifica comunque un acquisto definito, iure suc-
IX. ,OGLULWWRG¶DXWRUH 177

cessionis, anche in mancanza di un vero e proprio trasferimento. Biso-


gna però sottolineare come non ogni acquisto subordinato alla morte
rientri nella nozione di acquisto mortis causa, sono infatti da escludere
tutti gli acquisti non derivanti dal patrimonio del defunto (pensioni o
indennità) e gli acquisti avvenuti durante la vita della persona defunta
sebbene subordinati alla sua morte. In queste ipotesi da ultimo descrit-
te si suole parlare di acquisti iure proprio e non iure successionis.

9.5.1. Diversi tipi di delazione

Chiarito il concetto di successione mortis causa, dobbiamo ora con-


centrare la nostra attenzione sulle diverse modalità tramite cui può
DYHUOXRJRODGHOD]LRQHYDOHDGLUHO¶RIIHUWDGLHUHGLWjSHUSRWHUFRm-
SUHQGHUHLQFKHPRGRHFRQTXDOLHIIHWWLLGLULWWLG¶DXWRUHSRVVDQRHVVe-
re trasmessi.
Punto di partenza della nostra indagine deve essere necessariamen-
WHO¶DUWFRGFLY (UXEULFDWR³GHOD]LRQHGHOO¶HUHGLWj´), il quale di-
spone al primRFRPPDFKHO¶HUHGLWjVLGHYROYH per legge o per testa-
mento.
In altre parole il legislatore, sempre per particolari esigenze eco-
nomico-sociali volte ad impedire che alla morte di un soggetto il suo
patrimonio non abbai più un titolare, si preoccupa di individuare una
VHULHGLVRJJHWWLDLTXDOLGHYROYHUHO¶HUHGLWjLQTXHVWLRQH
7DOL VRJJHWWL VRQR LQGLFDWL GDOO¶DUW  FRG FLY LO TXDOe testual-
PHQWHSUHYHGHFKH³QHOODVXFFHVVLRQHOHJLWWLPDO¶HUHGLWjVLGHYROYHDO
coniuge, ai discendenti, agli ascendenti, ai collaterali, agli altri parenti
HDOOR6WDWRQHOO¶RUGLQHHVHFRQGROHUHJROHVWDELOLWHQHOSUHVHQWHWLWo-
OR´
Ciò posto occorre osservare come la successione ex lege o ab inte-
stato, che dir si voglia, rappresenta una fattispecie residuale, la quale
trova efficacia solo in assenza di un testamento o anche in presenza di
TXHVW¶XOWLPRQHOFDVRLQFXLLOWHVWDWRUHQRQDEELDGLVSRVWRGHOVuo in-
tero patrimonio.
In ambito mortis causa, il legislatore, ispirato dal favor testamenti,
ULFRQRVFHXQ¶DPSLDDXWRQRPLDDOWHVWDWRUHDIILQFKpLOPHGHVLPRSRVVD
regolare la propria successione come meglio crede. La più grande li-
mitazione alla libertà testamentaria è forse rappresentata dalla previ-
178 Manuale di diritto delle arti e dello spettacolo

sione della successione necessaria, argomento del quale però, per ra-
gioni di opportunità non è possibile approfondire la conoscenza in
questa sede.
La successione testamentaria rappresenta argomento piuttosto
complesso, necessitando di alcuni chiarimenti riguardanti le modalità
attraverso cui il beneficiario può addivenire al lascito e gli effetti del
medesimo, su cui ci soffermeremo di seguito.

9.5.2. Sulla successione testamentaria

Il testamento come accennato è lo strumento attraverso cui il testatore


può regolare gli aspetti patrimoniale e non solo della propria succes-
VLRQH6LWUDWWDGLXQ³FRQWHQLWRUH´LOTXDOHSXzHVVHUHDOO¶RFFRUUHQ]D
riempito secondo il desiderio del proprio autore.
Si eviterà di analizzare le varie forme testamentarie in quanto ar-
gomento non di stretto interesse. Basti solo ricordare che a prescindere
dalla forma assunta dal testamento, pubblico, segreto, olografo, inter-
nazionale o speciale che sia, vige nel nostro ordinamento il principio
di equipollenza delle forme testamentarie.
Ciò che è necessario aver ben presente, al fine di cogliere le diffe-
renze circa gli effetti in caso di un lascito testamentario avente ad og-
JHWWRGLULWWLSDWULPRQLDOLG¶DXWRUHqODGLVWLQ]LRQHtra disposizioni a ti-
tolo di eredità e disposizioni a titolo di legato.
Volendo semplificare la questione il testatore può, nel momento in
cui redige testamento, beneficiare un soggetto con un lascito a titolo di
erede o di legato: QHOSULPRFDVRO¶DWWULEX]LRQHGDUjOXRJR alla qualifi-
ca di erede, nel secondo di legatario.
/HGLIIHUHQ]HWUDOHGXHLSRWHVLVRQRWXWW¶DOWURFKHGLSRFRFRQWRH
spesso sorge il bisogno di appurare a che titolo sia stata posta in essere
una disposizione. AOULJXDUGRO¶DUWFRGFLYFKLDULVFe che le di-
VSRVL]LRQL WHVWDPHQWDULH TXDOXQTXH VLD O¶HVSUHVVLRQH R OD GHQRPLQa-
zione usata dal testatore, sono a titolo universale e attribuiscono la
qualità di erede, se FRPSUHQGRQR O¶XQLYHUVDOLWj R XQD quota dei beni
del testatore. Nel caso in cui il patrimonio del testatore fosse compo-
VWR HVFOXVLYDPHQWH R LQ JUDQ SDUWH GDL GLULWWL SDWULPRQLDOL G¶DXWRUH
XQ¶HYHQWXDOHGLVSRVL]LRQH del seguente tenore letterario: ³ODVFLRRJQL
IX. ,OGLULWWRG¶DXWRUH 179

diritto patrimoniale concernente la mia opera«´GRYUHEEHHVVHUHLQWe-


sa quasi sicuraPHQWHFRPHXQ¶LVWLWX]LRQHGLHUHGH
Volendo analizzare le differenze tra le due ipotesi, si rivela come
O¶HUHGHVXEHQWUDLQXQDTXRWDGHOSDWULPRQLRGHOde cuius, mentre il le-
JDWDULRQHOVLQJRORUDSSRUWRJLXULGLFRLQROWUHPHQWUHO¶DFTXLVWRDWLWo-
lo di eredità è subordinato, a causa degli effetti che ne derivano,
DOO¶DFFHWWD]LRQH GHO EHQHILFLDULR LO OHJDWR D QRUPD GHOO¶DUW  FRG
civ. si acquista senza bisogno di accettazione, fatta salva la facoltà di
rinunziarvi.
La differenza maggiore però tra le due tipologie di disposizioni ri-
guarda il regime della responsabilità per debiti ereditari; infatti solo gli
eredi rispondono dei debiti ereditari in proporzione alla propria quota
di eredità, anche in misura superiore al valore di quanto hanno ricevu-
to, ultra vires hereditatis, mentre il legatario di norma non risponde
dei debiti ereditari e qualora fosse chiamato a farlo ne risponderebbe
sempre nei limiti del valore di ciò che ha ricevuto, intra vires heredi-
tatis.

/HGXHFRPSRQHQWLGHOGLULWWRG¶DXWRUe

Posta questa breve disamina sul diritto successorio, necessaria al fine


di dare al lettore una guida per meglio comprendere le problematiche
legate alla trasmissibilità mortis causa GHLGLULWWLG¶DXWRUHRFFRUUHRUD
concentrare la nostra attenzione proprio su tale argomento.
&RPHJLjVSHFLILFDWRFRQLOWHUPLQHGLULWWRG¶DXWRUHVLVXROHRSHUDUH
una sintesi di diversi aspetti presi in considerazione e tutelati dal legi-
slatore. Da ciò discende LO FDUDWWHUH GXDOLVWLFR GHO GLULWWR G¶DXWRUH LO
quale ha portato a distinguere tra diritto morale e patrimoniale
G¶DXWRUH
3HUGLULWWLPRUDOLG¶DXWRUHVLULFRUGDVLLQWHQGHLOGLULWWRDYHGHUUi-
FRQRVFLXWDODSDWHUQLWjGHOO¶RSHUDWXWHODQGRODPHGHVLPDVRWWRLOSURIi-
OR GHOO¶LGHQWLWj TXDOHHVSUHVVLRQH GHOOD FUHDWLYLWj intellettuale del suo
autore. Diversamente dal punto di vista patrimoniale si considerano i
diritWLDOODUHDOL]]D]LRQHGHOO¶RSHUD di ingegno e allo sfruttamento eco-
nomico della stessa.
180 Manuale di diritto delle arti e dello spettacolo

La distinzione appena evidenziata ha notevole rilievo in materia


successoria, poiché come detto in principio, non tutti i diritti facenti
capo al de cuius sono suscettibili di trasmissione o, perlomeno, vi so-
no dei casi in cui è la legge a disciplinarne la trasmissibilità in modo
inderogabile.

9.6.1. Diritti patrimoniali

CoQULJXDUGRDLGLULWWLG¶DXWRUHGLQDWXUDSDWULPRQLDOHqQHFHVVDULRVRt-
WROLQHDUH FRPH O¶LQGLYLGXD]LRQH GHOO¶HVDWWR PRPHQWR GHOOD PRUWH
GHOO¶DXWRUH UDSSUHVHQWD XQ SXQWR GL QRWHYROH ULOLHYR SRLFKp DOPHQR
per la maggior parte delle opere, da tale momento inizia a decorrere il
WHUPLQHGLVHWWDQW¶DQQLDOODILQHGHOTXDOHGHWWLGLULWWLVLHVWLQJXHUDQQR
Al riguardo si ricorda che in passato tale termine era di anni cinquanta
ed è stato elevato a settanta per effetto della legge 6 febbraio 1996, n.
52, la quale ha recepito la direttiva CEE 93/98.
Trattandosi di normali diritti patrimoniali alla stregua degli altri di-
ritti presenti nel patrimonio del de cuius, al fine di individuarne la sor-
WHDOPRPHQWRGHOO¶DSHUWXUDGHOODVXFFHVVLRQHQRQULPDQHDOWURGDIDUH
che applicare quanto precedentemente chiarito sui meccanismi succes-
sori in genere.
3HUWDQWRQHOFDVRLQFXLO¶DXWRUHGHOO¶RSHUDPXRLDab intestato, vale
a dire senza aver lasciato un testamento, la trasmissione dei diritti in
oggetto sarà disciplinata dalle norme relative alla successione legitti-
ma e gli stessi saranno devoluti ai parenti più prossimi secondo
O¶RUGLQHLQGLYLGXDWRGDOOHQRUPHGDJOLDUWWHVVFRGFLY in tema
di categorie dei successibili.
&RQULJXDUGRDOO¶LSRWHVLGHOO¶DSHUWXUDGHOODVXFFHVsione legittima, si
ricorda come il legislatore abbia previsto come extrema ratio, per il
FDVRLQFXLO¶HUHGLWjYHQJDULILXWDWDGDWXWWLLVXFFHVVLELOLFKHODVtessa
venga devoluta allo Stato (ex art. 586 cod. civ.). Tale articolo ha chia-
rito la natura di acquisto a titolo derivativo anche nel caso di succes-
sione da parte dello Stato, natura messa in discussione sotto il previ-
gente codice del 1865, e, pertanto alla luce di ciò, appare indubbio che
DQFKHLGLULWWLG¶DXWRUHVLDQRWUDVIHULELOLDIDYRUHGHOPHdesimo.
Discorso a parte vale per il c.d. diritto di seguito, vale a dire il dirit-
WR SHU JOL DXWRUL GL RSHUH G¶DUWH H PDQRVFULWWL DG XQ FRPSHQVR VXO
IX. ,OGLULWWRG¶DXWRUH 181

prezzo di ogni vendita successiva alla prima cessione delle opere stes-
VH GD SDUWH GHOO¶DXWRUH FRVu FRPH LQGLYLGXDWR GDOO¶DUW  O
3HUWDOLGLULWWLO¶DUWGHOODPHGHVLPDOHJJHSUHVFULYHFKH
gli stessi spettino agli eredi GHOO¶DXWRUH VHFRQGR OH QRUPH GHl codice
civile, ma in difetto di successori entro il sesto grado, e qui la partico-
larità, tali GLULWWLVRQRGHYROXWLDOO¶(1$3 DFURQLPRGL(QWH1D]LRQDOH
di Previdenza e Assistenza per i pittori e scultori, musicisti, scrittori ed
autori drammatici) per perseguire i propri fini istituzionali.
Altra particolarità in caso di successione ab intestato è rappresenta-
WDGDOO¶DUWGHOODOHJJHVXOGLULWWRG¶DXWRUHLOTXDOHSUHVFULYHFKHLO
diritto di utilizzazione delle opere debba rimanere indiviso fra gli eredi
SHU LO SHULRGR GL WUH DQQL GDOOD PRUWH GHOO¶DXWRUH 7DOH WHUPLQH HQWUR
cui gli eredi sono tenuti a rimanere in comunione ereditaria può essere
disatteso solo ove la divisione sia autorizzata, ricorrendone gravi ra-
JLRQLJLXVWLILFDWULFLGDOO¶DXWRULWjJLXGL]LDULD
Una volta decorso il termine suddetto gli eredi possono sia addive-
nire alla divisione del relativo diritto o continuare nello stato di comu-
nione, che però avrà natura di comunione ordinaria e non ereditaria,
così come precisato dalla norma in commento. Gli eredi, inoltre, pos-
sono anche impegnarsi a rimanere in comunione per un determinato
SHULRGR FKH VHFRQGR TXDQWR GLVSRVWR GDOO¶DUW  FRG FLY QRQ
può eccedere il decennio.
'XUDQWH LO SHULRGR GHO SHUGXUDUH GHOOD FRPXQLRQH O¶DUW  O
633/1941 prescrive che i coeredi debbano nominare uno tra loro a cui
VLDFRQIHULWDWDQWRO¶Dmministrazione che la rappresentanza dei diritti
in oggetto; in caso di disaccordo o di mancata nomina entro un anno
GDOO¶DSHUWXUD GHOOD VXFFHVVLRQH O¶DXWRULWjJLXGL]LDULD FRPSHWHQWH FRn-
IHULVFHFRQ GHFUHWR O¶DPPLQLVWUD]LRQH DOOD 6,$( , SRWHUL GL DPPLQi-
strazione anzidetti sono individuati dal seguente art. 117, l. 633/1941.
'LYHUVDPHQWH TXDORUD O¶DXWRUH SULPD GL PRULUH DEELD UHGDWWR XQ
valido testamento, i diritti patrimoniali in oggetto saranno devoluti se-
condo le sue ultime volontà.
/¶DFTXLVWR GD SDUWH dei beneficiari potrà avvenire tanto a titolo di
erede, quanto di legato, e in entrambi i casi, ovviamente, non trova
VSD]LRO¶DUWFLWDWRGHOODOHJJHVXOGLULWWRG¶DXWRUH3ertanto in caso
di assegnazione dei diritti in oggetto in comunione a più soggetti, gli
182 Manuale di diritto delle arti e dello spettacolo

stessi potranno fin da subito addivenire ad una divisione dei medesi-


mi.

9.6.2. Diritti morali

3HUTXDQWRFRQFHUQHLGLULWWLPRUDOLG¶DXWRUHqQHFHVVDULRWHQHUSUHVHn-
WHODGLIIHUHQ]DHYLGHQ]LDWDDOO¶LQL]LRGHOODQRVWUDLQGDJLQHWUDDFTXLVWL
mortis causaSHULTXDOLO¶DFTXLVWRUDSSUHVHQWDXQDFRnseguenza diret-
ta della morte, e acquisti iure proprio, in cui non vi è una fenomeno
VXFFHVVRULR PDQFDQGR O¶DFTXLVWR D WLWROR GHULYDWLYR GDO SDWULPRQLR
del defunto.
/¶DUW  O  ULIHUHQGRVLDSSXQWR DO GLULWWR GHOO¶DXWRUH GL
ULYHQGLFDUHODSDWHUQLWjGHOO¶RSHUDHGLRSSRUVLDTXDOVLDVLGHIRUPD]Lo-
ne, mutilazione o altra modificazione che possano rappresentare pre-
giudizio al suo onore o alla sua reputazione, prevede che i medesimi
dopo la morte delO¶DXWRUH SRVVDQR HVVHUH IDWWL YDOHUH VHQ]D OLPLWL GL
tempo dal coniuge e dai figli, e, in loro, mancanza, dai genitori e dagli
ascendenti diretti; mancando gli ascendenti ed i discendenti, dai fratel-
li e dalle sorelle e dai loro discendenti´.
Dalla norma citata si evincono con facilità le differenze rispetto ai
GLULWWLSDWULPRQLDOLG¶DXWRUH
Prima di tutto mentre questi ultimi, come già detto, sono limitati
nel tempo, i primi, essendo legati alla tutela di interessi personalissimi
TXDOLO¶RQRUHH la reputa]LRQHGHOO¶DXWRUH, non subiscono limiti tempo-
rali.
Ma la differenza sicuramente più rilevante risiede nel fatto che
PHQWUHSHULGLULWWLSDWULPRQLDOLG¶DXWRUHFRPHYLVWRLO de cuius può
liberamente decidere di disporne mortis causa tramite testamento, per
i diritti morali ciò non è possibile.
Infatti il legislatore, LQYLUWGHOOHJDPHGLVDQJXHFKHOHJDO¶DXWRUH
ai soggetti individuati dalla norma in esame, reputa opportuno che
O¶HVHUFL]LR GL WDOL GLULWWL VLD FRPXQTXH DIILGDWR D WDOL VRJJHWWL $QFKH
per tale motivo, la dottrina maggioritaria al riguardo afferma che il
coniuge, i figli e gli altri congiunti più stretti, acquisterebbero il diritto
di esercitare i diritti morali iure proprio e non iure successionis.
Secondo tale ricostruzione i diritti in oggetto non durerebbero in
SHUSHWXR PD VL HVWLQJXHUHEEHUR FRQ OD PRUWH GHOO¶DXWRUH H FRQWe-
IX. ,OGLULWWRG¶DXWRUH 183

stualmente ne nascerebbero dei nuovi in capo ai soggetti beneficiari,


escludendo pertanto che si possa parlare di un acquisto derivativo dal
patrimonio del defunto. Alla luce di ciò pertanto si può affermare che i
GLULWWLG¶DXWRUHGLFDUDWWHUHPRUDOHQRQFDGDQRLQVXFFHVVLRQH
Bisogna, inoltre, sottolineare chHLVRJJHWWLEHQHILFLDULGLFXLDOO¶DUW
23 non possono esercitare tutte le prerogative relative al diritto morale
FKHO¶DXWRUHSRWHYDHVHUFLWDUHLQYLWDDGHVHPSLR, sono stati esclusi il
GLULWWR GL DXWHQWLFD]LRQH GHOO¶RSHUD ILJXUDWLYH il c.d. diritto di penti-
mento HODIDFROWjGLFKLHGHUHLOULFRQRVFLPHQWRGHOO¶LPSRUWDQWHFDUDt-
WHUHDUWLVWLFRGHOO¶RSHUDLQIXQ]Lone dello studio e attuazione delle mo-
GLILFKHGHOO¶RSHUDPHGHVLPD
DiVFRUVRDSDUWHPHULWDO¶DUWGHOOD l. 633/1941, il quale riferen-
dosi al diritto di pubblicare opere inedite prevede, come nel caso degli
DOWUL GLULWWL SDWULPRQLDOL G¶DXWRUH FKH LO PHGesimo segua le normali
norme della successione legale o testamentaria che sia, ma concede
facoltà al de cuius di vietare la pubblicazione, anche solo per un pe-
riodo di tempo determinato.
Capitolo X

La Società Italiana degli Autori ed Editori*


di MARIA TERESA DELLA VITTORIA SCARPATI

10.1. Cenni storici

Il dato di partenza per ogni questione dovesse sorgere in merito alla


WXWHODGHOGLULWWRG¶DXWRUHqFDSLUHFKHFRVDVLDOD6,$((acronimo che
sta per Società Italiana degli Autori ed Editori) e qual è il suo funzio-
namento.
/¶,VWLWXWR q XQD 6RFLHWj XQLFD GHILQLWD JHQHUDOLVWD GDJOL RSHUDWRUL
della materia, finalizzata al rilascio delle necessarie autorizzazioni uti-
OL VLD SHU OD WXWHOD GHOO¶DXWRUH FKH SHU OD JHVWLRQH GHO mercato dello
spettacolo.
Da uQODWRGLIDWWLLQWHUPLQLJHQHUDOLqDVVLVWLWDO¶DWWLYLWjGHOOHLm-
SUHVHSHUODFRUUHVSRQVLRQHGHOGLULWWRGDOO¶DOWURWURYDJDUDQ]LDLOODYo-
URGHOO¶DXWRUH
Le radici della Società affondano in un passato alquanto recente.
/¶,VWLWXWRYLGHODOXFHD0LODno il 23 aprile 1882 e rappresentò, per
O¶HSRFD LO SXQWR G¶inizio nonché il fulcro della tutela delle categorie
intellettuali, con buona probabilità rimaste negli anni prive della ne-
cessaria salvaguardia della propria professionalità e opera.
Appare, dunque, rilevante sottolineare che a fronte delle numerose
HVSUHVVLRQLDUWLVWLFKHRJJHWWRGHOO¶RGLHUQDWXWHODDLWHPSLOHFDWHJRULH
erano classificabili nella musica, nella letteratura e nel teatro, rappre-
*
Ad Andrea.
/¶HODERUDWRqIUXWWRGHOODSD]LHQ]DGHOPLRDPRUH
e di chi è in grado di dare fiducia.

185
186 Manuale di diritto delle arti e dello spettacolo

VHQWDWHQHOO¶DPELWRGHOSULPRFRQVLJOLRGLUHWWLYR da esponenti del cali-


bro di Giuseppe Verdi, Giosuè Carducci e Francesco De Sanctis.
(UDFKLDURDOORUDO¶LQWHQWRGLFROPDUHOHODFXQHGLWXWHODIRUPDWHVL
nel corso degli anni allo scopo di cominciare a dare forma al rinnova-
mento nel campo della produzione artistica e letteraria in generale.
Iniziava a vedere la luce il dLULWWRG¶DXWRUH
La prima vera espressione di tutela che avrebbe accompagnato gli
autori sino ai giorni nostri, passando per una modernità per certi versi
³DOO¶DYDQJXDUGLD´SHUO¶HSRFDHFRQQRWDWa da estrema contemporaneità
se paragonata ai giorni nostri, è rappresentata dalla Convenzione di
Berna del 1886.
Di chiara impronta sovranazionale, con la sottoscrizione del docu-
mentRDYYHQQHODFRVWLWX]LRQHGHOO¶Unione internazionale per la prote-
zione delle opere letterarie e artistiche sorta su ispirazione di Victor
Hugo secondo cui i Paesi civilisés KDQQRO¶RQHUHGLWXWHODUHQHOPRGR
più uniforme possibile senza prescindere da qualsiasi azione che possa
permettere la protezione delle loro opere.
Il docuPHQWRqDOO¶DYDQJXDUGLDLQTXDQWRSHUODSULPDYROWDOH1a-
zioni stabilivano di riconoscere sul materiale delle nazioni straniere la
VXVVLVWHQ]D GHO GLULWWR G¶DXWRUH IRQGDQGR LO SULQFLSLR GL UHFLSURFLWj
della tutela del copyright tra numerosi stati sovrani di tutto il continen-
te.
Questi erano i tre principi cardine della carta:
a) O¶LQWHUQD]LRQDOL]]D]LRQH GHOOD QRUPDWLYD LQ YLUW GHOOD TXDOH LO
GLULWWRG¶DXWRUHYHQLYDWXWHODWRLQWXWWLJOLVWDWLPHPEUL
b) LOSULQFLSLRGLLQGLSHQGHQ]DLQEDVHDOTXDOHO¶RSHUa era suscet-
tibile di tutela, a prescindere dalla circostanza che la stessa fosse
tutelata dal pDHVHG¶RULJLQH
c) il principio della tutela automatica secondo cui non era necessa-
ria registrazione alcuna, benché i singoli Stati fossero liberi di
richiederla.
Dal 1967, la Conven]LRQHqVWDWDDPPLQLVWUDWDGDOO¶Organizzazione
mondiale della proprietà intellettuale, costituita in seno alle Nazioni
Unite nel 1974.
Il documento ha, peraltro, ricevuto diverse revisioni sino ad addi-
venire alla ratifica della revisione di Parigi del 23 luglio del 1971.
X. La Società Italiana degli Autori ed Editori 187

Riconosciutole lo status di Ente morale nel 1891, nel 1926 la SIAE


si trasferì a Roma e aderì alla Confédération Internationale des So-
FLpWpV G¶$XWHXUV HW &RPSRVLWHXUV che riunisce le Società di autori di
tutto il mondo. Nelle more di tali vicende il nostro Paese viveva un ul-
teriore passaggio storico di rilievo.
1HOFRUVRGHJOLDQQL4XDUDQWDODGLVFLSOLQDGHOGLULWWRG¶DXWRUHFo-
minciava a fondarsi su una matrice di tipo nazionalista che risaliva
proprio agli ultimi anni del 5HJQR G¶,WDOLD H FKH WURYDYD LO SURSULR
SXQWRG¶DUULYRQHOODOHJJHDSULOHQ
,SULQFLSLHVSUHVVLQHOO¶DPELWRGHOSUHGHWWRTXDGURQRUPDWLYRVRQR
tali da potere essere ritenuti ancora attuali e compatibili con la Carta
costituzionale della Repubblica Italiana che, come noto, garantisce la
OLEHUWjGLSHQVLHURDOO¶DUW
In ogni caso la disciplina da ultimo richiamata va collocata
QHOO¶DPELWR GHO SHUFRUVR GL ULQQRYDPHQWR GHO VLVWHPD GHOOH IRQWL H
GHOO¶RSHUD GL FRGLILFD]LRQH GHJOL DQQL LQ GLVDPina dovuta principal-
mente a Rocco.
,QTXHVW¶RWWLFDIRQGDPHQWDOHqO¶incipit GHOO¶DUWGHOODO
LQ YLUW GHO TXDOH ³6RQR SURWHWWH DL VHQVL di questa legge le opere
GHOO¶ingegno di carattere creativo che appartengono alla letteratura, al-
la musicDDOOHDUWLILJXUDWLYHDOO¶architettura, al teatro ed alla cinema-
WRJUDILDTXDOXQTXHQHVLDLOPRGRRODIRUPDGLHVSUHVVLRQH´
Tale legge è stata talmente fondamentale nella nuova creazione e
ULQDVFLWDGHOGLULWWRG¶DXWRUHFKHO¶DUWOVDUHbbe stato ri-
SUHVRSHGLVVHTXDPHQWHGDOWHVWRGHOO¶DUWFRGFLY /LEUR4XLQWR
Titolo IX, 'HLGLULWWLVXOOHRSHUHGHOO¶LQJHJQRHVXOOHLQYHQ]LRQLLQGu-
striali).
La disposizione in tema di acquisto del diritto esprime il seguente
principio: il titolo orLJLQDULRGHOO¶DFTXLVWRGHOGLULWWRGLDXWRUHqFRVWi-
WXLWRGDOODFUHD]LRQHGHOO¶RSHUDTXDOHSDUWLFRODUHHVSUHVVLRQHGHOODYo-
ro intellettuale.
Ebbene, proprio O¶LQVHULPHQWR QHOO¶DPELWR GHO OLEUR GHO /DYRUR GL
una norma a tutela delle opere intellettuali lascia intendere la chiara
volontà del legislatore di restituire la giusta dignità alle opere realizza-
te.
188 Manuale di diritto delle arti e dello spettacolo

10.2. Le funzioni della SIAE e la valorizzazione dei suoi associati

A questo punto occorre prendere in considerazione le funzioni e il


funzionamento della SIAE; per fare ciò bisogna in via preliminare par-
lare dei suoi associati, ovvero dei creativi e autori nonché titolari di
diritti sulle opere i quali decidono di affidare il proprio repertorio alla
predetta Amministrazione.
Ciò che ne viene di conseguenza è la valorizzazione non solo del
del profilo giuridico del prodotto della creatività degli autori, ma an-
FKH H VRSUDWWXWWR GHO FDUDWWHUH HFRQRPLFR GL RJQL VLQJROD ³RSHUD]Lo-
QH´
Di qui la comprensione del carattere di base della SIAE che può
sintetizzarVL VHPSOLFHPHQWH QHOO¶DPSLD EDVH DVVRFLDWLYD H QHO YDVWLs-
simo repertorio che le viene affidato.
'HOUHVWRQRQVLSXzFUHGHUHFKHO¶XQLFRPRWLYRFKHLQGXFDL³FUHa-
WLYL´DGDVVRFLDUVLDOOD6,$(VLDXQDWUDGL]LRQHOXQJDROWUHDQQL
La gestione collettiva che per somme linee si sta tratteggiando, ba-
sata su un sistema di associazione rimessa alla volontà esclusiva di
ogni singolo associato, ha costituito la formula di amministrazione più
efficiente quando ci si trovi di fronte a molteplici forme di utilizzazio-
ne delle opere.
Al lume di quanto sopra vale la pena di anticipare e sottolineare il
FRQWHQXWRGHOO¶DUWGHOODOHJJHVXOGLULWWRG¶DXWRUHLOTXDOHULVHUYD
LQYLDHVFOXVLYDDOOD6,$(O¶DWWLYLWjGLLQWHUPHGLD]LRQHQHOVHWWRUHGHOOD
proprietà intellettuale.
La predetta attività è esercitata per le seguenti motivazioni:
a) ODFRQFHVVLRQHSHUFRQWRHQHOO¶LQWHUHVVHGHOO¶DYHQWHGLULWWRGLOi-
FHQ]HHDXWRUL]]D]LRQLSHUO¶XWLOL]]D]LRQHHFRQRPLFDGLRSHUHWu-
telate;
b) la percezione dei proventi ricollegati a licenze e autorizzazioni;
c) la ripartizione dei proventi tra gli aventi diritto.
Nel corso degli anni esigenze sempre nuove e diverse, ricollegate al
sorgere di nuove tecnologie e strumentazioni, hanno reso necessario
O¶LQWHUYHQWRGLQRUPD]LRQLXOWHULRUL
È per tale ragione FKHqVWDWRDJJLXQWRO¶DUW bis alla legge sul
GLULWWRG¶DXWRUHSHUPH]]RGHOGOJVRWWREUHQLOTXDOHVL
RFFXSD GHOO¶HVHUFL]LR GHO GLULWWR HVFOXVLYR GL ULXWLOL]]DUH OD ULWUDVPLs-
X. La Società Italiana degli Autori ed Editori 189

sione via cavo, esercitato esclusivamente tramite la SIAE mentre per i


diritti connessi la disposizione prevede, contestualmente, che la SIAE
DJLVFDSHULOWUDPLWHGLDSSRVLWHFRQYHQ]LRQLGDVWLSXODUHFRQO¶,VWLWXWR
Mutualistico Artisti Interpreti Esecutori (I.M.A.I.E.) e le altre società
di gestione collettiva.
A questo punto della disamina vale la pena di anticipare che la pre-
VHQ]D GL LVWLWXWL TXDOL TXHOOR GHOO¶,0$,( QRQ q WDOH GD VFDOILUH
O¶DQFRUD JUDQLWLFR PRQRSROLR 6,$( LQ PDWHULD GL WXWHOD GHO GLULWWR
G¶DXWRUH
La precisazione è dovuta in quanto diversa è la natura dei due Isti-
WXWLGDXQODWRF¶qOD6,$(FKHWXWHODLQYLDLPPHGLDWDHGLUHWWDFRPH
noto, iO GLULWWR G¶DXWRUH H TXLQGL O¶autore e il relativo prodotto;
GDOO¶altro lato, iQYHFH GLIIHULVFH LO UXROR GHOO¶I.M.A.I.E. chiamata a
fornire tutela DLGLULWWLFRQQHVVLDTXHOORG¶autore rispetto ai quali non
può parlarsi di monopolio in senso stretto.
A tal proposito, la l.d.a. disciplina espressamente i diritti connessi
QHO7LWROR,,DSDUWLUHGDOO¶art. 72 e li tutela in quanto diritti riferiti so-
VWDQ]LDOPHQWHDOGLULWWRG¶DXWRUHHDOO¶utiOL]]RGHOO¶opera.
Quindi, OD VIHUD GHOOD JHVWLRQH H GHOO¶intermediazione dei diritti
connessi, DIILGDWD SHUDOWUR QRQ VROR DOO¶I.M.A.I.E. ma anche ad altre
società, non va confusa con quella della gestione deOGLULWWRG¶autore in
senso stretto che resta propria del monopolio della SIAE
$SURSRVLWRGHLQXRYLSRWHULFRQIHULWLDOO¶,0$,(SRWUHEEHULVXl-
WDUH G¶DXVLOLR ODOHWWXUD GHOOH GLVSRVL]LRQL FRQWHQXWH QHO G3&0 GHO
19 dicembre 2012 recante le norme per O¶LQGLYLGXD]LRQHQHOO¶LQWHUHVVH
dei titolari aventi diritto, dei requisiti minimi necessari ad un razionale
e corretto sviluppo del mercato degli intermediari dei diritti connessi
DOGLULWWRG¶DXWRUH.
Le disposizioni ivi recate rilevano proprio in quanto agiscono
QHOO¶RWWLFDGHOODOLEHUDOL]]D]LRQHGHOPHUFDWRLQFRPPHQWRGHILQHQGR
modi, tempi e requisiti delle imprese partecipanti al settore, senza tut-
tavia intaccare il ruolo esclusivo della SIAE, unico soggetto deputato
nel nostro Paese alla tutela direWWDGHOO¶DXWRUH
(IIHWWXDWHOHGRYXWHSUHFLVD]LRQLO¶DUWOGDDJJLXQJHXOWHULRUL
funzioni alla SIAE, oltre a quelle attribuitele dalla legge, riconnesse
FRQ OD SURWH]LRQH GHOOH RSHUH GHOO¶LQJHJQR LQ EDVH DO VXR VWDWXWR /H
fornisce, altresì, i poteri di assumere servizi di accertamento e di per-
190 Manuale di diritto delle arti e dello spettacolo

cezione, di tasse, contributi e diritti per conto dello Stato e di altri Enti
pubblici e privati.
)RQGDPHQWDOHDSSDUHDOWUHVuO¶XOWHULRUHIXQ]LRQHVYROWDGDOOD6,$(
chiamata alla rappresentanza processuale ex lege SHUO¶HVHUFL]LRGHOOH
D]LRQL D WXWHOD GHO GLULWWR G¶DXWRUH VHFRQGR TXDQWR GLVSRVWR GDOO¶DUW
164 lGDQRQFKpGDOO¶DUWVHFRQGRFRPPD, della l. n. 2/2008.
Atteso il fondamentale ruolo di intermediazione e di tutela a favore
degli autori che le abbiano conferito il relativo incarico, può ben dirsi
FKHLOUDSSRUWRWUDO¶DXWRUHHOD6,$(VLDLQTXDGUDELOHQHOODILJXUDGHO
mandato, anche se non può semplicisticamente ridursi il ruolo della
SIAE a mera mandataria, essendo piuttosto un ente rivestito anche di
funzioni di preminente rilevanza pubblica.

10.3. La struttura

La Società è dotata di un ruolo caratterizzato da una complessa strut-


tura organizzativa in grado di confrontarsi con una molteplicità di si-
tuazioni variegate in base al tipo di espressione e di genere artistico
nonché per le forme di utilizzazione e per la vasta diffusione geografi-
ca.
3HUFLzFKHFRQFHUQHOHRSHUHGLWLSRFUHDWLYRO¶DPPLQistrazione è
affidata a cinque sezioni specializzate nella cura e negli interessi di un
peculiare settore.
La divisione in sezione mira a offrire una tutela efficace tenendo
conto delle specificità dei diversi generi di opere creative, delle parti-
FRODULWjGHOOHGLYHUVHIRUPHGLXWLOL]]D]LRQHGHOO¶HVLJHQ]DGLSURFHGe-
re rapidamente alla ripartizione dei diritti.
Pertanto, pare opportuno effettuare una preliminare disamina della
sezione più rappresentativa, ovvero quella della Musica per poi proce-
dere al commento delle altre strutture portanti della SIAE.
La sezione Musica ha in sè tutte le opere musicali (strumentali o
cantate) che abbiano alla base un testo e non costituiscano di per sè
XQR VSHWWDFROR FRPSOHWR QHO VHQVR FKH O¶RSHUD SXz HVVHUH XWLOL]]DWD
³LQRJQLIRUPDHPRGR´± come recita la legge ± come, a titolo esem-
SOLILFDWLYRDYYLHQHSHUXQ¶RSHUDOLrica.
X. La Società Italiana degli Autori ed Editori 191

6LWHQJDSUHVHQWHFKHQHOO¶DPELWRGLWDOHSDUWLFRODUHVH]LRQHVLSDUOD
JHQHUDOPHQWHGL³JUDQGHGLULWWR´VXOO¶RSHUDGDSDUWHGHOO¶DXWRUHHRJQL
utilizzazione, effettuata con qualsivoglia strumento riproduttivo, ivi
compreso Internet, costituisce uno specifico contratto tra aventi diritto
e utilizzatori.
,O³JUDQGHGLULWWR´qFRVDGLYHUVDGDO³SLFFRORGLULWWR´GDLQWHQGHUVL
FRPHODYRORQWjGHOO¶DXWRUHGLDXWRUL]]DUHHGLHVVHUHFRPSHQVDWRVHn-
]D FKH VLD SRVVLELOH GLIIHUHQ]LDUH OH FRQGL]LRQL G¶XVR LQ UHOazione
DOO¶RSHUDRDOO¶XWLOL]]DWRUH
Ne consegue che il sistema di amministrazione di questi utilizzi
(definiti livellati) VLIRQGDVXGLXQ¶DXWRUL]]D]LRQHDFDUDWWHUHJHQHULFR
che concede in uso il repertorio in modo indifferenziato, per il rilascio
della quale non ha rilievo né il numero né il tipo di brani utilizzati.
Occorre, poi, a questo punto, fare menzione della sezione Lirica la
quale gestisce le opere del teatro musicale e della danza, nonché dei
contributi coreografici.
Anche in tal caso le opere sono dichiarate e depositate con conse-
guente riscossione del compenso per le forme di utilizzazione affidate
in mandato alla SIAE. Il compenso viene poi ripartito tra gli aventi di-
ritto. A tale sezione compete anche, e su richiesta degli aventi diritto,
dLRFFXSDUVLGHOO¶LQWHUPHGLD]LRQHGHLGLULWWLHFRQRPLFLVSHWWDQWLSHUOH
utilizzazioni di opere musicali di dominio pubblico di prima pubblica-
zione o realizzate sulla base di una edizione critica nonché del com-
penso a titolo di noleggio di partiture e parti orchestrali.
8Q¶XOWHULRUH VH]LRQH q SRL OD '25 DFURQLPR che sta SHU³'UDm-
maWLFD 2SHUHWWD H 5LYLVWD´  OD TXDOH RFFDVLRQDOPHQWH VL RFFXSD GL
opere a contenuto musicale. La sezione in commento gestisce le crea-
zioni destinate al teatro e alle opere analoghe, quali rivista, cabaret,
marionette, commedie musicali, sia quando siano scritte per la rappre-
VHQWD]LRQHGDOYLYRFKHQHOO¶LSRWHVLGLGHVWLQD]LRQHDOODGLIIXVLRQHUa-
GLRIRQLFD H WHOHYLVLYD 1HOO¶LSRWHVL GL PXVLFKH FRPSRVWH SHU
O¶DEELQDPHQWRDSDUWLFRODUL spettacoli a contenuto testuale, la sezione
si occupa anche di acquisire la documentazione relativa alla parte mu-
sicale e di gestire i diritti di carattere economico anche per conto del
compositore.
Ebbene, vale la pena di precisare che le opere musicali assegnate
alla sezione Lirica e alla sezione DOR vengono gestite secondo le
192 Manuale di diritto delle arti e dello spettacolo

QRUPH GHO ³JUDQGH GLULWWR´ D GLIIHUHQ]D GHO UHSHUWRULR GHOOD VH]LRQH


Musica che viene gestito collettivamente e in essa gli associati non
hanno la facoltà di limitare o condizionare le autorizzazioni che la se-
zione rilascia, se non negli specifici casi indicati dal regolamento della
6,$(DSSURYDWRGDOO¶$VVHPEOHDLOJLXJQR
Esempio eclatante è rappresentato dalla limitazione degli usi online
GLFXLDOO¶DUWGHOUegolamento richiamato.
/DGLVWLQ]LRQHVLQRUDRSHUDWDWUD³DPPLQLVWUD]LRQHFROOHWWLYD´HJe-
VWLRQH³RSHUDSHURSHUD´SXzDYHUHLPSRUWDQWLULIOHVVLLQTXDQWRPHn-
WUH QRQ q IDFLOH RWWHQHUH O¶DXWRUL]]D]LRQH SHU XQ¶RSHUD DPPLQLVWUDWD
FRPH³JUDQGHGLULWWR´SXzULVXOWDUH semplice richiedere un permesso
JHQHUDOHSHUXQLQWHURUHSHUWRULRVRJJHWWRDL³SLFFROLGLULWWL´
Un breve cenno di richiamo meritano anche le altre sezioni che,
VHSSXUHUDSSUHVHQWDQRXQULOHYDQWHSXQWRIHUPRQHOO¶DPPLQLVWUD]LRQH
delle opere e dei connessi diritti, tuttavia non presentano, se non in ca-
VLVSHFLILFLLOFDUDWWHUHGHOGHSRVLWRGLXQDFRSLDGHOO¶RSHUD
Vi è, quindi, la sezione OLAF (acronimo che sta SHU³2SHUH/HWWe-
UDULHH$UWL)LJXUDWLYH´ QHOODTXDOHYHQJRQRDFRQIOXLUHOHRSHUHGHOOD
letteratura e delle arti visive, rispetto alle quali gli aventi diritto deci-
GDQRGLDIILGDUHDOOD6,$(O¶LQFDULFRGLULODVFLDUHDXWRUL]]D]LRQLHUi-
VFXRWHUH L UHODWLYL FRPSHQVL SHU O¶LSRWHVL GL XWLOL]]D]LRQH SXEEOLFD
1HOO¶DPELWRGLWDOHXOWLPRFRPSLWRLOUXRORGHlla SIAE diventa, peral-
tro, fondamentale.
8Q¶XOWHULRUHVH]LRQHqTXHOODGHO&LQHPDFKLDPDWDDGDPPLQLVWUa-
re, per quanto di competenza, i diritti degli autori di contributi creativi
alle opere per la cinematografia e la televisione.
La sezione in questione cura anche la tenuta del Pubblico Registro
Cinematografico ove sono acquisiti i crediti relativi ad autori e aventi
diritto della produzione cinematografica nazionale.

10.4. Il ruolo della SIAE: nello specifico, i soggetti tutelati e le at-


tività

Come è possibile evincere da quanto sinora esposto, la gestione collet-


tiva rappresenta la formula di amministrazione più efficiente, ma an-
X. La Società Italiana degli Autori ed Editori 193

che più efficace in termini di costi, al cospetto di una molteplicità di


XWLOL]]D]LRQLGLXQ¶RSHUD
Ciò che ne consegue è che mentre le espressioni creative possono
essere notevoli, rispetto a queste possono aversi processi commerciali
FKHVLVYROJRQRVHQ]DO¶LQWHUYHQWRGHOOD6,$(HGDOWULFKHLQYHFHQe-
cessariamente si attuano secondo OHVROX]LRQLGLTXHVW¶XOWLPD
Quanto detto combacia perfettamente con il principio che
O¶DVVRFLD]LRQH GL XQ DXWRUH DOOD 6,$( q D EDVH YRORQWDULD QHO VHQVR
FKHVLUHDOL]]DSHUHIIHWWRGLXQDYRORQWjQRQFRDUWDWDGHOO¶DXWRUHHGq
affidata a tre passaggi fondamentali: 1) la presentazione della doman-
da di ammissione; 2) il pagamento del proprio contributo; 3) la dichia-
UD]LRQHGHOO¶RSHUDFKHVLLQWHQGHDIILGDUHLQDPPLQLVWUD]LRQH
Occorre tenere presente che il contributo degli associati è fonda-
PHQWDOH SHU LO VRVWHQWDPHQWR GHOOD 6,$( LQ TXDQWR TXHVW¶Xltima non
gode di alcun sostegno pubblico e può affidarsi solo a una tassa istrut-
WRULDFKHVLSDJDDOPRPHQWRGHOO¶DVVRFLD]LRQHVXVVHJXLWDSRLGDXQD
quota annuale. Chiaramente il regolamento SIAE prevede anche un
regime di esclusioni dal versamento del predetto contributo agli artt.
da 21 a 25.
Un ulteriore fonte di sostentamento può derivare dalla trattenuta di
parte delle somme che la SIAE riscuote per conto degli autori, sotto
forma di provvigione o aggio sociale, in misura diversa a seconda del
genere di opere amministrate.
7DQWRSUHPHVVRQHFRQVHJXHFKHDOOD6RFLHWjRJJHWWRGHOO¶RGLHUQR
studio è riservata ex lege O¶DWWLYLWj GL LQWHUPHGLD]LRQH SHU O¶HVHUFL]LR
GHOGLULWWRG¶DXWRUH
È evidente, infatti, che nessuno è obbligato ad affidarsi alla SIAE
per lDJHVWLRQHHODWXWHODGHLSURSULGLULWWLPDVHO¶DXWRUHDYYHUWHODQe-
cessità di un affidamento non può che associarsi alla SIAE.
È il c.d. principio del monopolio legale che ha trovato, come già
GHWWR OD SURSULD IRQWH QRUPDWLYD QHOO¶DUW  OGD GD FXi consegue
FKHOD6,$(QHOO¶RSHUDUHLQUHJLPHGLPRQRSROLRqFRPXQTXHREEOi-
gata a negoziare con qualsiasi utilizzatore, osservando la parità di trat-
tamento in relazione a situazioni oggettivamente identiche (in tal sen-
so si è anche pronunciata una risalente giurisprudenza (Tribunale di
Roma, sentenza 21 marzo 1991).
194 Manuale di diritto delle arti e dello spettacolo

Chiaramente il regime di esclusiva riservato alla SIAE ha fatto sor-


JHUH GXEEL VXOOD FRVWLWX]LRQDOLWj GHOO¶DUW  OGD WXWWL ULVolti dalla
Corte nel senso che la ratio GHOO¶HVFOXVLYDLQIDvore della SIAE sta, ol-
tre che nella protezione dei diritti dei loro autori, nella funzione di
SURPR]LRQHGHOODFXOWXUDHQHOODGLIIXVLRQHGHOOHRSHUHGHOO¶ingegno di
carattere creativo. Non vi è dubbio che il pieno dispiegarsi di tale
compito potrebbe risXOWDUHPHQRPDWRVHO¶HQWHQRQIRVVHWHQXWRDFRn-
trattare con tutti gli utilizzatori e ad assicurare la loro parità di tratta-
mento a parità di condizioni oggettive, escludendo posizioni di privi-
legio o di svantaggio (Corte costituzionale, sentenza 15 maggio 1990,
n. 241).
Il problema ha trovato una precedente plausibile risoluzione quan-
do nel 1972 i giudici della Corte Costituzionale avevano ritenuto che
OD SRVL]LRQH GHOOD 6,$( IRVVH JLXVWLILFDWD GDOO¶HVLJHQ]D GL FDUDWWHUH
generale, nonché pubblico, di adeguDWDSURWH]LRQHGHOGLULWWRG¶DXWRUH
e dei diritti ad esso connessi (Corte costituzionale, sentenza 19 aprile
1972, n. 65).
Merita, peraltro, un particolare cenno la recente ordinanza resa dal
Tribunale di Milano che ha visto interessato e, per certi versi, minato
proprio il monopolio della SIAE da parte della società Soundreef Ltd.
portatrice del diritto a vedere tutelato il proprio ruolo nel mercato del-
ODPXVLFDQRQVRORQHOO¶DPELWRQD]LRQDOH
Il precitato provvedimento rileva in quanto, seppur nella sola logica
comunitaria, ha riconosciuto la possibilità per gli autori stranieri che
non abbiano scelto di essere tutelati dalla SIAE, di ottenere tutela
presso altre società.
Ebbene, il collegio chiamato a dirimere la controversia ha ritenuto
FKHO¶DUWl.d.a., nello stabilire dei precisi limiti, non può che esse-
re considerata norma di carattere eccezionale e di stretta interpretazio-
ne, né tale norma può essere estrapolata dal contesto normativo in cui
è inserita.
Del resto, neppure va sottaciuto che il successivo art. 185 limita
O¶DSSOLFD]LRQHGHOO¶LQWHURFRPSOHVVRGLQRUPHDLVROLDXWRULLWDOLDQL
'XQTXH q GDWR OHJJHUVL QHOO¶Rrdinanza in commento che il com-
plesso della normativa, quindi, si preoccupa chiaramente di tutelare gli
autori, i loro diritti, la loro posizione attiva, non certo imponendo loro
vincoli o limitazioni ed anzi espressamente escludendoli.
X. La Società Italiana degli Autori ed Editori 195

Pertanto, sulla base di detta interpretazione e del combinato dispo-


sto degli artt. 180 e 185 il principio espresso è che per gli autori stra-
nieri non esista un obbligo di rispetto della riserva di legge prevista
dalle predette norme. Ne consegue che, nel rispetto delle disposizioni
comunitarie e dei principi del libero mercato e della concorrenza, gli
stessi non hanno alcun obbligo di rivolgersi alla SIAE per la tutela dei
propri diritti.
Ebbene, proseguendo nella disamina dei compiti assolti dalla SIAE
e come è stato possibile verificare nel corso dello studio delle diverse
Sezioni, la stessa svolge, altresì, il ruolo di tenuta di alcuni pubblici
registri.
Si è già fatto cenno al Pubblico Registro Cinematografico il quale
rappresenta un registro di pubblicità che la legge ha affidato alla SIAE
nel quadro delle provvidenze di sostegno alla cinematografia naziona-
le.
Ciò che rileva a tale scopo è che la registrazione fa fede, fino a
SURYDFRQWUDULDGHOO¶HVLVWHQ]DGHOO¶RSHUDHGHOIDWWRGHOODVXDSXEEOi-
cazione.
Esiste poi un Registro pubblico per il software che rende pubblica
O¶HVLVWHQ]DHODWLWRODULWjGLGLULWWLUHODWLYLDSURJUDPPL*OLDXWRULLQGi-
cati nel Registro sono considerati, fino a prova contraria, autori delle
opere loro attribuite.
La richiesta di registrazione si effettua su apposito modello ed è ac-
compagnata da un disco ottico contenente il programma per elaborato-
re che si intende registrare.
La registrazione del software è facoltativa e onerosa.
Un ulteriore compito della SIAE consiste poi nella gestione del
servizio di deposito delle opere inedite che può avere a oggetto copio-
ni, trame, soggetti, opere audiovisive, software, banche dati e, comun-
TXHRSHUHGHOO¶LQJHJQR
Il predetto deposito ha validità di cinque anni ed è rinnovabile per
analoga durata, ha carattere privato e viene effettuato al fine di costi-
WXLUHSHULOGHSRVLWDQWHXQDSURYDGRFXPHQWDOHGLHVLVWHQ]DGHOO¶RSHUD
alla data del deposito.
/¶HIIHWWXD]LRQHGHOGHSRVLWRSHUDOWURQRQIRUQLVFHDOFXQGLULWWRSHU
O¶LVFUL]LRQHDOOD6,$(RDWXWHODGHOO¶RSHUDGDSDUWHGLTXHVW¶XOWLPDFKH
non assume alcun compito di lettura o collocamento del lavoro depo-
196 Manuale di diritto delle arti e dello spettacolo

sitato né responsabilità di sorta SHUO¶LSRWHVLGHOSODJLRRXWLOL]]D]LRQL


illecite.

10.5. La prevenzione e repressione della violazione della legge sul


GLULWWRG¶DXWRUH,OFRQWUDVVHJQR

1HOODSUHYHQ]LRQHGHOOHYLROD]LRQLGHOGLULWWRG¶DXWRUHDWWHVROD6,$(
svolge un ruolo fondamentale: può costituirsi persino parte civile in
taluni procedimenti penali aventi a oggetto le predette ipotesi di reato.
Si tengano presenti, a titolo esemplificativo, OHLSRWHVLGLFXLDOO¶DUW
171 ter l.d.a. ove si dà atto che la SIAE è immediatamente colpita dal
fenomeno della riproduzione e vendita di supporti magnetici che
O¶DEXVLYRSURGXWWRUHGXSOLFDHYLWDQGRGLFRUULVSRQGHUHDOOD6IAE i di-
ritti economici derivanti dalla legge.
/D FRQVXPD]LRQH GHO UHDWR GHWHUPLQD XQD OHVLRQH GHOO¶LPPDJLQH
GHOO¶,VWLWXWRPDanche dei suoi associati che, comunque, sono incapaci
di far fronte ad un fenomeno di tale diffusione.
Del resto, è la SIAE che ha il compito di agire e ha la conseguente
WLWRODULWj DOO¶HVHUFL]LR GHO GLULWWR DO ULVDUFLPHQWR GHO GDQQR VYROJHQGR
XQ¶DWWLYLWj intesa, non solo giuridica, ma anche economica, volta alla
VDOYDJXDUGLDGHOOHRSHUHGHOO¶LQJHJQR
7URYD GXQTXH SLHQR IRQGDPHQWR QHOO¶DWWXDOH VLVWHPD VDQzionato-
ULRGHOGLULWWRG¶DXWRUH il ruolo della SIAE, chiamata alla tutela dei di-
ritti morali e patrimoniali di autore a repressione dei fenomeni di vio-
lazione resi possibili anche grazie ai nuovi mezzi di diffusione e uti-
OL]]D]LRQHGHOOHRSHUHGHOO¶LQJHJQR.
Il bisogno di tutela ha trovato il proprio rinforzo, nelle attività di
prevenzione e di accertamento delle violazioni della legge del diritto
G¶DXWRUH FRQ O¶LQWURGX]LRQH GHOO¶DUW  bis l.d.a. che riguarda
O¶DSSRVL]LRQHGHOFRQWUDVVHJQRVXLVXSSRUWLFRQWHQHQWLSURJUDPPLSHU
elaboratore e opere multimediali nonché suoni, voci e immagini, non-
FKpGHOO¶Drt. 182 bis l.d.a. con cui sono stati attribuiti compiti più pre-
gnanti a tutela, prevenzione e repressione delle violazioni.
1HOO¶DPELWR GL TXDQWR VRSUD GHWWR WURYDQR VSD]LR OH QRUPH FKH VL
occupano del contrassegno e che sono dettate nel corpus GHOO¶DUW171
bis l.d.a. il cui primo comma sanziona due diverse fattispecie:
X. La Società Italiana degli Autori ed Editori 197

a) quella di chi abusivamente duplica, per trarne profitto, pro-


grammi per elaboratore;
b) quella di chi, agli stessi fini, distribuisce, vende, detiene a scopo
commerciale o imprenditoriale o concede in locazione pro-
grammi contenuti in supporti non contrassegnati dalla SIAE.
La Corte di Giustizia delle Comunità europee è intervenuta con una
recente pronuncia, datata 8 novembre 2007, nel corso del procedimen-
to pregiudiziale C-20/05 (Schwibbert contro Italia) rilevando che il
FRQWUDVVHJQR6,$(GHYHHVVHUHFRQVLGHUDWRXQD³VSHFLILFD]LRQHWHFQi-
FD´ DWWHVR FKH OD PLVXUD QD]LRQDOH ID ULIHULPHQWR DO SURGRWWR R
DOO¶LPEDOODJJLRLQTXDQWRWDOLGLVSRQHQGRTXLQGLXQDGHOOHFDUDWWHUi-
stiche richieste per il prodotto. La Corte ha proseguito rilevando che
O¶DSSRVL]LRQHGHOFRQWUDVVHJQRPLUDQWHDLQIRUPDUHLFRQVXPDWRULHOH
autorità nazionali che le copie sono legali, si effettua sul supporto
stesso.
Al lume di quanto sopra, si è concluso affermando che, siccome
ogni norma che istituisca una misura tecnica deve essere notificata alla
Commissione e nessuna delle disposizioni in tema di bollino sarebbe
VWDWD QRWLILFDWD O¶LQDGHPSLPHQWR GHOO¶REEOLJR GL FRPXQLFD]LRQH KD
FRVWLWXLWR XQ YL]LR SURFHGXUDOH QHOO¶DGR]LRQH delle norme tecniche,
FRPSRUWDQGRO¶LQDSSOLFDELOLWjGHOOHSUHGHWWHUHJROHLQRSSRQLELOLFRPH
tali ai privati.
Pertanto, i privati possono avvalersene dinanzi al giudice nazionale
cui compete la disapplicazione di una regola tecnica nazionale che non
sia stata notificata in conformità della direttiva 98/34/CE.
Ebbene, di fronte alla illegittimità sottolineata dalla Corte delle mi-
sure che impongono il EROOLQR 6,$( O¶XQLFR FRPSRUWDPHQWR HIIHWWi-
vamente sanzionabile e penalmente rilevante è la duplicazione, dato
che tale seconda ipotesi ruota attorno alla presenza del contrassegno.
Per quanto concerne, poi, il bollino SIAE in caso di programmi per
HODERUDWRUHLOFXLULOLHYRGHYHHVVHUHVRWWROLQHDWRSHUO¶DWWXDOLWjGHOOD
problematica, è dato rilevarsi che i soggetti per i quali è specificamen-
WHSUHYLVWDO¶apposizione del contrassegno sono:
a) O¶DXWRUH R FRPXQTXH XQ VRJJHWWR OHJLWWLPDWR LQ FDVR YRJOLDQR
commercializzare o cedere a qualsiasi titolo il software a scopo
di lucro;
b) FKLXQTXH VHQ]D O¶DXWRUL]]D]LRQH GHOO¶autore o di un soggetto
198 Manuale di diritto delle arti e dello spettacolo

appositamente legittimato duplica, importa, vende, commercia-


lizza, concede in locazione o distribuisce un programma per ela-
boratore a scopo di profitto.

/¶HTXRFRPSHQVR

Un argomento che merita particolare commento, per gli ultimi svilup-


pi giurisprudenziali raggiuntiqTXHOORGHOO¶HTXRFRPSHQVR
/¶HTXRFRPSHQVRRFRQWULEXWRSHUODFRSLDSULYDWDqXQFRQWULEXWR
imposto per avere il diritto di effettuare la copia privata delle opere
SURWHWWHGDOGLULWWRG¶DXWRUH
Il predetto contributo ha trovato quale primaria fonte normativa la
OHJJHIHEEUDLRQUHFDQWH³1RUPHDIDYRUHGHOOHLPSUHVH
fonografiche e compensi per le riproduzioni private senza scopo di lu-
FUR´
Numerosi sono stati gli interventi normativi in materia, tra cui van-
no citati il recepimento della direttiva europea 29/2001/CE tramite un
discusso provvedimento ratificato con il d.lgs. n. 68 del 9 aprile 2003.
Il suo ammontare è stabilito dalla l.d.a. e il contributo è inteso ad
assicurare ai possessori dei dirLWWL G¶DXWRUH XQ LQGHQQL]]R VXOOD FRSLD
privata delle loro opere.
Il compenso è stato poi determinato dal d.m. del 30 dicembre 2009.
Il contributo è rappresentato da una parte del prezzo finale del pro-
dotto per quanto concerne gli apparecchi destinati soltanto alla regi-
strazione mentre per gli apparecchi a più funzioni viene calcolato sul
prezzo di un prodotto monofunzionale equivalente.
A seguito di diverse revisioni, nel corso del 2014, per mezzo del
d.m. del 20 giugno vi è stato un rialzo del contributo per la copia pri-
vata tanto da spingere taluni produttori ad aumentare i prezzi per
compensare le tariffe.
Orbene, le premesse danno il senso di come sia stato avvertito nel
FRUVR GHJOL DQQL DQFKH GDOO¶RSLQLRQH SXEEOLFa O¶LVWLWXWR GHOO¶HTXR
compenso. Addirittura, vi è stato chi ha parlato di obolo, in quanto ve-
ra e propria tassa, che i consumatori sono tenuti a versare a fronte
GHOO¶HYHQWXDOHHIIHWWXD]LRQHGLFRSLHDXVRSULYDWRGLRSHUHWXWHODWHGDO
GLULWWRG¶DXWRUHHUHJRODUPHQWHDFTXLVWDWH
X. La Società Italiana degli Autori ed Editori 199

Proprio tale conformazione ha costituito la base per le ostilità che


talune associazioni dei consumatori nonché degli stessi produttori di
dispositivi hardware hanno esercitato.
Il caso era stato sollevato dinanzi al TAR del Lazio nel 2010,
quando le aziende e i consumatori ne avevano chiesto la declaratoria
GLLOOHJLWWLPLWjLQTXDQWRO¶DSSOLFD]LRQHGHOSUHOLHYRHUDHVWHVDDGDp-
parecchi e supporti non principalmente destinati alle funzioni di ripro-
duzione e conservazione di copie di opere di fonogrammi e audio-
grammi.
LD&RUWHGL*LXVWL]LDSHUDOWURDYHYDFKLDULWRFKHO¶HTXRFRPSHQVR
SHUFRSLDSULYDWDGRYHYDQHFHVVDULDPHQWHHVVHUHDQFRUDWRDOO¶HIIHWWLYR
utilizzo, anche se solo su base presuntiva, del supporto per tale scopo.
Nonostante ciò, il TAR aveva respinto i ricorsi limitandosi a defini-
UH O¶HTXR FRPSHQVR QRQ FRPH FRUULVSHWWLYR GHOO¶XWLOL]]R GHOO¶DOWUXL
RSHUDGHOO¶LQJHJQREHQVuFRPHXQDWDVVD
,O7$5LQGLFDYDFRPHORJLFDGHOO¶HTXRFRPSHQVRODFULVLGHOVHWWo-
re che aveva indotto sia il legislatore comunitario che quello nazionale
ad adottare le misure necessarie per poter garantire la remunerazione
GHLWLWRODULGHOOHRSHUHGHOO¶LQJHJQR
A conferma della posizione assunta dal giudice di prime cure, il
Consiglio di Stato, con sentenza 18 febbraio 2015, n. 823, ha sottoli-
neato che anche la normativa europea sostiene la possibilità che in ta-
luni casi i titolari di diritti debbano ricevere un equo compenso affin-
ché VLDQRDGHJXDWDPHQWHLQGHQQL]]DWLSHUO¶XVRGHOOHORUR opere o dei
materiali protetti, assegnando, dunque, allo Stato ampia discrezionalità
e margini di manovra estesi per la determinazione e quantificazione
GHOO¶HTXRFRPSHQVR
/D SURQXQFLD KD UDSSUHVHQWDWR SHU O¶,VWLWXWR XQ LPSRUWDQWH SXQWR
G¶DUULYRLQPDWHULDGLWXWHODGHOGLULWWRG¶DXWRUHWanto da essere defini-
ta senza ombre e di chiusura di ogni forma di strumentalizzazione
conWUDULD DO GLULWWR G¶DXWRUH H GHJOL HGLWRUL GL YHGHUH UHPXQHUDWH OH
proprie opere.
La predetta considerazione trova sostegno, altresì, nella circostanza
che, soprattutto in passato, si era persino assistito a doglianze legate
alla mancata piena soddisfazione derivante dai livelli di compenso fis-
sati dal decreto attuativo, non essendo questi ultimi ritenuti affatto
equi.
Capitolo XI

,OGLULWWRG¶DXWRUHLQ,QWHUQHW
di LOREDANA DELL¶AVERSANA

11.1. Premessa: perché occuparsi di Internet?

1HLSUHFHGHQWLFDSLWROLDEELDPRDQDOL]]DWRLOWHPDGHOGLULWWRG¶DXWRUH
in una prospettiva classica, così come dimostra il fatto che oggetto
principale ± quasi esclusivo ± di indagine sia stata la disciplina conte-
QXWDQHOODOHJJHGHOTXHVW¶XOWLPDLQIDWWLQRQRVWDQWHLYDULWHQWa-
tivi di superamento, manifestati soprattutto dalla dottrina giuridica, è
ancora vigente, con la conseguenza che non sono rari i casi in cui que-
VWLRQL SRVWH DOO¶DWWHQzione dei giudici vengano risolte con
O¶DSSOLFD]LRQHGHOOHGLVSRVL]LRQLLQHVVDFRQWHQXWH
,Q TXHVWR FRQWULEXWR WXWWDYLD DPSOLHUHPR O¶DQJROR YLVXDOH RFFu-
pandoci, in modo particolare, della regolamentazione del diritto
G¶DXWRUHVXOOHUHWLGLFRPXQLFD]LRQe elettronica.
Il primo problema che dovremo affrontare attiene alla corretta indi-
viduazione della normativa applicabile: a ben vedere, infatti, Internet
SRQHSUREOHPLJLXULGLFLHLPSRQHXQDULIOHVVLRQHVXOO¶HVLJHQ]DGLFRGi-
ficare un sistema di regole (universalmente) valido per il web. Pertan-
to, il giurista deve occuparsi di queste problematiche in via pregiudi-
ziale, dato che la soluzione concreta ai vari problemi non può non te-
QHUH QHOOD JLXVWD FRQVLGHUD]LRQH O¶DSSURIRQGLPHQWR GHOOH SHFXOLDULWj
della rete. Per esempio, già in questa sede, pare opportuno ricordare
FKHqQHFHVVDULRFRPSRUUHO¶DWWXDOHFRQWUDGGL]LRQHWUDODWHUULWRULDOLWj
GHOOHGLVFLSOLQHYLJHQWLLQPDWHULDGLWXWHODGHOGLULWWRG¶DXWRUHHLOFa-
UDWWHUHWUDQVQD]LRQDOHGHOODUHWH/¶LQRSSRUWXQLWà di affidare la regola-

201
202 Manuale di diritto delle arti e dello spettacolo

zione di un fenomeno che nasce globale a discipline limitate a specifi-


ci contesti geografici, secondo un sistema che non contribuisce a ga-
UDQWLUHO¶XJXDJOLDQ]DGLWUDWWDPHQWRWUDJOLXWHQWLHJOLRSHUDWRULHFo-
nomici, risulterà di tutta evidenza nel corso del nostro ragionamento.
Possiamo ritenerci soddisfatti se due situazioni o due condotte equiva-
lenti ± se non del tutto coincidenti ± vengono trattate in maniera diver-
sa in ragione del solo criterio territoriale? Possiamo ritenere realmente
utile una disciplina che sanzioni una violazione del copyright in alcuni
sistemi giuridici nella consapevolezza che altri ordinamenti giuridici
consentano quel medesimo comportamento?
'XQTXH O¶DYYHQWR GL ,QWHUQHW KD SURYRFDWR HIIHWWL GL SURSRU]LRQi
GLURPSHQWL VXOO¶DSSOLFD]LRQH GHOOH QRUPH FKH WXWHODQR OH RSHUH
GHOO¶LQJHJQRGLFDUDWWHUHFUHDWLYRHLQSDUWLFRODUHVXOOHQRUPHSRVWHD
WXWHOD GHO GLULWWR G¶DXWRUH 1RQ D FDVR OD ULIOHVVLRQH GHL JLXULVWL VX
questa tematica ha assunto un peso specifico sempre maggiore: lo di-
mostra chiaramente la vicenda del c.d. dilemma digitale, terminologia
impiegata per descrivere le ripercussioni causate dallo sviluppo delle
tecnologie di comunicazione digitale sul tradizionale sistema di distri-
buzione dei contenuti FRSHUWLGDOGLULWWRG¶DXWRUH
Il dilemma digitale sottintende una vera e propria contraddizione
tra le finalità perseguite con lo sviluppo di Internet e il tradizionale
meccanismo di tutela delle opere creative. Internet è uno strumento
che, almeno potenziDOPHQWHFRQWULEXLVFHDOO¶DPSOLDPHQWRGHOOHFRQo-
VFHQ]H GHL FRQVRFLDWL TXHVWL XOWLPL LQIDWWL JUD]LH DOO¶DXVLOLR GL XQ
computer connesso alla rete possono accedere a un numero di conte-
nuti maggiore rispetto alla quantità di informazioni veicolate sui tradi-
zionali mezzi di comunicazione. La navigazione in un sito può con-
GXUUHDOO¶HVSORUD]LRQHGLWDQWHDOWUHULVRUVHVWLPRODQGRFRVuFXULRVLWjH
intelligenze che, probabilmente, nessuna altra forma di diffusione del
SHQVLHURqLQJUDGRGLUHDOL]]DUH/¶LQVLHPH delle conoscenze rappre-
senta un patrimonio comune che, grazie ad Internet, possiamo conser-
vare, divulgare e sviluppare, anche nella prospettiva di agevolare
O¶DFFHVVRDLFRQWHQXWLLQIRUPDWLYLGDSDUWHGHOOHIXWXUHJHQHUD]LRQL
Questo approccio, tuttavia, entra in contrasto con la tradizionale
concezione del copyright, la quale ha condotto i giuristi a immaginare,
già in epoca risalente, un meccanismo di tutela essenzialmente fondato
VXOODHVFOXVLRQHGLDOWULVRJJHWWLGDOORVIUXWWDPHQWRGHOO¶RSHUDVHFRQGR
XI. ,OGLULWWRG¶DXWRUHLQ,QWHUQHW 203

uno schema interamente sovrapponibile al modello dello ius exclu-


dendi omnes alios, tipico del diritto di proprietà. Al pari, dunque, di
quanto avviene con riguardo ai beni mobili e immobili, anche al crea-
WRUHGLXQ¶RSHUDqDFFRUGDWDXQDWXWHODLQJUDGRGL porlo al riparo da
eventuali comportamenti abusivi posti in essere da terzi soggetti con il
SUHFLSXRLQWHQWRGLWUDUUHSURILWWRGDOORVIUXWWDPHQWRGHOO¶RSHUD
/D TXDOLILFD]LRQH SURSULHWDULD GHO GLULWWR G¶DXWRUH KD DYXWR ULSHr-
cussioni non secondarie: essa, infatti, ha operato sul piano concettuale
± soprattutto attraverso la valorizzazione dei rimedi propri della tradi-
zione privatistica in tema di diritti assoluti ± e sul piano terminologi-
co, così come dimostra il fatto che ben presto si è iniziato a parlare di
XQ GLULWWR GHOOD SURSULHWj LQWHOOHWWXDOH SHU GHVFULYHUH O¶LQVLHPH GHOOH
norme poste a tutela dei beni immateriali.
Nelle pagine seguenti cercheremo di affrontare questi due problemi
± individuazione delle fonti del diritto riguardanti Internet e composi-
zione del dilemma digitale ± nella piena consapevolezza che non esi-
ste una soluzione valida sub specie æternitatis.

11.2. Cenni sulle fonti del diritto di Internet

Come osservato nella premessa al nostro discorso, Internet solleva


molteplici interrogativi, il primo dei quali è costituito
GDOO¶LQGLYLGXD]LRQH GHOOD OHJJH DSSOLFDELOH DOOH UHOD]LRQL JLXULGLFKH
che si sviluppano sulla rete. La questione, ad avviso di chi scrive, è
strettamente connessa con il delicato tema della globalizzazione: capi-
re quali siano le fonti del diritto applicabili alla rete delle reti ± che per
definizione è mondiale ±, oltre ad essere una questione pregiudiziale
rispetto alla disamina nel merito delle specifiche questioni che affron-
teremo nel prosieguo, può essere particolarmente utile anche per una
migliore regolazione della globalizzazione, fenomeno che ± come so-
stenuto dalla dottrina ± richiede nuove soluzioni giuridiche. Quanto
appena detto è ancor più interessante se si tiene presente che la globa-
OL]]D]LRQHOXQJLGDOO¶essere un fenomeno meramente economico, in-
veste sia il piano del riconoscimento dei diritti che quello della relati-
va tutela.
204 Manuale di diritto delle arti e dello spettacolo

Dunque, gli Autori che si sono occupati di Internet e della sua rego-
lazione hanno dovuto necessariamente confrontarsi con il carattere
GHOO¶DWHUULWRULDOLWj DWWULEXWR FKH VLQWHWLFDPHQWH GHVFULYH OD QDWXUDOH
aspazialità della rete.
Internet dimostra che la globalizzazione può influire sulla ricostru-
zione e applicazione della normativa vigente: il carattere transnaziona-
le della rete, LQIDWWL VL SRQHLQ DSHUWR FRQWUDVWR FRQO¶DWWXDOH VLVWHPD
fondato sulla territorialità delle discipline, le quali, non infrequente-
mente, entrano in aperto contrasto tra loro. La medesima fattispecie
può, dunque, essere inquadrata in modo diverso a secondo dello speci-
fico contesto territoriale di riferimento. Tutto ciò determina che il giu-
rista venga a trovarsi dinanzi ad uno scenario in cui esistono più fonti,
applicabili ratione loci, che spesso hanno contenuti difficilmente con-
ciliabili.
Queste considerazioni hanno spinto chi si è occupato del tema a
suggerire la possibilità di procedere ad un vero e proprio processo di
FRVWUX]LRQH GHOO¶RUGLQDPHQWR GL ,QWHUQHW WDOH SURFHVVR LQROWUH Go-
vrebbe svilupparsi in ambito internazionalistico, attraverso lo sviluppo
di convenzioni e patti tra i vari paesi.
Ancor più forte è stata la posizione di chi vorrebbe implementare
un processo costituente per la rete, che porti alla positivizzazione delle
libertà degli utenti e degli operatori economici che partecipano alla vi-
ta della comunità del web.
Pur riconoscendo lo specifico valore di queste teorie, qui solo sinte-
ticamente accennate, svilupperemo il nostro discorso partendo dal da-
WRQRUPDWLYRYLJHQWHO¶XQLFRLQJUDGRGLYLQFRODUHJOLRSHUDWRULHLQ
modo particolare, FKLqFKLDPDWRDWXWHODUHLOGLULWWRG¶DXWRUHLQ,QWHr-
net. Si rende, dunque, indispensabile ampliare la riflessione in virtù
della comparazione tra le normative sviluppate in vari ordinamenti.

,YDULPRGHOOLGLWXWHODGHOGLULWWRG¶DXWRUHXQDULIlessione di
diritto comparato

Le criticità messe in luce nel precedente paragrafo in merito alla rico-


struzione del regime giuridico applicabile ad Internet stimolano una
riflessione di più ampio respiro. Nella consapevolezza che una regola-
XI. ,OGLULWWRG¶DXWRUHLQ,QWHUQHW 205

zione territoriale di Internet sia limitante ± e, come abbiamo cercato di


sottolineare, anche inefficace ± ci dedicheremo ora alla ricostruzione
di esperienze ordinamentali diverse da quella italiana, con il preciso
obiettivo di trarre elementi utili in una (eventuale) prospettiva de jure
condendo.
Alla luce di questo assunto, ricostruiremo nelle pagine seguenti
O¶HVSHULHQ]DDPHULFDQDHTXHOODIUDQFHVH

11.3.1. /¶HVSHULHQ]DDPHULFDQD

Il primo modello che prenderemo in considerazione è rappresentato


dalla normativa americana, la prima ad essere intervenuta in maniera
esplicita sulle questioni che qui ci impegnano: infatti, il Digital Mil-
lennium Copyright Act risale addirittura al 1998, in un fase di sviluppo
primordiale di Internet caratterizzata da una bassissima incidenza dei
problemi di pirateria informatica.
Il primo dato da tenere in considerazione è, dunque, di carattere
cronologico. Il Digital Millennium Copyright Act ha il pregio di disci-
plinare per la prima volta il fenomeno della pirateria online, dato che
prende LQ FRQVLGHUD]LRQH OH FRQGRWWH UHVH SRVVLELOL GDOO¶LPSLHJR GHL
nuovi mezzi di comunicazione elettronica. In particolare, integra mol-
te delle fattispecie già previste nella legislazione americana adeguan-
dole agli sviluppi della tecnologia, contribuendo in maniera sostanzia-
le alla configurazione di una disciplina organica.
Il contenuto di questa normativa può essere sinteticamente descritto
come segue. In primo luogo la normativa interviene al fine di san-
]LRQDUH O¶HOXVLRQH GHOOH PLVXUH WHFQRORJLFKH LPSLHJDWH dai titolari di
GLULWWLG¶DXWRUHSHUSURWHJJHUHOHORURRSHUHFRQODSUHFLVD]LRQHFKH

a) WR µFLUFXPYHQW D WHFKQRORJLFDO PHDVXUH¶ PHDQV WR GHVFUDPEOH D VFUDm-


bled work, to decrypt an encrypted work, or otherwise to avoid, bypass, re-
move, deactivate, or impair a technological measure, without the authority of
the copyright owner b) and a technoORJLFDOPHDVXUHµHIIHFWLYHO\FRQWUROVDc-
FHVV WR D ZRUN¶ LI WKH PHDVure, in the ordinary course of its operation, re-
quires the application of information, or a process or a treatment, with the
authority of the copyright owner, to gain access to the work.
206 Manuale di diritto delle arti e dello spettacolo

A ben vedere, la normativa appena richiamata (contenuta nella se-


zione 1201 della legge) si fonda su una nozione tanto ampia da inclu-
dere qualsiasi operazione di dHFRGLILFD GL XQ¶RSHUD FULSWDWD R FULWWo-
grafata, che miri a evitare, ignorare, rimuovere, disattivare o mettere
LQSHULFRORXQDPLVXUDWHFQRORJLFDVHQ]DO¶DXWRUL]]D]LRQHGHOWLWRODUH
del diritto.
Il giudizio sul punto non può che essere positivo, dato che il mec-
canismo ideato dal legislatore è idoneo a sanzionare ogni condotta che
LQ FRQFUHWR SRVVD FRQGXUUH DG XQD YLROD]LRQH GHO GLULWWR G¶DXWRUH Dl-
WUXL,QSDUWLFRODUHXQDIRUPXOD]LRQHFRVuDPSLDKDO¶LQGXEELRSUHJLR
di attrarre alla sua applicazione condotte future che, almeno ad oggi,
non possiamo immaginare. In questo modo, il legislatore americano
ha soddisfatto due esigenze: ha assicurato alla vigente normativa una
efficacia maggiore, dato che ha reso la stessa applicabile a un numero
maggiore di fattispecie; inoltre, ha reso la normativa più resistente ai
cambiamenti tecnologici, mettendola così al riparo dal rischio ± asso-
lutamente non secondario nel mondo di Internet ± di una rapida
/¶DWWRLQFRPPHQWRSURVHJXHFRQXQDVHFRQGDVH]LRQH± id est: se-
zione 1202 ± la quale testualmente prevede che nessun soggetto può

a) intentionally remove or alter any copyright management information, b)


distribute or import for distribution copyright management information
knowing that the copyright management information has been removed or al-
tered without authority of the copyright owner or the law, or c) distribute,
import for distribution, or publicly perform works, copies of works, or
phonorecords, knowing that copyright management information has been
removed or altered without authority of the copyright owner or the law.

In buona sostanza, la norma vieta di porre in essere comportamenti


FKHSRVVDQROHGHUHO¶DOWUXLGLULWWRG¶DXWRUHRFKHFRPXQTXHSRVVDQR
LQGXUUHFRQVHQWLUHIDFLOLWDUHRQDVFRQGHUHXQ¶LQIUD]LRQe compiuta da
altri.
Quali sanzioni sono previste per il caso in cui un soggetto ponga in
essere una delle condotte appena ricordate? La risposta a questo inter-
rogativo è formulata nella sezione 1203, la quale prevede la possibilità
GL ULFRUUHUH DOO¶DXWRULWj JLXGL]LDULD SHU RWWHQHUH XQ¶LQJLXQ]LRQH ±
«temporary and permanent» ± o il risarcimento del danno.
4XHVW¶XOWLPDLSRWHVLqRJJHWWRGLXQDGLVFLSOLQDSDUWLFRODUPHQWHGHWWa-
XI. ,OGLULWWRG¶DXWRUHLQ,QWHUQHW 207

gliata, in virtù della quale possiamo distinguere gli actual damages ±


comprensivi sia del danno emergente che del lucro percepito dal tra-
sgressore ± dagli statutory damages, la cui quantificazione è effettuata
direttamente dal legislatore.
Il riferimento al risarcimento del danno lascia trasparire che siamo
in presenza di tipici rimedi civilistici ± così come confermato dalla ru-
brica della disposizione in esame ± che, per espressa previsione del le-
JLVODWRUH QRQ SRVVRQR PDL FDXVDUH O¶DSULRULVWLFD UHVWUL]LRQH GHOOD Oi-
bertà di manifestazione del pensiero. Sul punto, è molto chiara la dis-
posizione secondo cui il giudice «may grant temporary and perma-
nent injunctions on such terms as it deems reasonable to prevent or
restrain a violation, but in no event shall impose a prior restraint on
free speech or the press protected under the 1 st amendment to the
Constitution». La norma è molto interessante perché rappresenta un
chiaro esempio di bilanciamento compiuto dal legislatore, una temati-
ca fondamentale su cui torneremo nelle conclusioni di questo capitolo:
a ben vedere, infatti, il legislatore è preoccupato di costruire un siste-
ma sanzionatorio che non sia a sua volta fonte di ingiuste limitazioni
di altre libertà costituzionali. Riservandoci di tornare sul tema nelle
pagine seguenti, possiamo già in questa sede esprimere un giudizio
positivo sul risultato conseguito dal legislatore, interessante perché ga-
UDQWLVFHODFRHVLVWHQ]DGHOGLULWWRG¶DXWRUHFRQODOLEHUWjGLPDQLIHVWa-
]LRQH GHO SHQVLHUR HYLWDQGR LQJLXVWLILFDWL VDFULILFL GHOO¶XQR R
GHOO¶DOWUD
Il quadro normativo si chiude con alcune disposizioni di carattere
penale, in virtù delle quali si sanziona, con misure pecuniarie o limita-
tive della libertà personale, ogni persona «who violates section 1201
or 1202 willfully and for purposes of commercial advantage or priva-
te financial gain».
/¶HIILFace meccanismo della normativa americana si fonda sul ri-
FRQRVFLPHQWRGLXQUXRORDWWLYRDOO¶DXWRUHGHOO¶RSHUDSURWHWWDLOTXDOH
può segnalare al service provider la presunta violazione dei propri di-
ritti da parte di terzi. In particolare, i titolari dei dLULWWLG¶DXWRUHSRVVo-
QRFRPXQLFDUHDOO¶Internet service provider O¶DYYHQXWDLPPLVVLRQHLQ
rete di contenuti illeciti e, conseguentemente, domandarne la rimozio-
ne. La notifica deve essere redatta in forma scritta e deve contenere
alcune informazioni espressamente richieste dal legislatore: si tratta
208 Manuale di diritto delle arti e dello spettacolo

del c.d. notice, un vero e proprio avvertimento che il titolare del diritto
G¶DXWRUHSXzSRUUHLQHVVHUHQHLFRQIURQWLGHOO¶Internet service provi-
der 4XHVW¶XOWLPR LQ EDVH DOOD QRUPDWLYD LQ FRPPHQWR q WHQXWR D
nominare un agent per godere delle limitations on liability previste dal
WLWROR ,, GHOOD OHJJH ,Q SDUWLFRODUH O¶agent è incaricato di esaminare
sollecitamente tutte le comunicazioni ricevute dagli utenti al fine di
verificare la fondatezza della segnalazLRQH OD YDOXWD]LRQH GHOO¶agent
conforme al contenuto della richiesta determina la rimozione del con-
tenuto dal sito (il c.d. takedown). Il notice prevede, dunque, un mec-
canismo particolarmente favorevole per il fornitore di servizi online, il
quale non potrà mai essere ritenuto responsabile nei confronti
GHOO¶DXWRUH GHOFRQWHQXWR ULPRVVR QHOO¶LSRWHVL LQFXLOD ULPR]LRQH VLD
avvenuta in buona fede.
Finora abbiamo descritto le peculiarità della procedura indicata nel
Digital Millennium Copyright Act mettendo in luce gli elementi posi-
tivi e, in particolare, la sua indubbia efficacia nel predisporre una tute-
ODUDIIRU]DWDLQIDYRUHGHLWLWRODULGLGLULWWLG¶DXWRUH7XWWDYLDSDUHRp-
portuno chiudere il discorso analizzando anche quelli che, giustamen-
te, sono stati ritenuti elementi di contraddittorietà o, quantomeno, di
criticità della normativa americana, i quali vengono sovente richiamati
a sostegno del superamento del Digital Millennium Copyright Act.
Gli interrogativi sono molteplici. Quale garanzia viene data
DOO¶DXWRUH GHO FRQWHQXWRLPPHVVR LQ UHWH" ,Q FKH PRGR TXHVW¶XOWLPR
può far valere le proprie ragioni e, dunque, evitare la rimozione coatta
del materiale? In merito a questo aspetto, si prevede la possibilità per
il presunto trasgressore²che deve essere tempestivamente informato
GHOO¶DYYHQXWD ULPR]LRQH ² di presentare una counter notification, a
seguito della quale il provider qWHQXWRDFRPXQLFDUHDOO¶RULJLQDULRUi-
chiedente la reimmissione del materiale in rete nel caso in cui si abbia
QRWL]LD GHOO¶DYYLR di una azione legale entro il termine fissato dalla
legge. Dunque, il meccanismo antepone la tutela del titolare di copy-
right DOODOLEHUWjGLPDQLIHVWD]LRQHGHOSHQVLHURGHOO¶uploader, il quale
qWHQXWRDVXELUHO¶LQL]LDOHULPR]LRQHGHOFRQWHQXWRVHQ]DSRWer indica-
UHDOO¶Internet service provider le proprie ragioni.
I punti di criticità del sistema appena descritto sono molteplici. In
SULPROXRJRSUHRFFXSDO¶DWWULEX]LRQHGLSRWHULDPSLDOO¶Internet ser-
vice provider, il quale, presumibilmente, sarà incline a rimuovere il
XI. ,OGLULWWRG¶DXWRUHLQ,QWHUQHW 209

contenuto in ragione delle limitazioni di responsabilità sopra descritte.


/¶LQWHUYHQWRGHOO¶agent si colloca al di fuori di qualsiasi garanzia pro-
cessuale e non è assistito dalla piena esplicazione del contraddittorio:
TXHVW¶XOWLPD LQIDWWL è subordinata a una manifestazione di interesse
GHOO¶uploader, il quale deve attivarsi con la counter notification per far
valere le proprie ragioni.
Nonostante queste valide obiezioni, è bene sottolineare che il Digi-
tal Millennium Copyright Act ha trovato applicazione in molte vicende
VRWWRSRVWH DOO¶DWWHQ]LRQH GHOO¶DXWRULWj JLXGL]LDULDDPHULFDQDOD TXDOH
nel pieno rispetto dei principi propri dei sistemi di common law, ha
FRQWULEXLWR LQPDQLHUD QRQ VHFRQGDULD DOO¶DSSOLFD]LRQH GL TXHOOD FKH
ancor oggi, UDSSUHVHQWDO¶XQLFDOHJJHDSUHVLGLRGHOGLULWWRG¶DXWRUHon-
line nel sistema giuridico americano. Nonostante le tante critiche mos-
se dalla dottrina e dagli operatori del settore, dunque, il sistema del
notice and takedown è ancora vigente e viene costantemente applicato
secondo la procedura descritta. Tuttavia, come già ricordato, la volon-
tà di modificare la disciplina vigente ha rappresentato un obiettivo
comune a più settori della società, anche se è innegabile che le varie
soluzioni proposte tendono a differenziarsi in maniera vistosa a se-
FRQGDGHOO¶LQWHUHVVHULWHQXWRSUHYDOHQWHHGXQTXHGHJQRGLPDJJLRUH
protezione. Il primo orientamento ± formulato in ambito accademico e
particolarmente gradito agli utenti della rete ± VLWUDGXFHLQXQ¶DSHUWD
critica al meccanismo del notice and takedown e propone di rimodula-
re la disciplina al fine di affermare la prevalenza della libertà di mani-
festazione del pensiero. Invece, la seconda tesi è stata sostenuta dagli
operatori economici del settore con il dichiarato intento di rafforzare
gli strumenti previsti dal legislatore, ritenuti poco incisivi e inefficaci.
Le due impostazioni ± evidentemente divergenti dal punto di vista
contenutistico ± KDQQRDYXWRXQGLYHUVRSHVRQHOO¶DPELWRGHOGLEDWWLWR
politico, così come dLPRVWUDO¶DVFULYLELOLWjDOVHFRQGRILORQHGLSHQVLe-
ro di entrambi i disegni di legge che analizzeremo. Lo scenario de-
VFULWWRFRQIHUPDO¶LGHDFKHLSRWHULHFRQRPLFLSDUWLFRODUPHQWHLQWHUHs-
sati alle questioni legate al controllo del web, sono in grado di orienta-
re il dibattito politico in misura maggiore rispetto al mondo degli uten-
ti. La mancata approvazione di entrambe le proposte non muta i ter-
mini della questione, dato che la mera presentazione dei disegni di
legge di cui parleremo in prosieguo è elemento sufficiente a dimostra-
210 Manuale di diritto delle arti e dello spettacolo

re la volontà di salvaguardare le libertà economiche anche quando ciò


determini la violazione di diritti fondamentali.
Limiteremo i riferimenti ai due disegni di legge che maggiormente
hanno animato il dibattito pubblico, non solo americano.
Nel maggio 2011 viene presentato un primo disegno di legge. Si
tratta del Protect IP Act, il cui obiettivo, per espressa indicazione del
OHJLVODWRUH VL VRVWDQ]LD QHO SUHYHQLUH ³online threats to economic
creativity and theft of intellectual property, and for other purposes´.
/¶LQWHURDWWRPLUDDUDIIRU]DUHLOFRQWUROORGDSDUWHGHOOHSXEEOLFKHDu-
torità di quei siti che non hanno la propria sede sul territorio degli Sta-
WL 8QLWL G¶$PHULFD ± i c.d. nondomestic domain name ± grazie
DOO¶LQWURGX]LRQHGi due nuove procedure a tutela dei diritti di proprietà
intellettuale. Tali procedure avrebbero determinato un decisivo ina-
sprimento della lotta alla pirateria informatica, avendo uno scarso ri-
guardo al problema della tutela delle altre libertà fondamentali interes-
sate dal tema.
La medesima impostazione del problema si rinviene anche in una
successiva proposta di legge esaminata dalla Camera dei Deputati del
Congresso americano. Ci si riferisce al disegno di legge intitolato Stop
Online Piracy Act, la cui approvazione avrebbe determinato il raffor-
zamento dei sistemi di controllo nei confronti dei siti operanti in vio-
OD]LRQH GHO GLULWWR G¶DXWRUH $QFKH LQ TXHVWR FDVR QRQRVWDQWH
O¶DIIHUPD]LRQH GL SULQFLSLR VHFRQGR FXL QLHQWH «in this Act shall be
construed to impose a prior restraint on free speech or the press pro-
tected under the 1st Amendment to the Constitution», sono evidenti le
violazioni della libertà di manifestazione del pensiero, in larga parte
FDXVDWH GDOO¶LQWHQ]LRQH GL DWWULEXLUH DXWRQRPL SRWHUL GL intervento al
WLWRODUH GHO GLULWWR G¶DXWRUH /D YLYD UHD]LRQH GHO PRQGR GHO web ha
FRQWULEXLWRLQPDQLHUDGHWHUPLQDQWHDOO¶LQVDEELDPHQWRGHOGLVHJQRGL
OHJJH FXOPLQDWR FRQ O¶DSSRVL]LRQH GHO YHWR GD SDUWH GHO SUHVLGHQWH
Barack Obama in data 15 gennaio 2012.

11.3.2. /¶HVSHULHQ]DIUDQFHVH

/¶HVSHULHQ]DDPHULFDQDKDUDSSUHVHQWDWRXQPRGHOORGLULIHULPHQWRD
OXQJRO¶XQLFRSHUJOLDOWULRUGLQDPHQWLFKHKDQQRWHQWDWRGLULVROYHUHLO
SUREOHPDGHOODWXWHODGHOGLULWWRG¶DXWRUHonline. La scelta di prosegui-
XI. ,OGLULWWRG¶DXWRUHLQ,QWHUQHW 211

re il discorso con la disamina delle norme adottate in Francia non è


casuale: come accennavamo in precedenza, infatti, quella francese
rappresenta una ulteriore esperienza da tenere nella giusta considera-
zione per dimostrare, in particolare, quale sia la reale efficacia delle
misure meramente repressive della pirateria in Internet.
/D OHJJH  RWWREUH  Q  HQWUDWD LQ YLJRUH DOO¶LQL]LR GHO
 KD LQWURGRWWR QHOO¶RUGLQDPHQWR IUDQFHVH XQD QXRYD $XWRULWj
Amministrativa Indipendente denominata Haute Autorité pour la dif-
fusion des oeuvres et la protection des droits sur Internet (meglio nota
come HADOPI) con il preciso obiettivo di prevenire tutte le forme di
pirateria informatica attuate dagli utenti attraverso lo scambio illegale
di files tramite reti di comunicazione elettronica. Si tratta di una legge
FKHKDIDWWRPROWRGLVFXWHUHO¶RSLQLRQHSXEEOLFDIUDQFHVHVRSUDWWXWWR
perché la sua approvazione è stata preceduta da una pronuncia della
Corte costituzionale francese che, con sentenza 10 giugno 2009, n.
580, ha dichiarato la parziale illegittimità costituzionale della legge 12
giugno 2009, n. 669 (che conteneva la prima formulazione della legge
HADOPI).
Questa sentenza è stata salutata da parte degli studiosi della materia
con grande soddisfazione: questi ultimi, infatti, hanno apprezzato la
censura mossa contro il meccanismo previsto nella legge secondo cui
il controllo sulla legittimità dei contenuti caricati in Internet da parte
degli utenti sarebbe stato svolto a priori da un soggetto privato
O¶Internet service provider). In particolare, la Corte costituzionale
qualificò come lesivo delle libertà degli utenti il controllo posto in es-
sere da parte di un soggetto privato in assenza di un mandato o altra
autorizzazione riconducibile agli organi preposti e in carenza di alcun
sospetto di colpevolezza. La normativa, ad avviso della Corte costitu-
zionale, era mal costruita perché escludeva il naturale intervento
GHOO¶DXWRULWjJLXGL]LDULDODTXDOHQRQDYUHEEHSRWXWRSURQXQFLDUVLVXl-
la legittimità della disconneVVLRQHGHOO¶XWHQWHQHSSXUHa posteriori.
A ben vedere la Corte costituzionale sviluppa tutto il ragionamento
recuperando la tradizionale impostazione in tema di riserva di giuri-
sdizione. Questo istituto ± accolto anche nella nostra Carta costituzio-
nale, insieme alla riserva di legge ± è posto a garanzia delle libertà
fondamentali. In base a questo principio, le libertà fondamentali pos-
VRQRHVVHUHOLPLWDWHVRORODGGRYHYLVLDXQSURYYHGLPHQWRGHOO¶DXWRULWj
212 Manuale di diritto delle arti e dello spettacolo

giudiziaria, la quale può comunque intervenire esclusivamente nei casi


e modi stabiliti dalla legge (in virtù della c.d. riserva di legge). La ri-
serva di legge, dunque, indica quali sono i casi in cui può aversi una
limitazione della libertà; la riserva di giurisdizione, invece, porta ad
escludere che soggeWWL GLYHUVL GDOO¶DXWRULWj JLXGL]LDULD SRVVDQR LQWHr-
venire per limitare tali libertà.
Alla luce di questa considerazione, analizziamo la formulazione fi-
QDOHGHOODOHJJHIUDQFHVHVXOGLULWWRG¶DXWRUH1HOODSURFHGXUDGLVFLSOi-
nata nella legge HADOPI II si prevede la possibilità per il titolare di
GLULWWL G¶DXWRUH GL FRPXQLFDUH DOO¶$XWRULWj OD SURYD GHOOD YLROD]LRQH
FRPSLXWDGDWHU]LHO¶LQGLUL]]R,3DWWUDYHUVRLOTXDOHqVWDWDFRPPHVVD
la violazione. Dunque, a differenza di quanto previsto nella prima ste-
sura della legge, il fornitore di connettività è tenuto solo a identificare
LO QRPLQDWLYR FRUULVSRQGHQWH DOO¶LQGLUL]]R ,3 GD FXL SURYHQJRQR OH
violazioni. Il compito di monitorare le condotte illecite è affidato
DOO¶$XWRULWjODTXDOHGRSRWUHVXFFHVVLYLULFhiami (i c.d. three strikes),
GHYHVHJQDODUHLOQRPLQDWLYRGHOO¶XWHQWHDLFRPSHWHQWLRUJDQLJLXGL]La-
UL 'XQTXH OD QXRYD QRUPDWLYD HVFOXGH OD SRVVLELOLWj SHU O¶$XWRULWj
Indipendente di comminare direttamente la sanzione del distacco. La
tutela del titolare GHOGLULWWRG¶DXWRUHVLUHDOL]]DDWWUDYHUVRLOULFRUVRD
XQ SURFHGLPHQWR G¶XUJHQ]D LQ JUDGR GL DVVLFXUDUH QHO FRQWHPSR OD
rapida definizione della questione e il pieno rispetto della riserva di
giurisdizione.
Tuttavia, il correttivo imposto dalla pronuncia della Corte costitu-
zionale lascia impregiudicato il piano della reale efficacia delle misure
sanzionatorie introdotte. In particolare, i dati statistici dimostrano che
il carattere repressivo della normativa congiunto alla prassi applicativa
eccessivaPHQWH ULJLGD GHOO¶$XWRULWj QRQ KDQQR LQFLVR QHOOD PDQLHUD
auspicata sulla riduzione del fenomeno della pirateria online. A ben
vedere, le statistiche confermano il mantenimento ± o, in alcuni casi,
addirittura la crescita ± dei fruitori di contenuti illegali in Internet.
Quale è, dunque, il giudizio finale che possiamo formulare in meri-
to a questa normativa? Alla luce delle considerazioni sin qui svolte,
SRVVLDPR ULWHQHUH YDOLGR LO VLVWHPD GHOLQHDWR QHOO¶+$'23, ,," 3o-
trebbe, per esempio, essere assunto come modello da parte del legisla-
tore italiano? Questi interrogativi trovano, ad avviso di chi scrive, suf-
ficiente risposta nel dibattito politico sviluppatosi in Francia
XI. ,OGLULWWRG¶DXWRUHLQ,QWHUQHW 213

DOO¶LQGRPDQLGHOO¶HQWUDWDLQYLJRUHGHOODOHJJH/HVHPSUHSLLQVLVWHn-
ti richieste di moGLILFD GHOOD QRUPDWLYD YLJHQWH SURYDQR O¶LQVXFFHVVR
GHOOHSROLWLFKHPHUDPHQWHUHSUHVVLYH4XDOHVDUjO¶HVLWRGLTXHVWRGi-
battito è un dato difficile da prevedere; è innegabile, invece, che allo
VWDWRDWWXDOHO¶RUGLQDPHQWRIUDQFHVHDEELDSHUVRO¶RFFDVLRQHGi costrui-
re un sistema efficace e pienamente in grado di affrontare le sfide po-
VWHGDOGLULWWRG¶DXWRUHonline.

11.4. /D UHJRODPHQWD]LRQH LWDOLDQD LO UHJRODPHQWR GHOO¶$XWRULWj


per le Garanzie nelle Comunicazioni

Consapevoli del fatto che il riferimento comparatistico potrebbe essere


ben più ampio di quello che abbiamo sviluppato nel precedente para-
grafo, iniziamo ad analizzare la più recente normativa introdotta in
ItaOLDVXOWHPDGHOGLULWWRG¶DXWRUHLQ,QWHUQHW
La prima considerazione da fare attiene al tipo di fonte che è stata
adottata per regolare la materia. A differenza di altri ordinamenti in
cui è stato il legislatore ad intervenire, nel sistema italiano la più re-
FHQWH QRUPDWLYD q DWWULEXLELOH DOO¶$XWRULWj SHU OH *DUDQ]LH QHOOH &o-
municazioni (nRWDDQFKHFRQO¶DFURQLPR$*&20 XQ¶$XWRULWj$m-
ministrativa Indipendente istituita nel 1997 al fine di salvaguardare il
GHOLFDWR VHWWRUH GHOO¶LQIRUPD]LRQH H GHOOD FRPXQLFD]LRQH 3HUWDQWR
svilupperemo il nostro discorso tenendo presente che il dibattito non
KDVXVFLWDWRO¶LQWHUHVVHGHOQRVWUROHJLVODWRUHLOTXDOHQRQKDULWHQXWR
opportuno modificare i testi normativi che disciplinano in termini ge-
QHUDOLLOGLULWWRG¶DXWRUHLOTXDGURGLULIHULPHQWRGHOLQHDWRQHOLn-
fatti, è rimasto sostanzialmente immutato.
La questione del mancato intervento del legislatore è questione
WXWW¶DOWURFKHLUULOHYDQWHHGKDLPSRUWDQWLLPSOLFD]LRQLVXOOHDWWLYLWjSL
UHFHQWLSRVWHLQHVVHUHGDOO¶$*&20 ,Q SDUWLFRODUHDGDYYLVRGLFKL
VFULYHqLPSRUWDQWHFRPSUHQGHUHVHO¶RPLssione del legislatore abbia
o meno una diretta influenza sulla legittimità ± formale e sostanziale ±
GHOODUHJRODPHQWD]LRQHSRVWDLQHVVHUHGDOO¶$XWRULWjGLVHWWRUH,OWHPD
già affrontato dalla dottrina con alterne soluzioni, verrà ormai definiti-
vamente analizzato dalla Corte costituzionale italiana: infatti, il 26 set-
tembre 2014 il Tribunale Amministrativo Regionale del Lazio (TAR
214 Manuale di diritto delle arti e dello spettacolo

Lazio) si è pronunciato con due ordinanze sui ricorsi promossi da al-


cune associazioni di consumatori e di imprese contro il Regolamento
GHOO¶$*&20LQPDWHULDGLWXWHODGHOGLULWWRG¶DXWRUHVXOOHUHWLGLFo-
municazione elettronica. La premessa da cui parte il ragionamento del
TAR è chiara: il Collegio, infatti, ha riconosciuto la competenza
GHOO¶$XWRULWjDGHPDQDUHLOVXGGHWWRUHgolamento, affermando la cor-
UHWWH]]DGHOULIHULPHQWRIDWWRGDOO¶$*&20DOGOJVDSULOHQ
UHFDQWHOD³$WWXD]LRQHGHOODGLUHWWLYD&(UHODWLYDDWDOXQL
DVSHWWLJLXULGLFLGHLVHUYL]LGHOODVRFLHWjGHOO¶LQIRUPD]LRQHQHOPHUFDWR
interno, con SDUWLFRODUHULIHULPHQWRDOFRPPHUFLRHOHWWURQLFR´SHUDf-
fermare la propria potestà ad intervenire in subiecta materia. In base
DOOHOHJJLYLJHQWLLIRUQLWRULGLVHUYL]LGHOODVRFLHWjGHOO¶LQIRUPD]LRQH
SRVVRQRHVVHUHOHFLWDPHQWHREEOLJDWLGDOO¶$*&20DULPuovere o di-
VDELOLWDUHO¶DFFHVVRDFRQWHQXWLLOOHFLWLVRVWHQHQGRWXWWLLUHODWLYLFRVWL
Inoltre, il TAR ha riconosciuto la piena correttezza delle procedure
VHJXLWHGDOO¶$*&20SHUDSSURYDUHLOUHJRODPHQWRQRQFKpO¶DVVHQ]D
GLFRQWUDVWLWUDTXHVW¶XOWLPRHO¶RUGLQDPHQWRFRPXQLWDULR4XLQGLSHU
LOJLXGLFHDPPLQLVWUDWLYRO¶$XWRULWj,QGLSHQGHQWHKDEHQDJLWRULVSHt-
tando il quadro normativo di riferimento.
7XWWDYLD SXU ULFRQRVFLXWD OD FRQIRUPLWj GHOO¶DWWLYLWj GHOO¶$XWRULWj
con quanto prescritto nella legge, il TAR Lazio ha comunque deciso di
sollevare la questione di legittimità costituzionale della normativa del
ODTXDOHFRVWLWXHQGRIRQWHSULPDULDUDSSUHVHQWDO¶XQLFRDWWRFKH
SXzHVVHUHSRUWDWRDOO¶DWWHQ]LRQHGHOOD&RUWHFRVWLWX]LRQDOHLQSDUWLFo-
larHLO7$5/D]LRKDFKLHVWRO¶LQWHUYHQWRGHOOD&RQVXOWDFRQULJXDUGR
alle norme contenute negli artt. 5, primo comma, 14, terzo comma, 15,
VHFRQGR FRPPD  WHU]R FRPPD GHO GOJV  H QHOO¶DUW 
bis, terzo comma, del d.lgs. 31 luglio 2005, n. 77 UHFDQWH LO ³Testo
XQLFRGHLVHUYL]LGLPHGLDDXGLRYLVLYLHUDGLRIRQLFL´. Tali disposizio-
ni, che secondo il TAR attribuiscono ad AGCOM il potere che in con-
creto è stato esercitato, potrebbero violare i canoni di ragionevolezza e
SURSRU]LRQDOLWjGHOO¶DWWLYLtà legislativa, dal momento che configurano
un diverso livello di tutela della manifestazione di pensiero via Inter-
net rispetto a quello riguardante la stampa, così come configurato
QHOO¶DUWFRVWFLzSRWUHEEHLPSOLFDUHDGDYYLVRGHOJLXGLFHULPHt-
tente, anche la violazione degli artt. 24 e 25 cost., proprio in conse-
guenza del mancato riconoscimento alla manifestazione del pensiero
XI. ,OGLULWWRG¶DXWRUHLQ,QWHUQHW 215

via Internet di quelle tutele giurisdizionali previste dalla Costituzione


per la stampa cartacea.
Pur consapevoli del fatto che in breve tempo ci sarà una pronuncia
della Corte costituzionale sul tema, riteniamo comunque opportuno
indicare, almeno nei tratti essenziali, il contenuto del regolamento
GHOO¶$*&20
A ben vedere la delibera n. 680/13/CONS del 12 dicembre 2013
recanWHLO³5HJRODPHQWRLQPDWHULDGLWXWHODGHOGLULWWRG¶DXWRUHVXOOH
reti di comunicazione elettronica e procedure attuative ai sensi del de-
FUHWR OHJLVODWLYR  DSULOH  Q ´ LQWHQGH WXWHODUH LO GLULWWR
G¶DXWRUH online attraverso due azioni, complementari tra loro e di
uguale importanza:
a) il sostegno allo sviluppo del mercato dei contenuti mediante
FDPSDJQHLQIRUPDWLYHHDOODGLIIXVLRQHGHOO¶RIIHUWDOHJDOH
b) la lotta alla pirateria professionale attraverso lo sviluppo di pro-
cedure di enforcement effettive, proporzionate e dissuasive, che,
SXUWXWHODQGRLOGLULWWRG¶DXWRUHQRQFRPSULPDQRLQDOFXQPRGR
gli altri diritti rilevanti.
Dunque, il provvedimento si articola in due parti: la prima persegue
O¶RELHWWLYRGLSURPXRYHUHODGLIIXVLRQHOHJDOHGHLFRQtenuti accessibili
agli utenti, anche attraverso lo sviluppo di un mercato aperto; la se-
conda ha ad oggetto la definizione delle misure repressive a tutela del
GLULWWRG¶DXWRUHVXOOHUHWLGLFRPXQLFD]LRQHHOHWWURQLFD
In base alla prima parte del regolamenWRO¶$XWRULWjSRWUj± rectius:
dovrà ± SURPXRYHUH O¶HGXFD]LRQH GHJOL XWHQWL DOOD OHJDOLWj QHOOD IUXi-
]LRQH GHOOH RSHUH GLJLWDOL 3HUWDQWR O¶$*&20 GRYUj DGRSHUDUVL FRQ
interventi positivi al fine di accrescere la consapevolezza degli utenti
LQPHULWRDOO¶Lmportanza del copyright in Internet. Pertanto, dovranno
essere sviluppate campagne di sensibilizzazione sul tema, rivolte, in
modo particolare, agli utenti più giovani. Queste nuove competenze
LVWLWX]LRQDOL VDUDQQR FRPSLXWH GDOO¶$XWRULWj JUD]LH DOO¶DXVLOLR di un
LVWLWXHQGR &RPLWDWR SHU OR VYLOXSSR H OD WXWHOD GHOO¶RIIHUWD OHJDOH GL
opere digitali, composto da esponenti delle associazioni di categoria,
chiamato a occuparsi anche del delicato tema della autoregolamenta-
zione delle questioni attinenti alla diffusione di contenuti digitali lega-
li. Il condivisibile contenuto di questa parte del regolamento non rende
PHQR ULOHYDQWH O¶RELH]LRQH FKH DQFRUD XQD YROWD SXz HVVHUH PRVVD
216 Manuale di diritto delle arti e dello spettacolo

QHL FRQIURQWL GHO PHWRGR LPSLHJDWR GDOO¶$*&20 3RVVLDPR ULWHQHUH


FRHUHQWH FRQ O¶RUGLQDPHQWR JLXULGLFR OD VFHOWD GL GHOHJDUH O¶HVHUFL]LR
GL XQD FRPSHWHQ]D FKH O¶$XWRULWj VL q DXWR±attribuita a un comitato
non previsto in alcuna fonte normativa di rango primario? Possiamo
ritenere valido, anche in questo caso, il principio generale secondo cui
QRQqSRVVLELOHGHOHJDUHDWHU]L O¶HVHUFL]LRGL XQSRWHUHFKHqVWDWRD
sua volta oggetto di delega? Considerato che le azioni rientranti nelle
politiche di promotion hanno un ruolo determinante nella prospettiva
generale del regolamento, riteniamo di dover concludere sul punto af-
IHUPDQGR FKH O¶$XWRULWj DYUHEEH GRYXWR PHJOLR SUHFLVDUH L FRQWRUQL
GHOO¶D]LRQHGHO&RPLWDWRPDJDULDIILGDQGRJOLXQDPHUDIXQ]LRQHFRn-
sultiva: se, infatti, sussistono già molti dubbi con riguardo alle attività
FKH O¶$*&20 VYRlgerà in base al presente regolamento, è evidente
FKH DQFRU SL SUREOHPDWLFD VDUj O¶DQDOLVL GHOOH TXHVWLRQL SRVWH
GDOO¶LQWHUYHQWRGHO&RPLWDWR
Tuttavia, i punti di maggiore criticità del regolamento sono rac-
chiusi nella parte dedicata alle politiche di enforcement, il cui specifi-
co contenuto, a differenza delle politiche di promotion, non è condivi-
VLELOHLQUDJLRQHGHOO¶HYLGHQWHYLROD]LRQHGHLSULQFLSLFRVWLWX]LRQDOL
3UHQGHQGRVSXQWRGDOODOHJLVOD]LRQHGLDOWULSDHVLO¶$XWRULWjSUHVWD
particolare attenzione alle violazioni compiute con finalità di lucro.
Inoltre, assegna carattere assolutamente prioritario alla lotta contro la
pirateria c.d. massiva, ritenuta particolarmente pericolosa a differenza
delle violazioni compiute in maniera sporadica e occasionale.
Le politiche di enforcement si traducono nella previsione di una
procedura amministrativa speciale, più rapida rispetto alla via giudi-
ziaria che cerca di dare risposta alle esigenze di celerità proprie della
UHWHVHQ]DFKHFLzGHWHUPLQLO¶LQJLXVWDFRmpressione delle garanzie di
partecipazione e difesa: il procedimento, infatti, assicura il contraddit-
torio tra le parti ed è scandito da tempi adeguati durante i quali ogni
soggetto interessato potrà far valere le proprie ragioni. Il procedimento
dinanzi DOO¶$XWRULWjSXzHVVHUHDYYLDWRVRORVXLVWDQ]DGHOVRJJHWWROe-
gittimato, il quale deve preventivamente rivolgersi con una richiesta di
rimozione al gestore della pagina Internet.
4XDORUDO¶RSHUDWXWHODWDGDOGLULWWRG¶DXWRUHQRQYHQJDULPRVVDSo-
trà essere ULFKLHVWD OD ULPR]LRQH GLUHWWDPHQWH DOO¶$XWRULWj OD TXDOH
GRSRO¶LVWUXWWRULDLQFRQWUDGGLWWRULRWUDOHSDUWLSRWUjGLVSRUUHla archi-
XI. ,OGLULWWRG¶DXWRUHLQ,QWHUQHW 217

YLD]LRQHGHOSURFHGLPHQWRRO¶LPSRVL]LRQHGHOO¶REEOLJRGLUimozione.
Infine, sono previste delle sanzioni pecuniarie per il caso di inottem-
SHUDQ]DDOO¶RUGLQHGHOO¶$*&20LOFXLDPPRQWDUHYDULDGDXQPLQi-
mo di diecimila euro a un massimo di duecentocinquantamila euro. Il
PDQFDWRULVSHWWRGHOO¶RUGLQHGHOO¶$XWRULWjSXzDVVXPHUHDQFKHXQDUi-
levanza penale.
La procedura pone alcuni interrogativi. Riservandoci di riprendere
il discorso nelle conclusioni di questo capitolo, riteniamo opportuno
evidenziare già in questa sede i possibili dubbi interpretativi che po-
tranno porsi in sede applicativa. Limitandoci al solo profilo soggetti-
vo, possiamo, ad esempio, chiederci: chi sarà realmente legittimato a
presentare istanza di rimozione? Quale criterio potrà essere impiegato
SHUTXDOLILFDUHXQVRJJHWWRFRPHDXWRUHQHOO¶DPELWRGLVLVWHPDLQFXL
sono frequenti meccanismi di condivisione e creazione delle opere as-
solutamente non corrispondenti a quelli che caratterizzano il mondo
offline? E ancora, spostandoci dal lato del soggetto passivo: riscontra-
ta la terminologia ampia e generica impiegata nel regolamento, quali
soggetti potranno essere chiamati a dare esecuzione ai provvedimenti
LQLELWRUL GHOO¶$*&20" 4XHVWe domande troveranno, forse, una ade-
JXDWDULVSRVWDQHOODSUDVVLGHOO¶$XWRULWjODTXDOHDQFRUDXQDYROWDSo-
trà decidere a chi spetteranno diritti e chi sarà tenuto a rispettare i pro-
pri ordini.

11.5. La composizione del dilemma digitale: il bilanciamento dei


diritti

Concludiamo il nostro discorso chiedendoci se in una prospettiva de


jure condendo sia possibile delineare una soluzione normativa che
tenga in giusto conto le esigenze degli autori e le contrapposte libertà
degli utenti della rete, le quali indubbiamente subiscono una compres-
sione in presenza di meccanismi volti a tutelare il copyright in Inter-
net.
Le varie esperienze prese in considerazione in questo capitolo mo-
strano che non è affatto semplice individuare il punto di equilibrio tra
O¶HIILFDFHWXWHODGHOGLULWWRG¶DXWRUHHODSLHQDJDUDQ]LDGHOODOLEHUWjGL
espressione degli utenti della rete. Come abbiamo visto, i legislatori
218 Manuale di diritto delle arti e dello spettacolo

che sono intervenuti in subiecta materia hanno prodotto spesso nor-


mative sbilanciate a favore dHOGLULWWRG¶DXWRUHFDXVDQGRXQD irragio-
nevole compressione della manifestazione del pensiero. Ciò giustifica
un giudizio negativo, dato che la strada intrapresa dalla maggioranza
dei legislatori nazionali ± RULHQWDWD DOO¶LPSOHPHQWD]LRQH GL PHFFDQi-
smi di blocco e/o di rimozione rispetto ai siti Internet ove siano diffu-
se illeJDOPHQWHRSHUHSURWHWWHGDGLULWWRG¶DXWRUH ± pone problemi sia
in termini di efficacia che di efficienza del sistema: infatti, gli inter-
venti meramente sanzionatori, oltre ad essere inefficaci rispetto al fine
di garantire adeguatamente i diritti degli autori, sono anche inefficienti
perché sacrificano gli altri diritti costituzionalmente rilevanti in misura
ultronea rispetto a quanto sarebbe realmente necessario.
,QWHUQHWqXQRVSD]LRLQFXLO¶HVHUFL]LRGLQXRYHOLEHUWjqUHVRSRs-
sibile grazie al pieno riconoscimento dei tradizionali diritti. Pertanto,
il blocco dei siti Internet che non trovi la propria giustificazione
QHOO¶HVLJHQ]DGi tutelare un altro valore di rango costituzionale rappre-
VHQWDXQ¶LQGHELWDOLPLWD]LRQHGHOGLULWWRGLDFFHVVRDOODUHWHHGHYHHs-
sere considerata alla stregua della lesione di un diritto fondamentale,
LQ JUDGR GL LQFLGHUH QHJDWLYDPHQWH VXOO¶HVHUFL]LR GL DOtre libertà fon-
GDPHQWDOL GHOO¶LQGLYLGXR 'XQTXH VH GDXQ ODWRq YHUR FKHOH QXRYH
tecnologie hanno rappresentato e continuano a rappresentare un fattore
di sviluppo per le libertà, dato che hanno permesso di accrescere ed
HVSDQGHUH O¶DJLUH XPDQR q DOWUHWtanto corrispondente al vero che la
tendenza a comprimere la dimensione libertaria di Internet non è affat-
to trascurabile.
Per questa ragione diviene centrale capire quale sia il corretto bi-
lanciamento tra le libertà che vengono in rilievo: infatti, il bilancia-
mento svolto dal legislatore deve rispondere, tra gli altri, ad un criterio
di necessità, nel senso che la scelta di limitare o postergare un diritto o
un interesse costituzionale deve giustificarsi per la necessità di dare
attuazione a un altro diritto o interesse di pari rango.
E questo è, per definizione, compito esclusivo del legislatore. In
particolare, riteniamo di poter concludere affermando che lo sviluppo
tecnologico debba essere continuamente orientato dal legislatore verso
O¶HPHUVLRQH GL TXelle posizioni giuridiche soggettive che sono state
acutamente qualificate dalla dottrina come nuovi diritti fondamentali,
la cui rilevanza per il diritto costituzionale discende, pur in assenza di
XI. ,OGLULWWRG¶DXWRUHLQ,QWHUQHW 219

un esplicito riconoscimento normativo, dal forte e chiaro tono che esse


SUHVHQWDQRVRORLQTXHVWRPRGRLQIDWWLVLSRWUjGDUHXQ¶DGHJXDWDUi-
sposta ai tanti problemi emersi nel cyberspazio che pongono nuovi in-
WHUURJDWLYLDOJLXULVWD/DWXWHODGHOGLULWWRG¶DXWRUHLQ,QWHUQHWGLPRVWUD
O¶LPSRUWDQ]DGLLQTXDGUDUHla regolazione dei nuovi mezzi di comuni-
cazione secondo le procedure ordinarie e nel pieno rispetto dei princi-
pi fondamentali del sistema. Dunque, per quanto riguarda
O¶RUGLQDPHQWR LWDOLDQR LO UHJRODPHQWR GHOO¶$*&20 VXOOD WXWHOD GHO
GLULWWR G¶DXWRUH VXOOH reti di comunicazione elettronica non chiude la
SDUWLWDFRVuFRPHGLPRVWUDO¶LGHDVHFRQGRFXLVDUjLQGLVSHQVDELOHXQD
sua riscrittura ± forse ad opera della Corte costituzionale ± maggior-
mente rispettosa dei principi espressi in Costituzione e nel diritto
GHOO¶Unione europea.
Capitolo XII

/DWXWHODSHQDOHGHOGLULWWRG¶DXWRUH
di ALDO ALBORE

12.1. Premessa: il patrimonio come bene giuridico protetto

Fin dalla pubblicazione del testo originario della l. 22 aprile 1941, n.


LOGLULWWRG¶DXWore ha goduto di tutela non solo in sede civile ma
anche in sede penale. Lo stigma connesso alla previsione di fattispecie
criminose si spiega in ragione della importanza dei valori interessati
dalla materia de qua, direttamente riconducibili a principi costituzio-
QDOLTXDOLODJDUDQ]LDGHLGLULWWLLQYLRODELOLGHOO¶XRPR DUWFRVW OD
promozione del pieno sviluppo della persona umana (art. 3, secondo
comma, cost.); la libertà di pensiero (art. 21 cost.); la libertà delle arti
e delle scienze (art. 33 cost.); ed anche la tutela del lavoro, della pro-
prietà e della libera iniziativa economica (artt. 35, 42 e 41 cost.) che
rappresentano il fondamento composito del profilo patrimoniale del
GLULWWRG¶DXWRUHYDOHDGLUHGHOGLULWWRHVFOXVLYRDOO¶XWLOL]]D]LRQHHco-
QRPLFDGHOO¶RSHUD
Il riferimento alla proprietà ± nella declinazione di «proprietà in-
tellettuale» utilizzata dalla dottrina tradizionale per indicare la relazio-
QHJLXULGLFDFKHLQWHUFRUUHWUDO¶DXWRUHHO¶RSHUDRJJHWWRGHOODVXDDWWi-
vità creativa ± è utile al penalista per individuare correttamente il bene
giuridico tutelato dalle norme incriminatrici dettate in subiecta mate-
ria,QIDWWLWXWWHOHIDWWLVSHFLHGLUHDWRSRVWHDWXWHODGHOGLULWWRG¶DXWRUH
ne proteggono la sola manifestazione economica, garantiscono cioè il
SLHQR JRGLPHQWR GHL GLULWWL GL VIUXWWDPHQWR HFRQRPLFR GHOO¶RSHUD GD
parte del titolare, mentre si disinteressano totalmente del c.d. profilo
221
222 Manuale di diritto delle arti e dello spettacolo

morale, comprensivo del diritto ad essere riconosciuto come autore,


del diritto di inedito, del GLULWWRGLPRGLILFDUHO¶RSHUDHGLPDQWHQHUH
O¶DQRQLPDWR&LzVLJQLILFDFKHLUHDWLGLFXLVLLQWHQGHGLVFRUUHUHVRQR
LQTXDGUDELOLQHOO¶DPELWRGHLGHOLWWLFRQWURLOSDWULPRQLRFRQWXWWRFLz
che ne consegue in termini di effettiva o potenziale vis expansiva della
tutela penale: il patrimonio, pur essendo un bene di sicura rilevanza
FRVWLWX]LRQDOHQRQILJXUDWUDLSULQFLSLIRQGDPHQWDOLGHOO¶RUGLQDPHQWR
Pertanto, la sua tutela non può essere assoluta ma deve, al contrario,
essere bilanciata con quella di altri valori costituzionalmente protetti
con i quali potrebbe entrare in conflitto. Si pensi ai fini di socialità che
SRVVRQROLPLWDUHO¶HVHUFL]LRGHOODSURSULHWjHGHOODLQL]LDWLYDHFRQRPi-
FD DUWWHFRVW RSSXUHDOO¶LQWHUHVVHDOORVYLOXSSRGHOODFultura
DUWFRVW HDOODVWHVVDOLEHUWjGHOO¶DUWHHGHOODVFLHQ]D DUWFRVW 
3ULQFLSLTXHVWLFKHSRVVRQROHJLWWLPDUHO¶DSSRVL]LRQHGLOLPLWLDTXHl-
lo che, con espressione tipicamente riferita al diritto di proprietà, po-
trebbe definirsi come ius excludendi GHOO¶DXWRUH7DQWRSLVHVLFRQVi-
dera che i numerosi interventi legislativi riguardanti le opere
GHOO¶LQJHJQRQRQVRQRVWDWLSUHFHGXWLQpKDQQRSURGRWWRXQDXWHQWLFR
bilanciamento dei molteplici interessi legati al mondo della proprietà
intellettuale.
In ogni caso, oggetto di trattazione sarà soltanto la tutela sanziona-
WRULDSHQDOHGHOOH³RSHUHGHOO¶LQJHJQR´GLFXLDOO¶DUWFRGFLYH
DOO¶DUWGHOODOQYDOHDGLUHULSRUWDQGRODGL]LRQHFRPXQH
ad entrambe le norme, quelle ³GLFDUDWWHUHFUHDWLYRFKHDSSDUWHQJRQR
DOODOHWWHUDWXUDDOODPXVLFDDOOHDUWLILJXUDWLYHDOO¶DUFKLWHWWXUDDOWHa-
tro ed alla cinematografia, qualunque ne sia il modo o la forma di
HVSUHVVLRQH´$TXHVWHVLDJJLXQJRQRDQFKHL³SURJUDPPLSHUHODERUa-
tore´HOH³EDQFKHGLGDWL´LTXDOLVRQRVWDWLLQVHULWLDOsecondo com-
ma GHOO¶DUWOGDDGRSHUDGHOGOJVGLFHPEUHQ
5HVWDQRHVFOXVHLQYHFHOH³LQYHQ]LRQLLQGXVWULDOL´GLFXLDJOLDUWW
2584 ss. cod. civ., le quali, pur essendo parimentLIUXWWRGHOO¶LQJHJQR
creativo, sono oggetto di disciplina particolare. Si segnala, comunque,
che i brevetti ed i marchi sono tutelati dagli artt. 473, 474, 475, 514,
517, 517 bis e 518 cod. pen., laddove però il bene giuridico protetto da
queste norme non è tanto, e certamente non solo, il patrimonio
GHOO¶LQYHQWRUHLQWHVRFRPHGLULWWRGLXWLOL]]D]LRQHHFRQRPLFDGHOOHVXH
XII. /DWXWHODSHQDOHGHOGLULWWRG¶DXWRUH 223

LQYHQ]LRQLTXDQWRSLXWWRVWROD©IHGHSXEEOLFDªH©O¶HFRQRPLDSXEEOi-
FDO¶LQGXVWULDHLOFRPPHUFLRª
8Q¶DOWUDSUHFLVD]LRQHSUHOLPLQDUHVL impone in ordine alla formula-
zione delle norme incriminatrici che si andranno, di qui a poco, ad
esaminare: il metodo adottato dal legislatore è quello casistico, consi-
stente in una fin troppo analitica descrizione delle condotte incrimina-
te, il che se da un lato si spiega col tentativo di ricomprendere tutte le
SRVVLELOLIRUPHGLDJJUHVVLRQHDOEHQHWXWHODWRGDOO¶DOWUo lato espone la
legislazione al pericolo di essere facilmente superata dalla sempre più
rapida evoluzione tecnologica; inoltre le fattispecie presentano spesso
clausole di illiceità c.d. speciale (si pensi DOO¶XWLOL]]RGLDYYHUELTXDOL
abusivamente, illecitamente, o di espressioni come senza averne dirit-
to) che rinviano alla disciplina civilistica sottostante e che, pertanto,
necessitano di essere interpretate alla luce di questa. Invero, un sog-
getto potrebbe ad esempio avere diritto a vendere, diffondere, recitare
LQSXEEOLFRXQ¶DOWUXLRSHUDGHOO¶LQJHJQRSHUFKpO¶DXWRUHJOLKDFHGXWRL
diritti patrimoniali a lui spettanti ed è chiaro che, in questo caso, non
si potrà imputare al primo il delLWWRGLFXLDOO¶DUWOGDVXOODFXL
evoluzione ci soffermeremo nelle pagine seguenti.

(YROX]LRQHGHOODGLVFLSOLQDSHQDOHO¶DUWOGDGDQRUPD
fondamentale a norma residuale

Lo svilXSSR GLDFURQLFR GHOOD OHJLVOD]LRQH VXO GLULWWR G¶DXWRUH q VWDWR


ingenerato essenzialmente dalla evoluzione tecnologica dei metodi di
SURGX]LRQH H GLIIXVLRQH GHOO¶RSHUD GHOO¶LQJHJQR 3HU TXDUDQW¶DQQL
O¶XQLFR SUHVLGLR SHQDOLVWLFR q VWDWR O¶DUW  YHFFKLR testo) l.d.a. il
quale prevedeva una sola fattispecie di reato che sanzionava con la
multa da 500 a 20.000 lire chiunque, senza averne diritto, a qualsiasi
scopo e in qualsiasi forma riproducesse, trascrivesse, recitasse in pub-
blico o diffondesse, vendesse o mettesse in vendita o ponesse altri-
PHQWL LQ FRPPHUFLR ©XQ¶RSHUD DOWUXLª (YLGHQWHPHQWH OD UHDOWj GHO
1941 non consentiva nemmeno di immaginare il fenomeno della pira-
teria HODPDJJLRUSDUWHGHOOHDJJUHVVLRQLDOGLULWWRG¶DXWRUHSDWULPo-
niale consistevano in inadempimenti contrattuali.
224 Manuale di diritto delle arti e dello spettacolo

La situazione è rimasta pressoché immutata fino agli anni Ottanta


quando, per stare al passo coi tempi, il legislatore ha introdotto ± dap-
prima con la l. 29 luglio 1981, n. 406 e poi con la l. 20 luglio 1985, n.
400 ± nuove IDWWLVSHFLHGLUHDWRFRQWURO¶LOOHFLWDULSURGX]LRQHRFRm-
PHUFLDOL]]D]LRQHGL³GLVFKLQDVWULRDOWULVXSSRUWLDQDORJKL´HGL³RSe-
UHGHVWLQDWHDOFLUFXLWRFLQHPDWRJUDILFRRWHOHYLVLYR´6HJXLYDQRSRL
il d.lgs. 29 dicembre 1992, n. 518 (attuativo della direttiva
91/250/CEE per la tutela dei programmi per elaboratore); il d.lgs. 16
novembre 1994, n. 685 (attuativo della direttiva 92/100/CEE concer-
nente il diritto di noleggio, il diritto di prestito e taluni diritti connessi
al diritto di autore); il d.lgs. 6 maggio 1999, n. 169 (attuativo della di-
rettiva 96/9/CE in materia di banche di dati) e la legge di riforma or-
ganica 18 agosto 2000, n. 248. Innovazioni sul piano della repressione
penale sono state apportate, infine, anche dal d.lgs. 9 aprile 2003, n.
68; dal d.l. 22 marzo 2004, n. 72 (convertito con modificazioni dalla l.
21 maggio 2004, n. 128); dal d.l. 31 gennaio 2005, n. 7 (convertito
con modificazioni dalla l. 31 marzo 2005, n. 43); e dal d.lgs. 16 marzo
2006, n. 140.
Il quadro che ne è derivato è complesso e variegato sebbene, per
fortuna, condensato nel testo della l. 633/1941. Sono previsti delitti,
contravvenzioni, aggravanti, attenuanti, pene accessorie, misure di si-
curezza e sanzioni amministrative. Le norme di riferimento sono quel-
le degli artt. da 171 a 174 quinquies l.d.a., sebbene non vada sottaciuto
FKHFRQO¶RELHWWLYRGLUDIIRU]DUHO¶HIILFDFLDGHWHUUHQWHGHOVLVWHPDVDn-
zionatorio, la l. 248/2000 ha revisionato e ampliato soprattutto le san-
zioni amministrative ed interdittive, considerate come strumenti più
duttili ed immediati delle sanzioni penali, pur estendendo al contempo
il novero delle condotte costituenti reato e rendendo più severe le rela-
tive pene nei minimi e nei massimi edittali.
6HPSUHQHOO¶RWWLFDGLXQDGHFLVDUHSUHVVLRQHGHLIHnomeni lesivi del
GLULWWR G¶DXWRUH D FRPLQFLDUH GDOOD pirateria, si giustificano disposi-
zioni come quelle degli artt. 171 nonies e 171 octies 1 l.d.a.. La prima
prevede una attenuante a favore del responsabile di uno dei reati che si
analizzeranno nei paragrafi a venire in caso di denuncia spontanea del-
la violazione prima che questa gli venga contestata in un atto
GHOO¶DXWRULWj JLXGL]LDULD H VRSUDWWXWWR TXDQGR HJOL VL UHQGD GHODWRUH
FRQVHQWHQGR O¶LQGLYLGXD]LRQH GHO SURPRWRUH R GHOO¶RUJDQL]]DWRUH
XII. /DWXWHODSHQDOHGHOGLULWWRG¶DXWRUH 225

GHOO¶DWWività caratterizzata, ad esempio, dal fine di commercio di opere


abusivamente duplicate, riprodotte, trasmesse o diffuse in pubblico
ovvero di strumenti e materiali atti a consentire la violazione del dirit-
WRG¶DXWRUH/DVWHVVDDWWHQXDQWHVLDSSOLFDTXDQGo il delatore consenta
il sequestro di notevoli quantità di supporti audiovisivi e fonografici o
di mezzi destinati alla commissione dei reati suddetti. Una sorta di
collaborazione ± resa conveniente da un importante sgravio di pena
(da un terzo alla metà) ± introdotta nella materia de qua in considera-
zione del fatto che non è raro imbattersi in vere e proprie organizza-
]LRQLGHGLWHDVSHFXODUHVXOODYLROD]LRQHGHLGLULWWLG¶DXWRUHSLFFROHR
grandi che siano.
/¶DUW  octies 1, invece, sanziona con le penH SUHYLVWH GDOO¶DUW
372 cod. pen. per il delitto di falsa testimonianza ridotte della metà
chiunque si rifiuti senza giustificato motivo di rispondere in sede civi-
OHDOOHGRPDQGHFKHDLVHQVLGHOO¶DUWter OGDO¶DXWRULWjJLXGL]La-
ria su richiesta di parte può porre ± per ottenere informazioni
VXOO¶RULJLQH H VXOOH UHWL GL GLVWULEX]LRQH GL PHUFL R GL SUHVWD]LRQL GL
VHUYL]LOHVLYLGHOGLULWWRG¶DXWRUH± DOO¶DXWRUHGHOODYLROD]LRQHQRQFKpD
chi sia stato trovato in possesso di merci per tal verso illecite su scala
commerciale, a chi sia stato sorpreso a fornire sempre su scala com-
merciale servizi ugualmente illeciti ovvero a chi sia stato indicato co-
me persona implicata nella produzione, fabbricazione o distribuzione
di tali prodotti o nella fornitura dLWDOLVHUYL]L,QVRPPDVHO¶DUW
nonies offre una sorta di ricompensa al soggetto attivo del reato per
farlo FROODERUDUHO¶DUWocties 1, nel diverso ambito della tutela ci-
YLOLVWLFD GHO GLULWWR G¶DXWRUH LQWURGXFH XQD VDQ]LRQH SHQDOH FKH KD
fondamentalmente lo stesso fine: indurre a rivelare.
9HQHQGR DOO¶HVDPH GHOOH VLQJROH IDWWLVSHFLH GL UHDWR O¶DWWXDOH DUW
171 l.d.a., in virtù della clausola VDOYRTXDQWRSUHYLVWRGDOO¶DUW bis
HGDOO¶DUW 171 ter´GHOLQHDRJJLVROWDQWRXQDIDWWLVSHFLHUesiduale, la
quale punisce con la multa (da euro 51 ad euro 2.065) chiunque, senza
averne diritto, a qualsiasi scopo e in qualsiasi forma ± quindi con dolo
generico ± riproduce, trascrive, diffonde, pone in circolazione
XQ¶RSHUD DOWUXL RYYHUR UDSSUHVHQWD esegue o recita in pubblico
XQ¶RSHUDWHDWUDOHPXVLFDOHRFLQHPDWRJUDILFDDOWUXL/DOHWWD bis del
primo comma estende espressamente la sanzione a chi «mette a dispo-
sizione del pubblico, immettendola in un sistema di reti telematiche,
226 Manuale di diritto delle arti e dello spettacolo

mediante connessioQLGLTXDOVLDVLJHQHUHXQ¶RSHUDGHOO¶LQJHJQRSUo-
tetta, o parte di essa». È chiaro che la disposizione si riferisce al fe-
nomeno del file sharing, il quale è affrontato dalla legge sul diritto
G¶DXWRUH VHFRQGR GLYHUVH SURVSHWWLYH 3HU RIIULUH DO OHWWRUH XQD rico-
struzione organica si dedicherà un apposito paragrafo a questo tema.
Il terzo comma GHOO¶DUWSUHYHGHLQYHFHXQDIRUPDDJJUDYDWD
di tutte le condotte summenzionate: qualora esse siano commesse su
GLXQ¶RSHUDQRQGHVWLQDWDDOODSXEEOLFD]LRQHRYYero con usurpazione
GHOODVXDSDWHUQLWjRYYHURDQFRUDFRQPRGLILFD]LRQLGHOO¶RSHUDGDOOH
TXDOL ULVXOWL XQ¶RIIHVD DOO¶RQRUH R DOOD UHSXWD]LRQH GHO VXR DXWRUH OD
pena è della reclusione fino ad un anno alternativa alla multa.
/HGLVSRVL]LRQLGHOO¶DUWvanno necessariamente integrate con i
OLPLWL DOO¶XWLOL]]R GL WHFQLFKH ULSURJUDILFKH IRWRFRSLDWXUD et similia)
VDQFLWLGDOO¶DUWOGDD seguito della novella del 2000, infatti, la ri-
produzione fotomeccanica di opere altrui è consentita ± esclusivamen-
te per uso personale ± nei limiti del 15% di ciascun volume o fascicolo
GL SHULRGLFR DQFKH VH HIIHWWXDWD DOO¶LQWHUQR GL ELEOLRWHFKH SXEEOLFKH
con annesso obbligo di corresponsione di un compenso agli autori ed
editori (per il tramite della SIAE) da parte dei responsabili dei punti o
centri di riproduzione o da parte delle biblioteche. Resta libera, inve-
ce, la riproduzione effettuata a mano o con mezzi non idonei allo
VSDFFLRRDOODGLIIXVLRQHLQSXEEOLFRGHOO¶RSHUDFRVuFRPHTXHOODGHOOH
opere esistenti nelle biblioteche accessibili al pubblico o in quelle sco-
lastiche fatta per i servizi della biblioteca. Resta vietato, infine, non
solo lo spaccio al pubblico delle copie ottenute ma, più in generale,
ogni utilizzazione in concorrenza con i diritti di utilizzazione econo-
PLFDVSHWWDQWLDOO¶DXWRUH

12.3. La tutela del software e delle banche di dati: in particolare, il


fine di profitto e lo scopo commerciale o imprenditoriale

/¶DUWbis l.d.a. è stato introdotto dal d.lgs. 518/1992 che ha equi-


parato i programmi per elaboratore alle opere letterarie anziché inqua-
GUDUOLQHOO¶DPELWRGHOOHLQYHQ]LRQLLQGXVWULDOLFRQIRUPHPHQWHDOOHLn-
dicazioni della direttiva 91/250/CEE.
XII. /DWXWHODSHQDOHGHOGLULWWRG¶DXWRUH 227

1HO  O¶2UJDQL]]D]LRQH 0RQGLDOH GHOOD 3URSULHWj ,QWHOOHWWXDOH


(OMPI) ha definito il software quale espressione di un insieme orga-
nizzato e strutturato di istruzioni in qualsiasi forma o su qualunque
supporto capace, direttamente o indirettamente, di far eseguire o far
ottenere una funzione o un compito o far ottenere un risultato partico-
lare per mezzo di un sistema di elaborazione elettronica
GHOO¶LQIRUPD]LRQH1R]LRQHYROXWDPHQWHPROWRDPSLDFDSDFHGLWHQe-
re il passo rispetto alla rapidissima ed esponenziale evoluzione della
scienza informatica.
Una definizione giuridica di banca di dati (da non confondere con il
c.d. database) la si trova, invece, nel §  GHOO¶DUW  GHOOD GLUHWWLYD
&(³XQDUDFFROWDGLRSHUHGDWLRDOWULHOHPHQWLLQGLSHQGHQWLVi-
stematicamente o metodicamente disposti ed individualmente accessi-
bili grazie a mezzi eOHWWURQLFLRLQDOWURPRGR´7DOHGHILQL]LRQHYDLn-
WHJUDWDFRQLOGHWWDWRGHOO¶DUWOGDVHFRQGRLOTXDOHVRQRRJJHWWRGL
SURWH]LRQH OH EDQFKH GL GDWL ³FKH SHU OD VFHOWD R OD GLVSRVL]LRQH GHO
PDWHULDOH FRVWLWXLVFRQR XQD FUHD]LRQH LQWHOOHWWXDOH GHOO¶DXWRUH´ &Lz
significa che la banca di dati è tutelata non tanto per i suoi contenuti ±
magari altrimenti reperibili ± quanto per il sistema logico con cui i va-
ri elementi sono stati individuati, inclusi nella raccolta e posti in rela-
zione gli uni con gli alWUL6LSHQVLDGXQDDQWRORJLDXQ¶HQFLFORSHGLDR
DXQGL]LRQDULRIUXWWRGHOO¶LQJHJQRFUHDWLYRGHOO¶DXWRUHqODUDFFROWDLQ
quanto tale con le sue caratteristiche strutturali e sistemiche e non gli
elementi inclusi in essa. Lo stesso è a dirsi per un elenco clienti.
Il primo comma GHOO¶DUW  bis punisce con la reclusione da sei
mesi a tre anni e con la multa da euro 2.582 a euro 15.493 tutte le pos-
VLELOLFRQGRWWHOHVLYHGHOGLULWWRG¶DXWRUHVXSURJUDPPLSHUHODERUDWo-
re: duplicazione, importazione, distribuzione, vendita, detenzione e
concessione in locazione. Integra il reato de quo non solo la condotta
di abusLYDLQWHJUDOHGXSOLFD]LRQHGHOO¶opera informatica altrui, ma al-
tresì qualsiasi attività di sviluppo di tale opera in assenza
GHOO¶DXWRUL]]D]LRQHGHOO¶avente diritto che ne implichi anche solo par-
zialmente la riproduzione (Cass. Pen., Sez. V, sentenza 21 giugno
2011, n. 38325). Elemento costitutivo del reato è, in tutte le ipotesi
menzionate, che i programmi siano contenuti in supporti non contras-
segQDWL FRQ O¶DSSRVLWR EROOLQR  GDOOD 6,AE. Il secondo periodo del
primo comma LQYHFH UHDOL]]D XQ¶DQWLFLSD]LRQH GHOOD WXWHOD SHQDOH
228 Manuale di diritto delle arti e dello spettacolo

estendendo le medesime pene alle condotte che riguardano non i soft-


ware in quanto tali ma i vari crakes, key-generators, trial resets che
consentano di rimuovere o aggirare i sistemi informatici posti a prote-
zione di un programma. Il secondo comma punisce allo stesso modo
condotte equivalenti a quelle di cui al primo comma aventi ad oggetto,
però, le banche di dati come sopra definite.
È da notare che per entrambe le fattispecie, almeno dopo la novella
GHOO¶DUWbis richiede il dolo specifico identificato dalla no-
zione di profitto: le descritte condotte, per essere penalmente rilevanti,
devono essere compiute al fine di trarne profitto. Il dolo specifico si
distingue dal dolo generico proprio perché il legislatore individua nel-
la norma incriminatrice la particolare finalità in vista della quale il fat-
to deve essere compiuto, laddove il dolo generico consiste al contrario
nella coscienza e volontà di realizzare tutti gli estremi di un fatto co-
stituente reato ± vale a dire la sola condotta nei cc.dd. reati di pura
condotta OD FRQGRWWD H O¶HYHQWR FDXVDOPHQWH FROOHJDWR DG HVVD QHL
cc.dd. reati di evento  indipendentemente dal fine perseguito
GDOO¶DXWRUH
Ebbene, il concetto di profitto è diverso da quello di lucro. Il legi-
slatore utilizza le due espressioni in modo alternativo nella definizione
dei vari delitti contro il patrimonio, inclusi quelli inseriti nella l.d.a. ed
anche la loro comune accezione è diversa, per cui senza dubbio non
possono essere considerate come sinonimi. Se non hanno lo stesso si-
gnificato, occorre allora cogliere i profili differenziali delle due nozio-
ni: dottrina e giurisprudenza ritengono concordemente che il fine di
profitto sia più ampio di quello di lucro. Quando si passa al significato
concreto, però, non è facile giungere ad una soluzione univoca e se la
Suprema Corte ha affermato, proprio in materia di tutela del diritto
G¶DXWRUHFKHLOILQHGLSURILWWRQRQULFKLHGHXQD³ILQDOLWjGLUHWWDPHQWH
SDWULPRQLDOH´ offrendo qualche spunto a quanti sostengono che il pro-
fitto può consistere anche in un vantaggio di carattere morale o psico-
logico (Cass. Pen., Sez. III, sentenza 17 maggio 2007, n. 25184), in
precedenza aveva già chiarito che con la modifica del primo comma
GHOO¶DUWbis il legislatore ha introdotto «accanto alla persecuzione
di uno scopo determinato, quantificabile in denaro, una qualunque al-
tra finalità che, pur non costituendo lucro, comporti tuttavia un qual-
XII. /DWXWHODSHQDOHGHOGLULWWRG¶DXWRUH 229

VLDVLYDQWDJJLRPDWHULDOHG¶altra natura» (Cass. Pen., Sez. III, sentenza


25 giugno 2001, n. 33303). Vantaggio materiale quindi, e non sempli-
cemente morale o psicologico. Non si può prescindere, cioè, dal fatto
che le fattispecie di reato contemplate dalla l.d.a. vanno inquadrate nei
reati contro il patrimonio e che pertanto ± come affermato da autore-
vole dottrina ± se è vero da un lato che il profitto può assumere, a se-
conda dei casi, ora una rilevanza strettamente economica ora una ca-
ratterizzazione più ampia ± non potendo comunque consistere mai in
XQD ³XWLOLWj PHUDPHQWH LPPDJLQDULD R IDQWDVWLFD´ ex plurimis Cass.
Pen., Sez. II, sentenza 9 gennaio 2013, n. 843) ± GDOO¶DOWURODWRQRQq
possibile smarrire ogni riferimento alla patrimonialità, seppure intesa
in senso ampio. Ancor di più se il profitto viene concepito come
O¶HOHPHQWRVLPPHWULFRGHOGDQQRDUUHFDWRDOVRJJHWWRSDVVLYRGHOUHa-
to: trattandosi di reati contro il patrimonio, il danno subito dal sogget-
to passivo è di carattere economico-patrimoniale; quindi anche il pro-
fitto deve presentare il medesimo carattere, sia pure in senso lato.
7XWWRFLzFRPSRUWDFKHSHULQWHJUDUHOHIDWWLVSHFLHGLFXLDOO¶DUW
bis non è necessario che le condotte siano poste in essere al fine di
trarne, in positivo, un guadagno quantificabile in denaro (lucro) ma è
sufficiente che il vantaggio perseguito dal reo sia anche in via indiretta
o potenziale di carattere patrimoniale (profitto): si pensi al risparmio
GLVSHVDGHULYDQWHGDOO¶XWLOL]]R di software VHQ]DOLFHQ]DG¶XVRUHJo-
larmente acquistata o alla possibilità di irretire i clienti inclusi in un
elenco altrui.
Il primo comma GHOO¶DUWbis, oltre al fine di profitto, richiede
anche lo scopo commerciale o imprenditoriale per la sola ipotesi della
detenzione di programmi contenuti in supporti non contrassegnati dal-
la Società Italiana degli Autori ed Editori. Tale ulteriore specificazio-
ne in termini di dolo ha suscitato non pochi dubbi interpretativi poiché
SUHVXSSRQH XQ¶HVDWWD LQGLYLGXD]ione delle attività che possono inte-
JUDUH OR VFRSR FRPPHUFLDOH R LPSUHQGLWRULDOH /¶DUW  FRG FLY
GHILQLVFH O¶LPSUHQGLWRUH FRPH FROXL FKH ©HVHUFLWD SURIHVVLRQDOPHQWH
XQ¶DWWLYLWj HFRQRPLFD RUJDQL]]DWD DO ILQH GHOOD SURGX]LRQH R GHOOR
scambio di beni o GLVHUYL]LªPHQWUHGDOO¶DUWFRGFLYVLULFDYD
FKH VRQR LPSUHVH FRPPHUFLDOL TXHOOHHVHUFHQWL XQ¶DWWLYLWj LQGXVWULDOH
GLUHWWDDOODSURGX]LRQHGLEHQLRVHUYL]LXQ¶DWWLYLWjLQWHUPHGLDULDQHOOD
FLUFROD]LRQHGHLEHQLXQ¶DWWLYLWjGLWUDVSRUWRSHUWHUra, per acqua o per
230 Manuale di diritto delle arti e dello spettacolo

DULDXQ¶DWWLYLWjEDQFDULDRDVVLFXUDWLYDXQ¶DOWUDDWWLYLWjDXVLOLDULDGHOOH
precedenti. Pertanto, se la detenzione di software abusivamente dupli-
cato è finalizzata alla vendita o alla concessione in locazione del me-
GHVLPRQHOO¶DPELWRGLXQ¶DWWLYLWjFKHSUHVHQWLOHFDUDWWHULVWLFKHDSSe-
na indicate (cioè svolta in forma di impresa ex art. 2082 cod. civ. ed,
eventualmente, di carattere commerciale) certamente essa ha scopo
imprenditoriale o commerciale e come tale costituisce reato.
SenQRQFKpO¶LPSUHQGLWRUHO¶LPSUHQGLWRUHFRPPHUFLDOHHGDQFKHLO
professionista ± il quale ultimo se non è imprenditore in senso proprio
FRPXQTXHUHQGHXQDSUHVWD]LRQHG¶RSHUDLQWHOOHWWXDOHSDUDJRQDELOHLQ
un certo senso, ad un servizio ± potrebbero detenere programmi non
originali QRQWDQWRSHUYHQGHUOLTXDQWRSHUXWLOL]]DUOLQHOO¶DPELWRGHOOD
loro attività e quindi al fine di produrre o scambiare altri e diversi beni
o servizi. La particolarità di queste situazioni ha indotto talvolta la
giurisprudenza di merito a ritenere che esse ricadessero non nella pre-
YLVLRQHGHOO¶DUWbis primo commaEHQVuLQTXHOODGHOO¶DUWter
l.d.a. che configura un illecito amministrativo. La giurisprudenza di
legittimità, però, ha sgomberato il campo da tentativi di tal genere di
circoscrivere la portata della fattispecie, optando più correttamente per
O¶HVWHQVLRQHPDVVLPDGHOODPHGHVLPD1XPHURVHVRQROHSURQXQFHLQ
tal senso, alcune delle quali costituiscono oggi delle massime: secon-
do il Supremo Collegio la detenzione a scopo commerciale ricom-
prende «anche le fattispecie di deten]LRQH SHU XQ ³XVR LQWHUQR´
QHOO¶ambito di una attività imprenditoriale caratterizzata da uno scopo
commerciale, purché tale attività imprenditoriale sia favorita
GDOO¶utilizzo del programma con ODFRQVDSHYROHILQDOLWj>«@GLVHUYLUVL
di copie non autorizzate per percepire un vantaggio di tipo patrimonia-
le FRQVLVWHQWHQHOO¶immediato risparmio sul relativo costo di acquisto»
(Cass. Pen., Sez. III, sentenza 28 giugno 2001, n. 33896); allo stesso
modo il titolare di una scuola informatica organizzata in forma im-
prenditoriale, che aveva abusivamente duplicato mediante un maste-
rizzatore numerosi programmi per elaboratore, installandoli DOO¶interno
dei sistemi della sua scuola è stato ritenuto colpevole del delitto de
quo (Cass. Pen., Sez. III, sentenza 20 ottobre 2011, n. 18905); ancora,
la detenzione di programmi per elaboratore elettronico abusivamente
duplicati dagli originali da parte di soggetto esercente professional-
PHQWH O¶attività di assistenza in campo informatico può integrare il
XII. /DWXWHODSHQDOHGHOGLULWWRG¶DXWRUH 231

reaWRSUHYLVWRGDOO¶DUWbis primo comma della l. n. 633/1941, poi-


ché la finalità di commercio della detenzione medesima non deve es-
sere valutata esclusivamente con riguardo alla vendita diretta dei pro-
grammi, ma anche alla installazione dei medesimi sugli apparecchi af-
fidati in assistenza e, più in generale, alla loro utilizzazione in favore
dei clienti (Cass. Pen., Sez. III, sentenza 9 gennaio 2014, n. 6988).
Dunque, si può concludere affermando che le condotte di detenzio-
QHLQFULPLQDWHGDOO¶DUWbis l.d.a. sono quelle finalizzate in genera-
le alla produzione, alla cessione ed alla fornitura di beni o servizi, an-
che ulteriori e diversi dai software in quanto tali.

12.4. La tutela delle opere audiovisive e letterarie

/¶DUW  ter l.d.a., introdotto dal d.lgs. n. 685/1994 e modificato


dapprima dal d.lgs. n. 204/1996 e poi dalla l. 248/2000, sanziona pe-
nalmente una serie di condotte relative ad opere destinate al cinema o
alla televisione, supporti di qualsiasi tipo contenenti fonogrammi, vi-
deogrammi di opere musicali, opere cinematografiche o audiovisive o
sequenze di immagini in movimento, nonché opere letterarie, scienti-
ILFKH R GLGDWWLFKH /H YDULH WLSRORJLH GL FUHD]LRQL GHOO¶LQJHJQR VRQR
tutelate anche se rivestono carattere multimediale o consistono in tra-
smissioni criptate.
In particolare, sono punite con la reclusione da sei mesi a tre anni e
FRQODPXOWDGDHXURDHXURO¶DEXVLYDGXSOLFD]LRQHWUa-
smissione, diffusione in pubblico di opere audiovisive e letterarie
(primo comma, lett. a) e b)); la distribuzione in commercio, la deten-
zione per la vendita, il noleggio o la cessione, la proiezione o trasmis-
sione delle stesse opere da parte di chi non ha concorso alla duplica-
zione o alla riproduzione (lett. c)); la detenzione commerciale e qua-
lunque forma di distribuzione di supporti contenenti opere audiovisive
privi del prescritto contrassegno SIAE o dotati di contrassegno con-
traffatto o alterato (lett. d)); la diffusione e la ritrasmissione di tra-
VPLVVLRQL FULSWDWH QRQFKp OD IDEEULFD]LRQH O¶LPSRUWD]LRQH R LO FRm-
mercio di qualunque dispositivo hardware o software idoneo ad elu-
dere i sistemi di criptaggio e le misure tecnologiche di protezione di
cui agli artt. 102 quater e quinquies l.d.a., vale a dire i cc.dd. DRM ±
232 Manuale di diritto delle arti e dello spettacolo

acronimo che sta per Digital Rights Mangement ± (lett. e), f), f bis) e
K TXDOLULVXOWDQWLGDOGOJV (YLGHQWHPHQWHO¶LQFOXVLRQHGHO
traffico di tali ultimi strumenti elettronici o informatici nel novero del-
le condotte sanzioQDWHUHDOL]]DXQ¶DQWLFLSD]LRQHGHOODWXWHODSHQDOHVe-
condo lo schema dei reati di pericolo presunto: la condotta colpita non
è direttamente lesiva del bene giuridico tutelato (che si ricorda essere
LOSURILORHFRQRPLFRGHOGLULWWRG¶DXWRUH SRLFKpDGHVHPpio la vendi-
ta di dispositivi di decodificazione potrebbe non offendere in alcun
modo i diritti del broadcaster se nessuno degli acquirenti utilizzi poi
in concreto tali dispositivi per visionare trasmissioni criptate. È facile
immaginare, però, che chi acquista dispositivi di tal genere non si de-
terminerà a pagare ugualmente il canone o il prezzo dovuto
DOO¶HPLWWHQWHHGqSHUTXHVWRFKHLOOHJLVODWRUHDQWLFLSDODVRJOLDGLSu-
nibilità valutando presuntivamente (e senza possibilità di prova con-
traria) come pericolosa per il bene giuridico tutelato la condotta di
vendita. Sul punto, comunque, si ritornerà più avanti.
In ogni caso, i fatti sono puniti solo se compiuti per uso non perso-
nale e con fine di lucro: si determina, così, una singolare e ingiustifi-
cata disparità di trattamento rispetto ai software e alle banche di dati,
PDJJLRUPHQWH WXWHODWL LQ YLUW GHO GROR GL SURILWWR SUHYLVWR GDOO¶DUW
171 bis. Disparità che ha comportato conseguenze paradossali
QHOO¶RWWLFD GHFLVDPHQWH UHSUHVVLYD H JHQHUDOSUHYHQWLYD del sistema
sanzionatorio approntato nella l.d.a.. Basti pensare che la Suprema
&RUWHKDULWHQXWRQRQLQWHJUDUHLOUHDWRGLFXLDOO¶DUWter, lett. e) ±
proprio per mancanza del fine di lucro ± la diffusione in pubblico, da
parte del gestore di un pub o di altro pubblico locale, di un evento
sportivo trasmesso da una piattaforma a pagamento per la televisione
digitale terrestre o satellitare utilizzando un contratto di tipo domesti-
co, posto che il fine di lucro QRQqUDYYLVDELOHQHOO¶intento di far con-
fluire nel locale un maggiore numero di clienti, almeno se la fruizione
del servizio viene offerta gratuitamente (Cass. Pen., Sez. III, sentenze
2 dicembre 2011, n. 7051, e 24 novembre 2010, n. 45567). È chiaro,
al contrario, che nel comportamento in questione sarebbe stato ravvi-
VDELOHVLFXUDPHQWHLOGRORGLSURILWWRSHUFKpO¶LQWHQWRGLDWWLUDUHFOLHQWL
è certamente legato alla possibilità che questi ultimi, una volta nel lo-
cale, spendano denaro in consumazioni ovvero alla volontà di suscita-
re un maggior apprezzamento del locale da parte degli avventori in
XII. /DWXWHODSHQDOHGHOGLULWWRG¶DXWRUH 233

PRGR FKH YL ULWRUQLQR ,Q HQWUDPEL L FDVL O¶DJHQWH QH ULFDYHUHEEH XQ
vantaggio di carattere patrimoniale, sia pure non immediato ma soltan-
to potenziale.
Il secondo comma GHOO¶DUWter è disposizione di difficile inter-
pretazione: ad una prima lettura sembra contemplare delle mere circo-
stanze aggravanti della fattispecie (rectius delle fattispecie) di cui al
primo comma, ma a ben vedere almeno le lettere a) ed a-bis) indivi-
duano autonome figure di reato. La prima concerne la condotta di chi
abusivamente riproduce, duplica, vende e così via oltre cinquanta co-
SLHRHVHPSODULGLRSHUHWXWHODWHGDOGLULWWRG¶DXWRUHHGDGLULWWLFRQQHs-
si. La seconda colpisce in sostanza chi pratica file sharing con scopo
di lucro.
La linea di demarcazione tra qualificazione costitutiva o circostan-
ziale di una fattispecie ± TXDORUD OD QDWXUD GL TXHVW¶XOWLPD QRQ VLD
espressamente manifestata dal legislatore ± può essere tracciata sulla
base dei criteri opportunamente individuati da Cass. Pen., Sez. Unite,
sent. 26 giugno 2002, n. 26351, la quale ebbe modo di chiarire che la
SUHYLVLRQHGHOO¶DUWbis cod. pen. (norma che sanziona la truffa ag-
gravata per il conseguimento di erogazioni pubbliche) costituisse ef-
fettivamente una circostanza aggravante del delitto di truffa ex art. 640
cod. pen. e non una fattispecie autonoma come era stato sostenuto in
giudizio.
I criteri in questione sono di natura testuale o topografica; di natura
strutturale o di natura teleologica. I primi fanno riferimento ad aspetti
quali il nomen iuris del reato adottato dal legislatore in particolare nel-
la rubrica della disposizione incriminatrice, i termini in cui altre nor-
me fanno riferimento alla fattispecie della cui natura si discorre, la
collocazione sistematica della norma in questione. I secondi implica-
no, invece, la valutazione della struttura del precetto e della sanzione
risultanti dalle norme poste a confronto. Il criterio teleologico, infine,
qLQFHQWUDWRVXOEHQHJLXULGLFRWXWHODWRTXDQGRTXHVW¶Xltimo è diverso
rispetto a quello ad oggetto della norma di riferimento evidentemente
si è in presenza di una autonoma fattispecie di reato. Si aggiunga che i
criteri testuali o topografici hanno valore meramente indiziario; quelli
strutturali hanno sicuramente maggior peso; quello teleologico è il cri-
terio maggiormente utilizzato dalla giurisprudenza di legittimità.
234 Manuale di diritto delle arti e dello spettacolo

Con riferimento, allora, al secondo comma GHOO¶DUW ter, se da


una parte le considerazioni di ordine testuale, topografico e teleologi-
co farebbero propendere per la natura circostanziale di tutte e quattro
OHOHWWHUHLQFOXVHLQHVVRGDOO¶DOWUDSDUWHFRQIURQWDQGRODVWUXWWXUDGHO
secondo comma con la previsione del primo comma, emerge che non
è così. Mentre le lettere b) e c) fanno espresso riferimento ai fatti e al-
le attività di cui al co. 1, richiamando dunque tutti gli elementi costitu-
tivi oggettivi e soggettivi del reato base per poi aggiungere soltanto
particolari modalità di attuazione degli stessi ritenute maggiormente
lesive del profLOR HFRQRPLFR GHO GLULWWR G¶DXWRUH id est la forma im-
prenditoriale ed il ruolo di organizzatore o di promotore del soggetto
agente), le lettere a) ed a-bis) presentano una fattispecie che non è de-
scritta per relationem al primo comma ma è identificata con elementi
materiali e psicologici diversi o comunque non completamente so-
vrapponibili con quelli previsti nelle lettere da a) ad h) del ripetuto
primo comma. Basti sottolineare che alla lett. a) del secondo comma
non è previsto il dolo specifico (fine di lucro) richiesto per tutte le ipo-
tesi di cui al comma primo, mentre la lett. a-bis) ha dovuto espressa-
mente riproporre il dolo di lucro per evitare che la fattispecie ± punita
severamente ± diventasse troppo ampia. Queste diversità strutturali
delle norme sono indice sicuro del loro carattere autonomo e non cir-
costanziale, benché il bene giuridico protetto sia lo stesso e nonostante
ODORURFROORFD]LRQHQHOO¶DPELWRGHOODPHGHVLPDGLVSRVL]LRQHQRUPa-
tiva.
4XHVWDG¶DOWURQGHqODSRVL]LRQHDVVXQWDGDO6XSUHPR Collegio in
alcuni importanti arresti, talvolta ritenendo la natura costitutiva
GHOO¶LQWHURFRPPDsecondo GHOO¶DUWter (Cass. Pen., Sez. III, sen-
tenza 1 ottobre 2003, n. 42190; Cass. Pen., Sez. III, sentenza 3 ottobre
2007, n. 39415), talaltra sostenendo più correttamente che solo la lett.
a) integri una figura autonoma di reato (Cass. Pen., Sez. III, sentenza
12 febbraio 2008, n. 13844). Si permetta di estendere il ragionamento
anche alla lett. a-bis), introdotta nel 2004 per combattere il dilagante
fenomeno del file sharing e che ictu oculi presenta le stesse caratteri-
stiche di autonomia della lett. a).
Questa lunga parentesi sul secondo comma non deve trarre in in-
ganno il lettore non esperto di diritto: non si tratta di elucubrazioni fini
a sé stesse. Si consideri che il giudice, quando ricorrono contestual-
XII. /DWXWHODSHQDOHGHOGLULWWRG¶DXWRUH 235

mente circostanze aggravanti ed attenuanti, è chiamato a decidere, do-


po aver determinato la c.d. pena base, se le une siano prevalenti sulle
altre o se, viceversa, siano da considerarsi equivalenti. Dopodiché, nel
secondo caso nessuna circostanza, in aumento o in diminuzione della
pena base, dovrà essere applicata; nel primo, si applicheranno solo le
circostanze prevalenti (art. 69 cod. pen.). Ciò significa che se la lett. a)
venisse considerata come circostanza, la più grave pena prevista dal
secondo comma GHOO¶DUWter (reclusione da uno a quattro anni più
la multa) potrebbe non trovare applicazione pur di fronte ad un reo che
abbia ad esempio venduto più di cinquanta copie abusive se le atte-
nuanti (magari comuni o generiche, riferibili a qualsivoglia reato, ex
artt. 62 e 62 bis cod. pen.) siano da considerarsi equivalenti o addirit-
tura prevalenti. Viceversa, se si ritiene che la lett. a) sia fattispecie au-
tonoma, nel caso appena descritto si dovrà determinare innanzitutto la
pena base nel range indicato dal secondo comma e poi applicare, se
del caso, le circostanze.
3HUFRQFOXGHUHLOGLVFRUVRVXOOHGLVSRVL]LRQLGHOO¶DUW ter l.d.a.
si segnala che il terzo comma SUHYHGH O¶DWWHQXDQWH GHOOD SDUticolare
tenuità del fatto ± OD TXDOH SHUDOWUR SXz FRQFRUUHUH FRQ O¶DWWHQXDQWH
comune del danno di particolare tenuità ex art. 62, n. 4, cod. pen. qua-
lora ricorrano simultaneamente la condizione del perseguimento (o del
FRQVHJXLPHQWR GDSDUWHGHOO¶autore del reato, di un lucro di speciale
tenuità e quella della produzione, a detrimento della persona offesa, di
un evento dannoso o di una situazione di pericolo di speciale tenuità,
laddove la valutazione in ordine al presupposto della speciale tenuità
spetta al giudice del merito ed è censurabile in sede di legittimità solo
per mancanza o manifesta illogicità della motivazione (Cass. Pen.,
Sez. III, sentenza 12 ottobre 2011, n. 2685) ± mentre il quarto comma
enumera tre pene accessorie conseguenti alla condanna per uno dei
reati previsti dal comma primo.
Occorre, a questo punto, affrontare il problema del raccordo delle
SUHYLVLRQLGHOO¶DUW ter l.d.a. con altre norme incriminatrici, quali
O¶DUWocties GHOODVWHVVDOHJJHHO¶DUWFRGSHQ
/¶DUW. 171 octies sembra sovrapporsi alle lett. H HGI GHOO¶DUW
ter primo comma, ai limiti del concorso apparente di norme, dal mo-
mento che esso punisce, se il fatto non costituisce più grave reato,
chiunque a fini fraudolenti produce, importa, commercia, installa, uti-
236 Manuale di diritto delle arti e dello spettacolo

lizza per uso pubblico e privato apparati atti alla decodificazione di


trasmissioni audiovisive ad accesso condizionato.
Sennonché da un confronto più attento delle due disposizioni si
HYLQFHFKHD ODIDWWLVSHFLHGLFXLDOO¶DUW octies è più grave ± la
pena comminata è della reclusione da sei mesi a tre anni e della multa
da euro 2.582 a euro 25.822 ± quindi non scatta la clausola di esclu-
sione del reato de quo E  O¶DUW  ter fa riferimento a trasmissioni
criptate per le quali è preYLVWRXQFDQRQHG¶DFFHVVRPHQWUHO¶DUW
octies a segnali audiovisivi visibili esclusivamente da gruppi chiusi di
utenti selezionati dal soggetto emittente indipendentemente dalla im-
posizione di un canone; c) il dolo richiesto è diverso: fine di lucro in
XQFDVRILQHIUDXGROHQWRQHOO¶DOWUR

12.4.1. Art. 171 ter l.d.a. ed art. 648 cod. pen.: concorso di reati

/¶DOWUDTXHVWLRQHLPSRUWDQWHULJXDUGDODSRVVLELOLWjGLXQFRQFRUVRGL
UHDWL WUD LO GHOLWWR GL ULFHWWD]LRQH SUHYLVWR H SXQLWR GDOO¶DUW  FRG
pen. e il delitto di commercio abusivo di prodotti audiovisivi illecita-
mente riprodotti ex art. 171 ter (in particolare lettere c) e d)). In altre
parole si tratta di capire se la condotta di chi acquista o riceve supporti
illecitamente duplicati o comunque non conformi alle norme che di-
VFLSOLQDQRLOGLULWWRG¶DXWRUHHOLGHWLHQHSHUODYHQGLWDOLGLVWULEXLVFH
li mette in commercio, li cede in noleggio o a qualsiasi altro titolo, in-
WHJUDVRORLOUHDWRSUHYLVWRGDOO¶DUWter oppure anche il reato di ri-
cettazione.
Ebbene, il problema ha impegnato la giurisprudenza di legittimità
con esiti spesso contraddittori al punto che sono dovute intervenire le
Sezioni Unite per risolvere il contrasto (Cass. Pen., Sez. Unite,
sent.enza 20 dicembre 2005, n. 47164).
Il punto nodale è rappresentato dalla esatta individuazione
GHOO¶DPELWRDSSOLFDWLYRGLXQDWHU]DQRUPDO¶DUW ter l.d.a., intro-
dotto dalla l. 248/2000 e modificato dal d.lgs. n. 68/2003. Norma de-
stinata a reprimere con sanzione meno grave anche il momento finale
del fenomeno della pirateria, ossia quello in cui il privato ottiene la
copia illecita di opere audiovisive, informatiche o multimediali.
Essa, infatti, prevedeva ± e prevede tuttora ± un illecito ammini-
straWLYRDYHQWHDGRJJHWWRWUDO¶DOWURla condotta di chi «acquista o no-
XII. /DWXWHODSHQDOHGHOGLULWWRG¶DXWRUH 237

leggia» supporti audiovisivi, fonografici, informatici o multimediali


QRQ FRQIRUPL DOOH SUHVFUL]LRQL GHOOD OHJJH VXO GLULWWR G¶DXWRUH VHQ]D
ULSRUWDUHO¶LQFLVR³SHUXVRSHUVRQDOH´HFRQXQDFODXVRODGLULVHUYDFKH
nella veUVLRQHRULJLQDULDHVFOXGHYDO¶DSSOLFD]LRQHGHOO¶DUW ter se
il fatto costituiva concorso nei reati di cui agli artt. da 171 a 171 oc-
ties'¶DOWUDSDUWHO¶DUWter SUHYHGHYDJLjLOUHTXLVLWRGHOO¶XVRQRQ
personale e ciò era sufficiente, secondo il legislatore, per distinguere
la posizione di chi, per uso non personale e a fini di lucro, ponesse in
HVVHUHOHFRQGRWWHGHVFULWWHGDOO¶DUWter da quella del privato che,
fuori dai casi di concorso nei reati sopra indicati, acquistasse o pren-
desse in noleggio supporti non conformi alle disposizioni della l.d.a..
7XWWDYLD SURSULR OD PDQFDQ]D QHOO¶DUW  ter, del riferimento
DOO¶XVRSHUVRQDOHHODSUHVHQ]DGLXQDFODXVRODGLULVHUYDFKHDOOXGHYD
ad un concorso nei reati ± vale a dire alla figura del concorso di perso-
ne nel reato ± DYHYDSRUWDWRO¶RULHQWDPHQWRPDJJLRULWDULRDQFKHJLXUi-
sprudenziale, a ritenere che questa norma si applicasse anche al caso
LQFXLO¶DFTXLVWRRULFH]LRQHGHLVXSSRUWLLOOHFLWLIRVVHDWWLYLWjSURGUo-
mica alla successiva messa in commercio, fermo restando che accanto
alla sanzione amministrativa doveva applicarsi anche la sanzione pe-
QDOH SUHYLVWD GDOO¶DUW  ter nel momento in cui i supporti fossero
stati effettivamente venduti, distribuiti, messi in commercio.
Infatti, posto FKHODOHWWHUDGHOO¶DUWter non limita la sua appli-
FD]LRQHDLFDVLGLXVRSHUVRQDOHHFKHDQFKHO¶DUWFRGSHQSUe-
VHQWDXQDFODXVRODGLULVHUYDFKHQHHVFOXGHO¶DSSOLFD]LRQHQHLFDVLGL
FRQFRUVR QHO UHDWR SUHVXSSRVWR QHOO¶LSRWHVL LQ FXL O¶DFTXLrente dei
supporti illeciti ± con acquisto finalizzato alla messa in commercio dei
medesimi ± QRQ DYHVVH FRQFRUVR QHO UHDWR GL FXL DOO¶DUW  ter, si
UHQGHYDQRDSSOLFDELOLVLDO¶DUW ter l.d.a. (illecito amministrativo)
VLDO¶DUWFRGSHQ GHOLtto di ricettazione). Di conseguenza doveva
comminarsi la sola sanzione amministrativa in virtù del principio di
VSHFLDOLWjVDQFLWRGDOO¶DUWGHOODOQ©4XDQGRXQRVWHVVR
fatto è punito da una disposizione penale e da una disposizione che
prevede una sanzione amministrativa, ovvero da una pluralità di di-
sposizioni che prevedono sanzioni amministrative, si applica la dispo-
VL]LRQHVSHFLDOHª1RQF¶qGXEELRLQYHURFKHO¶DUWter sia norma
speciale, essendo inserito nella l. n. 633/1941 specificamente rivolta
DOODWXWHODGHOGLULWWRG¶DXWRUH
238 Manuale di diritto delle arti e dello spettacolo

Il d.lgs. n. 68/2003, come si diceva, ha inciso sul tenore letterale


GHOO¶DUWterPRGLILFDQGRWUDO¶DOWURODFODXVRODGLULVHUYDLOWHVWR
attuale esclude la sanzione amministrativa se il fatto concorra con i
reati di cui agli artt. da 171 a 171 octies, alludendo non più alla figura
del concorso di persone nel reato, ma a quella del concorso (formale o
materiale) di reati. Una minuzia che però ha mutato il quadro normati-
YR GHVFULWWR SULPD /¶DPELWR GHOO¶LOOHFLWR DPPLQLVWUDWLYR VL q ULGRWWR
SHUFKp OH FRQGL]LRQL GL DSSOLFD]LRQH GHOO¶DUW  ter sono diventate
due: il non aver concorso ± per ciò che qui interessa ± nel reato di cui
DOO¶DUWter e il non aver posto in essere una condotta che possa in-
WHJUDUH XQ DOWUR UHDWR LQ JUDGR GL FRQFRUUHUH FRQ TXHOOR GHOO¶DUW 
ter3HUWDQWRSRLFKpO¶DFTXLVWRRODULFH]LRQHGLVXSSRUWLLOOHFLWDPHQWH
duplicati finalizzato alla messa in commercio degli stessi integra cer-
tamente il delitto di ricettazione ± che va a concorre col reato ex art.
171 ter nel momento in cui i supporti vengano effettivamente venduti,
distribuiti, concessi in noleggio ± WURYHUjDSSOLFD]LRQHDQFKHO¶DUW
FRGSHQUHVWDQGRO¶DUWter confinato alle ipotesi di acquisto per
uso personale.
In conclusione è ammissibile un concorso di reati tra il delitto di ri-
FHWWD]LRQHHTXHOORSXQLWRGDOO¶DUW ter l.d.a., salvo che si tratti di
FRQGRWWHUHDOL]]DWHQHOODYLJHQ]DGHOODOQHILQRDOO¶HQWUDWD
in vigore del d.lgs. n. 68/2003. Se commesso in questo periodo,
O¶DFTXLVWR H ULFH]LRQH GL VXSSRUWL LOOHFLWL ILQDOL]]DWD DO VXFFHVVLYR
FRPPHUFLRULFDGHVRWWRODSUHYLVLRQHGHOO¶DUW ter e costituisce il-
OHFLWR DPPLQLVWUDWLYR &RQ LO GOJV Q  O¶DUW  ter diventa
applicabile esclusivamente alle condotte di acquisto e ricezione poste
in essere per uso personale.

12.5. DRM e trasmissioni audiovisive ad accesso condizionato

Oltre alle fattispecie fondamentali trattate fino a questo punto, la l.


248/2000 contiene anche altre norme incriminatrici che completano il
quadro repressivo e sanzionatorio.
/¶DUWquater SXQLVFHDWLWRORGLFRQWUDYYHQ]LRQH FRQO¶DUUHVWR
ILQRDGXQDQQRRFRQO¶DPPHQGDGDOLUHXQPLOLRQHDOLUHGLHFLPLOLo-
ni) chiunque «concede in noleggio o comunque concede in uso a qua-
XII. /DWXWHODSHQDOHGHOGLULWWRG¶DXWRUH 239

lunque titolo, originali, copie o supporti lecitamente ottenuti di opere


WXWHODWHGDOGLULWWRG¶DXWRUHª/DQRUPDSHUzULFKLHGHDQFKHLQTXHVWR
caso il fine di lucro e non si riferisce, quindi, al comportamento di chi,
ad esempLRFHGDLQYLDDPLFDOHDGDOWULODFRSLDGLXQ¶RSHUDRWWHQXWDD
partire da un supporto da lui lecitamente acquistato. Tale condotta è
piuttosto sanzionata sul piano amministrativo dagli artt. 174 bis e 174
ter.
La questione delle copie ottenute da supporti lecitamente acquistati
offre lo spunto per affrontare un altro delicato problema: quello dei
cc.dd. DRM (Digital Rights Management), ossia le misure tecnologi-
che di protezione, di natura hardware o software, che i titolari di dirit-
WLG¶DXWRUHHGLGLULWti connessi possono apporre sulle opere, come pre-
YLVWRGDOO¶DUWquater l.d.a., per impedire o rendere più difficile il
FRPSLPHQWRGL³DWWLQRQDXWRUL]]DWL´HFLRqLQEXRQDVRVWDQ]DODFo-
SLDRODULWUDVPLVVLRQHGHOO¶RSHUD0LVXUHRJJLJHQHUDOPHQWHXWilizzate
per proteggere opere audiovisive, videogiochi (equiparati più volte
dalla giurisprudenza alle opere audiovisive) e programmi per elabora-
tore.
Ebbene, si è detto in precedenza che qualunque attività diretta alla
violazione di tali misure di protezione costituisce reato ai sensi degli
artt. 171 bis e 171 ter l.d.a. se accompagnata, rispettivamente, dal fine
di profitto o di lucro. Laddove, però, il fine di profitto o di lucro man-
chi ed il legittimo acquirente voglia costituirsi una c.d. «copia di sicu-
UH]]DªGHOO¶RSHUDDFTXLVWDWDL'50VLSRQJRQRLQHYLGHQWHFRQIOLWWR
con quello che dovrebbe essere un vero e proprio diritto
GHOO¶DFTXLUHQWH/DOGDFRQVHQWHLQIDWWLODFRSLDSHUXVRSHUVRQDOHR
privato, sia pure a certe condizioni. Premesso che i concetti di uso per-
sonale e privato ± oggetto di ampio dibattito dottrinale ± sembrano
doversi ritenere sostanzialmente equivalenti e significanti una utiliz-
zazione non necessariamente individuale ma piuttosto estesa
DOO¶DPELWR IDPLOLDUH VRFLDOH H SURIHVVLonale (ad esempio legato
DOO¶DWWLYLWjGHOORVWXGLRHDLFROODERUDWRULSLULVWUHWWL O¶DUWGHOODO
n. 633/1941, relativo alle fotocopie di opere letterarie, pone dei limiti
TXDQWLWDWLYL DOOD ULSURGX]LRQH SHU XVR SHUVRQDOH QRQFKp O¶REEOLJR GL
corresponsione di un equo compenso agli autori ed agli editori, così
come gli artt. 71 da sexies a octies HVWHQGRQRLOPHFFDQLVPRGHOO¶HTXR
compenso agli apparecchi ed ai supporti idonei alla registrazione o al-
240 Manuale di diritto delle arti e dello spettacolo

la copia analogica o digitale di opere audiovisive. Equo compenso che


UDSSUHVHQWD VHFRQGR O¶LPSRVWD]LRQH SLHTXLOLEUDWD XQD VRUWD GL ©Oi-
cenza» per la copia personale, la quale se da una parte determina un
PDQFDWRJXDGDJQRDOWLWRODUHGHLGLULWWLG¶DXWRUHGDOO¶DOWUDqFRQVHQWLWD
proprio perché non caratterizzata da finalità commerciali.
6HQQRQFKpO¶DUWsexies prescrive al primo comma di rispettare
FRPXQTXHOH PLVXUH WHFQRORJLFKH GLFXLDOO¶DUW  quater (i DRM)
mentre al quarto comma prevede che i titolari dei diritti sono tenuti a
consentire, nonosWDQWH O¶DSSOLFD]LRQH GL PLVXUH GL SURWH]LRQH FKH LO
OHJLWWLPRSRVVHVVRUHGLXQHVHPSODUHGHOO¶RSHUDSRVVDHIIHWWXDUQHXQD
copia privata senza arrecare ai primi un ingiustificato pregiudizio.
Ê QRWR FKH TXHVW¶XOWLPD SUHYLVLRQH VSHVVR QRQ YLHQH ULVSHWWDWD si
pensi alle consolle FKHQRQIDQQR³JLUDUH´, come si è soliti dire in ger-
go tecnico, YLGHRJLRFKLFRSLDWLGDOO¶RULJLQDOHRDLdecoder che magari
consentono di registrare una trasmissione ma che impediscono di vi-
sionare la registrazione attraverso un altro apparecchio. In buona so-
staQ]D DOORUD O¶DFTXLUHQWH GL XQ¶opera avrebbe diritto ad effettuare
una copia di sicurezza per uso personale; spesso i titolari dei diritti
JOLHOR LPSHGLVFRQR DSSHOODQGRVL DOOD FODXVROD GHO ³FRQWUDVWR FRQ OR
sfruttamento normalHGHOO¶RSHUD´ SXUHSUHYLVWDGDOO¶DUWsexies l.d.a.
e corrispondente alla nozione, molto discussa nel diritto anglosassone,
del c.d. fair useVHO¶XWHQWHLQTXHVWLFDVLSRQHLQHVVHUHDWWLYLWjYROWH
ad eludere i DRM commette un illecito, sebbene il suo intento sia sol-
tanto quello di ottenere un backup! Beninteso, non un illecito penale,
il quale presuppone il fine di profitto o di lucro, ma comunque un ille-
cito amministrativo ex art. 174 ter l.d.a..
Si comprende, allora, quanto sia contraddittoria, o quantomeno far-
raginosa, la normativa in tema di DRM e di copia ad uso personale e
perché a fronte di una giurisprudenza che tende ad applicare in modo
ULJRURVRO¶DUWter, lett. f-bis), nei confronti di chi fabbrica, impor-
ta, vende e così via prodotti idonei ad eludere le misure tecnologiche
GLFXLDOO¶DUWquater e le sanzioni amministrative nei confronti di
chi usa tali prodotti, la dottrina faccia notare che i sistemi in questione
QRQ SRWUHEEHUR ULWHQHUVL LQ TXDQWR WDOL UHDOL]]DWL FRQ OD ³SUHYDlente
ILQDOLWj´GLHOXVLRQHGHLPHFFDQLVPLGLSURWH]LRQHULFKLHVWDGDOODQRr-
ma penale: senza un c.d. modchip, ad esempio, non è possibile utiliz-
zare una copia privata masterizzata di un videogioco lecitamente ac-
XII. /DWXWHODSHQDOHGHOGLULWWRG¶DXWRUH 241

quistato, oppure un c.d. kit sharer potrebbe essere utilizzato non per
distribuire a terzi programmi satellitari ad accesso condizionato a par-
tire da un unico decoder con annessa smart card lecitamente acquista-
WD EHQVu SHU FRQVHQWLUQH OD IUXL]LRQH VX SL WHOHYLVRUL DOO¶LQWHUQR
GHOO¶DELWD]LRQHGHOOegittimo acquirente. Tuttavia, è pur vero che il più
delle volte sarebbe probatio diabolica sia quella a carico degli organi
inquirenti e relativa alla concreta dimostrazione in positivo della pre-
valente finalità di elusione, sia quella eventualmente posta a carico del
SURGXWWRUHYHQGLWRUHLPSRUWDWRUHRSSXUHDFDULFRGHOO¶XWHQWHILQDOHH
FRQFHUQHQWH LQ QHJDWLYR O¶XVR OHFLWR GL VWUXPHQWL GHO JHQHUH 6HQ]D
FRQWDUHFKHDULJRUHDQFKHLQPDWHULDGLLOOHFLWLDPPLQLVWUDWLYLO¶onus
probandi ULFDGHVXOO¶RUJDQR FKHDFFHUWDO¶LOOHFLWRFRVuFRPHQHOSUo-
FHVVRSHQDOHULFDGHVXOSXEEOLFRPLQLVWHURFKHHVHUFLWDO¶D]LRQHSHQa-
le. Ciò deriva dalla adozione da parte della l. 689 del 1981 del c.d.
modello penale anche con riferimento alle sanzioni amministrative pe-
cuniarie, sebbene la giurisprudenza abbia talvolta ammesso
XQ¶LQYHUVLRQH GHOO¶RQHUH GHOOD SURYD QHO VHQVR FKH VSHWWL DOO¶DXWRUH
GHOO¶LOOHFLWRGLPRVWUDUHGLDYHUDJLWRLQFROSHYROPHQWH
Si aggiunga, come osservato anche da Cass. Pen., Sez. III, sentenza
25 maggio 2007, n. 33768, che il tema dei diritti digitali implica anche
seri «rischi di posizione dominante o di compressione della concor-
UHQ]DGHULYDQWLGDOO¶REEOLJRGLDFTXLVWDUHXQLFDPHQWHVSHFLILFLDSSDUa-
ti (dal costo rilevante) che viene imposto al consumatore che intenda
XWLOL]]DUHXQ¶RSHUDGHOO¶LQJHJQRFRQWHQXWDLQXQVXSSRUWRFKHQHFHVVi-
ta di quel tipo di apparato per poter essere fruita e consumata». Vi è
LQVRPPDXQDLPSRUWDQWHOLPLWD]LRQHGHLGLULWWLQRQVRORGHOO¶LQGLYLGXR
ma anche del consumatore.
Diverso dalla condotta lesiva di misure tecnologiche di protezione
qLOFRPSRUWDPHQWRGLFKLXWLOL]]LSHUXVRSULYDWR³DSSDUDWLRSDUWLGL
apparati atti alla decodificazione di trasmissioni audiovisive ad acces-
so condizionato effettuate via etere, via satellite, via cavo, in forma sia
DQDORJLFDFKHGLJLWDOH´1RQDFDVRO¶DUW octies l.d.a. prevede al
riguardo un autonomo delitto operante qualora il fatto non costituisca
più grave reato e punito severamente con la reclusione da sei mesi a
tre anni e con la multa da euro 2.582 a euro 25.822.
Accanto alle solite condotte di produzione, messa in vendita, im-
portazione, installazione di apparati del genere (si pensi al caso classi-
242 Manuale di diritto delle arti e dello spettacolo

co della smart card clonata) la norma incrimina espressamente anche


il loro uso privato FRQO¶XQLFRUHTXLVLWRFRPXQHDWXWWHOHLSRWHVLGHO
fine fraudolento. È evidente che il fine fraudolento è ben più ampio di
quello di lucro e di profitto e tale da includere qualunque impiego di
strumenti di decodificazione non ufficiali. La ratio di una norma così
severa è quella di creare un forte deterrente alla dilagante fruizione
abusiva delle trasmissioni radiotelevisive ad accesso condizionato ± di
solito a pagamento ± tutelando, così, non solo i diritti delle emittenti
ma indirettamente anche i diritti prettamente economici degli autori,
SURGXWWRULHLQWHUSUHWLLFXLSURYHQWLFROOHJDWLDOO¶XWLOL]]RGLORURRSHUH
o contributi inseriti nei palinsesti, sono di regola parametrati alla red-
ditività realizzata dalle emittenti.
Il legislatore, però, incorre talvolta in delle vere e proprie sviste e
ciò è accaduto anche in subiecta materia. Il d.lgs. 373 del 2000 (attua-
tivo della direttiva 98/84/CE, del 20 novembre 1998, in tema di tutela
dei servizi ad accesso condizionato) aveva previsto, a breve distanza
GDOO¶HQWUDWD LQYLJRUHGHOODOO¶irrogazione di una sanzione
amministrativa (art. 6) a carico di chiunque (art. 4) ponesse in essere
una delle seguenti attività: a) la fabbricazione, l'importazione, la di-
stribuzione, la vendita, il noleggio ovvero il possesso a fini commer-
FLDOLGLGLVSRVLWLYLLOOHFLWLGLGHFRGLILFD]LRQHE O¶LQVWDOOD]LRQHODPa-
nutenzione o la sostituzione a fini commerciali dei predetti dispositivi;
c) la diffusione con ogni mezzo di comunicazioni commerciali per
promuovere ODGLVWULEX]LRQHHO¶XVRGHJOLVWHVVLGLVSRVLWLYL
/D GLVSRVL]LRQH RFFXSDQGRVL GHOO¶DVSHWWR FRPPHUFLDOH GHO IHQo-
PHQR DYHYD FRPSOHWDPHQWH LJQRUDWR O¶DVSHWWR GHOO¶XWLOL]]R GHJOL
strumenti di decodificazione, di guisa che i più gravi comportamenti
relativi alla commercializzazione dei dispositivi illeciti ± sovrapponi-
bili a quelli previsti dalla norma penale ± venivano puniti con sanzio-
ne amministrativa (in virtù del principio di specialità ex art. 9 della l.
n. 689/1981) mentre la condotta di utilizzazione per uso privato di ap-
parati o parti di apparati atti alla decodificazione di trasmissioni au-
diovisive ad accesso condizionato, non assimilabile ad alcuna tra quel-
le amministrativamente sanzionate, continuava ad essere penalmente
VDQ]LRQDWDDLVHQVLGHOO¶Drt. 171 octies.
Questa situazione di distonia del sistema è stata poi eliminata dalla
legge n. 22 del 2003, la quale ha previsto che ai comportamenti illeciti
XII. /DWXWHODSHQDOHGHOGLULWWRG¶DXWRUH 243

GLFXLDOO¶DUWGHOd.lgs. n. 373 del 2000 «si applicano altresì le san-


zioni penali e le altre misure accessorie previste per le attività illecite
di cui agli articoli 171-bis e 171-octies della legge 22 aprile 1941, n.
633, e successive modificazioni». In altre parole, il legislatore, avve-
GXWRVLGHOO¶HUURUHFRPPHVVRLQSUHFHGHQ]DKDIDWWRVuFKHOe condotte
più gravi venissero punite con sanzione amministrativa e con sanzione
penale, laddove il mero utilizzo privato di dispositivi illeciti restava
DVVRJJHWWDWRDOODVRODSHQDSUHYLVWDGDOO¶DUWocties.
È di palmare evidenza, allora, che la situazione protrattasi dalla en-
trata in vigore del d.lgs. n. 373/2000 fino alla entrata in vigore della l.
QFRQWUDGGLFHYDLFDQRQLGLUDJLRQHYROH]]DLPSRVWLGDOO¶DUW
della Costituzione. Ecco perché la Corte costituzionale, investita in via
incidentale della questione, ha dichiarato con la sentenza n. 426/2004
± appartenente alla categoria delle sentenze cc.dd. sostitutive ±
O¶LOOHJLWWLPLWjFRVWLWX]LRQDOHGHOO¶DUWocties l.d.a. nella parte in cui
puniva con sanzione penale, anziché con la sanzione amministrativa
SUHYLVWDGDOO¶DUWGHOd.lgs. QRYHPEUHQO¶XWLOL]]D]LRQH
per uso privato di apparati o parti di apparati atti alla decodificazione
di trasmissioni audiovisive ad accesso condizionato effettuate via ete-
re, via satellite, via cavo, in forma sia analogica sia digitale. Declara-
toria di illegittimità temporalmente estesa dalla stessa Corte al periodo
FRPSUHVRWUDO¶HQWUDWDLQYLJRUHGHOO¶DUWocties HO¶HQWUDWDLQYLJo-
UHGHOODOQ,QIDWWLO¶DUWGHOGOJV del 2000 ± di fatto
rapportato dalla Corte anche alle condotte di uso privato ± doveva ri-
WHQHUVLQRUPDSLIDYRUHYROHDSSOLFDELOHDLVHQVLGHOO¶DUWFRGSHQ
anche ai fatti commessi prima della sua entrata in vigore, inclusi quelli
di uso privato. ViceYHUVDFRQO¶HQWUDWDLQYLJRUHGHOODOQ H
quindi in relazione ai fatti commessi da questo momento in poi), ve-
nendo meno la irragionevole disparità di trattamento, la sanzione pe-
QDOH SUHYLVWD GDOO¶DUW  octies è tornata a spiegare efficacia sia ri-
spetto alle condotte di fabbricazione, vendita, importazione, installa-
zione e così via di dispositivi illeciti di decodificazione sia rispetto a
quelle di uso privato dei medesimi.
244 Manuale di diritto delle arti e dello spettacolo

12.6. Il file sharing

Il web, come è noto, costituisce una delle più gravi minacce al diritto
G¶DXWRUHHDLGLULWWLFRQQHVVLVRSUDWWXWWRVRWWRLOSURILORHFRQRPLFRGDO
momento che Internet nasce proprio con la finalità di scambiare in-
formazioni gratuitamente tra gli utenti in maniera pressoché istanta-
nea. Indipendentemente dalle posizioni di principio secondo le quali la
cultura dovrebbe essere libera ed accessibile a tutti, le quali vedono
nella Rete il mezzo che finalmente consente di liberalizzare la fruizio-
ne dei più vari contenuti ± posizioni tendenzialmente estranee, non a
caso, al mondo del diritto ± il giurista non può non prendere atto della
costante aggressione perpetrata in particolare attraverso i sistemi di fi-
le sharing DO GLULWWR VRJJHWWLYR GL VIUXWWDPHQWR HFRQRPLFR GHOO¶RSHUD
GHOO¶LQJHJQRGDSDUWHGHOVXR DXWRUH'¶DOWUDSDUWHRJJLSLFKHPDL
QRQVLSXzSUHWHQGHUHFKHXQLQGLYLGXRGHGLFKLODSURSULDYLWDDOO¶DUWH
senza averne un ritorno economico e lo stesso vale per gli editori o i
produttori, i quali se da un lato tentano di massimizzare i loro profitti
± peraltro in maniera del tutto legittima in una logica di impresa ±
GDOO¶DOWURODWRVRQRFKLDPDWLVSHVVRDHIIHWWXDUHQRWHYROLLQYHVWLPHQWL
come accade ad esempio nel mondo del cinema, quantomeno in rela-
zione ad un certo tipo di produzioni cinematografiche.
)LQRDOPDU]RQRQHUDQRSUHYLVWHQHOO¶RUGLQDPHQWRLWDOLDQR
VDQ]LRQLSHQDOLSHUODFRQGLYLVLRQHGLRSHUHWXWHODWHGDOGLULWWRG¶DXWRUH
qualora non vi fosse scopo di lucro. Il c.d. decreto Urbani (d.l. 22
marzo 2004, n. 72, convertito in l. 21 maggio 2004, n. 128) sostituì la
ILQDOLWjGLOXFURSUHYLVWDGDOO¶DUWter l.d.a. con la più ampia finalità
di profitto e introdusse, al secondo comma GHOO¶DUWter, la nuova
disposizione della lett. a-bis) con la quale si puniva con la reclusione
da uno a quattro anni e con la multa chiunque «in violazione
GHOO¶DUWLFRORSHUWUDUQHSURILWWR>FRPXQLFDVVH@DOSXEEOLFRLPPHt-
tendola in un sistema di reti telematiche, mediante connessioni di
TXDOVLDVLJHQHUHXQ¶RSHUDGHOO¶LQJHJQRSURWHWWDGDOGLULWWRG¶DXWRUHR
parte di essa».
$OO¶LQGRPDQLGHOGHFUHWR8UEDQLDOFXQLGHLSULPLFRPPHQWDWRULUi-
tennero che le modifiche normative fossero tali da far ricadere sotto la
scure della sanzione penale anche le condotte di quanti facessero un
uso esclusivamente personale di sistemi di file sharing, essenzialmen-
XII. /DWXWHODSHQDOHGHOGLULWWRG¶DXWRUH 245

te perché il fine di profitto poteva ricomprendere anche il risparmio di


spesa derivante dal download GL XQ¶RSHUD H SRL SHUFKpFKL VFDULFDYD
opere protette attraverso reti peer to peer (il c.d. p2p) inevitabilmente
condivideva tutti i file già scaricati in precedenza. È noto, infatti, che
la maggior parte dei programmi p2p si basano sulla condivisione au-
tomatica dei files già scaricati o in corso di download durante la fase
di scaricamento.
Tuttavia questo oULHQWDPHQWR HUPHQHXWLFR GLPHQWLFDYD FKH O¶DUW
171 ter OGDULFKLHGHLQDSHUWXUDO¶uso non personale  il quale va ri-
ferito anche alle ipotesi contemplate dal secondo comma GHOO¶DUW
ter, benché costituiscano fattispecie autonome di reato (Cass. Pen.,
Sez. III, sentenza 25 gennaio 2007, n. 7309) ± e che il dolo di profitto
era collegato non al download di opere protette ma alla loro immissio-
ne in un sistema di reti telematiche.
Comunque sia, la sostituzione del dolo di lucro con quello di profit-
to aveYD UHVR OH IDWWLVSHFLH WURSSR DPSLH H FRVu O¶DQQR VHJXHQWH IX
emanato il d.l. 31 gennaio 2005, n. 7, convertito in l. 31 marzo 2005,
n. 43, il quale ripristinò lo status quo ante in materia di elemento psi-
cologico con riferimento sia alla previsione della lett. a-bis) del se-
condo comma, sia a quella del primo comma GHOO¶DUW  ter. Però,
tale decreto inserì anche la lett. a-bis  GHOO¶DUW  OGD VHFRQGR OD
quale è punito solo con la multa (da euro 51 ad euro 2.065) chiunque,
senza averne diritto ed a qualsiasi scopo e in qualsiasi forma «mette a
disposizione del pubblico, immettendola in un sistema di reti telemati-
FKHPHGLDQWHFRQQHVVLRQLGLTXDOVLDVLJHQHUHXQ¶RSHUDGHOO¶LQJHJQR
protetta, o parte di essa».
Dunque, poiché la normativa dal 2005 ad oggi non è cambiata, si
può concludere dicendo che in buona sostanza scaricare per fini per-
VRQDOLRSHUHGHOO¶LQJHJQRSURWHWWHGDOGLULWWRG¶DXWRUHVHQ]DFRQWHVWXa-
le condivisione di file costituisce illecito amministrativo punibile, ai
sensi degli artt. 174 bis e ter l.d.a., con sanzione pecuniaria pari ad eu-
UR  SL LO GRSSLR GHO SUH]]R GL PHUFDWR GHOO¶RSHUD LQPLVXUD Fo-
munque non inferiore a euro 103, per ogni esemplare abusivamente
ottenuto. Scaricare per fini personali opere protette attraverso sistemi
che impongono la contestuale condivisione di file già scaricati o in
corso di download (vale a dire la totalità delle reti p2p), così come la
246 Manuale di diritto delle arti e dello spettacolo

sola immissione in rete delle medesime effettuata senza scopo di lu-


FUR LQWHJUD LO GHOLWWR SUHYLVWR H SXQLWR GDOO¶art. 171, primo comma,
lett. a-bis) con la sola multa, alla quale va comunque aggiunta la san-
zione pecuniaria amministrativa ex art. 174 bis /¶XWLOL]]R GL SUo-
grammi di file sharing (di qualunque tipo) a fine di lucro integra, in-
vece, il delitto di cui all¶DUW ter secondo comma, lett. a-bis) che
prevede la reclusione da uno a quattro anni e la multa da euro 2.582 a
euro 15.493, oltre la solita sanzione amministrativa per ogni violazio-
ne e per ogni esemplare abusivamente duplicato o riprodotto.
InoltreQHOO¶LSRWHVLGLXVRGRPHVWLFR di software di condivisione ±
TXDQGR VL ULFDGH FLRq QHOOD SUHYLVLRQH GHOO¶DUW , primo comma,
lett a-bis) ± il soggetto attivo del delitto, con evidente intento deflatti-
vo dei procedimenti penali, è ammesso a quella che è in sostanza una
IRUPDGLREOD]LRQHEHQFKpSHUUHJRODJHQHUDOHO¶REOD]LRQHVLDFDXVD
di estinzione soltanto dei reati contravvenzionali (artt. 162 e 162 bis
cod. pen.), è previsto al secondo comma GHOO¶DUWFKHLOUHRSRVVD
SDJDUH SULPD GHOO¶DSHUWXUa del dibattimento ovvero prima
GHOO¶HPLVVLRQH GHO GHFUHWR SHQDOH GL FRQGDQQD XQD VRPPD SDUL DOOD
metà del massimo della pena prevista dal primo comma e tale paga-
mento estingue il reato. Si fa notare al lettore non giurista che la diffe-
renza tra delitti e contravvenzioni si fonda essenzialmente sul tipo di
SHQHFRPPLQDELOLLGHOLWWLVRQRSXQLWLFRQO¶HUJDVWRORODUHFOXVLRQHH
OD PXOWD OH FRQWUDYYHQ]LRQL FRQ O¶DUUHVWR H O¶DPPHQGD 3HUWDQWR LO
UHDWRSUHYLVWRGDOO¶DUWqXQGHOLWWR

12.7. Conclusioni

/¶DQDOLVL FRQGRWWD QHL SDUDJUDIL SUHFHGHQWL EHQ OXQJL GDOO¶DVVXPHUH


carattere di completezza, è sufficiente ad evidenziare ± almeno ad av-
viso di chi scrive ± quanto il sistema di tutela penale del diritto
G¶DXWRUHWHQGDDGHVVHUHFRPSOLFDWRSLXWWRVWRFhe complesso, laddove,
VH OD FRPSOHVVLWj q WDOYROWD QHFHVVDULD LQ IXQ]LRQH GHOO¶HIILFLHQ]D OD
FRPSOLFDWH]]DVLWUDGXFHLQXQGHWULPHQWRGLTXHVW¶XOWLPD(VVRUHQGH
punibili numerose condotte fra loro distinte ma sovente in parte so-
vrapponibili, al fine non necessariamente condivisibile di assicurare la
più ampia ed articolata tutela penale, ai limiti di quella che parte della
XII. /DWXWHODSHQDOHGHOGLULWWRG¶DXWRUH 247

dottrina anglosassone definisce overcriminalization, vale a dire una


sovrabbondanza di fattispecie penali, peraltro scarsamente coordinate
tra loro e con la normativa extrapenale. Piuttosto potrebbero essere
privilegiati strumenti di natura civilistica di risoluzione di conflitti tra
privati, relegando la sanzione penale ai fatti caratterizzati da maggiore
disvalore sociale con conseguente esclusione della stessa per ogni
IRUPDGLYLROD]LRQHGHOGLULWWRG¶DXWRUHSHUSHWUDWDSHUXVRSHUVRQDOH
È chiaro che il legislatore abbia seguito una logica di deterrenza ±
come dimostrato anche dalla predisposizione di una vasta gamma di
sanzioni amministrative ± ma in questo modo, rispetto alla costante e
ULVDOHQWHWHQVLRQHWUDGLULWWRG¶DXWRUHHGLULWWLFRQQHVVLGDXQODWRHDc-
FHVVLELOLWjDOOHLQIRUPD]LRQLHDOOHRSHUHGHOO¶LQJHJQRGDOO¶DOWURKDDc-
cordato netta prevalenza ai primi a scapito della seconda. Di fronte al-
la rivoluzione tecnologica, nel tentativo di stroncare le oggettive mi-
QDFFHDOGLULWWRG¶DXWRUHLOOHJLVODWRUHKDSURVHJXLWROXQJRODPHGHVi-
ma strada della deterrenza ma con risultati inevitabilmente scarsi: il
file sharing ad esempio, in tutte le sue forme, difficilmente si può
combattere con la sanzione penale, la quale risulta sostanzialmente
inefficace di fronte ad un fenomeno che coinvolge quotidianamente
migliaia di individui distribuiti ai quattro angoli del globo. Ancora una
volta, quindi, la norma penale assume soltanto una veste formale di
strumento di deterrenza e non si traduce, se non di rado, in concreta
punizione dei comportamenti vietati. In confronto ad essa, presentano
XQ¶HIILFDFLDVLFXUDPHQWHPDJJLRUHTXHOOHFKHDXWRUHvole dottrina de-
finisce come misure tecnologiche di autotutela: DRM e simili, le qua-
li, però, comprimono a loro volta i diritti dei legittimi fruitori.
Insomma, tutti gli elementi normativi considerati dimostrano che
O¶LGHDGLIRQGRqTXHOODFKHOHRSHUHSrotette da copyright appartengo-
QRDOO¶DXWRUHHDLWLWRODULGHLGLULWWLFRQQHVVLQHOORVWHVVRPRGRLQFXLOH
res appartengono al proprietario. Di conseguenza la violazione del di-
ULWWRG¶DXWRUH± anche per uso personale ± viene trattata come una sorta
di furWRFRQILQDQGRO¶LQWHUHVVHGHOSXEEOLFRDOO¶DFFHVVRDOODIUXL]LRQH
GHOO¶RSHUDDGXQUXRORPLQLPR
Si consenta di osservare che tale approccio non solo si pone in at-
triWRFRQGHWWDPLGLULOHYRFRVWLWX]LRQDOHPDTXDQG¶DQFKHQRQULVXOWL
in buona parte inefficace sul piano della effettiva repressione delle
condotte criminalizzate, può determinare effetti deleteri per il mondo
248 Manuale di diritto delle arti e dello spettacolo

GHOO¶LQJHJQRFUHDWLYROLPLWDQGRIRUWHPHQWHLOOLEHURXWLOL]]RGHOOHRSe-
re si finisce per incidere negativamente sullo sviluppo culturale ed ar-
tistico della società e, alla fine, si riduce anziché incrementare la pro-
GX]LRQHHO¶HYROX]LRQHGLRSHUHFUHDWLYH
Non si può non osservare, poi, che la tutela penale accordata al di-
ULWWR G¶DXWRUH q FRPXQTXH SDU]LDOH ULJXDUGD TXDVL HVFOXVLYDPHQWH Ll
profilo economico del medesimo mentre il profilo morale è ad oggetto
della sola disposizione del terzo comma GHOO¶DUWOGD&RPHRs-
servato, anche in questo caso, da autorevole dottrina, un ordinamento
che riconosce la componente personalistica del GLULWWR G¶DXWRUH Go-
vrebbe approntare una proporzionata tutela penale al diritto morale.
1DWXUDOPHQWH QRQ VL YXROH DIIHUPDUH O¶LQXWLOLWj DVVROXWD R
O¶XOWURQHLWj GL XQ VLVWHPD VDQ]LRQDWRULR SHQDOH QHOOD PDWHULD de qua,
quanto piuttosto la necessità che esso recuperi in termini di coerenza e
di razionalità e che la sanzione penale abbia effettivamente il ruolo di
extrema ratio che le compete.
Capitolo XIII

Opera e impresa cinematografica:


GDOODOHJJHVXOGLULWWRG¶DXWRUHDOODOHJJHFLQHPD
di MARCO MIRAGLIA

 /H IRQWL GHO GLULWWR FLQHPDWRJUDILFR O¶DSSURGR D XQD GLVFi-


plina unitaria

)LQRDOO¶HQWUDWDLQYLJRUHGHOd.lgs. 22 gennaio 2004, n. 28 (la c.d. leg-


ge cinema anche nota come decreto Urbani), la disciplina in materia di
attività cinematografiFKH HUD IUDPPHQWDWD /¶HQWUDWD LQ YLJRUH GHOOD
legge cinema ha profondamente innovato il sistema normativo di rife-
rimento, generando una regolamentazione unitaria dalla quale traspare
O¶LQWHQWRGHOOHJLVODWRUHGDUHRUGLQHDGXQDGLVFLSOLQDSHUPHDWDGDGi-
scontinuità e, allo stesso tempo, semplificare la procedura di finan-
ziamento per la realizzazione dei film.
Anteriormente alla legge cinema lo scenario era composto da un
nucleo di norme fondamentali, quelle comprese nel più ampio conte-
sto della legge n. 633 del 22 aprile 1941 sulla protezione del diritto
G¶DXWRUHHGLDOWULGLULtti connessi al suo esercizio, nonché da una serie
di interventi legislativi in favore della cinematografia (l. 4 novembre
1965, n. 1213; d.l. 14 gennaio 1994, n. 26). Di non minor rilevo, a
completare lo scenario in discorso, la disciplina sulla censura delle
opere cinematografiche (contenuta nella l. 21 aprile 1962, n. 161) e le
disposizioni volte a ratificare la Convenzione Europea sulla co-
produzione cinematografica firmata a Strasburgo il 2 ottobre 1992.

249
250 Manuale di diritto delle arti e dello spettacolo

Merita menzione la soppressione del Ministero del Turismo e dello


Spettacolo avvenuta nella cornice dei referendum abrogativi del 1993
e la conseguente necessità di dare un nuovo assetto al riparto delle
competenze tra Stato e Regioni; invero, le Regioni concorrono alla
elaborazione e alla attuazione della politica nazionale e comunitaria in
materia dello spettacolo (art. 3, d.l. 29 marzo 1995, n. 97, poi conver-
tito in l. 30 maggio 1995, n. 203).
La legge cinema ha quindi riordinato una serie di disposizioni nor-
mative, abrogandone talune, in modo da costituire essa stessa un soli-
do insieme di norme che, affiancate a quelle applicabili alla cinemato-
JUDILD FRQWHQXWH QHOOD OHJJH VXO GLULWWR G¶DXWRUH UHFDQR XQ RUJDQLFR
insieme di diVSRVL]LRQL WUD OH TXDOL O¶LQWHUSUHWH SXz IDFLOPHQWH RULHn-
tarsi.
0DO¶DWWLYLWjGHOOHJLVODWRUHYROWDDOODUHJRODPHQWD]LRQHGHOOHDWWLYi-
tà cinematografiche non si è arrestata alla legge cinema; come vedre-
PR QHL SDUDJUDIL VXFFHVVLYL O¶,WDOLD KD UHFHSLWR OD disciplina
GHOO¶Unione europea in materia, che, a sua volta, si adattava ai tempi
odierni e alle relative novità tecnologiche e prassi commerciali (da ul-
timo, il d.lgs. 15 marzo 2010, n. 44, che ha recepito la direttiva
2007/65/CE sui servizi media e audiovisivi, modificando il d.lgs. 31
OXJOLRQRUD³7HVWRXQLFRGHLVHUYL]LGLPHGLDDXGLRYLVLYLH
UDGLRIRQLFL´ 

13.1.1. /DFLQHPDWRJUDILDQHOODOHJJHVXOGLULWWRG¶DXWRUH

/DOHJJHQGHOWXWHODOHRSHUHGHOO¶DUWHFLQHPDWRJUDILFD DUW
2, n. 6, l.d.a.); preliminarmente, si rileva la necessità di una precisa-
]LRQH WHUPLQRORJLFD LQGLUL]]DWD DOO¶LQWHUSUHWH DO ILQH GL LQGLYLGXDUH LO
perimetro di tutela offerto dalla l.d.a.. Per opera cinematografica si
intende il contenuto del film: più opere o parti di opere (il soggetto, la
sceneggiatura, la musica), che conservano una propria autonomia,
FRPSRQJRQRO¶RSHUD± cinematografica ± ultima.
La legge in discorso e molti dei successivi interventi normativi in
materia non forniscono una definizione di opera cinematografica. Bi-
sogna attendere la legge 7 marzo 2001, n. 62, per avere una definizio-
ne di opera filmica («lo spettacolo, con contenuto narrativo o docu-
mentario, realizzato su supporto di qualsiasi natura, purché costituente
XIII. Opera e impresa cinematografica 251

RSHUDGHOO¶LQJHJQRDLVHQVLGHOODGLVFLSOLQDGHOGLULWWRG¶DXWRUHGHVWi-
nato originariamente dal titolare dei diritti di utilizzazione economica,
alla programmazione nelle sale cinematografiche, ovvero alla diffu-
sione al pubblico attraverso mezzi audiovisivi»), poi fatta propria e ul-
teriormente raffinata dalla legge cinema (art. 2, primo comma: «lo
spettacolo realizzato su supporti di qualsiasi natura, purché costituente
RSHUDGHOO¶LQJHJQRDLVHQVLGHOODGLVFLSOLQDGHOGLULWWRG¶DXWRUHGHVWi-
nato al pubblico, prioritariamente nelle sale cinematografiche, dal tito-
lare dei diritti di utilizzazione»).
Tale precisazione terminologica permette un migliore inquadra-
PHQWRVLDGHOO¶RJJHWWRGLWXWHODGHOODOGDFKHGLTXHOORGHJOLXOWHULRUL
contributi legislativi connessi con la cinematografia. Paradossalmente,
la l.d.a. contiene una serie di definizioni fondamentali tralasciando ±
come appena illustrato ± proprio quella di opera cinematografica.
$OO¶LQWHUQRGHOODVH]LRQH,,, DUWW-50 l.d.a.), si rinviene ± in pri-
mo luogo ± la definizione di coautori GHOO¶RSHUDFLQHPDWRJUDILFD(s-
VHQGRO¶RSHUDFLQHPDWRJUDILFDFRPELQD]LRQHGLPROWHSOLFLDSSRUWLDu-
tonomi ma non sufficienti ± singolarmente ± alla sua realizzazione, es-
sa non risale ad un autore ma a più FRDXWRUL$LVHQVLGHOO¶DUW l.d.a.,
VLFRQVLGHUDQRWDOL©O¶DXWRUHGHOVRJJHWWRO¶DXWRUHGHOODVFHQHJJLDWXUD
O¶DXWRUHGHOODPXVLFDHGLOGLUHWWRUHDUWLVWLFRª5HVWDQRHVFOXVLSHUWDn-
WR O¶DXWRUH GHOOD VFHQRJUDILD GHL FRVWXPL H GHOOH IRWRJUDILH WXWWDYLD
tali soggetti potranno essere tutelati in via contrattuale, estendendo lo-
ro la tutela spettante ai soggetti rientranti ex art. 44 l.d.a. nella defini-
zione di coautori.
Secondariamente, è presente una definizione di produttore
GHOO¶RSHUDFLQHPDWRJUDILFDVHSSXURWWHQXWDWUDPLWHLOPeccanismo del-
ODSUHVXQ]LRQH'LIDWWLVLSUHVXPHSURGXWWRUHGHOO¶RSHUDFLQHPDWRJUa-
fica chi è indicato come tale sulla pellicola cinematografica; diversa-
PHQWHVHO¶RSHUDqUHJLVWUDWDSUHVVRLOUHJLVWURSXEEOLFRVSHFLDOHSHUOH
opere cinematografiche e le opere audiovisive tenuto dalla SIAE, la
UHJLVWUD]LRQHIDIHGHVLQRDSURYDFRQWUDULDGHOODHVLVWHQ]DGHOO¶RSHUD
e del fatto della sua pubblicazione. Gli autori e i produttori indicati nel
registro sono reputati, sino a prova contraria, autori o produttori delle
opere che sono loro attribuite (art. 45, secondo comma, l.d.a.).
Il legislatore, sebbene riconosca il valore artistico trasmesso da cia-
scuna opera filmica, è anche cosciente della capacità di sfruttamento
252 Manuale di diritto delle arti e dello spettacolo

economico e dei processi di diffusione proprLGHOO¶LQGXVWULDFLQHPDWo-


grafica; da qui, la necessità di imputare in capo ad uno dei soggetti
FRLQYROWLQHOODUHDOL]]D]LRQHGHOO¶RSHUDO¶HVHUFL]LRGHLGLULWWLGLXWLOLz-
]D]LRQH GHOO¶RSHUD VWHVVD q LO SURGXWWRUH LO VRJJHWWR FXL VSHWWD WDOH
esercizio (art. 45, primo comma, l.d.a.). Il produttore però ± secondo
la lettera della norma ± non sembra esserne titolare ma semplice eser-
cente; dal combinato disposto degli artt. 44 e 45 l.d.a. risulta che i tito-
ODULGHLGLULWWLGLXWLOL]]D]LRQHVRQRLFRDXWRULGHOO¶RSera cinematogra-
fica, mentre la loro gestione spetterebbe al produttore. In realtà, è or-
mai opinione consolidata in dottrina, che il produttore cinematografico
non sia mero esercente, ma titolare dei diritti di utilizzazione econo-
mica del film. A tale conclusione si può giungere soppesando attenta-
mente il ruolo che il produttore cinematografico assume nella realiz-
]D]LRQHGHOO¶RSHUDHJOLQHqLPSXOVRRUJDQL]]DWLYRH ± in parte ± fi-
nanziario. Sulle modalità di ripartizione dei risultati economici frutto
dei dLULWWLGLXWLOL]]D]LRQHGHOO¶RSHUDODQRUPDLQGLVFRUVRQXOODGLVSo-
QHODVFLDQGRODUHODWLYDGHILQL]LRQHDOO¶DXWRQRPLDQHJR]LDOHGHOOHSDr-
ti coinvolte nella distribuzione.
È evidente che una puntuale individuazione dei diritti di utilizza-
]LRQH GHOO¶RSHUD FLQHPDWRJUDILFD RIIUH DOO¶LQWHUSUHWH OD SRVVLELOLWj GL
ricostruire il tipo di protezione che la legge stessa accorda al soggetto
produttore. A tal proposito, è utile attingere alle correnti dottrinali e
giurisprudenziali più recenti per comprendere come lo sfruttamento si
sostanzi nei diritti derivanti dalla distribuzione televisiva e nelle sale
cinematografiche.
Secondo un primo orientamento dottrinale, i diritti relativi alla di-
stribuzione televisiva, mediante home-video e internet, non sarebbero
± secondo le citate interpretazioni ± ricompresi ex lege tra i diritti di
XWLOL]]D]LRQHGHOO¶RSHUD4XHVWDWHVLUHVWULWWLYDVRVWLHQHFKHORVIUXWWa-
mento nelle sale cinematografiche e quello televisivo o tramite home
video si differenziano profondamente nelle rispettive modalità di frui-
zione da parte dello spettatore; pertanto la proiezione televisiva non
sarebbe la GHVWLQD]LRQH QDWXUDOH GHOO¶RSHUD LQGLYLGXDWD LQYHFH QHOOH
sale cinematografiche), costituendo una realtà estranea ai diritti spet-
tanti al produttore /¶RSHUD FLQHPDWRJUDILFD VDUHEEH DSSUH]]DELOH LQ
concreto e nel suo complesso di elementi che la compongono (musica,
immagini, dialoghi) solo nelle sale cinematografiche, poiché solo la
XIII. Opera e impresa cinematografica 253

SURLH]LRQH LQ VDOD FDWWXUHUHEEH O¶DWWHQ]LRQH GHOOR VSHWWDWRUH LQ PRGR


intenso, coinvolgente e quasi totalizzante. La televisione, invece, non
ha queste capacità, ed è pertanto condannata a un ruolo secondario ri-
spetto alle sale riscontrandosi anzi in essa una sorta di virtù negativa
FRQVLVWHQWHQHOO¶DXWRPDWLFDULGX]LRQHGHO YDORUHGHOO¶RSHUDFLQHPDWo-
grafica. In definitiva, il diritto di sfruttamento televisivo o tramite ho-
me video non sarebbe ricompreso tra quelli spettanti al produttore e,
viceversa, deve essere fatto rientrare tra i diritti generalmente attribuiti
agli autori.
,O ILORQH GRWWULQDOH PDJJLRULWDULR q SHUz FRQWUDVWDWR GDOO¶LQGLUL]]R
assunto dalla suprema Corte di Cassazione, condiviso da voci isolate
di alcuni Autori. Secondo la Corte, «la normativa in tema di diritti di
autore non opera alcuna distinzione tra diritto di utilizzazione cinema-
WRJUDILFDGLXQ¶RSHUDHGLULWWRGLXWLOL]]D]LRQHWHOHYLVLYDGHOODPHGHVi-
ma diverso ed ulteriore rispetto al primo (che spetta ordinariamente al
SURGXWWRUH DYHQGRLOOHJLVODWRUHGHODOO¶DUWOQHVSUHs-
samente FRQVLGHUDWRRJQLSRVVLELOHXWLOL]]D]LRQHGHOO¶RSHUDILOPLFDLQ
quanto tale, cioè a dire del film quale prodotto di spettacolo che adotta
ODWHFQLFDGHOO¶LPPDJLQHLQPRYLPHQWRFDSDFHGLUHDOL]]DUHXQDUHDOWj
virtuale (utilizzazione, pertanto, sia cinematografica che televisiva),
con esclusione della sola utilizzazione economica che prescinda del
tutto da tale ontoloJLFDHVVHQ]DGHOO¶RSHUDILOPLFD» (Cass. Civ., Sez. I,
sentenza 1° dicembre 1999, n. 13398).
Resta inteso, in ogni caso, che le varie forme di sfruttamento po-
tranno essere regolamentate in via contrattuale tra i soggetti coinvolti
nella distribuzione stessa. Peraltro, a prescindere da quanto stabilito
contrattualmente dalle parti e dalla legge riguardo ai diritti patrimonia-
li, ai coautori spetta LOGLULWWRPRUDOHVXOO¶DSSRUWRFUHDWLYRGDORURUHa-
lizzato.
/DOHJJHVXOGLULWWRG¶DXWRUHDWWULEXLVFHDOWUHVuDOSURGXWWRUHLOGLULt-
WR GL PRGLILFDUH O¶RSHUD GL DXWRUL]]DUQH OD ULSURGX]LRQH OD GLVWULEu-
zione, il noleggio e il prestito degli originali o di copie delle sue rea-
lizzazioni.
Diritti di sfruttamento, diritti di modifica e diritti connessi non han-
no durata indeterminata. Essi sono attribuiti ai relativi proprietari per
un periodo di tempo limitato; in particolare, «i diritti di utilizzazione
econoPLFDGHOO¶RSHUDGXUDQRWXWWDODYLWDGHOO¶DXWRUHHVLQRDOWHUPLQH
254 Manuale di diritto delle arti e dello spettacolo

del settantesimo anno solare dopo la sua morte» (art. 25 l.d.a.); invece,
LGLULWWLFRQQHVVLKDQQRXQDGXUDWDILVVDWDLQFLQTXDQW¶DQQLDSDUWLUHGD
eventi specificati dalla legge e che sostanzialmente coincidono con il
fatto costitutivo di ciascun diritto connesso.
Alla luce di tutto quanto sopra, si comprende come la l.d.a. tracci
uno scheletro della disciplina che, seppur modificato e integrato nel
corso degli anni viste le normali esigenze di adattamento anche termi-
QRORJLFRGHWWDWRGDOO¶DUULYRGLQXRYHWHFQRORJLHqVWDWDVHPSUHLOSXn-
to di riferimento per gli interventi normativi posteriori ad essa.

13.2. La legge cinema

Nel paragrafo precedente abbiamo messo in luce il modus operandi


del legislatore nel forgiare la struttura della legge cinema. Il legislato-
re ha voluto creare un punto di riferimento per gli operatori giuridici
che dialogano e interagiscono con la nuova regolamentazione e, ancor
più importante, ha creato un precipitato di criteri oggettivi sulla base
GHLTXDOLDWWULEXLUHILQDQ]LDPHQWLDOO¶RSHUDFLQHPDWRJUDILFD,QROWUHKD
previsto la possibilità inserire nelle scene del film marchi e prodotti di
proprietà di terzi, cosicché attraverso il contributo economico di questi
ultimi si realizzi un abbattimento dei costi di produzione.
Peraltro, alcune disposizioni della legge cinema furono oggetto di
pronuncia di incostituzionalità (Corte costituzionale, 19 luglio 2005,
n. 285) in quanto, a valle della riforma del Titolo V della Costituzione
± che ripartiva le competenze legislative tra Stato e Regioni ± la stessa
legge cinema non rifletteva le nuove direttive di fonte costituzionale.
,QVRVWDQ]DQRQSUHYHGHYDO¶LQWHVDRLOSDUHUHGHOOD&RQIHUHQ]D6WDWR-
Regioni per i vari interventi volti ad attuare il d.lgs. n. 28/2004.
La sentenza della Corte Costituzionale ha anche circoscritto le fun-
zioni della Consulta territoriale per le attività cinematografiche (cfr.
DUW DGHVVRULGRWWHDPHUDFRQVXOHQ]DOD&RQVXOWDqO¶RUJDQRLnca-
ricato di fornire direttive funzionali al raggiungimento degli obiettivi
della legge cinema ed è presieduta dal Capo del Dipartimento per lo
spettacolo e lo sport o dal Direttore generale competente appositamen-
te delegato. Tale organo è composto dal Presidente del Centro speri-
mentale di cinematografia, dal Presidente di Cinecittà Holding S.p.A.
XIII. Opera e impresa cinematografica 255

(una società che ha il compito di promuovere il cinema italiano nel


mondo), da quattro membri designati dalle associazioni di categoria
maggiormente rappresentative nel settore cinematografico (due dei
quali designati dalle associazioni maggiormente rappresentative nel
VHWWRUH GHOO¶HVHUFL]LR  GD WUH UDSSUHVHQWDQWL GHOOH 5HJLRQL GHVLJQDWL
dalla Conferenza Stato-Regioni, e da tre rappresentanti degli enti loca-
li, designati dalla Conferenza Stato-Città.
Un altro punto cardine della legge cinema è la disciplina del Pub-
blico Registro Cinematografico, la cui tenuta è affidata alla SIAE dal-
la legge istitutiva (r.d.l. n. 1061/1938). Il Registro si compone delle
seguenti sezioni: (i) film di lungometraggio di nazionalità italiana; (ii)
ILOPGLOXQJRPHWUDJJLRGLQD]LRQDOLWjGLXQRGHLSDHVLGHOO¶Unione eu-
ropea; (iii) film di lungometraggio di nazionalità di uno dei paesi
esterni aOO¶Unione europea; (iv) film di cortometraggio (italiani o stra-
nieri); e infine, (v) film di attualità (italiani o stranieri). In tali sezioni
sono iscritti i film di produzione nazionale e sono trascritti gli atti di
vendita del film, gli atti costitutivi, modificativi e dispositivi dei diritti
e pURYHQWL ,O 5HJLVWUR q IRQGDPHQWDOH SHU O¶DFFHVVR DL ILQDQ]LDPHQWL
previsti dalla legge cinema, infatti, le iscrizioni e trascrizioni ivi pre-
senti costituiscono prova per il Ministero per i Beni e le Attività Cul-
turali ± Direzione Generale per il Cinema, in quanto realizzano una
forma di pubblicità notizia: la registrazione fa fede fino a prova con-
WUDULD GHOO¶HVLVWHQ]D GHO ILOP H GHOOD VXD SXEEOLFD]LRQH JOL DXWRUL H L
produttori indicati nel Registro sono reputati, fino a prova contraria,
rispettivamente autori e produttori delle opere loro attribuite. Salvo il
FDVRGLDFFHVVRDLILQDQ]LDPHQWLO¶LVFUL]LRQHHODWUDVFUL]LRQHGHJOLDWWL
sono facoltative. Il Registro non ha, invece, funzione di pubblicità di-
chiarativa (ciò che ivi è iscritto o trascritto non è opponibile a terzi in-
dipendentemente dal fatto che questi ultimi ne abbiano avuto cono-
VFHQ]DRPHQR 1HOO¶HFRQRPLDGHOSUHVHQWHVFULWWRDSSDUHXWLOHVRf-
IHUPDUVLVROWDQWRVXLVRJJHWWLOHJLWWLPDWLDULFKLHGHUHO¶LVFUL]LRQHRWUa-
scrizione nel Registro e le sezioni in cui lo stesso si articola: essi sono
il produttore o i suoi aventi causa ovvero, con riferimento alle opere
cinematografiche di nazionalità diversa da quella italiana,
O¶LPSRUWDWRUH LO FHVVLRQDULR R LO FRQFHVVLRQDULR GHL GLULWWL GL VIUXWWa-
menWRLQ,WDOLDGHOO¶RSHUDRLORURDYHQWLFDXVD
256 Manuale di diritto delle arti e dello spettacolo

13.2.1. Le imprese cinematografiche

/¶LPSUHVDFLQHPDWRJUDILFD LQGLYLGXDOHRFROOHWWLYDFKHVLDLQIRUPD
anche di società) non trova una serie di norme ad hoc volte a regolar-
ne il funzionamento: si applicheranno le norme del codice civile rela-
WLYHDOO¶LPSUHQGLWRUHLQGLYLGXDOHRDOO¶LPSUHVDFROOHWWLYD
È frequente, nella prassi del settore, che due o più imprese cinema-
tografiche decidano di apportare ciascuna un proprio contributo (fi-
nanziario, operativo, artistico) alla realizzazione dello stesso progetto
filmico. Disciplineranno quindi i loro rapporti attraverso un accordo di
co-produzione il quale ± in primo luogo ± definirà il progetto filmico e
regolerà la durata della collaborazione, e specificherà gli apporti delle
parti; rispetto a questi ultimi avremo una co-produzione maggioritaria
qualora una delle imprese partecipi al finanziamento del film con una
quota superiore rispetto alle altre imprese, una co-produzione minori-
taria qualora una delle imprese partecipi al finanziamento del film con
una quota inferiore rispetto alle altre imprese e, infine, una co-
produzione paritetica qualora tutte le imprese partecipino equamente
al finanziamento del film.
A seguito della legge cinema e degli interventi attuativi ad essa
connessi, le imprese di produzione cinematografica, distribuzione e
esportazione con sede legale e domicilio fiscale in Italia sono specifi-
camente riconosciute dal nostro ordinamento. Le imprese aventi
O¶DWWLYLWj FLQHPDWRJUDILFD TXDOH RJJHWWR Vociale ma sede legale e do-
PLFLOLR ILVFDOH LQ XQR GHL 3DHVL GHOO¶Unione europea possono essere
equiparate a quelle italiane, a condizione di reciprocità, purché abbia-
no in Italia una branch operativa dove svolgono prevalentemente la
loro attività.
Rientra nHOO¶HFRQRPLD GHOO¶LPSUHVD LO VXR VRVWHJQR 5LFRUGDYDPR
SRF¶DQ]LFKHRELHWWLYRSULPDULRGHOOHJLVODWRUHHUDODGHILQL]LRQHGLWa-
luni criteri oggettivi per consentire alle imprese cinematografiche
O¶DFFHVVR H OD IUXL]LRQH GL ILQDQ]LDPHQWL Ê VWDWR FRVu VWXGLato un si-
VWHPDVHPSOLFHEDVDWRVXOO¶DWWULEX]LRQHGLSXQWLVHFRQGRLOULVFRQWURR
PHQRGLGHWWLFULWHULLQFDSRDOO¶LPSUHVDSLqDOWRLOSXQWHJJLRRWWHQu-
WRPDJJLRUHVDUjO¶DPPRQWDUHGLILQDQ]LDPHQWRDFFHVVLELOHHIUXLELOH
DOO¶LPSUHVD,SDUDPHWULGLULIerimento sono i seguenti:
a) partecipazione a festival e alle cinquine di premi negli ultimi
XIII. Opera e impresa cinematografica 257

cinque anni;
b) premi principali vinti negli ultimi dieci anni;
c) numero anni di attività;
d) numero dei film prodotti;
e) capitale sociale;
f) restituzione di finanziamenti già erogati;
g) valore medio box office;
h) valore totale box office;
i) YHQGLWDDOO¶HVWHUR
9HUUDQQR FRVu DVVHJQDWL DOO¶LPSUHVD XQD VHULH GL SXQWL DYHQGR Ui-
JXDUGRDOODTXDOLWjGHLILOPUHDOL]]DWLGDOODVWHVVDQHOO¶DUFRWHPSRUDOH
GHOO¶XOWLPR TXLQTXHQQLR SDUDPHWUL a e b di cui sopra), alla stabilità
GHOO¶LPSUHVD SDUDPHWULc, d, e ed f di cui sopra) e infine alla capacità
commerciale dimostrata (parametri g, h e i di cui sopra).
,OFRVWDQWHDJJLRUQDPHQWRGHOO¶HOHQFRqFXUDGHOOD'LUH]LRQHJHQe-
rale per il cinema la quale, sulla base dei dati a sua disposizione, asse-
gna un punteggio a ciascuna impresa, comunicandolo alla stessa. Qua-
ORUDO¶LPSUHVDULWHQJDQRQFRQJUXRLOSXQWHJJLRDVVHJQDWROHKDODSRs-
sibilità di richiedere un riesame della sua posizione fornendo le prove
a sostegno della richiesta.
,OVRVWHJQRHFRQRPLFRVWDWDOHVLULYROJHWDQWRDOO¶LPSUHVDTXDQWRDO
singolo progetto che sta alla base di una realizzanda opera cinemato-
grafica; in tal caso, il legislatore promuove la prevalenza delle com-
ponenti creative ed operative italiane. Difatti, ciascun film è idoneo a
ricevere finanziamenti statali qualora esso sia italiano. È qualificato
tale il film che, inter aliaDEELDLOUHJLVWDLWDOLDQRO¶DXWRUHGHOVRJJHt-
to italiano o gli autori in maggioranza italiani, lo sceneggiatore italia-
no o gli sceneggiatori in maggioranza italiani, gli interpreti principali
in maggioranza italiani, la troupe italiana.

13.2.2. La Commissione per la cinematografia e il Fondo Unico per


lo Spettacolo

&RPHLOVLVWHPDGLYDOXWD]LRQHGHOO¶Lmpresa cinematografica è basato


su dei criteri oggettivi, anche il sistema di valutazione proprio di cia-
scun progetto filmico è basato su criteri dello stesso tipo. Tali valuta-
zioni, improntate a reference systems solo in parte discrezionale (vedi
258 Manuale di diritto delle arti e dello spettacolo

infra), sono funzionali al godimento dei benefici che la legge cinema


attribuisce a imprese e opere cinematografiche che raggiungano de-
terminati punteggi.
A tal fine, presso il Ministero per i Beni e le Attività Culturali è
istituita la Commissione per la cinematografia. Essa è composta dalle
seguenti sottocommissioni:
a) ODVRWWRFRPPLVVLRQHSHULOULFRQRVFLPHQWRGHOO¶LQWHUHVVHFXOWXUa-
OH GHOO¶RSHUD FKH SURYYHGH FRQ DSSRVLWH VH]LRQL DO ULFRQRVFi-
PHQWRGHOO¶LQWHUHVVHFXOWXUDOHLQIDVHSURJHWWXDOHGHLOXQJRPe-
traggi, delle opere prime e seconde e dei cortometraggi, ed alla
definizione della quota massima di finanziamento assegnabile,
anche in relazione alla comprovata valenza artistica degli autori,
nonché alla valutazione delle sceneggiature originali o di parti-
colare rilievo culturale o sociale;
b) ODVRWWRFRPPLVVLRQHSHUODSURPR]LRQHHSHULILOPG¶essai. Es-
sa, suddivisa in apposite sezioni, esprime parere sulle istanze re-
ODWLYHDOO¶HURJD]LRQHGHLFRQWULEXWLHQHGHILQLVFHO¶LPSRUWRDs-
segnabile; verifica la rispondHQ]D VRVWDQ]LDOH GHOO¶RSHUD UHDOLz-
zata al progetto già valutato dalla sottocommissione di cui alla
lettera a), ed i requisiti di idoneità tecnica; provvede alla indivi-
GXD]LRQHGHLILOPG¶essai.
/HVRWWRFRPPLVVLRQLVYROJRQRO¶DWWLYLWjGLYDOXWD]LRQHVHFRQGo un
calendario di sedute suddiviso in due distinti semestri, che si conclu-
dono il 31 maggio ed il 30 novembre di ogni anno. La sottocommis-
VLRQHSHULOULFRQRVFLPHQWRGHOO¶LQWHUHVVHFXOWXUDOHGHOO¶RSHUDSXzDn-
FKHDYYDOHUVLGHOODIDFROWjGLULFKLHGHUHO¶DXdizione del regista e di un
UDSSUHVHQWDQWHGHOO¶LPSUHVDGLSURGX]LRQHHVXOODVFRUWDGHLVHJXHQWL
FULWHULHVSULPHLOVXRJLXGL]LRVXOO¶RSHUD
a) valutazione della qualità artistica, in relazione ai diversi generi
cinematografici;
b) valutazione della qualità tecnica del film;
c) coerenza delle componenti artistiche e di produzione con il pro-
getto filmico;
d) TXDOLWj GHOO¶DSSRUWR DUWLVWLFR GHO UHJLVWD H GHOOR VFHQHJJLDWRUH
nonché valutazione del trattamento o della sceneggiatura, con
particolare riferimento a quelli riconosciuti di rilevanza sociale e
cXOWXUDOHDLVHQVLGHOO¶DUW 13, sesto comma, ed a quelli destinati
XIII. Opera e impresa cinematografica 259

alla realizzazione di film per ragazzi ovvero tratti da opere lette-


rarie.
Si noti come i criteri di cui ai punti a), b) e c) di cui sopra attengo-
no alla parte del giudizio permeata da discrezionalità dei componenti
della Commissione, mentre i criteri di cui al punto d) sono automatici
e basati su una serie di indici che svolgono la funzione di parametri
oggettivi cui ± al ricorrere di determinate situazioni ± corrisponde
O¶DWWULEX]LRQH DXWRPDWLFD GL XQ SUHGHWHUPLQDWR DPPRQWDUH GL SXQWL
Sostanzialmente la legge cinema richiede la sussistenza di due condi-
]LRQLSHUO¶RWWHQLPHQWRGLILQDQ]LDPHQWLGDSDUWHGLXQ¶RSHUDILOPLFD
ossia che la medesima sia riconosciuta quale opera di nazionalità ita-
liana e opera di interesse culturale nazionale per motivi artistici e cul-
turali o artistici e spettacolari.
Ma quali sono i mezzi pubblici di finanziamento delle opere che
posseggono le condizioni per accedervi? Ebbene, le risorse finanziarie
disponibili sono quelle del Fondo Unico per lo Spettacolo (FUS). Al
FUS affluiscono le risorse finanziarie disponibili ed esistenti ± alla da-
ta di entrata in vigore del d.lgs. 28/2004 ± sui fondi precedentemente
esistenti (ora sostituiti dal fondo unico) oltre a quelle ogni anno ad es-
VRGHVWLQDWHGDOODOHJJHILQDQ]LDULD$LVHQVLGHOO¶DUWdella legge ci-
nema, il FUS è destinato:
a) al sostegno degli investimenti promossi dalle imprese cinemato-
grafiche per la produzione di opere filmiche, anche con riferi-
mento alla realizzazione di colonne sonore, e per lo sviluppo di
sceneggiature originali di particolare rilievo culturale e sociale;
b) alla corresponsione di contributi a favore di imprese di distribu-
zione ed esportazione, anche per la realizzazione di versioni dei
film riconosciuti di interesse culturale in lingua diversa da quel-
la della ripresa sonora diretta;
c) alla corresponsione di contributi sugli interessi dei mutui ed alla
concessione di contributi in conto capitale a favore delle impre-
se di esercizio e dei proprietari di sale cinematografiche, per la
realizzazione di nuove sale o il ripristino di sale inattive, nonché
SHUO¶DGHJXDPHQWRGHOOHVWUXWWXUHHSHULOULQQRYRGHOOHDSSDUHc-
FKLDWXUH FRQ SDUWLFRODUH ULJXDUGR DOO¶LQWURGuzione di impianti
automatizzati o di nuove tecnologie;
d) alla concessione di mutui decennali a tasso agevolato o contri-
260 Manuale di diritto delle arti e dello spettacolo

buti sugli interessi a favore delle industrie tecniche cinematogra-


fiche, per la realizzazione, la ristrutturazione, la trasformazione
o l¶DGHJXDPHQWR VWUXWWXUDOH H WHFQRORJLFR GL WHDWUL GL SRVD GL
stabilimenti di sviluppo e stampa, di sincronizzazione, di post-
produzione;
e) alla corresponsione di contributi destinati ad ulteriori esigenze
del settore delle attività cinematografiche, salvo diversa deter-
minazione del Ministro con riferimento ad altri settori dello
spettacolo.

13.2.3. Il product placement

Da anni, si indica come product placement quel fenomeno relativo al-


la promozione di marchi e prodotti attraverso i mezzi di intrattenimen-
to maggiormente diffusi; qui ci occuperemo dei lineamenti che tale
fenomeno ha assunto nel settore cinematografico.
8Q¶LPSUHVDFKHGHVLGHUDSXEEOLFL]]DUHLOSURSULRPDUFKLRRSURGRt-
WR SXz IDUOR WUDPLWH O¶LQVHULPHQWR ± dietro corrispettivo in favore
GHOO¶LPpresa cinematografica ± di prodotti o dei relativi segni distinti-
YLQHOOHVFHQHGLXQ¶RSHUDFLQHPDWRJUDILFD /DGLUHWWLYD&((
concernente la fornitura di servizi di media audiovisivi, come modifi-
cata dalla direttiva 2007/65/CE (direttiva sui servizi media audiovisi-
vi, c.d. SMA, attuata in Italia con d.lgs. n. 44 del 15 marzo 2010), de-
finisce inserimento di prodotti «ogni forma di comunicazione com-
PHUFLDOHDXGLRYLVLYDFKHFRQVLVWHQHOO¶LQVHULUHRQHOIDUHULIHULPHQWRD
un prodotto, a un servizio o a XQPDUFKLRFRVuFKHDSSDLDDOO¶LQWHUQRGL
un programma dietro pagamento o altro compenso». In altre parole, è
XQDIRUPDGLSXEEOLFLWjLQGLUHWWDUHDOL]]DWDSHUPH]]RGHOO¶HVSRVL]LRQH
visiva, uditiva, scritta o anche combinata, di prodotti marchi o altri
simEROL FRPPHUFLDOL DOO¶LQWHUQR GL VFHQH FLQHPDWRJUDILFKH D FRQGi-
zione che tale esposizione si adatti perfettamente al contesto narrativo
della scena.
&RPH ULOHYDWR GDOOD GRWWULQD FKH VL q RFFXSDWD GHOO¶DQDOLVL GHO Ie-
nomeno, il product placement rappresenta uno strumento ambito per-
FKpUHDOL]]DPROWHSOLFLYDQWDJJLVLDSHUO¶LPSUHVDFLQHPDWRJUDILFDVLD
SHUO¶LPSUHVDSURSULHWDULDGHOPDUFKLRRGHOSURGRWWRGDSXEEOLFL]]DUH
Invero, ogni film è indirizzato a una specifica categoria di pubblico
XIII. Opera e impresa cinematografica 261

(per esempio, i fiOP G¶DQLPD]LRQH D XQ SXEEOLFR PROWR JLRYDQH XQ


film-denuncia a un pubblico più adulto) che può essere così raggiunta
GDOODSXEEOLFLWjLQPDQLHUDGLUHWWDHPLUDWD1HGHULYDFKHO¶LPSUHVD
che desidera dare visibilità e promuovere un determinato prodotto de-
VWLQDWRHVFOXVLYDPHQWHDOO¶XWLOL]]RGDSDUWHGHOODIDVFLDSLJLRYDQHGHL
consumatori, potrà ottenere una pubblicità più efficace inserendo i
suoi marchi o prodotti nelle scene di un film per adolescenti. Inoltre,
la grande distribuzione cinematografica pHUPHWWHGLGLIIRQGHUHO¶RSHUD
filmica non solo nelle sale cinematografiche di tutto il mondo ma an-
che attraverso molteplici canali quali internet (download a pagamento)
e home video (DVD, blu-ray), rendendo così molto appetibile lo sfrut-
tamento pubblicitarLR GHOO¶RSHUD PHGHVLPD OH LPSUHVH QRQ SRVVRQR
che essere attratte da questo mezzo pubblicitario. Infine, nei limiti del-
la credibilità trasmessa, il prodotto o marchio potrà anche essere asso-
ciato ad un determinato contesto o categoria di consumatori nonché
allo stile di un personaggio del film (basti pensare, con riferimento al
personaggio protagonista di numerosi film su James Bond, alle vetture
della casa inglese Aston Martin o ai drink del brand torinese Martini).
Dei vantaggi che il product placement porta con sé, ne trae utilità
DQFKHO¶LPSUHVDFLQHPDWRJUDILFDLQSULPROXRJRODFRQWURSDUWLWDHFo-
QRPLFDSURYHQLHQWHGDOO¶DFFRUGRGL product placement andrà a finan-
ziare la spesa necessaria per la realizzazione del film, abbattendo i co-
sti di produzione; secondariamente, il collocamento di determinati
prodotti nelle scene contribuisce ad aumentare la realtà trasmessa allo
spettatore e a ricamare la personalità di ogni attore.
Alla luce di quanto appena illustrato si comprendono le potenzialità
del fenomeno, dal punto di vista del proprietario del marchio o prodot-
WR PDUNHWLQJLQFLVLYRHSHUVXDVLYR HGDTXHOORGHOO¶LPSUHVDFLQHPa-
tografica (maggiori risorse, ricercatezza, impostazione e distinzione di
scene e personaggi); ma se ne possono comprendere altresì i rischi,
SRLFKpO¶LQVHULPHQWRGLPDUFKLHRSURGRWWLSRWUHEEHFHODUHXQDIRUPD
di pubblicità occulta. Da qui, il bisogno di norme a tutela di tutti gli
interessi coinvolti.
Nonostante il product placement fosse già da tempo normativizzato
in altri Paesi, in Italia la relativa disciplina è stata introdotta con la
legge cinema (art. 9, terzo comma, e conseguente d.m. del 30 luglio
2004) e implementata con il d.lgs. n. 44 del 15 marzo 2010. La liceità
262 Manuale di diritto delle arti e dello spettacolo

di tale strumento è subordinata al rispetto di specifiche modalità tecni-


che; in via di principio, e posto che si richiede sempre un collegamen-
to tra il marchio o prodotto e la trama del film, il collocamento nelle
scene potrebbe essere realizzato:
a) in forma visiva e senza alcuna citazione uditiva che vi si riferi-
sca, con il marchio o prodotto più o meno in vista, a seconda che
sia posizionato in primo piano o sullo sfondo della scena, di
FRQVHJXHQ]D IRFDOL]]DQGR O¶DWWHQ]LRQH GHOOR VSHWWDWRUH VHFRQGR
gradi diversi (c.d. screen placement);
b) in forma uditiva, con un personaggio o una voce fuori campo
che facciano diretto ed esplicito riferimento al prodotto, che non
rientra nel campo visivo della scena, anche incoraggiandone
O¶DFTXLVWR FGscript placement);
c) sulla base della relazione che si instaura tra il marchio o prodot-
to e la trama del film (c.d. plot placement);
d) combinando le forme di cui ai punti precedenti (ad esempio,
forma visiva e uditiva, con il marchio o prodotto a vista e con
una espressione verbale ad esso associata o indirizzata).
Resta inteso che, qualsiasi forma di collocamento che non rientri
tra quella sopra indicate e che rappresenti mera pubblicità inserita
DOO¶LQWHUQR GHO ILOP QRQ ULHQWUD QHOOD QR]LRQH GL product placement.
3HUDOWUR SHU O¶LPSUHVD SURSULHWDULD GHO PDUFKLR R SURGRWWR q IRQGa-
PHQWDOHFKHO¶LQVHULPHQWRQHOFRQWHVWRGHOODVFHQDULVXOWLLOSLQDWXUa-
le e realistico possibile, in modo che si instauri un forte intreccio tra ±
da un lato ± O¶XWLOL]]RRO¶DSSDUL]LRQHJHQHULFDGHOPDUFKLRRSURGRWWR
e ± GDOO¶DOWUR ODWR ± la trama del film: si vuole che lo spettatore non
percepisca il collocamento del prodotto come messaggio commerciale
promozionale o pubblicitario, bensì come parte del contesto ovvero
come elemento parte dello stile di vita dei personaggi. Più il colloca-
mento sarà realistico, giusto, opportuno e preciso, maggiore sarà la
SHUVXDVLRQHLQJHQHUDWDQHOORVSHWWDWRUHO¶RELHWWLYRRYYLRqWUDVIRUPDUH
lo spettatore-potenziale consumatore in spettatore-consumatore finale.
Per completezza, si riporta ± parzialmente ± il primo comma
GHOO¶DUW  bis del d.lgs. n. 177 del 31 luglio 2005 (Testo unico dei
servizi di media audiovisivi e radiofonici), così come modificato dal
GOJV  LQ DWWXD]LRQH GHOOD GLUHWWLYD 60$ ©O¶LQVHULPHQWR GL
prodotti è consentito nelle opere cinematografiche, in film e serie pro-
XIII. Opera e impresa cinematografica 263

GRWWLSHULVHUYL]LGLPHGLDDXGLRYLVLYL>«@O¶LQVHULPHQWRSXzDYYHQLUH
dietro corrispettivo monetario ovvero dietro fornitura gratuita di de-
WHUPLQDWLEHQLHVHUYL]LTXDOLDLXWLDOODSURGX]LRQLHSUHPL>«@ª7DOH
disposizione, anche ± e soprattutto ± nei commi che seguono, ricalca
la disciplina dettata dalla legge cinema, quasi a consolidaUHO¶LQJUHVVR
QHOO¶RUGLQDPHQWRLtaliano del fenomeno del product placement.
1HOO¶RWWLFD GHJOL LQWHUHVVL FKH LO product placement coinvolge,
alO¶LQIXRULGLTXHOOLHFRQRPLFLDSSDUWHQHQWLDOO¶LPSUHVDFLQHPDWRJUDIi-
ca e quella proprietaria del marchio o prodotto, quali quelli dei con-
sumatori inerenti la disciplina della pubblicità (che deve essere, inter
alia, trasparente, vera e corretta, e vietata per alcune categorie di pro-
GRWWL LOOHJLVODWRUHDOO¶DUW, terzo comma, della legge cinema dispo-
ne: «fatte salve le disposizioni contenute nella legge 10 aprile 1962, n.
165, per i film che contengono inquadrature di marchi e prodotti, co-
munque coerenti con il contesto narrativo, è previsto un idoneo avviso
che rende nota la partecipazione delle ditte produttrici di detti marchi
e prodotti ai costi di produzione del film». Del resto, come già in pas-
sato evidenziato in dottrina, il product placement è «una forma di
pubblicità nascosta, difficilmente individuabile da uno spettatore an-
che non particolarmente sprovveduto».
Con il d.m. 30 luglio 2004, sono state stabilite le modalità tecniche
di attuazione del collocamento pianificato di marchi e prodotti nelle
VFHQHGLXQ¶RSHUDFLQHPDWRJUDILFDDPPHVVDODSRVVLELOLWjGLWDOHFRl-
locamento pianificato, il decreto ministeriale rimette alla contrattazio-
ne delle parti le relative forme dettando però, alcuni requisiti e limiti
di applicazione cui le parti dovranno attenersi nel negoziare e imple-
mentare le modalità tecniche del product placement. In particolare:
a) la presenza di marchi e prodotti «deve integrarsi nello sviluppo
GHOO¶D]LRQHVHQ]DFRVWLWXLUHLQWHUUX]LRQHGHOFRQWHVWRQDUUDWLYRª
b) affinché sia riconosciuta la forma del collocamento pianificato,
VL ULFKLHGH FKH L WLWROL GL FRGD GHOO¶RSHUD FLQHPDWRJUDILFD FRn-
tengano un avviso, il c.d. warning, «che informi il pubblico del-
ODSUHVHQ]DGHLPDUFKLHSURGRWWLDOO¶LQWHUQRGHOILOPFRQODVSe-
cifica indicazione delle ditte inserzioniste». In altre parole, il
messaggio potrà essere tanto persuasivo da ± in un primo mo-
mento, quello più importante, della visione della scena ± non far
percepire allo spettatore il collocamento del prodotto come mes-
264 Manuale di diritto delle arti e dello spettacolo

saggio commerciale promozionale o pubblicitario, purché ± in


un secondo momento che, come vedremo, coincide con i titoli di
coda ± egli sia cosciente del fine commerciale della presenza del
relativo marchio o prodotto in scena.
c) il product placement, come accennato, dovrà comunque con-
formarsi alla normativa in tema di trasparenza pubblicitaria e
limitazioni alla pubblicità di determinati prodotti.
La disciplina del collocamento pianificato presenta alcune lacune.
In primo luogo, sembra riferirsi ai soli film di nazionalità italiana qua-
lificati come tali ai sensi della legge cinema, lasciando scoperta la tu-
tela dello spettatore di film stranieri proiettati in Italia (la gran parte, si
SHQVLDOO¶HQRUPHIHWWDGLPHUFDWRPRQGLDOHDSSDUWHQHQWHDOO¶LQGXVWULD
cinematografica statunitense); in secondo luogo, intendendosi per film
ORVSHWWDFRORUHDOL]]DWRVXVXSSRUWLGLTXDOVLDVLQDWXUD>«@GHVWLQDWRDO
pubblico, prioritariamente nelle sale cinematografiche (art. 2, primo
comma, della legge cinema), ci si chiede se tale disciplina sia applica-
ELOHDLILOPFKHQRQDEELDQRWDOHSULRULWj,QROWUHO¶LQWHUSUHWD]LRQHGHO
precetto coerente con il contesto normativo appare di non facile indi-
viduazione: è probabile che il legislatore abbia inteso concedere fi-
nanziamenti solo ai film che mantengano un certo valore artistico che
certamente sarebbe leso e danneggiato da un irrazionale collocamento
di marchi e prodotWL,QILQHO¶DFFRUJLPHQWRGHOFGwarning non pare
idoneo a permettere al pubblico di cogliere il contenuto commerciale e
pubblicitario GHLPHVVDJJLFRPXQLFDWLDWWUDYHUVRO¶LQVHULPHQWR di mar-
chi e prodotti in quanto è difficile che tutti gli spettatori prestino la
dovuta attenzione ai titoli di coda.
,QILQHLOQHJR]LRDOODEDVHGHOO¶DFFRUGRGLproduct placement è un
contratto. Sebbene la legge non disponga nulla rispetto al contratto (in
quanto il legislatore non ha tipizzato un contratto di product place-
ment), la dottrina che si è occupata della sua qualificazione lo ricon-
duce ad un contratto di appalto di servizi. A parere di chi scrive, tale
ricostruzione non può che essere corretta: si tratta evidentemente di un
QHJR]LRDSUHVWD]LRQLFRUULVSHWWLYHLQFXLXQDSDUWHO¶LPSUHVDFLQHPa-
tografica, offre ± come servizio ± il collocamento dei marchi o prodot-
WLDOO¶LQWHUQRGHOOHVcene realizzanGHO¶DOWUDSDUWH O¶LPSUHVDSURSULHWa-
ULDGHLPDUFKLRSURGRWWLSDJKHUjLQIDYRUHGHOO¶LPSUHVDFLQHPDWRJUa-
fica un corrispettivo quale contropartita del servizio offerto da
XIII. Opera e impresa cinematografica 265

TXHVW¶XOWLPD HDOWURODWRGHOODPHGDJOLDLOFRUULVSHWWLYRRYYLDPHQWH
rappresenta XQD ULVRUVD ILQDQ]LDULD D GLVSRVL]LRQH GHOO¶LPSUHVD FLQe-
matografica nella realizzazione del film). Possiamo facilmente imma-
JLQDUHFKHO¶DFFRUGRVXOFRUULVSHWWLYRQRQVDUjIDFLOHGDUDJJLXQJHUH
Gli interessi delle due parti appaiono ben definiti (la pubblicizzazione
indiretta di un marchio o prodotto e la raccolta di contributi economi-
ci), al contrario delle modalità con le quali realizzarli. La negoziazione
sul come effettivamente inserire in scena il marchio o prodotto richie-
GHXQ¶DWWHQWDSLDQLILFD]LRQH in quanto, come abbiamo visto, non può
prescindere dalla trama del film; bisognerà allora comprendere, ad
esempio, quale prodotto associare a quale dei personaggi, se nella si-
tuazione scenica è realistico inserire un marchio o prodotto, quante
volte reiterDUHLOPHVVDJJLRLQGLUHWWRRYYHURYDOXWDUHO¶LPSRUWDQ]DFKH
un marchio o prodotto può avere nella pellicola con la potenzialità di
ottenere ± per assurdo ± una sorta di ruolo. Il corrispettivo sarà quindi
sicuramente commisurato rispetto alla centralità o marginalità attribui-
ta al marchio o prodotto, ma anche rispetto alla durata del potenziale
sfruttamento. Infatti, molti film restano nelle sale per un periodo mol-
to più esteso di altri; alcuni, passano direttamente dalle sale cinemato-
grafiche alla riproduzione televisiva, senza la distribuzione su supporti
home video (fonte di ulteriore e duratura pubblicità del marchio o
SURGRWWR  DYHUH OD SRVVLELOLWj GL HVWHQGHUH QHO WHPSR O¶HIILFDFLD GHO
messaggio pubblicitario influirà evidentemente sulla determinazione
GHOO¶DPPRQWDUHGHOFRUULVSHWWLYR
In conclusione, il product placement è ormai uno strumento am-
piamente diffuso e affermato nel settore cinematografico (esistono
delOH VRFLHWj FKH VL RFFXSDQR HVDWWDPHQWH GL DJHYRODUH O¶LQFRQWUR WUD
domanda e offerta, offrendo anche consulenza alle parti coinvolte sul
tipo di prodotti potenzialmente inseribili nelle scene nonché sulle mo-
dalità di inserimento) che porta con sé una serie di benefici di cui go-
dono sicuramente le imprese di produzione cinematografica e le im-
prese proprietarie dei marchi o prodotti, ma anche ± perché no? ± lo
spettatore (potenziale) consumatore finale. Le lacune normative (di-
sparità di trattamento tra film nazionali e stranieri, assenza di controllo
sul messaggio pubblicitario effettivamente trasmesso) sono certamente
da colmare; pertanto, in considerazione del crescente sviluppo che ha
caratterizzato la normativa del settore cinematografico negli ultimi
266 Manuale di diritto delle arti e dello spettacolo

anni e degli interessi coinvolti nella regolamentazione della pubblicità,


non pare irragionevole auspicare un prossimo intervento del legislato-
re.

13.2.4. I contratti di distribuzione cinematografica

Il contratto di distribuzione cinematografica è il principale strumento


giuridico attraverso il quale il produttore realizza i suoi interessi eco-
nomici, esercitando i diritti di sfruttamento di cui ± come illustrato nel
paragrafo precedente ± è titolare.
Anche il contratto di distribuzione cinematografica, al pari del pro-
duct placement, non è tipizzato nel nostro ordinamento. Tuttavia, la
sua natura pare riconducibile al contratto di mandato di cui agli artt.
1703 e ss. cod. civ.. Analizzando il meccanismo di funzionamento
della distribuzione cinematografica e della sua catena, a grandi linee,
il produttore (che potrebbe provvedere da sé allo sfruttamento
GHOO¶RSHUD VLDYYDOHGLLPSUHVHQHOVHWWRUHGHOODGLVWULEX]LRQHFLQHPa-
tografica su larga scala. Tali imprese rendono la distruzione capillare,
rivolgendosi a loro volta a imprese di distribuzione di dimensioni più
contenute che operano su piccola scala. In coda alla catena di distribu-
zione vi sono gli esercenti delle sale cinematografiche: è con costoro
che le imprese di distribuzione locale negoziano e stipulano il contrat-
to di proiezione cinematografica.
Sia i distributori su larga scala che quelli locali riceveranno natu-
ralmente un corrispettivo il quale, nella prassi, è commisurato alla
quantità di incassi ottenuti dal film. Ne risulta che entrambi, avranno
WXWWRO¶LQWHUHVVHDGLVWULEXLUHODSHOOLFRODQHOPRGRSLHIILFDFHSRVVLEi-
OH FRVu O¶LQWeresse del produttore e quello dei distributori sono con-
vergenti. Non bisogna però ricondurre, per questo fatto, il fine di
XQ¶RSHUD FLQHPDWRJUDILFD DO solo VIUXWWDPHQWR HFRQRPLFR XQ¶RSHUD
cinematografica è pur sempre una forma di spettacolo, ricca di valori
artistici, culturali e morali e resta, pertanto, una manifestazione del
pensiero artistico dei suoi autori.
Capitolo XIV

,EHQLFXOWXUDOLQHOO¶RUGLQDPHQWRJLXULGLFRLWDOLDQR
di CLARA MENALE

14.1. Introduzione

Il termine bene culturale si impone nelle varie legislazioni nazionali in


seguito alla Convenzione per la protezione dei beni culturali in caso di
FRQIOLWWRDUPDWRVLJODWDDOO¶$LDQHOSHQHWUDLQ,WDOLDDWWUDYHUVRL
lavori della Commissione Franceschini e rappresenta un momento
cruciale per la mutazione della concezione di bene culturale.
La Commissione ha rifiutato di ricorrere alla redazione di un cata-
logo chiuso di beni da proteggere, per assoggettare a tutela il bene cul-
turale non più come res, ma come rappresentazione di un valore im-
materiale. Nel 1967 è stata così introdotta la definizione di bene cultu-
rale come bene che costituisce una testimonianza materiale di civiltà.
Da questa definizione si evince che la nozione di bene culturale è
necessariamente aperta e risente profondDPHQWH GHOO¶evoluzione so-
cioculturale. Infatti non esiste una concezione immobile e perenne
GHOO¶DUWHGHOODVFLHQ]DR della cultura in genere.
Il concetto formulato dalla Commissione Franceschini è stato uffi-
cializzato dal d.l. 14 dicembre 1974, n. 657, convertito nella legge 29
gennaio 1975, n. 5, istitutiva del Ministero per i beni culturali e am-
bientali.
,QTXHVWDVHGHYHUUjLOOXVWUDWDLQOLQHDJHQHUDOHO¶HYROX]LRQHOHJLVOa-
WLYD GHO EHQH FXOWXUDOH QHOO¶RUGLQDPHQWR LWDOLDQR ,Q SDUWLFRODUH YHr-
ranno presi in considerazione il Testo Unico sui beni culturali (d.lgs.
29 ottobre 1999, n. 490), il quale rappresenta un primo tentativo di or-
267
268 Manuale di diritto delle arti e dello spettacolo

ganizzazione della normativa in materia di beni culturali e ambientali


emessa nel corso del Novecento, ed il Codice dei Beni culturali (d.lgs.
22 gennaio 2004, n. 42) che rappresenta attualmente il nostro punto di
riferimento in ambito legislativo. Verranno esposte le novità introdotte
da tali decreti legislativi ma anche le incongruenze e le mancanze in
materia di tutela, promozione, valorizzazione e gestione dei beni cul-
turali.
/DFRQFOXVLRQHGLTXHVWRTXDGURJHQHUDOHGHOO¶RUGLQDPHQWRLWDOLDQR
VXLEHQLFXOWXUDOLqVWDWDGHGLFDWDDOODVWUXWWXUDHDOO¶RUJDQL]]D]LRQHGHO
Ministero dei beni, delle attività culturali e del turismo.

14.2. Il Testo Unico sui beni culturali

/¶HPDQD]LRQHGHO7HVWR8QLFRVXLEHQLFXOWXUDOLFRQLOGOJVRWWo-
bre 1999, n. 490, rappresenta un primo tentativo di organizzazione
della normativa in materia di beni culturali e ambientali emessa nel
corso del Novecento.
Il Testo Unico è definito come un insieme di norme che raccoglie
in un unico contesto di legge una serie di disposizioni emanate disor-
ganicamente ed in tempi diversi sulla stessa materia creando così pos-
sibili problemi di interpretazione e/o coordinamento.
/¶HPDQD]LRQH del Testo Unico fu possibile grazie alla legge del 15
marzo 1997, n. 59, e al decreto legislativo 31 marzo 1998, n. 112, con
le quali si definirono le aree di competenza istituzionale riservate allo
Stato e quelle attribuite, in via esclusiva o in forma congiunta allo Sta-
to stesso, alle Regioni e agli enti locali. Di fondamentale importanza
IX O¶LQWURGX]LRQH GHOOH QXRYH GHILQL]LRQL di bene culturale, di bene
ambientale e dei concetti di tutela, promozione, valorizzazione e ge-
stione degli stessi. Questi concetti furono ottenuti rielaborando gli
elementi di riferimento della legislazione in materia dei beni culturali
ed ambientali.
Fu poi approvata la legge 8 ottobre 1997, n. 352, con la quale il
Governo fu delegato ad emanare, entrRXQDQQRGDOO¶entrata in vigore
della legge, un decreto legislativo recante un Testo Unico nel quale
fossero riunite e coordinate tutte le disposizioni legislative vigenti in
materia di beni culturali e ambientali.
XIV. ,EHQLFXOWXUDOLQHOO¶RUGLQDPHQWRJLXULGLFRLWDOLDQR 269

Attraverso la delegazione legislativa prHYLVWDGDOO¶DUW. 76 della Co-


VWLWX]LRQH q SRVVLELOH O¶HPDQD]LRQH GL XQ 7HVWR Unico da parte del
Governo con determinazione di principi e criteri direttivi e soltanto
per tempo limitato e per oggetti definiti ponendo quindi limiti molto
chiari e precisi per quanto riguarda la competenza, il contenuto, di
tempo, di finalità e di forma. Il Testo Unico sui beni culturali è dun-
que di tipo codicistico, cioè SUHYHGH LO ULRUGLQR GHOO¶LQWHUD materia e
presenta elementi di WLSRLQGXWWLYRSURYYHGHQGRDOO¶DVVHPEODJJLRdel-
le normative sostanziali in materia legislativa e procedimentale.
Dal punto di vista strutturale il Testo Unico si compone di due tito-
li: il primo riservato ai beni culturali (compresi i beni archeologici e
demo-etno-antropologici) e il secondo riservato ai beni ambientali.
Come è stato già sottolineato, la legge di delega presentava dei li-
miti alla delega stessa. Con la difficoltà sorta innanzitutto in relazione
alO¶LQGLYLGXD]LRQHGHOO¶RJJHWWRGHOQXRYRSURYYHGLPHQWRHGHOPDWe-
riale normativo da includere, si tenne conto allora delle norme che
prendevano in considerazione il bene nella sua materialità e in rela-
zione ai valori culturali e storici che esprime. Furono escluse, invece,
OHGLVSRVL]LRQLULJXDUGDQWLO¶RUJDQL]]D]LRQHDPPLQLVWUDWLYDHODVWUXt-
tura del Ministero e di conseguenza le disposizioni relative alla disci-
plina delle attività di natura amministrativa, finanziaria e contabile.
Furono invece introdotte norme di raccordo per procedimenti com-
plessi come la VIA (Valutazione di Impatto Ambientale).
Per quanto riguarda gli archivi, i procedimenti per la tutela dei beni
culturali furono estesi alle funzioni di vigilanza sugli archivi stessi,
FROO¶LQWHQWR di equiparare gli archivi agli altri beni culturali.
Inoltre SHU ULGXUUH OD JHQHULFLWj H O¶indeterminatezza delle norme
SUHHVLVWHQWL O¶LQWULFDWR VLVWHPD GHOOH VDQ]LRQL IX FRPSOHWDPHQWH Ui-
scritto al fine di adeguarlo ai principi costituzionali relativi alle norme
in materia penale.

14.3. Il Codice dei beni culturali e del paesaggio

Il Codice dei beni culturali e del paesaggio ha abrogato il Testo Unico


H TXLQGL DO PRPHQWRq O¶XQLFD GLVFLSOLQD QRUPDWLYD GL ULIHULPHQWR LQ
materia di beni culturali e ambientali. Entrato in vigore il primo mag-
270 Manuale di diritto delle arti e dello spettacolo

gio 2004, si compone di 184 articoli e si articola in 5 parti.


La prima parte (artt. da 1 a 9), riguarda le disposizioni generali; la
seconda parte (artt. da 10 a 130) è divisa in tre titoli e disciplina tutta
la materia relativa ai beni culturali, mentre la parte terza, composta da
un solo titolo (artt. da 131 a 159), tratta dei beni paesaggistici; la parte
quarta (artt. da 160 a 181), divisa in due titoli, dispone in ordine alle
sanzioni; la parte quinta (artt. da 182 a 184), infine, contiene le dispo-
sizioni transitorie e le abrogazioni disposte.
Il nuovo Codice dei beni culturali riprende in gran parte la norma-
tiva del Testo Unico, ma vi aggiunge alcuni elementi innovativi; non
si limita alla riorganizzazione della disciplina vigente, ma mira alla
codificazione della materia.
La prima novità del Codice è costituita dalla parte generale che
rappresenta con i primi articoli (da 1 a 9) la chiave di lettura di tutte le
norme seguenti.
8Q¶Dltra novità è il trattamento unitario di tutela e valorizzazione:
la tutela viene ricondotta alla pubblica fruizione, riproponendo un mo-
dello che vede lo Stato, le Regioni e gli Enti locali agire con
O¶RELHWWLYRGLFRVWUXLUHXQVLVWHPDLQWHJUDWRGLYDORUL]]D]LRne. In parti-
colare il terzo comma GHOO¶DUW. 1 prevede che lo Stato e gli altri enti
pubblici territoriali assicurino e sostengano la conservazione del pa-
trimonio culturale e ne favoriscano la pubblica fruizione e la valoriz-
zazione.
Anche i commi primo e terzo GHOO¶DUW 6 introducono alcuni elemen-
ti innovativi rispetto alla precedente legislazione: O¶HVWHQVLRQHGHOFRn-
cetto di valorizzazione anche agli interventi di conservazione del pa-
trimonio culturale H O¶DSHUWXUD DOOD SDUWHFLSD]LRQH GL VRJJHWWL SULYDWL
alle attività di valorizzazione del patrimonio culturale.
,QROWUH DO SURSULHWDULR GHO EHQH FXOWXUDOH YLHQH SRVWR O¶REEOLJR Gi
garaQWLUQHODFRQVHUYD]LRQHDOO¶DUW 1, quinto comma, si prevede che i
privati proprietari possessori o detentori di beni appartenenti al patri-
monio culturale sono tenuti a garantirne la conservazione. Questo
elemento non era presente nella precedente legislazione, secondo la
TXDOH O¶REEOLJR GL JDUDQ]LD GHOOD FRQVHUYD]LRQH DYYHQLYD VROR FRPH
FRQVHJXHQ]D GHOO¶HVHUFL]LR GHO SRWHUH GL FRQWUROOR
deOO¶$PPLQLVWUD]LRQH SHUHVHPSLRFRQO¶LPSRVL]LRQHGLXQLQWHUYHn-
to di restauro).
XIV. ,EHQLFXOWXUDOLQHOO¶RUGLQDPHQWRJLXULGLFRLWDOLDQR 271

Un bene di proprietà privata è soggetto alla disciplina di cui al


d.lgs. 42/20TXDORUDLO0LQLVWHURDFFHUWLO¶LQWHUHVVHFXOWXUDOHGHOEe-
ne.
Nello specifico, i beni di proprietà privata che rivestono pubblico
interesse possono essere divisi in due categorie: i beni vincolati e i be-
ni di rilevanza pubblica.
I beni vincolati sono beni che non possono essere liberamente fruiti
dai proprietari essendo egli stesso sottoposto ad autorizzazioni per
O¶HVHUFL]LR GL GHWHUPLQDWH D]LRQL LO YLQFROR SXz HVVHUH GHWHUPLQDWR
dalla natura stessa del bene (strade, porti) o da un provvedimento am-
ministrativo (vincolo artistico, storico, paesaggistico).
I beni di rilevanza pubblica invece sono beni per cui è prevista una
utilizzazione da parte del proprietario, che pur essendo libero nel suo
godimento ha l¶REEOLJRGLPLJOLRUDUHLOEHQHR di sfruttarlo in modo da
garantire delle utilità sociali e per questo deve tener conto di determi-
nate direttive della Pubblica Amministrazione.
Il Ministero, la Regione o un altro ente pubblico territoriale interes-
sato al bene hanno la facoltà di acquistare in via di prelazione i beni
FXOWXUDOLYLQFRODWLDOPHGHVLPRSUH]]RVWDELOLWRQHOO¶DWWRGLDOLHQD]Lo-
ne.
Il procedimento di prelazione disciSOLQDWR GDOO¶DUW  q DUWLFRODWR
come segue. Il soprintendente, ricevuta la denuncia di un atto soggetto
a prelazione, ne dà immediata comunicazione alla Regione e agli altri
enti pubblici territoriali nel cui ambito si trova il bene. Trattandosi di
bene mobile, la Regione ne dà notizia sul proprio Bollettino Ufficiale
ed eventualmente attraverso mezzi di pubblicità idonei a livello nazio-
QDOHFRQODGHVFUL]LRQHGHOO¶RSHUD HO¶LQGLFD]LRQHGHOSUH]]R/D5e-
gione e gli altri enti pubblici territoriali, nel termine di venti giorni
dalla denuncia, formulano al Ministero una proposta motivata di pre-
OD]LRQHFRUUHGDWDGDOODGHOLEHUD]LRQHGHOO¶RUJDQRFRPSHWHQWHFKHSUe-
GLVSRQJDDYDOHUHVXOELODQFLRGHOO¶HQWHODQHFHVVDULDFRSHUWXUDILQDn-
ziaria della spesa indicando le specifiche finalità di valorizzazione cul-
turale del bene (tale disciplina è VWDWDLQWHJUDWDGDOO¶DUW 2 del d.lgs. n.
156 del 2006).
Una rilevante novità apportata dal nuovo Codice dei beni culturali
e del paesaggio è rappresentata dalO¶LQWURGX]LRQHGHOSURFHGLPHQWRGL
³YHULILFDGHOO¶LQWHUHVVHFXOWXUDOH´GHOEHQHGLFXLDOO¶DUW12:
272 Manuale di diritto delle arti e dello spettacolo

Art. 12
1. /HFRVH LPPRELOL H PRELOL LQGLFDWHDOO¶DUWLFRORFRPPDFKHVLDQR
opera di autore non più vivente e la cui esecuzione risalga ad oltre cin-
quanta anni, sono sottoposte alle disposizioni del presente Titolo fino a
quando non sia stata effettuata la verifica di cui al comma 2.
2. ,FRPSHWHQWLRUJDQLGHO0LQLVWHURG¶XIILFLRRVXULFKLHVWDIRUPXODWDGDL
soggetti cui le cose appartengono e corredata dai relativi dati conoscitivi,
YHULILFDQR OD VXVVLVWHQ]D GHOO¶LQWHUHVVH DUWLVWLFR VWRULFR DUFKHRORgico o
etnoantropologico nelle cose di cui al comma 1, sulla base di indirizzi di
carattere generale stabiliti dal Ministero medesimo al fine di assicurare
uniformità di valutazione.

Tale procedimento è previsto per i beni culturali di proprietà dello


Stato, delle Regioni e degli altri enti pubblici territoriali e per le per-
VRQHJLXULGLFKHSULYDWHVHQ]DILQLGLOXFURFRVuFRPHHOHQFDWLDOO¶DUW.
10 del Codice.
La verifica spetta al Ministero per i beni e le attività culturali, che
tramite i suoi organi competenti può effettuarla G¶XIILFLRRVXULFKLHVWD
degli enti proprietari del bene. Il Ministero ha quindi il compito di ve-
ULILFDUHODVXVVLVWHQ]DGHOO¶LQWHUHVVHFXOWXUDOHGHLEHQLGLSURSULHWjGHL
suddetti enti che quindi, fino a verifica contraria, sono considerati beni
culturali. Nel momento in cui il bene sottoposto a verifica risulta privo
G¶LQWHUHVVH FXOWXUDOH QRQ ULFDGH SL QHOO¶DPELWR GL DSSOLFD]LRQH GHO
Codice, può essere sdemanializzato ed è alienabile.
I beni di proprietà pubblica si suddividono in beni demaniali, beni
del patrimonio indisponibile e beni del patrimonio disponibile.
I beni demaniali sono quei beni che appartengono necessariamente
allo Stato e agli enti pubblici territoriali ed il loro regime è disciplina-
WRGDOO¶DUW. 823 cod. civ.. Il Demanio comprende quei beni che per loro
natura non possono che appartenere allo Stato o ad altri enti pubblici
territoriali (demanio marittimo, idrico, militare); i beni appartenenti ad
enti locali per una legge o atto amministrativo appartengono invece al
demanio accidentale (stradale, ferroviario, aeronautico, acquedotti e
demanio storico, archeologico, artistico, culturale).
I beni del patrimonio indisponibile sono individuati dal r.d. 18 no-
vembre 1923QHGDOO¶DUW 826 cod. civ.. In base a queste norme
si può affermare che fanno parte del patrimonio indisponibile dello
Stato le cose di interesse storico, archeologico, paleontologico e arti-
XIV. ,EHQLFXOWXUDOLQHOO¶RUGLQDPHQWRJLXULGLFRLWDOLDQR 273

stico, da chiunque e in qualunque modo ritrovate nel sottosuolo o sui


fondali marini. I beni del patrimonio indisponibile appartengono al pa-
trimonio dello Stato e sono destinati ad un pubblico servizio o ad altra
finalità di interesse generale. Il regime di tali beni è uguale a quello
dei beni demaniali finché dura la pubblica destinazione: infatti sono
alienabili purché venga mantenuta la destinazione pubblica, sono sog-
getti al diritto di usucapione purché venga mantenuta la destinazione
pubblica e inespropriabili salvo che per un pubblico interesse.
I beni del patrimonio disponibile sono individuati dal r.d. 18 no-
vembre 1923, n. 2440: sono quei beni appartenenti allo Stato e ad enti
territoriali destinati a produrre un reddito. Pertanto hanno un valore
economico e possono essere oggetto di rapporti contrattuali di diritto
privato. Dal 1922, per ridurUHO¶LQVRstenibile onere del debito pubbli-
co, lo Stato ha avviato una graduale dismissione, mediante
O¶DOLHQD]LRQH, di questi beni.
La terza parte del Codice, come già detto, tratta della tutela e della
valorizzazione del paesaggio. /¶LQFOXVLRQH GHO SDWULPRQLo paesaggi-
stico è dovuta alla Commissione Franceschini, che ribadisce come il
SDHVDJJLR VLD HOHPHQWR FDUDWWHUL]]DQWH GHOO¶LGHQWLWj FXOWXUDOH GHOOD
comunità nazionale. ,O FRPPD WHU]R GHOO¶DUW 2 individua i beni pae-
saggistici (scompare il termine ambientale) disponendo che sono tali
JOLLPPRELOLHOHDUHHLQGLFDWLQHOO¶DUW. 134 e FRVWLWXHQWL³HVSUHVVLRQH
dei valori storici, culturali, naturali, morfologici ed estetici del territo-
ULRHJOLDOWULEHQLLQGLYLGXDWLGDOODOHJJHRLQEDVHDOODOHJJH´ O¶DUW
131 disponHFKH³SHUSDHVDJJLRVLLQWHQGHXQDSDUWHRPRJHQHDGLWHr-
ritorio i cui caratteri derivano dalla natura, dalla storia umana e dalle
UHFLSURFKHLQWHUUHOD]LRQL´
Allo scopo di individuare criteri riguardanti attività di tutela, piani-
ficazione, recupero, riqualificazione e valorizzazione del paesaggio
O¶DUW. 132 prevede una cooperazione tra pubbliche amministrazioni.
In generale il Codice, fermo restando LOULVSHWWRGHOO¶LPSLDQWRWUDGi-
zionale, introduce novità relative alO¶DJJLRUQamento dei singoli istituti,
in riferimento ai modelli di gestione e valorizzazione, procedendo così
ad una sistemazione organica ed aggiornata di tutta la normativa in
tema di beni culturali.
274 Manuale di diritto delle arti e dello spettacolo

14.4. Il bene culturale: definizione e significato

La terminologia di bene culturale è relativamente recente ed è ancora


soggetta a dinamismi e a spinte innovatrici.
/D &RPPLVVLRQH )UDQFHVFKLQL ³&RPPLVVLRQH GL LQGDJLQH SHU OD
WXWHODHODYDORUL]]D]LRQHGHOOHFRVHG¶LQWHUHVVHVWRULFRDUFKHRORJLFR
DUWLVWLFR H GHO SDHVDJJLR´  LQWURGXVVH SHU OD prima volta in un docu-
PHQWR XIILFLDOH LOFRQFHWWR GL³EHQH FXOWXUDOH´ FKH VL DIIDFFLD SHU OD
SULPD YROWD D OLYHOOR LQWHUQD]LRQDOH FRQ OD &RQYHQ]LRQH GHOO¶$LD GHO
³&RQYHQ]LRQHSHUODSURWH]LRQHGHLEHQLFXOWXUDOLLQFDVRGLFRn-
IOLWWR EHOOLFR´  H DSSRrtò a questa nozione un radicale cambiamento.
Dal criterio estrapolato dalla l. n. 1089/1939, secondo il quale
O¶DVSHWWRHVVHQ]LDOHGHJOLRJJHWWLRFRVHG¶DUWHHUDODFRQQRWD]LRQHPa-
teriale, alla metà degli anni Sessanta si giunse così ad un criterio stori-
FLVWLFR VHFRQGR LO TXDOH ³DSSDUWHQJRQR DO SDWULPRQLR FXOWXUDOH GHOOD
1D]LRQHWXWWLLEHQLDYHQWLULIHULPHQWRDOODVWRULDGHOODFLYLOWj´
Il termine bene culturale LQTXDQWR³WHVWLPRQLDQ]DDYHQWHYDORUHGL
FLYLOWj´ ULPDQGD DG DOWUH GLVFLSOLQH LPSOLFDQGR Xn criterio di discre-
zionalità tecnica extragiuridica. La qualità culturale del bene compor-
ta una scissione tra la parte materiale di esso, che ne fa una cosa, e il
suo valore. Il suo carattere pubblico lo caratterizza non per
O¶DSSDUWHQHQ]DDTXHVWRRDTXel proprietario ma per gli aspetti di frui-
ELOLWjHTXLQGLGLVSRQLELOLWjDOO¶XVRGDSDUWHGLWXWWL
Il termine assume un valore riassuntivo nel senso che vuole ricon-
durre ad unità categorie diverse di valori, sottoponendole ad una di-
sciplina unitaria; tuttavia, è innegabile che vi è la necessità di ricorrere
ad una pluralità di regimi diversi poiché non esiste la possibilità di
unificare beni aventi una QDWXUDRJJHWWLYDPHQWHGLYHUVDVRWWRXQ¶XQLFD
GHILQL]LRQHHXQ¶XQLFDGLVFLSOLQD
Evidenti sono i problemi derivanti da una applicazione indiscrimi-
QDWDGHOODWHUPLQRORJLD³beni culturali´ nella prassi. Se prendiamo in
considerazione i beni demo-etno-antropologici o il caso specifico del-
lo spettacolo riscontreremo come nella definizione del T.U. d.lgs.
490/99, Titolo I, art. 2, primo comma, punto a, i beni culturali e imma-
teriali sono rimasti esclusi dal Testo UQLFR SHUFKp QRQ VRQR ³FRVH´
,QIDWWLVHFRQGRO¶DUWGHO&RGLFHsono beni culturali
XIV. ,EHQLFXOWXUDOLQHOO¶RUGLQDPHQWRJLXULGLFRLWDOLDQR 275

tutte le cose immobili e mobili che, ai sensi degli articoli 10 e 11 del Codice
stesso, presentano interesse artistico, storico, archeologico, etnoantropologi-
co, archivistico e bibliografico e le altre cose individuate dalla legge o in base
alla legge quali testimonianze aventi valore di civiltà.

È chiaro dunque che il Codice dei beni culturali, a differenza del


Testo Unico e al di là delle catalogazioni, dispone un metodo per in-
cludere nella categoria dei beni culturali le testimonianze aventi valore
di civiltà, lasciando così la possibilità di qualificare come beni cultura-
li anche beni immateriali.
Il Codice presuppone una definizione ampia di bene culturale po-
QHQGRO¶DFFHQWRQRQVXOODWLWRODULWjGHOEHQHPDVXOODIXQ]LRQHVWRULFD
e sociale che il bene stesso svolge. Sotto questo punto di vista muta
anche il concetto di tutela dei beni culturali, che, da statico e basato
sulla protezione materiale (Testo Unico), si evolve in un modello di-
namico incentrato sulla valorizzazione.
Per comprendere meglio le tematiche legate alla tutela, è doveroso
far riferimento al Capo I che iQGLYLGXDO¶RJJHWWRGHOODWXWHODHGLQSDr-
WLFRODUHDOFRPPDSULPRGHOO¶DUWLOTXDOHVWDELOLVFHFKHVRQREHQL
culturali le cose immobili e mobili appartenenti allo Stato, alle Regio-
ni, agli altri Enti pubblici territoriali, nonché ad ogni altro Ente ed Isti-
tuto e a persone giuridiche private senza fine di lucro, che presentano
interesse artistico, storico, archeologico o etnoantropologico; inoltre,
al secondo comma, precisa che sono beni culturali:

a) le raccolte di musei, pinacoteche, gallerie e altri luoghi espositivi dello


Stato, delle regioni, degli altri enti pubblici territoriali, nonché di ogni al-
tro ente ed istituto pubblico;
b) gli archivi e i singoli documenti dello Stato, delle regioni, degli altri enti
pubblici territoriali, nonché di ogni altro ente ed istituto pubblico;
c) le raccolte librarie delle biblioteche dello Stato, delle regioni, degli altri
enti pubblici territoriali, nonché di ogni altro ente e istituto pubblico, ad
HFFH]LRQHGHOOHUDFFROWHGHOOHELEOLRWHFKHLQGLFDWHDOO¶DUWLFROR 47, comma
2, del decreto del Presidente della Repubblica 24 luglio 1977, n. 616, e di
quelle ad esse assimilabili.

Inoltre possono essere considerati beni culturali, dopo che sia in-
tervenuta la dichiarazione delO¶LQWHUHVVHFXOWXUDOHSUHYLVWD GDOO¶DUW3
del Codice:
276 Manuale di diritto delle arti e dello spettacolo

a) le cose immobili e mobili che presentano interesse artistico, storico, ar-


cheologico o etnoantropologico particolarmente importante, appartenenti
a soggetti diversi da quelli indicati al comma 1;
b) gli archivi e i singoli documenti, appartenenti a privati, che rivestono inte-
resse storico particolarmente importante;
c) le raccolte librarie, appartenenti a privati, di eccezionale interesse cultura-
le;
d) le cose immobili e mobili, a chiunque appartenenti, che rivestono un inte-
resse particolarmente importante a causa del loro riferimento con la storia
SROLWLFD PLOLWDUHGHOOD OHWWHUDWXUDGHOO¶DUWHHGHOODFXOWXUDLQJHQHUHRv-
YHUR TXDOL WHVWLPRQLDQ]H GHOO¶LGHQWLWj H GHOOD VWRULD GHOOH LVWLWX]LRQL SXb-
bliche, collettive o religiose;
e) le collezioni o serie di oggetti, a chiunque appartenenti, che, per una tra-
dizione, fama e particolari caratteristiche ambientali, rivestono come
complesso un eccezionale interesse artistico o storico.

6HFRQGR LO &RGLFH TXLQGL O¶LQGLYLGXD]LRQH GHL EHQL FXOWXUDOL QRQ


avviene esclusivamente sulla base di categorie predefinite: in alcuni
casi, infatti, come abbiamo visto, è prevista una procedura di verifica
GHOO¶LQWHUHVVHFXOWXUDOHDOO¶HVLWRGHOODTXDOH, in mancanza dei presup-
posti previsti dalla legge, si determina O¶LQDSSOLFDEilità delle disposi-
zioni contenute nel Codice.
Sono comprese tra le cose indicate al primo e al terzo comma, lett.
a):

a) le cose che interessano la paleontologia, la preistoria e le primitive civil-


tà;
b) le cose di interesse numismatico FKHLQUDSSRUWRDOO¶HSoca, alle tecniche
e ai materiali di produzione, nonché al contesto di riferimento, abbiano
carattere di rarità o di pregio, anche storico;
c) i manoscritti, gli autografi, i carteggi, gli incunaboli, nonché i libri, le
stampe e le incisioni, con relative matrici, aventi carattere di rarità e di
pregio;
d) le carte geografiche e gli spartiti musicali aventi carattere di rarità e di
pregio;
e) le fotografie, con relativi negativi e matrici, le pellicole cinematografi-
che ed i supporti audiovisivi in genere, aventi carattere di rarità e di
pregio;
f) le ville, i parchi e i giardini che abbiano interesse artistico o storico;
g) le pubbliche piazze, vie, strade e altri spazi aperti urbani di interesse ar-
tistico o storico;
h) i siti minerari di interesse storico od etnoantropologico;
XIV. ,EHQLFXOWXUDOLQHOO¶RUGLQDPHQWRJLXULGLFRLWDOLDQR 277

i) le navi e i galleggianti aventi interesse artistico, storico od etnoantropo-


logico;
l) le architetture rurali aventi interesse storico od etnoantropologico quali
WHVWLPRQLDQ]HGHOO¶HFRQRPLDUXUDOHWUDGL]LRQDOH

14.5. Il Ministero dei beni e delle attività culturali e del turismo

Il Ministero dei beni e delle attività culturali e del turismo, noto anche
FRQO¶DFURQLPRMiBACT, è il dicastero del Governo Italiano preposto
alla tutela della cultura e dello spettacolo, alla conservazione del pa-
trimonio artistico, culturale e del paesaggio e alle politiche inerenti al
turismo. La struttura organizzativa del dicastero è piuttosto complessa
e nel corso degli anni è stata oggetto di ripetute modifiche.
Il Ministero per i Beni Culturali e Ambientali fu istituito da Gio-
vanni Spadolini con d.l. 14 dicembre 1974, n. 657, convertito nella
legge 29 gennaio 1975, n. 5, come Ministero appositamente costituito
per la specifica competenza della gestione del patrimonio culturale e
GHOO¶DPELHQWH, DO ILQH GL DVVLFXUDUH O¶RUJDQLFD WXWHOD GL LQWHressi di
estrema rilevanza sul piano interno e nazionale. Questo Ministero rac-
colse le competenze e le funzioni in materia che prima erano del Mini-
stero della Pubblica Istruzione (Antichità e Belle Arti, Accademie e
Biblioteche), del Ministero degli Interni (Archivi di Stato) e della Pre-
sidenza del Consiglio dei Ministri (Discoteca di Stato, editoria libraria
e diffusione della cultura). È da sottolineare la nuova denominazione
di Ministero per i beni e le attività culturali contenuta nella legge n.
59/1997. Questa legge diede modo, così, di ampliare in modo signifi-
cativo le competenze del Ministero, contrariamente al principio del
decentramento amministrativo.
Con d.lgs. n. 368 del 20 ottobre 1998 venne istituito il nuovo Mini-
stero per i Beni e le Attività Culturali, il quale perse in larga parte le
attribuzioni in materia di beni ambientali, guadagnando invece compe-
tenze sullo sport, sullo spettacolo (dal teatro al cinema, dalla musica
alla danza, dal circo alle rappresentazioni itineranti), sul diritto
G¶DXWRUH VXOOD SURSULHWj OHWWHUDULD VXOOD SURPR]LRQH GHO OLEUR VXOOD
cultura architettonica e urbanistica e sulle attività multimediali, com-
petenze in precedenza dislocate presso la Presidenza del Consiglio dei
278 Manuale di diritto delle arti e dello spettacolo

Ministri. Fu riservata inoltre maggiore importanza alle funzioni tradi-


zionalmente devolute al Ministero GHOO¶,VWUXzione OD ULFHUFD H O¶DOWD
IRUPD]LRQH OD GLIIXVLRQH GHOO¶DUWH H GHOOD FXOWXUD LWDOLDQD OD SURPo-
zione culturale.
Nel 2006, con il d.l. 18 maggio 2006, n. 181, le competenze in ma-
teria di sport sono state assegnate al nuovo Dipartimento per le Politi-
che Giovanili e le Attività Sportive, presso la Presidenza del Consiglio
dei Ministri. Con la fine del 2006 i Dipartimenti sono stati sostituiti
dal Segretario generale, il quale, SHUTXDQWRDWWLHQHDOO¶DWWXD]LRQHGHOOH
linee SURJUDPPDWLFKHGHOO¶$UHDVLDYYDOH delle competenze dei Diret-
tori Generali, dei Dirigenti dei servizi, e, con funzioni di consulenza
su temi specifici, dei Dirigenti Generali.
Anche la promozione del turismo, precedentemente affidata al Mi-
nistero dello Sviluppo Economico, è stata affidata alla Presidenza del
Consiglio, presso il nuovo Dipartimento per lo sviluppo e la competi-
tività del turismo. Tuttavia la responsabilità di questa struttura è stata
affidata al Ministro per i beni e le attività culturali Francesco Rutelli.
Col governo Monti il dipartimento è stato unificato a quello per gli af-
IDULUHJLRQDOLHDOO¶XIILFLR per lo sport, creando il Dipartimento per gli
affari regionali, il turismo e lo sport.
Nel 2013 il governo Letta ha affidato al Ministro Massimo Bray le
competenze del turismo al Ministero, che ha assunto così O¶DWWXDOHGe-
nominazione di Ministero dei beni e delle attività culturali e del turi-
smo (MiBACT).
Capitolo XV

Il marketing culturale
di LAURA IENI

15.1. Introduzione

Il marketing è la disciplina che si occupa del mercato (il termine deri-


YD GDOO¶LQJOHVH market: mercato, il luogo nel quale avvengono gli
VFDPEL GL EHQL H VHUYL]L  H KD O¶Rbiettivo di coniugare le esigenze di
venditori e compratori attraverso studi sul prezzo dei beni e dei servizi
oggetto di scambio e sulla loro distribuzione, ma anche attraverso lo
sviluppo di idee volte a ottimizzare il rapporto tra domanda e offerta.
È stato di fondamentale importanza SHU O¶DIIHUPD]LRQH LQ (XURSD
del marketing quale disciplina necessaria alla nuova realtà economica
degli anni Ottanta O¶DSSRUWR GL 3KLOLS .RWOHU LO TXDOH OR KD GHILQLWR
come «processo sociale e manageriale diretto a soddisfare bisogni ed
esigenze attraverso processi di creazione e scambio di prodotti e valo-
UL «  O¶DUWH H OD VFLHQ]D GL LQGLYLGXDUH FUHDUH H IRUQLUH YDORUH SHU
soddisfare le esigenze di un mercato di riferimento realizzando un pro-
fitto». Gli studi di Kotler hanno inoltre contribuito ad ampliare
O¶DPELWR G¶LQGDJLQH del marketing dalla realizzazione del prodotto e
GDOO¶DQDOLVLGHL risultati economici delOHYHQGLWHDOO¶RVVHUYD]LRQHGHOOH
esigenze del mercato e dei clienti.
Nello specifico, il marketing culturale studia le modalità di promo-
zione di eventi culturali, opere G¶DUWHe spettacoli.
Nonostante tale materia abbia riscontrato inizialmente una certa
ostilità negli ambienti culturali, poiché considerata poco affine o addi-

279
280 Manuale di diritto delle arti e dello spettacolo

rittura diametralmente opposta alle attività umanistiche, nel corso del


tempo si è affermata come indagine economica non più esclusivamen-
te fondata su matematica e statistica, ma disposta a sfruttare strumenti
di ricerca propri della psicologia, delO¶DQWURSRORJLD della filosofia e
della sociologia, per osservare, alla luce degli andamenti del mercato,
i mutamenti delle esigenze GHOODGRPDQGDHGHOO¶RIIHUWD
Sin dagli anni Sessanta, IXRULG¶,WDOLDH prevalentemente negli Stati
Uniti e nel Regno Unito, gli studiosi della materia hanno messo a pun-
to metodi di ricerca volti a coniugare cultura e marketing. Questo
orientamento è stato recepito in Italia FRQTXDVLWUHQW¶DQQLGLULWDUGR
VWDQWHLOULILXWRDOOD³PHUFLILFD]LRQH´GHOODFXOWXUD,QVHJXLWRSroba-
bilmente per lo stato in cui versava, il prodotto culturale è stato consi-
derato DOODVWUHJXDGHJOLDOWULRJJHWWLGD³YHQGHUH´DOSXEEOLFRHFRPH
tale soggetti a commercio, concorrenza e gradimento del consumatore.
Le imprese culturali, peraltro, rappresentano un elemento imprescin-
dibile per ogni 3DHVHHDQFRUGLSLSHUO¶Italia, che conserva un patri-
monio artistico e culturale di inestimabile ricchezza.
Durante gli ultimi due decenni, si è presa più coscienza dei disagi
che purtroppo vessano il settore culturale, ai quali si è aggiunta da ul-
tima la recente crisi economica che ha ridotto ulteriormente i fondi a
disposizione degli enti culturali costringendo questi ultimi a dover ri-
correre a finanziamenti privati o a limitare la propria attività. A causa
di questi eventi, è stato necessario ricorrere a nuovi metodi di ricerca e
promozione. Difatti oggi i musei, i teatri, le mostre private, le gallerie,
le radio, le imprese cinematografiche e i festival sono marketing
oriented.
Il primo a teorizzare compiutamente il marketing culturale è stato il
canadese François Colbert, il quale, DOO¶LQWHUQRGHOVXRPDQXDOHinte-
ramente dedicato al Marketing delle arti e della cultura, pubblicato nel
2000, ha abbinato alla nota teoria del marketing mix ± sviluppata già
DOOD ILQH GHJOL DQQL ¶ H LQFHQWUDWD VXOO¶DQDOLVL GHOOH ³TXDWWUR 3´ le
quattro componenti fisse: prodotto, prezzo, distribuzione (placement)
e promozione ± un nuovo approccio basato sul consumatore (customer
satisfaction). Alla luce di ciò, il marketing deve rappresentaUHO¶DQHOOR
di congiunzione tra il prodotto e il fruitore. Come si evince dal model-
lo tratto da suddetto manuale, Colbert ritiene che in primo luogo il
processo prende YLWDGDOO¶HQWHFXOWXUDOHFRn la creazione del prodotto;
XV. Il marketing culturale 281

in secondo luogo O¶HQWHPHGHVLPRVFHglie la fascia di mercato cui si


dovrà rivolgere (target); e infine si individuano gli elementi relativi a
prezzo, distribuzione e promozione. Di seguito il modello di Colbert:

15.2. Le principali variabili socio-demografiche del mercato dei


consumatori

Per creare un evento è necessario iniziare dalla scelta del soggetto e/o
oggetto da promuovere. In seguito, opportune ricerche svolte da ope-
ratori del settore aiuteranno il produttore a indirizzare la promozione
verso lo specifico tipo di affluenza che si desidera attirare, sul presup-
posto, quindi, che egli sia cosciente del target di partecipanti cui mira
(ad esempio, IDVFHG¶HWjGLYHUVHVDUDQQo attratte da prodotti diversi).
BLVRJQD SHUWDQWR LQWXLUH DWWUDYHUVR XQ¶DQDOLVL GHOOH SUHIHUHQ]H GHO
mercato di riferimento, se ciò che si offre possa piacere al pubblico.
PURSULRLQTXHVWDIDVHGLULFHUFDHFRVWUX]LRQHGHOO¶HYHQWRHQWUDQRLQ
gioco tutte le materie socioculturali citate nel precedente § 15.1. Con-
seguentemente viene eseguito uno screening del campione di pubblico
che si vuole conquistare. A tal proposito, le variabili da dover prende-
re in considerazione sono numerose.
282 Manuale di diritto delle arti e dello spettacolo

IQQDQ]LWXWWR O¶età è la prima variabile che può determinare gusti


discordanti. Come appena anticipato, non tutte le fasce di età sono in-
teressate alle medesime attività: ad esempio, un adolescente e un an-
ziano ascolteranno musica diversa, presumibilmente il primo opterà
per un gruppo rock-pop mentre il secondo per musica da camera o per
vecchia musica della sua gioventù.
In secondo luogo la provenienza geografica, che apparentemente
può non sembrare una discriminante. È stato invece provato statisti-
camente che vi sono notevoli differenze nel livello di partecipazione
agli eventi culturali in base alle regioni o alle città di provenienza.
Prendendo come esempio il nostro Paese, purtroppo, è stato rilevato
che nelle regioni del Nord Italia vi è maggiore affluenza ai musei, ai
teatri e alle manifestazioni culturali rispetto alle regioni del Sud Italia.
Infatti, come si evince dalle riviste specializzate e dai media, viene al-
lestito un maggior numero di grandi eventi nelle grandi città, soprat-
tutto in quelle del Centro-Nord.
8Q¶DOWUD YDULDELOH GD SUHQGHUH LQ HVDPH LQ SDUWH OHJDWD D TXHOOD
precedente, è il livello culturaleTXHVW¶XOWLPRFUHDXQDJUDQGHGLVFUe-
panza di comportamenti e dipende sia dal grado di istruzione raggiun-
to da un soggetto che dal tipo di interesse che nutre nei confronti della
cultura (quanti libri legge o quanti film vede, ovvero quanto spesso si
rechi a teatro o al museo).
Infine bisogna tener presente la capacità economica, un fattore
fondamentale per la partecipazione ad eventi di ogni tipo. In seguito
alOD FULVL ILQDQ]LDULD FKH LQIOXHQ]D O¶DWWXale condizione socio-
economica, molte persone, nonostante un discreto livello culturale,
una grande curiosità o una passione legata al campo artistico, non pos-
sono prender parte agli eventi poiché non se lo possono permettere.
Le quattro variabili sopra descritte non sono da considerare assolu-
te. Invero, esistono delle eccezioni che rappresentano ulteriori variabi-
li a sé stanti: giovani appassionati di musica classica, anziani che si
recano agli eventi giovanili (ad esempio per accompagnare il figlio o
il nipote); individui istruiti non realmente colti o viceversa individui
che non hanno avuto la possibilità di studiare ma molto interessati agli
eventi culturali; persone benestanti alle quali non interessa assoluta-
mente la cultura ovvero che frequentano il teatro solo per affermare il
proprio stato sociale; infine, chi pur, non abbiente, fa dei sacrifici per
XV. Il marketing culturale 283

seguire le proprie passioni. Proprio per questo, solo alla fine del pro-
cesso di analisi si desume quale sia il mercato potenziale e quale quel-
lo reale, vale a dire quali sono i soggetti cui effettivamente indirizzare
il prodotto.
Da quanto affermato, risulta evidente che nelle ricerche statistiche
da compiere bisognerà tener conto di più fattori. Se con lo stesso pro-
dotto si vorranno attirare target di pubblico diversi, allora saranno ne-
FHVVDULH SL VWUDWHJLH SHU FRQTXLVWDUH O¶DWWHQ]LRQH GL XQ SXEEOLFR più
vasto (tra le quali lo svilXSSRGLXQ¶DGHJXDWDSXEEOLFLWjsi veda il suc-
cessivo § 15.4).

15.2.1 Il turismo

Nonostante il turismo non faccia prettamente parte delle segmentazio-


ni sociali di una popolazione, sarebbe opportuno svolgere degli studi
statistici per comprenderne a fondo le potenzialità; in Italia e in parti-
colar modo in determinate zone, il turismo contribuisce in maniera
FRQVLVWHQWHDOO¶HFRQRPLDDOSXQWRFKHVLSXzSDUODUHGL³WXULVPRFXl-
WXUDOH´3URSULRLOQRVWUR3DHVHYDQWDXQDVHULHQumerosa di beni cultu-
rali e artistici e una consolidata tradizione musicale e teatrale ricono-
sciuta in tutto il mondo: il turismo (sia interno che esterno) rappresen-
ta una risorsa importantissima, sebbene non sfruttata adeguatamente.
Quotidianamente centinaia di turisti visitano i monumenti più noti,
soprattutto nelle grandi città. Tuttavia, anche i luoghi meno accessibili
e meno conosciuti necessitano di un incremento di pubblicità e fruibi-
lità e, allo stesso modo, le località con un patrimonio meno accattivan-
te dovrebbero trovare dei metodi alternativi per attirare pubblico. Co-
sì, negli ultimi anni, sono diventati frequenti festival dedicati a libri,
film, musica, filosofia o gastronomia, che vengono riproposti sempre
nel medesimo luogo così da creare una tradizione: il Festival della Fi-
ORVRILDD0RGHQDHL1DVWULG¶$UJHQWRD7DRUPLQDQHVRQRHVHPSLR

15.3. Progetto e prodotto

8QD GHOOH IXQ]LRQL GHO PDUNHWLQJ q TXHOOD GL VXSSRUWDUH O¶HQWH per
creare un buon prodotto; perciò, oltre alle indagini sul pubblico, sono
284 Manuale di diritto delle arti e dello spettacolo

effettuate ricerche sulle tipologie di prodotti da realizzare.


Come spesso accade per teatri con spettacoli itineranti, per rasse-
gne cinematografiche o esposizioni museali, gli enti scelgono di offri-
re al pubblico una vasta gamma di prodotti, valutando i pro e i contro
del contenuto GHOO¶RIIHUWD4XDORUDXQHQWHabbia O¶obiettivo di ottene-
re un profitto economico, la cognizione del mercato e della concorren-
za attenuerà il rischio di una scarsa affluenza del pubblico (ad esem-
pio, uno stesso evento non sarà offerto in due luoghi diversi nello stes-
so arco di tempo).
Tramite le ricerche di mercato (attraverso le quali riuscire a capire
cosa desidera il pubblico: eventi nuovi, divertenti, rilassanti, eventi di
cui è a conoscenza dai quali è incuriosito perché già proposti in altre
città con ottimo successo), un teatro sarà in grado di organizzare al
meglio la stagione teatrale valutando quali eventi inserire tra gli spet-
tacoli di prosa, musica classica, opera, balletti o concerti contempora-
nei; allo stesso modo, un museo stabilirà quali mostre allestire ed or-
ganizzare, tra arte moderna, contemporanea e installazioni. Difatti,
esiste una varietà di eventi (anche relativamente alla durata, che può
essere una stagione, pochi giorni o addirittura un giorno solo) tale che
ciascun tipo attrarrà principalmente un determinato target di pubblico.
Restando in tema di teatro, considerando che non tutto il pubblico è
particolarmente interessato a tutti gli spettacoli o eventi, vi sono degli
strumenti a disposizione dei produttori che hanno il preciso fine di
uniformare il più possibile la partecipazione del pubblico a ciascun
evento: uno di questi strumenti è O¶DEERQDPHQWR.
0HQWUHQHLVHFROLSDVVDWLVLDFTXLVWDYDSLFKHDOWURO¶XWLOL]]RHVFOu-
sivo di un palco come status symbol, oggi gli abbonamenti sono un
espediente del teatro per coinvolgere più spettatori possibili.
/¶DEERQDPHQWRFRQVLVWHQHOSDJDPHQWRGLXQ prezzo prefissato che è
minore della somma dei prezzi dei singoli biglietti e consente la parte-
cipazione a tutti gli spettacoli della stagione, perciò invoglia lo spetta-
tore a prender parte anche agli eventi cui non era particolarmente inte-
ressato e per i quali non avrebbe acquistato un singolo biglietto.
Per suscitare la partecipazione dei giovani, spesso considerati la
parte meno numerosa del pubblico, molti teatri hanno proposto degli
abbonamenti o degli sconti per studenti HJLRYDQLVRWWRLWUHQW¶DQQL ad
esempio la Scala di Milano e il San Carlo di Napoli concedono ai gio-
XV. Il marketing culturale 285

vani di assistere alle prove generali a prezzi ridotti).

15.4. La pubblicità

Spesso la pubblicità è confusa con il marketing, o ne è considerata


O¶HVVHQ]DLQUHDOWjVLWUDWWDGLGXHDVSHWWLGLYHUVLPDFROOHJDWLIUDORUR
poiché creare e diffondere un messaggio pubblicitario è sicuramente
fondamentale per vendere qualunque prodotto. Quotidianamente ci
imbattiamo in centinaia di messaggi pubblicitari senza neanche ren-
dercene conto e, in modo passivo e casuale, molti di loro influiscono
VXOOH QRVWUH VFHOWH XQ SDLR GL IUDVL R XQ¶LPPDJLQH attirano la nostra
attenzione perché racchiudono O¶HVVHQ]DGLFLzFKHè proposto al pub-
blico. La pubblicità si può divulgare infatti attraverso molteplici mez-
zi: radio, tv, giornali, riviste, locandine, cartellonistica, web. Tali mez-
zi sono estemporanei, per cui risulta fondamentale riuscire ad attrarre
il pubblico e convincerlo contemporaneamente a non cambiare canale
o a non girare pagina. /¶acronimo che racchiude tutte le proprietà che
una pubblicità deve avere è AIDA: attenzione, interesse, desiderio,
azione. LR VYLOXSSR GL XQ¶adeguata pubblicità deve effettuarsi anche
attraverVRXQ¶attenta valutazione delle variabili di cui al § 15.2.
Tra i mezzi citati, Internet è quello che meglio permette al messag-
gio pubblicitario di raggiungere il consumatore attraverso diverse piat-
taforme: quotidiani online che riservano delle sezioni delle loro pagine
alla pubblicità, newsletter, pubblicità su Youtube di fianco o prima del
video cercato o messaggi forzati (spam). Pertanto oggi si può afferma-
re che il consumatore medio subisce un vero e proprio attacco media-
tico e le fasce più giovani, che utilizzano quotidianamente computer,
tablet e smartphone, sono le più colpite. Proprio i giovani sono i più
influenzati dalla c.d. pubblicità indiretta, cioè dai messaggi pubblicita-
ri non percepiti come tali: si pensi ai post o alle foto di amici o di star
del mondo dello spettacolo che si seguono (following), pubblicate su
Facebook, Instagram, Flickr o Twitter.
1HOO¶DPELWR GHOOD SXEEOLFLWj LQGLUHWWD PHULWDQR PHQ]LRQH FRORUR
che vengono chiamati blogger o influencer, ormai accettati come nuo-
va realtà commerciale. Quando leggiamo che un blogger di cui siamo
follower partecipa a un evento, siamo spesso portati a documentarci ±
286 Manuale di diritto delle arti e dello spettacolo

anche solo per mera curiosità ± VXOO¶HYHQWR VWHVVo, recependo così il


messaggio pubblicitario in modo inconsapevole e indiretto.

15.5. Il museo quale luogo culturale aperto. Breve vademecum di


marketing culturale applicato al museo

Il mXVHRqXQOXRJRGLFRPXQLFD]LRQHFKHILQGDOO¶2WWRFHQWRUDSSUe-
senta una realtà sociale; spesso si pensa che sia un luogo destinato
unicamente alle classi medio-alte ma non è affatto così. Nel corso del
tempo discipline come la museografia e la museologia hanno coopera-
WRFRQLOPDUNHWLQJLQDOFXQLFDVLIRQGHQGRVLFRQTXHVW¶XOWLmo e ren-
dendo così il museo un luogo sempre più vicino ed accessibile a tutti.
Anche dal punto di vista critico-artistico, il museo non è e non deve
essere un luogo chiuso, ma destrutturato da quel tipo di sacralità che
lo connotava anticamente: uno spazio aperto, che si evolve di pari pas-
so con il mondo che lo circonda e che interagisce con la città che lo
ospita.
/¶,&20 International Council of Museum) afferma che

,O0XVHRqXQ¶LVWLWX]LRQHSHUPDQHQWHVHQ]D VFRSRGL OXFURDO VHUYL]LRGHOOD


società e del suo sviluppo, aperta al pubblico, che effettua ricerche sulle te-
stimonianze PDWHULDOLHLPPDWHULDOLGHOO¶XRPRHGHOVXRDPELHQWHOHDFTXLVi-
sce, le conserva, le comunica e specificatamente le espone per scopi di stu-
dio, educazione e diletto.

Le parole chiave VRQR ³DSHUWR DO SXEEOLFR´ LO Puseo offre colle-
zioni fruibili non più unicamente da una certa élite, ma da tutti.
Il museo è innegabilmente un luogo educativo e culturale ma, negli
ultimi anni, è stato reso un ambiente più confortevole in cui poter
svolgere molteplici attività, evolvendosi da luogo istituzionale a luogo
ricreativo, socializzante, estetico e celebrativo, come teorizzato dagli
studiosi Neil e Philip Kotler.
Nei musei sono state inserite sale per conferenze per dibattere sulle
mostre. Così, ad esempio, in occasione di mostre di arte contempora-
QHDO¶DUWLVWDqLQYLWDWRDGHVSRUUHLOSHQVLHURDOODEDVHGHLVXRLODYRUL
Viceversa, se la mostra non dà modo di far LQWHUYHQLUHO¶DUWLVWDVRQR
XV. Il marketing culturale 287

spesso invitati degli esperti per aprire dibattiti. AOO¶LQWHUQRGHOORVSa-


zio museale si realizzano anche rassegne cinematografiche, per la
proiezione di opere legate da un filo conduttore che abbia rapporti con
O¶DUWHRFROWHPDGHOOHPRVWUH
Per avvicinare anche il pubblico giovane e quello meno avvezzo
DOO¶DUWHRJJLLOPuseo può contemplare la presenza di ristoranti, caf-
fetterie e librerie, diventando così un ambiente attivo che interagisce
con la comunità ed è capace di attirare anche coloro che non si inte-
ressano alle esposizioni.
1HOO¶HFRQRPLDGHOSUesente scritto, appare utile una disamina sulle
possibili strategie di marketing da adottare in base ai tipi di musei.
$WDOSURSRVLWRPXVHLFRQXQ¶HVSRVL]LRQHSHUPDQHQWHFRPHTXHOOL
comunali, che non possono puntare ad attirare il pubblico con nuovi
prodotti da offrire, dovranno elaborare delle strategie di marketing
proponendo singoli eventi che possano valorizzare la struttura. Anche
i musei che si compongono di spazi espositivi da riempire di volta in
volta necessitano, ROWUHFKHGHOO¶D]LRQHGHOFXUDWore, di tutte le attività
di marketing sopra descritte.
Per realizzare una mostra in origine senza vincolo alcuno, è neces-
sario capire:
a) che tipo di prodotto possa essere inserito in tali spazi, poiché an-
che se vuoti, il museo non è mai uno spazio bianco ma conserva
al suo interno una connotazione intrinseca indipendentemente da
ciò che ospita;
b) cosa possa interessare al pubblico, basandosi su mostre prece-
GHQWLHFRQVLGHUDWRFKHYLVWRDQFKHO¶DUWHFRPHWXWWLLFDPSLUi-
sente delle mode, è possibile che si conosca un artista perché ri-
corrente in pubblicità o libri ovvero ancora perché sembra alla
moda recarsi alla sua mostra (ciò genera talvolta delle esposi-
zioni di cattivo gusto, create unicamente a scopo di lucro, che
rappresentano una grande offesa alla FXOWXUDHDOO¶DUWH 
Una volta scelto il tipo di prodotto da promuovere, vale a dire
O¶oggetto della mostra, prende vita la fase promozionale del marke-
WLQJFKHFRQVLVWHQHOO¶DYYLFLQDUHLOSXEEOLFR
Inizialmente, si diffonde una grande pubblicità su tutto il territorio
urbano di riferimento ricorrendo a cartellonistica, inserzioni pubblici-
tarie sui quotidiani, locandine, brochure, redazione di cataloghi, ovve-
288 Manuale di diritto delle arti e dello spettacolo

ro merchandising da acquistare negli store del museo. In secondo luo-


go, ci si deve concentrare sul vero e proprio spazio espositivo puntan-
do a incuriosire il visitatore non abituale e colui che non conosce bene
O¶RJJHWWRPHVVRLQPRVWUD,SDQQHOOLHVSRVLWLYLGRYUDQQRTXLQGLHVVHUH
chiari, recanti esaustive descrizioni e spiegazioni circa il contesto sto-
rico-artistico intorno al quale orbita la mostra. Resta inteso che i me-
desimi pannelli necessitano di traduzione in più lingue, poiché soprat-
tutto nelle grandi città una consistente porzione del pubblico è costitu-
ta da turisti; pertanto sarebbe poco opportuno che una volta entrati non
DYHVVHURPRGRGLXVXIUXLUHDOPHJOLRGHOO¶HVSRVL]LRQH
,QILQH FDPELDQGR O¶DSSURFFLR QHL FRQIURQWL GHO SXEEOLFR XOWLPa-
mente è più raro trovare il personale addetto alla guida e al suo posto,
sono disponibili delle audioguiGH DO PRPHQWR GHOO¶DFTXLVWR GHO Ei-
glietto. Così il visitatore è libero di trascorrere tutto il tempo che vuole
DOO¶LQWHUQR GHOOR VSD]LR PXVHDOH FRQFHGHQGRVL L SURSUL WHPSL H VRf-
fermandosi su ciò che maggiormente lo interessa senza alcuna delle
limitazioni e costrizioni derivanti dal dover seguire un gruppo.
1HJOLXOWLPLDQQLXQ¶DWWLYLWjFXLVLGà PROWDLPSRUWDQ]DDOO¶LQWHUQR
del museo è la didattica rivolta ai bambini. Questi ultimi vi possono
partecipare sia durante una visita scolastica sia accompagnati dai geni-
tori, con percorsi diversi; ciò dovrebbe invogliare le famiglie a recarsi
ai musei, affinché i bambini fin da piccoli vengano educati ed abituati
a trascorrere il tempo libero in modo costruttivo. Insieme agli operato-
ri, i bambini sono guidati in un percorso al termine del quale si offre
loro la possibilità di disegnare e fare dei giochi stimolandone la crea-
tività e la memoria.
1RQRVWDQWHO¶LGHDGHO museo sia comunemente associata DOO¶DUWHL
musei scientifici, automobilistici, di arti e mestieri, di storia e tante al-
tre tipologie sono altrettanto diffusi e importanti.
$OO¶LQWHUQR GL TXHVWL SHU UHQGHUH SL GLYHUWHQWH H FRLQYROJHQWH OD
visita, sono stati creati degli spazi ad hoc nei quali il pubblico può en-
WUDUHLQFRQWDWWRDWWLYRFRQO¶HVSRVL]LRne: i visitatori possono travestir-
si al Victoria aQG $OEHUW 0XVHXP HQWUDUH LQ XQ¶astronave o creare
energia pedalando al Deutsche Museum.
Grazie alle innovazioni introdotte negli ultimi anni è stato rilevato
un incremento del pubblico, sebbene i rapporti marketing-cultura fos-
sero in un primo momento demonizzati o considerati con grande scet-
XV. Il marketing culturale 289

ticismo. Contemporaneamente però, si continua a riscontrare poco af-


flusso in alcuni musei e, in particolare, in quelli comunali che investo-
no poco nel marketing esterno per mancanza di fondi.
Capitolo XVI

,OVLVWHPDGHOO¶$OWD)RUPD]LRQH
Artistica e Musicale
di ISABELLA MENALE

16.1. Introduzione

Con l¶DFURQLPR$)$0si LQGLFDLOVLVWHPDGHOO¶$OWD)RUPD]LRQH$UWi-


stica e Musicale, che comprende varie istituzioni quali le Accademie
di belle aUWLO¶$FFDGHPLDQD]LRQDOHGLDUWHGUDPPDWLFDO¶$FFDGHPLD
nazionale di danza, gli Istituti superiori per le industrie artistiche
(ISIA), i Conservatori di musica e gli Istituti musicali pareggiati (che
dovrebbero più propriamente definiti come Istituti superiori di studi
musicali).
/¶DUWGHOOD&RVWLWX]LRQHGHILQLVFHFKHWDOLLVWLWXWLGL³DOWDFXOWu-
UD´KDQQRLOGLULWWRGLGDUVLRUGLQDPHQWLDXWRQRPLFRVuFRPHOH8Qi-
versità e le Accademie. Questo principio costituzionale è stato recepi-
to dalla legge 21 dicembre 1999, n. 508, che ha attuato una riforma di
tutto il settore artistico e musicale.
Le più importanti innovazioni apportate dalla legge riguardano la
equiparazione delle Istituzioni AFAM agli istituti di livello universita-
rio, con riferimento sia al riconoscimento della personalità giuridica e
autonomia statutaria, regolamentare ed organizzativa, sia ai titoli rila-
VFLDWL VLD DOO¶RIIHUWD IRUPDWLYD HG LQ TXDQWR LO 0LQLVWHUR
GHOO¶,VWUX]LRQH GHOO¶8QLYHUVLWj H GHOOD 5LFHUca (MIUR) nel rispetto
della nuova disciplina, limita i propri poteri di programmazione, indi-
rizzo e coordinamento.

291
292 Manuale di diritto delle arti e dello spettacolo

/¶DWWULEX]LRQHGLDXWRQRPLDDJOLHQWLFKHRSHUDQRQHOO¶DPELWRDUWi-
stico e musicale è, altresì, espressione del dettato costituzionale e delle
più recenti normative comunitarie cui la legge del 1999 si attiene.
$IIURQWDUH XQR VWXGLR VXO VLVWHPD $)$0 FRPSRUWD O¶HVDPH GHOOD
SDUWH UHODWLYD DOO¶DPPLQLVWUD]LRQH DQFKH GHWWD governance, con
O¶LQGLYLGXD]LRQH GHJOL RUJDQL PRQRFUDWLFL 3UHVLGHQWH H 'LUettore) e
collegiali (Consiglio di amministrazione, Consiglio accademico, Col-
legio dei revisori, Nucleo di valutazione, Collegio dei professori e
&RQVXOWDGHJOLVWXGHQWL RSHUDQWLDOO¶LQWHUQR delle Istituzioni.
/DOHJJHGLULIRUPDGHOO¶$)$0FRQVHQWHGLLQiziare il discorso sul
delicato argomento del sistema di reclutamento del personale docente.
Infatti un importante passo in avanti compiuto dalla l. 508/1999 è sta-
WRLQWURGXUUHXQQXRYRVWUXPHQWRSHUIDFLOLWDUHO¶DVVXQ]LRQHGHOSHUVo-
nale AFAM: le graduatorie nazionali ad esaurimento dal carattere
permanente.
Il nuovo percorso formativo e didattico prevede il rilascio di di-
plomi accademici di primo e secondo livello ad esito dei corsi attivati
VHFRQGRLOVLVWHPDGHO³´FKLXQTXHFRQVHJXHXQGLSORPDDFFDGe-
mico di primo livello può accedere a concorsi pubblici, in quanto tale
titolo è equiparato ad una laurea, oppure può accedere a corsi di laurea
magistrali universitari, dopo che siano stati riconosciuti i crediti for-
mativi acquisiti.
È prevista, infatti, O¶DVVHJQD]LRQH GL  FUHGLWL DO WHUPLQH GHO
triennio con conseguimento del diploma di I livello e di 120 crediti a
conclusione del biennio con conseguimento del diploma di II livello,
TXDOHHYLGHQWHDPSOLDPHQWRGHOO¶RIIHUWDIRUPDWLYDFKHVLDUWLFRODVX
FLFOLGLVWXGLRHFRQVLVWHQHOO¶DWWLYD]LRQHGLFRUVLVSHULPHQWDOLIRQGDWL
su un sistema di crediti formativi accumulabili e trasferibili (ECTS)
secondo gli schemi europei.
Prima di passare in rassegna le singole Istituzioni che compongono
O¶$)$0qQHFHVVDrio ricordare un altro effetto della riforma che con-
VLVWHQHOO¶DYHUWUDVIRUPDWRL Conservatori di musica, gli Istituti musi-
caOLSDUHJJLDWLHO¶$FFDGHPLDQD]LRQDOHGLGDQ]DLQIstituti superiori di
studi musicali e coreutici.
Nel presente capitolo, quindi, si affronteranno queste tematiche e
WXWWLLSUREOHPLOHJDWLDOVLVWHPD$)$0DWWUDYHUVRO¶DQDOLVLGHOODOHg-
XVI. ,OVLVWHPDGHOO¶$OWD)RUPD]LRQH$UWLVWLFDH0XVLFDOH 293

JHQLQWXWWLLVXRLSXQWLHFRQFHQQLDOO¶excursus normativo
che ha preceduto la riforma.

16.2. Le Istituzioni AFAM

Come già accennato nella parte introduttiva, il sistema AFAM è costi-


tuito dalle istituzioni espressamente indicate nella legge n. 508/1999:
le Accademie di belle aUWLO¶$FFDGHPLDQD]LRQDOHGLDUWHGUDPPDWLFD
O¶$FFDGHPLD QDzionale di danza, gli Istituti superiori per le industrie
artistiche (ISIA), i Conservatori di musica e gli Istituti musicali pareg-
giati.
Per riuscire a comprendere gli effetti che la riforma del 1999 ha
UHDOL]]DWR QHO VHWWRUH GHOO¶$OWD )RUPD]LRQH $UWLVWLFD H 0XVLFDOH LQ
primo luogo, riteniamo opportuno partire dalla disamina delle singole
Istituzioni.

16.2.1. Accademie di belle arti

Le Accademie di belle arti, presenti in Italia già dai tempi di Lorenzo


LO0DJQLILFR IRQGDWRUHGHOODSULPDDFFDGHPLDG¶DUWHQHOPRQGR Gi-
vennero nazionali soltanto nel 1803.
In passato, le competenze attribuite alle Accademie erano molto
più numerose ed includevano la formazione non solo dei pittori, scul-
tori, decoratori e scenografi, ma anche degli architetti, mancando un
istituto che si occupasse esclusivamente di architettura come le attuali
facoltà. In più esse godevano di uno speciale potere di controllo sulle
opere pubbliche che era esercitato attraverso le Commissioni
GHOO¶RUQDWR SUHILJXUD]LRQH GHOOH DWWXDOL 6RSULQWHQGHQ]H $WWXDOPHQWH
le Accademie sono dedicate allo studio delle arti visive ed applicate.
Tempo fa si programmavano attività a scopo didattico al fine di salva-
guardare e tutelare il patrimonio artistico italiano: così negli istituti
erano introdotti dei laboratori in qualità di pinacoteche e gipsoteche,
FKHFRQVHQWLYDQRO¶HVSRVL]LRQHGLVLQJROLEHQLRGLFROOH]LRQLHLOFRn-
seguente arricchimento del patrimonio museale italiano.
&RQO¶LVWLWX]LRQHGHLOLFHLDUWLVWLFLHGHJOLLVWLWXWLG¶DUWHqFUHVFLXWRLO
numero degli iscritti alle Accademie di belle arti e dal 1970 in poi so-
294 Manuale di diritto delle arti e dello spettacolo

no aumentate anche le Accademie statali operanti in Italia, tanto che


oggi sul territorio nazionale se ne contano più di venti, affiancate da
un numero quasi pari di istituzioni private e legalmente riconosciute.
La l. 508/1999 e le VXFFHVVLYHQRUPDWLYHULJXDUGDQWLO¶$)$0KDn-
QRDPSOLDWRO¶RIIHUWDIRUPDWLYDGHOOHLVWLWX]LRQL1HOORVSHFLILFRODOQ
143/2004 ha stabilito che docenti di materie artistiche possono for-
PDUVLSUHVVROH$FFDGHPLHGLEHOOHDUWLSHUO¶LQVHJQDPHQWRQHJOL,VWi-
tuti secondari.

16.2.2. Accademia nazionale di arte drammatica

,O IRQGDWRUH GHOO¶$FFDGHPLD QD]LRQDOH GL DUWH GUDPPDWLFD q 6LOYLR


'¶$PLFRXQLPSRUWDQWHWHRULFRFULWLFRHVFULWWRUHWHDWUDOHLWDOLDQRFKH
nel 1936 a Roma diede vita ad una vera e propria scuola per chiunque
volesse entrare a far parte del mondo del teatro e del cinema.
/¶$FFDGHPLDKDO¶RELHWWLYRGLIRUPDUHQXRYLDWWRULHUHJLVWLLQEDVH
DOO¶LQVHJQDPHQWR FULWLFR H SHGDJRJLFR WUDPDQGDWR GDOOR VWHVVR 6LOYLR
'¶$PLFRDLVXRLVXFFHVVRULGLYHQWDWi, poi, docenti della scuola. I corsi
sono a numero chiuso e si strutturano in lezioni, esercitazioni e prove
GLSDOFRVFHQLFRFKHULFKLHGRQRO¶LPSHJQRFRVWDQWHHWRWDOHGHJOLDOOLe-
vi ammessi. È previsto lo svolgimento di attività di studio, ricerca e
sperimentazione in materia di spettacolo e cultura e la frequenza ai
corsi per circa otto ore al giorno, ogni giorno in tre anni, con un even-
tuale anno aggiuntivo di perfezionamento. Il numero degli studenti
ammessi ai corsi varia a seconda della disponibilità delle strutture e
del personale docente, se si considera che il MIUR ed il Ministero per
i Beni e le Attività Culturali finanziano le attività e i progetti promossi
GDOO¶$FFDGHPLD
*UDQGLDWWRULGLFLQHPDHWHDWURVLVRQRIRUPDWLSUHVVRO¶$FFDGHPLD
nazionale di arte drammatica, basti ricordare alcuni nomi come Nino
Manfredi, Vittorio Gassman, Oreste Lionello e tra i più recenti Mas-
VLPR 'DSSRUWR 7RVFD '¶$TXLQR H 1LFROHWWD %UDVFKL ,O SUHVWLJLR
GHOO¶$FFDGHPLDFUHVFHDQFKHDWWUDYHUVROHFROODERUD]LRQLFRQVFuole di
teatro straniere come la Scuola nazionale indiana e le scuole di recita-
]LRQHGHOO¶Unione europea HGHOO¶$PHULFD/DWLQD
XVI. ,OVLVWHPDGHOO¶$OWD)RUPD]LRQH$UWLVWLFDH0XVLFDOH 295

16.2.3. Accademia nazionale di danza

Nel 1940 a Roma è istituita la Regia scuola nazionale di danza, prima


manifestazione di un interesse verso la disciplina della danza che, tut-
tavia, non si identifica in un istituto autonomo ma come parte connes-
VD DOO¶$FFDGHPLD QD]LRQDOH GL DUWH GUDPPDWLFD /D VYROta si realizza
nel 1948, anno in cui viene emanato un decreto che trasforma la Regia
scuola in Accademia nazionale di danza, una istituzione autonoma sot-
to vari aspetti come quello amministrativo e didattico. Riveste la cari-
FDGLIRQGDWRUHHGLUHWWRUHGHOO¶$FFDGHPLDODEDOOHULQDGLRULJLQHUXVVD
Eugenia Borissenko, ricordata con il suRQRPHG¶DUWH-LD5XVNDMD per i
VXRLLQQXPHUHYROLVSHWWDFROLHSHUIRUPDQFHGLVXFFHVVR/¶$FFDGHPLD
nazionale di danza, in quanto eccellente scuola di formazione per bal-
lerini ed insegnanti, sin dai primi tempi forma uno stabile gruppo di
allievi che la rappresenta e pubblicizza esibendosi al di fuori
GHOO¶LVWLWXWR
%HQ SUHVWR OD VHGH GHOO¶LVWLWXWR GLYHQWD XQD PDJQLILFD YHWULQD SHU
eventi di spettacolo e culturali, anche grazie alla sua favorevole collo-
cazione sul colle romano Aventino ed ospita notevoli artisti ed autori
per la promozione ed esposizione delle loro opere e pubblicazioni. Dal
1999, con la riforma GHOO¶$)$0 O¶$FFDGHPLD QD]LRQDOH GL GDQ]D q
entrata a far parte del sistema degli Istituti superiori di studi musicali e
coreutici insieme ai Conservatori di musica e agli Istituti musicali pa-
reggiati.
&ROSDVVDUHGHJOLDQQLVLDVVLVWHDOODFUHVFLWDGHOO¶RIIHUWDIRUPDWLYD
HGLGDWWLFDGHOO¶$FFDGHPLDHGLFRQVHJXHQ]DDXPHQWDQROHPDWHULHGD
proporre agli allievi come oggetto di studio. La danza classica non è
SLO¶XQLFDGLVFLSOLQDGDDSSUHQGHUHPDVLULYROJHO¶DWWHQ]LRQHDQFKH
alle forme e agli stili di danza più innovativi e moderni, oltre
DOO¶LQWURGX]LRQHGLPDWHULHGDOFDUDWWHUHWHFQLFR-scientifico come ana-
tomia, fisiologia del movimento, fisiotecnica e spazio scenico. Grazie
alle conoscenze e competenze acquisite in Accademia, ogni allievo
diventa, o può aspirare a diventare, un ballerino o addirittura primo
ballerino delle più importanti compagnie di danza esistenti al mondo.
296 Manuale di diritto delle arti e dello spettacolo

16.2.4. Istituti superiori per le industrie artistiche

Gli Istituti superiori per le industrie artistiche (ISIA) sono istituzioni


statali dello stesso livello delle Università, a cui è riconosciuto stesso
valore giuridico delle Accademie di belle arti, ma specializzate nello
VWXGLRGHOGLVHJQRLQGXVWULDOHFRQO¶RELHWWLYRGLIRUPDUHLQXRYL desi-
gner del futuro. Gli ISIA presenti in Italia hanno origine trentennale,
sono dislocati in sole quattro città (Roma, Firenze, Urbino e Faenza)
ed ognuno persegue specifici obiettivi IRUPDWLYL/¶,6,$GL5RPDPi-
UD DOOD IRUPD]LRQH GHJOL VWXGHQWL QHO VHWWRUH GHOO¶industrial design (il
GLVHJQR LQGXVWULDOH  PHQWUH D )LUHQ]H O¶,6,$ SURSRQHODVFHOWDGLXQ
percorso specialistico in industrial design o design della comunica-
zione. /¶,6,$GL8rbino si occupa prevalentemente della progettazio-
ne grafica ed editoriale, quindi opera nel settore della comunicazione
visiva. Infine a Faenza, per conservare la tradizionale produzione delle
ceramiche, sono attivi dei corsi di product design finalizzati al rinno-
YDPHQWRGLPDWHULDOLHWHFQRORJLHFHUDPLFKH/¶HVLJHQ]DGLUivolgersi
a professionisti competenti nel campo della progettazione industriale è
sorta negli anni Sessanta con il boom economico ed in quel periodo
sono stati attivati i primi corsi di disegno industriale che, in seguito,
hanno dato luogo agli odierni ISIA.
Tali Istituti offrono dei corsi formativi a numero chiuso e di durata
quadriennale. Tuttavia il piano di studi appare molto flessibile, al pari
del modo di assegnazione degli incarichi ai docenti. Un Comitato
scientifico didattico, infatti, si occupa ogni anno di assegnare le catte-
dre a docenti scelti tra le più alte personalità in ambito artistico e cul-
turale.

16.2.5. Conservatori di musica e Istituti musicali pareggiati: la statiz-


zazione

I Conservatori di musica sono le più antiche ed importanti istituzioni


dedicate alla formazione artistica e culturale dei musicisti. Hanno ori-
gine nel Seicento a Napoli, quando istituti che fornivano accoglienza
ed assistenza agli orfani ed ai poveri si sono impegnati a garantir loro
una educazione che andasse oltre il semplice insegnamento di un me-
VWLHUH,QTXHOSHULRGRO¶,WDOLDLQSDUWLFRODUHLO0HULGLRQHJLjSUHVHn-
XVI. ,OVLVWHPDGHOO¶$OWD)RUPD]LRQH$UWLVWLFDH0XVLFDOH 297

tava una cultura incentrata sulla conoscenza delle arti e della musica
che è stata automaticamente recepita dai Conservatori, determinando
la loro trasformazione in veri e propri centri di alta formazione cultu-
UDOHFRVWLWXHQWLXQHVHPSLRSHUWXWWRLOUHVWRG¶(XURSD1HO6HWWHFHQWR
infatti, i Conservatori hanno perso completamente il carattere assi-
stenziale e si sono affermati come scuole musicali incentrate sullo stu-
dio di teoria, canto, composizione, vari strumenti musicali e arte
drammatica. I Conservatori italiani sono diventati le più prestigiose
istituzioni impegnate nella musica ed hanno formato gli artisti e musi-
cisti più famosi al mondo. Oggi i Conservatori prevedono la specializ-
zazione in diversi settori musicali attraverso la scelta di vari indirizzi
di studio, al fine di preparare figure professionali operanti nel mondo
della musica in qualità di: cantanti, strumentisti, direttori di coro o di
orchestra, docenti, compositori, tecnici del suono.
Con la legge n. 508/1999 sono state introdotte novità riguardanti
anche i Conservatori di musica, che entrano a far parte del sistema
AFAM diventando istituti di grado universitario con corsi di primo li-
vello, della durata di 3 anni, e corsi di secondo livello, che durano 2
anni. Si è già ricordato come la riforma GHOO¶$)$0 abbia stabilito che
anche i Conservatori di musica e gli Istituti musicali pareggiati, insie-
me alO¶$FFDGHPLDQD]LRQDOHGLGDQ]D si trasformano in Istituti supe-
riori di studi musicali e coreutici.
$WDOSURSRVLWRRUDqQHFHVVDULRVSRVWDUHO¶DWWHQ]LRQHVXJOL Istituti
Musicali Pareggiati (IMP), ossia le istituzioni di formazione musicale
FKH QDVFRQR GDOO¶HVLJHQ]D GHJOL HQWLORFDOL LWDOLDQL (Comune, Provin-
cia, Consorzio tra Comune e Provincia, Regione) di garantire una
istruzione musicale sul territorio, laddove manchino i Conservatori di
musica.
Gli IMP, infatti, hanno origine nel secolo scorso e nel 1930 vengo-
QRSDUHJJLDWLDL&RQVHUYDWRULVWDWDOLLQVHJXLWRDOO¶DSSOLFD]LRQHGHOr.d.
n. 1170. Tuttavia il pareggiamento non sana una differenza sostanziale
tra le due istituzioni che riguarda la fonte dei finanziamenti: mentre i
Conservatori sono completamente finanziati dallo Stato, gli IMP si
reggono esclusivamente sui finanziamenti degli enti locali che ne sono
i promotori. Le più importanti novità introdotte con la legge di riforma
n. 508/1999 riguardano anche gli IMP e ne SUHYHGRQRO¶LQFOXVLRQHWUD
le Istituzioni AFAM (e il conseguente riconoscimento della personali-
298 Manuale di diritto delle arti e dello spettacolo

WjJLXULGLFDHGHOO¶DXWRQRPLD HO¶DWWULEX]LRQHGHOODTXDOLILFDGL,VWLWXWL
GL DOWD FXOWXUD DL VHQVL GHOO¶DUW  GHOOD &RVWLWX]LRQH /¶LQQRYD]LRQH
più significativa rimane quella della loro trasformazione in Istituti su-
periori di studi musicali e coreutici (ISSM), alla pari dei Conservatori
GL PXVLFD VWDWDOL H GHOO¶$FFDGHPLD QD]LRQDOH GL GDQ]D DWWUDYHUVR OD
quale si rileva che la normativa non fa alcuna distinzione tra la disci-
plina delle istituzioni statali e non statali. La mancanza di finanzia-
menti statali per gli ex IMP rappresenta uno degli aspetti inattuati del-
la legge 508/1999 e pone forti limiti alla libera espressione ed attività
di questi Istituti. Diventa sempre più difficile per gli enti locali, inol-
tre, coprire tutte le spese necessarie a tener in vita gli ex IMP ed è
sempre più imminente il rischio di una loro scomparsa con una conse-
guente grave perdita per tutto il patrimonio culturale ed artistico. La
soluzione è stata individuata dalla legge n. 508/1999 sin dalla sua en-
trata in vigore e si sostanzia nella statizzazione degli ex IMP, finora
mai realizzata e che ora necessita di provvedimenti urgenti, affinché si
proceda alla sua immediata attuazione e regolamentazione. Le propo-
VWH FLUFD O¶DWWXD]LRQH GHOOD VWDWL]]D]LRQH GHJOL H[ ,03 VRQR VWDWH Qu-
merose e tra le altre, si ricordano le più recenti presentate nel 2014 in
forma di disegno di legge. In particolare, in risposta al disegno di leg-
ge n. 322, è stata presentata una relazione durante una audizione par-
lamentare da parte del coordinatore dei Presidenti degli Istituti AFAM
non statali Giulio Cesare Ricci ± già Presidente GHOO¶,660 ³3ietro
0DVFDJQL´GL/LYRUQR± che fornisce un contributo pratico per la defi-
nizione di una legge per la statizzazione degli ex Istituti musicali pa-
reggiati.
La legge, pertanto, ha delineato un sistema di istruzione musicale
che ha come obiettivo quello di garantire ai giovani la possibilità di
affrontare un percorso di formazione culturale e musicale che abbia
inizio sin dalle scuole medie, grazie alla frequenza delle scuole ad in-
dirizzo musicale, attive JLj GD  DQQL /¶iter può continuare con la
scelta di licei musicali e coreutici istituiti con la legge di riforma sco-
lastica n. 53/2002, che sancisce anche la loro propedeuticità
DOO¶iscrizione presso gli Istituti superiori di studi musicali e coreutici
che, in tal modo, mirano a rafforzare e valorizzare la preparazione
posseduta dal giovane artista.
XVI. ,OVLVWHPDGHOO¶$OWD)RUPD]LRQH$UWLVWLFDH0XVLFDOH 299

/¶DXWRQRPLDGHOle Istituzioni AFAM

16.3.1. Profilo storico

La legge n. 508/1999 pone in essere una nuova disciplina del settore


artistico e musicale secondo la quale è possibile attribuire personalità
giuridica e autonomia alle Istituzioni AFAM, alla pari degli istituti
universitari. Uno dei primi tentativi per il raggiungimento di questo
RELHWWLYR VL HUD JLj FRPSLXWR QHO  FRQ O¶HPDQD]LRQH GHO 7HVWR
unico n. 297, introdotto da un decreto legislativo in materia di istru-
]LRQHQHJOLLVWLWXWLG¶DUWHFKHKDUHJRODPHQWDWo, in modo specifico, la
modalità di reclutamento del personale prevedendo un sistema di con-
corsi per titoli e per esami ovvero di concorsi per soli titoli. Nel 1994,
tuttavia, il Governo non ha osservato i termini indicati nella legge de-
lega determinando O¶LQHIILFDFLDGHOGHFUHWRHPDQDWRHODPDWHULDWUDt-
tata è rimasta senza una adeguata regolamentazione.
La mancanza di una appropriata normativa in tema di istituzioni
G¶LVWUX]LRQH DUWLVWLFD VL q DYYHUWLWD DQFKH QHJOL DQQL VXFFHVVLYL &RVu
nel 1997 la VII Commissione della Camera dei deputati ha approvato
il disegno di legge n. 2881 disponendo la trasformazione delle istitu-
zioni di istruzione artistica superiore in Istituti superiori delle arti
(ISDA) di livello universitario, che avrebbero goduto di una propria
personalità giuridica ed autonomia amministrativa, didattica, finanzia-
ULD H FRQWDELOH VXOOD EDVH GL TXDQWR VWDELOLWR QHOO¶RUGLQDPHQWR DXWo-
nomo delle Università e degli istituti di ricerca. Obiettivo del legisla-
tore del 1997 è stato estendere la disciplina delle Università agli
ISDA, per cercare di eliminare le difformità esistenti tra gli istituti
G¶LVWUX]LRQH pur volendo preservare le peculiarità presenti in ambito
DUWLVWLFR,OGLVHJQRGLOHJJHKDDWWULEXLWRDJOLLVWLWXWLG¶DUWHODFDSDFLWj
di fornire una istruzione di tipo universitario, espressa attraverso il ri-
ODVFLRGLGLSORPLXQLYHUVLWDULGLSULPROLYHOORFRQO¶LQWURGX]LRQHGHOOD
ILJXUDGHO5HWWRUHHO¶LVWLWX]LRQHGLXQRVSHFLILFRRUJDQRFRQVXOWLYRLO
Consiglio nazionale delle arti (CNDA).
CRQO¶HPDQD]LRQHGHOODOHJJHGLULIRUPDGHO, le Camere han-
no deciso in modo unanime di riformulare la disciplina del settore ar-
tistico e musicale e di disporre le modalità di regolamentazione della
PDWHULD6LDEEDQGRQDO¶LGHDGLUHDOL]]DUHJOL,6'$H si affida al Go-
300 Manuale di diritto delle arti e dello spettacolo

verno il potere di emettere regolamenti in seguito alla proposta del


MIUR e previa consultazione delle Commissioni parlamentari e di un
QXRYRRUJDQRLO&RQVLJOLR1D]LRQDOHSHUO¶$OWD)RUPD]LRQH$UWLVWLFD
e Musicale (CNAM), introdotto al finHGLLQGLUL]]DUHO¶RUJDQRHVHFXWi-
vo a prendere le decisioni migliori sulle tematiche più importanti
QHOO¶DPELWRGHOO¶LVWUX]LRQHDUWLVWLFD/DOHJJHQSRQHDOWUe-
Vu OLPLWL DOO¶HVHUFL]LR GHOOD SRWHVWj UHJRODPHQWDUH GLVSRQHQGR
O¶RVVHUYDQ]DGLSULQFipi e criteri direttivi; tuttavia il rinvio ad atti nor-
mativi di natura secondaria, quali sono i regolamenti governativi, per
disciplinare la materia delle istituzioni artistiche, fa comprendere il
UXRORSUHPLQHQWHFKHqDVVHJQDWRDOO¶RUJDQRHVHFXWLYRQHOO¶DWWXD]LRQH
della riforma.

16.3.2. /¶DXWRQRPLDVWDWXWDULD

Punto saliente della legge di riforma del 1999 è, di sicuro, il ricono-


VFLPHQWR GHOOD SHUVRQDOLWj JLXULGLFD H GHOO¶DXWRQRPLD DOOH ,VWLWX]LRQL
G¶$OWD )RUPD]LRQHHVSHFLDOL]]D]LRQH$UWLVWLFDGRSRDQni in cui si è
tentato di perseguire tale obiettivo/¶DWWULEX]LRQHGHOO¶DXWRQRPLD pre-
VXSSRQHLQSULPROXRJRLOJRGLPHQWRGHOO¶DXWRQRPLDVWDWXWDULDGDSDr-
te degli istituti AFAM, ossia del potere di autogovernarsi attraverso
O¶HPDQD]LRQHGLSURSULHQRUPHLn forma di statuti e regolamenti. Lo
VWDWXWRqXQDWWRQRUPDWLYRFKHFRQVHQWHO¶RUJDQL]]D]LRQHGHLSXEEOLFL
poteri diversi dallo Stato, affinché sia garantito il buon andamento e
O¶LPSDU]LDOLWj GHOO¶DPPLQLVWUD]LRQH VHFRQGR LO GHWWDWR GHO SULQFLSLR
contenutRQHOO¶DUWGHOOD&RVWLWX]LRQH/¶DXWRQRPLDVWDWXWDULDGHOOH
Istituzioni AFAM, tuttavia, presenta differenze rispetto a quella rico-
nosciuta alle Università per quel che riguarda la fonte normativa che
QHFRQVHQWHO¶HVHUFL]LRLQTXDQWRODOHJJHQ999 prevede espres-
samente che sia un regolamento governativo a disciplinarla. Gli istituti
universitari, invece, esercitano la propria autonomia statutaria in base
DSULQFLSLILVVDWLGDXQDOHJJHVWDWDOHHGLQOLQHDFRQO¶DUWGHOOD&o-
stituzione che riconosce sia agli Istituti di alta cultura, sia alle Univer-
sità ed Accademie, il diritto di darsi ordinamenti autonomi nei soli li-
miti stabiliti dalle leggi dello Stato.
/D &RVWLWX]LRQH SHUWDQWR SUHYHGH O¶DGR]LRQH GL OHJJL GHOOR 6WDWR
SHUGLVFLSOLQDUHO¶Dutonomia statutaria, al fine di fissare criteri e prin-
XVI. ,OVLVWHPDGHOO¶$OWD)RUPD]LRQH$UWLVWLFDH0XVLFDOH 301

cipi che garantiscano democraticità e trasparenza. Ciò si realizza con


JOLVWDWXWLXQLYHUVLWDULGHILQLWLDQFKH³DWWLIRQWHDQDWXUDQRUPDWLYD´SHU
la loro capacità di introdurre nuove norme che danno rilevanza giuri-
GLFDHGLVFLSOLQDQRQXRYHIDWWLVSHFLHLQQRYDQGRO¶RUGLQDPHQWRJLXUi-
dico. Le Università, infatti, emanano i propri statuti in modo autono-
PRGDQGRYLWDDGXQDQXRYDIRQWHGLGLULWWRPDKDQQRO¶REEOLJRGLRs-
servare la legge statale laddove contenga una specifica disciplina in
materia universitaria, in quanto essa prevarrà sulle norme statutarie in
caso di contrasto tra le due fonti di diritto. Tuttavia nel caso in cui la
legge non si riferisca esplicitamente agli istituti universitari, è applica-
ta in automatico la normativa statutaria quale integrazione della fonte
normativa primaria.
A differenza della disciplina prevista per le Università, la legge n.
508/99 che introduce e regolamenta le Istituzioni AFAM riconosce ad
esse la capacità statutaria, ma non specifica in alcun modo in che rap-
porto si trovino gli statuti rispetto alle altre fonti di diritto.
La mancanza di indicazioni normative specifiche crea incertezza e
confusione sul valore delle norme statutarie AFAM rispetto alle fonti
di diritto primarie, quali possono essere le leggi ordinarie, ma anche
rispetto alle fonti secondarie, quali sono gli atti ministeriali, come le
FLUFRODUL ,O ULIHULPHQWR DG ³DOWUH QRUPH´ FKH SRVVRQR GLVFLSOLQDUH OH
Istituzioni AFAM, contenuto nella legge n. 508/1999, sembra non
escludere che anche fonti di diritto secondarie possano incidere sulla
regolamentazione GHOO¶AFAM, ciò in contrasto con quanto è affermato
QHOO¶DUW  GHOOD &RVWLWX]LRQH FKH SRQH QHOO¶RVVHUYDQ]D GHOOH OHJJL
VWDWDOLO¶XQLFROLPLWHDOO¶DXWRnomia normativa degli istituti di alta cul-
tura.

16.3.3. /¶DXWRQRPLDGLGDWWLFD

La legge n. 508/1999 ha disposto anche il riconoscimento di una auto-


nomia didattica a favore degli istituti di alta cultura, attraverso
O¶LVWLWX]LRQH GL RUGLQDPHQWL GLGDWWLFL O¶DWWLYD]LRQH GHL FRUVL H OD SUo-
grammazione degli accessi, previa indicazione di criteri generali. Ciò
VLHYLQFHGDOO¶DUWVHWWLPRFRPPDOHWW h), contenente la disciplina
in materia di studi delle Istituzioni AFAM che, tuttavia, ha trovato at-
tuazione VRORQHOFRQO¶HPDQD]LRQHGHOG35QFKHKDLn-
302 Manuale di diritto delle arti e dello spettacolo

FOXVRLO³5HJRODPHQWRUHFDQWHODGLVFLSOLQDSHUODGHILQL]LRQHGHJOLRr-
dinamenti didattici delle Istituzioni di alta formazione artistica, musi-
FDOHHFRUHXWLFD´7DOHUHJRODPHQWRPLUDDUHDOL]]DUHO¶RELHWWLYRGHOOD
legge n. 508/1999 di assegnare la necessaria autonomia al sistema
GHOO¶AFAM, affinché si ottenga un adeguato ordinamento didattico, in
VHJXLWR DOO¶HPDQD]LRQH GL UHJRODPHQWL LQWHUQL FKH FRQVHQWD
O¶DFTXLVL]LRQHGLXQDSURSULDLGHQWLWjFXOWXrale ed istituzionale e della
JLXVWDFROORFD]LRQHQHOVLVWHPDQD]LRQDOHGHOO¶LVWUX]LRQH
3XUWURSSRO¶DXWRQRPLDDXVSLFDWDQRQVLqPDLUHDOL]]DWDDSLHQRPD
piuttosto la riforma si è concretizzata in una mera imitazione del si-
stema universitario, se si coQVLGHUD FKH q VWDWR UHFHSLWR O¶REEOLJR GL
frequenza di corsi di studio triennali che si concludono con il conse-
guimento di una laurea al solo raggiungimento di 180 crediti formati-
vi, oltre alla possibilità di conseguire una laurea magistrale in seguito
al raggiungimento di 120 crediti al termine di altri 2 anni di corsi.
Il regolamento del 2005 contenuto nel decreto n. 212 prevede, per-
tanto, che gli istituti AFAM possano rilasciare titoli di studio al termi-
ne di specifici percorsi didattici che presuppongoQR O¶DPPLVVLRQH DL
corrispondenti corsi di studio, ognuno dei quali mira a perseguire pro-
SULRELHWWLYL/¶DUW, dal terzo al settimo comma, indica in modo spe-
cifico gli obiettivi dei diversi corsi di studio che varia a seconda del
livello di ognuno: ad esempio, garantire la padronanza di metodi e
tecniche artistiche per far acquisire competenze disciplinari e profes-
VLRQDOL VSHFLILFKH q O¶RELHWWLYR GHO FRUVR GL GLSORPD DFFDGHPLFR GL
primo livello. Gli altri corsi di livello superiore perseguono obiettivi
commisurati al maggior grado di difficoltà e di impegno richiesti. Di
conseguenza, il corso di diploma accademico di secondo livello, assi-
cura una formazione di livello avanzato per la piena padronanza di
PHWRGLHWHFQLFKHDUWLVWLFKHHSHUO¶DFTXLVL]LRQHGL competenze profes-
sionali elevate. Obiettivo principale del corso di specializzazione è
fornire le più elevate conoscenze professionali in specifici settori,
mentre seguire il corso di formazione alla ricerca consente di ottenere
le competenze necessarie per programmare e realizzare attività di ri-
cerca di alta qualificazione. InfineVLSUHYHGHO¶LVWLWX]LRQHGL corsi di
perfezionamento, di master (sia di primo che di secondo livello, volti a
fornire conoscenze approfondite ed aggiornate in specifiche materie,
rispondendo così ad esigenze di riqualificazione professionale e di
XVI. ,OVLVWHPDGHOO¶$OWD)RUPD]LRQH$UWLVWLFDH0XVLFDOH 303

educazione permanente) e di dottorato di ricerca (il c.d. terzo livello di


IRUPD]LRQHFKHPLUDDGDYYLDUHO¶DUWLVWDDOSHUFRUVRGHOODULFHUFD 
Si consideri che ogni corso di studio presenta la stessa denomina-
zione del titolo di studio corrispondente, per cui il corso di diploma
accademico di primo livello consente di conseguire il diploma acca-
demico di primo livello e così pure il corso di diploma accademico di
secondo livello che consente di conseguire il diploma accademico di
secondo livello. Di conseguenza, il corso di specializzazione può con-
cludersi con il conseguimento di un diploma accademico di specializ-
zazione e un successivo corso di formazione alla ricerca consente di
ottenere il diploma accademico di formazione alla ricerca. Infine, il
corso di perfezionamento o master si conclude conseguendo il relativo
diploma di perfezionamento.
Il regolamento del 2005, tuttavia, non dimentica di porre dei limiti
FLUFD O¶DPPLVVLRQHDLFRUsi di studio appena elencati, indicando i re-
quisiti necessari e senza i quali essa non è consentita. Elemento impre-
VFLQGLELOHSHUO¶DFFHVVRDWXWWLLFRUVLqGLFHUWRODVXVVLVWHQ]DGLFo-
noscenze artistiche, che deve essere accompagnata dal possesso degli
VSHFLILFLWLWROLULFKLHVWLSHUFHUWLILFDUHO¶LVWUX]LRQHRWWHQXWDILQRDTXHO
momento e purché si possegga la preparazione prescritta nei regola-
menti didattici.
Per accedere al corso di diploma di primo livello, ad esempio, è ne-
cessario possedere il diploma di scuola secondaria superiore o di altro
WLWRORGLVWXGLRFRQVHJXLWRDOO¶HVWHURHULWHQXWRLGRQHRVHFRQGRTXDQWR
GLVSRQHO¶DUW. 7 del regolamento, che successivamente rimette ai rego-
lamenti didattici il potere di indicare gli altri requisiti richiesti per
O¶DFFHVVR
,QSDUWLFRODUHO¶DUWsecondo comma, stabilisce che i regolamenti
didattici hanno il compito di dimostrare la sussistenza della prepara-
zione tecnica iniziale del candidato relativa alle sue conoscenze arti-
stiche, attraverso le modalità di verifica che reputano più idonee.
/D GLVFLSOLQD SHU O¶DPPLVVLRQH DL FRUVL GL GLSORPD DFFDGHPLFR GL
secondo livello e di specializzazione, invece, prevede che sia necessa-
rio possedere la laurea o il diploma accademico di primo livello, ovve-
ro altro titRORGLVWXGLRFRQVHJXLWRDOO¶HVWHURHULWHQXWRLGRQHRROWUHDG
avere una adeguata preparazione che consenta di affrontare i nuovi
studi.
304 Manuale di diritto delle arti e dello spettacolo

Infine, è richiesto il possesso del diploma accademico di secondo


livello o della laurea magistrale, ovvero di altro titolo di studio conse-
JXLWRDOO¶HVWHURHULFRQRVFLXWRLGRQHRQHOFDVRLQFXLVLYRJOLDHVVHUH
ammessi ad un corso di formazione alla ricerca.
Appare evidente come tutta la regolamentazione del sistema
AFAM, anche con riferimento alla ammissione ai corsi di studio, cer-
FKLGLDIIHUPDUHO¶DXWRQRPLDGHOOHLVWLWX]LRQLULFRQRVFHQGRORURDPSLR
potere decisionale attraverso i regolamenti didattici.
Il d.P.R. n. 212/2005, infatti, ispirato alla disciplina universitaria
contenuta nel d.m. n. 270/2004, prevede che O¶DXWRQRPLDGLGDWWLFDGe-
gli IVWLWXWL $)$0 SRVVD DIIHUPDUVL FRQ O¶HPDnazione di regolamenti
che disciplinano gli ordinamenti didattici dei corsi di studio e soltanto
tramite questi atti interni di recepimento sembra possibile creare un
ordinamento didattico nuovo e stabile che rispetti le disposizioni di
legge, dello stesso regolamento del 2005 e dei conseguenti decreti mi-
nisteriali e statuti. Oggetto dei regolamenti didattici sono i più svariati
argomenti riguardanti gli aspetti strutturali e funzionali degli istituti
$)$0FKHQHFHVVLWDQRGHOO¶DSSURYD]LRQHGHO0,85DOTXDOHqDWWUi-
buito un potere di veto assoluto al fine di effettuare tutti i controlli più
opportuni.

16.3.4. /¶DXWRQRPLDDPPLQLVWUDWLYD

'RSRDYHUHVDPLQDWRODGLVFLSOLQDGHOO¶$)$0FRQULIHUimento alla di-


GDWWLFDqSRVVLELOHRUDDQDOL]]DUHXQDOWURDVSHWWRGHOO¶DXWRQRPLDULFo-
QRVFLXWDDJOLLVWLWXWLGLDOWDFXOWXUDO¶DXWRQRPLDDPPLQLVWUDWLYDILQDn-
ziaria e contabile. In base al disposto della legge n. 508/1999, le Isti-
tuzioni AFAM godono di autonomia potendo derogare alle norme
GHOO¶RUGLQDPHQWRFRQWDELOHGHOOR6WDWRHGHJOLHQWLSXEEOLFLSXUFKpQH
RVVHUYLQRVHPSUHLSULQFLSLIRQGDPHQWDOL,QROWUHOR³6FKHPDGLUHJo-
ODPHQWRGLDPPLQLVWUD]LRQHILQDQ]DHFRQWDELOLWj´GHO0,85VWDELOi-
sce che sia il CDA a stabilire gli obiettivi e i programmi della gestione
amministrativa ed a determinare le dotazioni finanziarie
GHOO¶,VWLWX]LRQHDOILQHGLDWWXDUHLSLDQLGLLQWHUYHQWRHVYLOXSSRGHOOD
didattica così come sono definiti dal Consiglio accademico.
SLFRQVLGHULFKHO¶RUJDQL]]D]LRQHGLRJQL,VWLWXWRqFRPSOHWDPHQWH
affidata alla figura del Direttore amministrativo che è il responsabile
XVI. ,OVLVWHPDGHOO¶$OWD)RUPD]LRQH$UWLVWLFDH0XVLFDOH 305

della gestione amministrativa, organizzativa, finanziaria, patrimoniale


HFRQWDELOHGHOO¶LVWLWX]LRQH&RQULIHULPHQWR alle finanze istituzionali,
ad esempio, si tiene conto del bilancio di previsione annuale, un do-
cumento unico formulato in termini di competenza e di cassa che è ar-
ticolato in Unità Previsionali di BDVH 83% FRVWLWXHQWLO¶LQVLHPHGHl-
le risorse finanziarie che il Direttore amministrativo ha il compito di
gestire in considerazione degli obiettivi da perseguire. Rientrano nelle
competenze del Direttore, quindi, le entrate e le spese di tutte le UPB
ODFXLJHVWLRQHULFKLHGHO¶RVVHUYDQ]DGHOOHIDVLGLDFFHUWDPento, riscos-
sione e versamento per quel che riguarda le entrate, mentre per le usci-
WH q QHFHVVDULR UHDOL]]DUH OH IDVL GHOO¶LPSHJQR GHOOD OLTXLGD]LRQH
GHOO¶RUGLQD]LRQHHGHOSDJDPHQWR3HUDVVLFXUDUHJOLRSSRUWXQLFRQWURl-
li sul rispetto delle fasi in cui sono strutturate entrate ed uscite, è pre-
posto un rHVSRQVDELOHGHOO¶8IILFLRGLUDJLRQHULDFKHHIIHWWXDYHULILFKH
periodiche, coPXQLFDQGR O¶HVLWR DO 'LUHWWRUH Dmministrativo, mentre
un apposito istituto di credito bancario si occupa del servizio di cassa.
Ancora una volta, pHUz O¶DXWRQRPLD DWWULEXLWD DOOH ,VWLWX]LRQL
AFAM in materia di amministrazione, finanza e contabilità è limitata
dalla stessa legge che la prevede, nel punto in cui dispone che il rego-
lamento elaborato dalle istituzioni deve essere conforme ad uno sche-
ma tipo elaborato dal Ministero che in seguito è sottoposto allo speci-
fico controllo del MIUR, nella forma di richiesta motivata di riesame.
Il successivo d.P.R. n. 132/2003 stabilisce le modalità ed i tempi per
la delibera e la trasmissione al Ministero del regolamento di ammini-
strazione, finanza e contabilità.
6HFRQGROR³6FKHPDGLUHJRODPHQWRGLDPPLQLVWUD]LRQHILQDQ]DH
FRQWDELOLWj´ GHO 0,85 LO UHJRODPHQWR HODERUDWR GDOOH ,VWLWX]LRQL
AFAM in ambito amministrativo, finanziario e contabile consente di
ottenere la visione complessiva delle entrate, delle uscite e quindi di
FRPH VLD FRVWLWXLWR O¶LQWHUR SDWULPRQLR GHOO¶,VWLWXWR ,Q WDO PRGR VL
tengono sempre ben presenti le finalità e gli obiettivi istituzionali e
operando un adeguato controOORVXOO¶DQGDPHQWRJHVWLRQDOHVLFHUFDGL
raggiungere il miglior grado di efficienza, efficacia ed economicità
GHOO¶,VWLWXWR,OULVSHWWRGHLSULQFLSLIRQGDPHQWDOLLQPDWHULDGLRUGLQa-
mento contabile pubblico diventa condizione imprescindibile affinché
ogni istituzione adotti il proprio regolamento. Pertanto è necessario
operare opportuni controlli di legittimità, regolarità e correttezza
306 Manuale di diritto delle arti e dello spettacolo

GHOO¶D]LRQHDPPLQLVWUDWLYDHGLUHJRODULWjDPPLQLVWUDWLYDHFRQWDELOH
affidati ad un Collegio di revisori composto da tre membri designati
GDO0LQLVWHURGHOO¶(FRQRPLDHGHOOH)LQDQ]H 0() HGDO0,85,QIi-
ne si ricordi che le Istituzioni AFAM sono pubbliche amministrazioni
e per tal motivo godono di autonomia negoziale, potendo stipulare
contratti e convenzioni di qualsiasi genere per raggiungere i fini istitu-
zionali e nel rispetto della legislazione vigente.

16.4. La governance delle Istituzioni AFAM

'RSR DYHU DIIURQWDWR LO WHPD GHOO¶DXWRQRPLD ULFRQRVFLXWD DOO¶AFAM


analizzando la figura del Direttore amministrativo, sembra opportuno
indicare gli altri fondamentali organi che compongono la governance
o amministrazione istituzionale. Si specifichi che per organo si inten-
de lo strumento espressione della volontà della persona giuridica, nel
QRVWURFDVRO¶,stituto AFAM, che agisce attraverso una o più persone
fisiche costituenti un ufficio molto qualificato e capace di compiere
atti giuridici. Gli uffici, infatti, non sono altro che unità soggettive
elementari attraverso le quali si articola la struttura organizzativa
GHOO¶HQWHHFKHVLFRPSRQJRQRGLSHUVRQHILVLFKHDFXLVRQRDVVHgnati
specifici compiti.
La disciplina in materia di governance delle Istituzioni AFAM è
contemplata dal d.P.R. n. 132/2003 che inquadra tra i soggetti preposti
al governo gli organi monocratici: Presidente e Direttore e gli organi
collegiali (Consiglio di amministrazione, noto FRQ O¶DFURQLPR &'$
Consiglio accademico, Collegio dei revisori, Nucleo di valutazione,
Collegio dei professori e Consulta degli studenti). Analizzando i prin-
cipali organi di vertice si pone un automatico confronto tra il sistema
AFAM ed il modello universitario e vengono alla luce due figure ap-
parentemente simili ma che presentano ruoli e competenze molto dif-
ferenti, il Direttore artistico e il Direttore amministrativo (di
TXHVW¶XOWLPRJLjVLqSDUODWRLQSUHFHGHQ]D /¶DWWHQ]LRQHYerso gli or-
gani monocratici di vertice, tuttavia, implica un primo approfondimen-
to sulla figura del Presidente e su quella del Direttore artistico che at-
traverso lo svolgimento delle proprie attività devono rappresentare
O¶LVWLWX]LRQHHODVXDYRORQWj
XVI. ,OVLVWHPDGHOO¶$OWD)RUPD]LRQH$UWLVWLFDH0XVLFDOH 307

16.4.1. Il Presidente

,O 3UHVLGHQWH qOD SHUVRQD ILVLFD WLWRODUHGHOO¶RUJDQR PRQRFUDWLFR FKH


ULFRSUH XQD GHOOH FDULFKH GLUHWWLYH SL DOWH DOO¶LQWHUQR GHOOD VWUXttura
RUJDQL]]DWLYDGHOO¶HQWH(gli infatti possiede una qualifica che non può
essere inferiore a quella dirigenziale ed inoltre è il rappresentante le-
gaOHJHQHUDOHGHOO¶LVWLWX]LRQH3HUWDOLPRWLYLHJOLQRQVRORSXzUDp-
SUHVHQWDUHO¶HQWHLQJLXGL]LRVLDGDOODWRDWWLYRVLDGDTXHOORSDVVLYR
ma in più vanta un potere negoziale che gli consente di essere compe-
tente nei rapporti intersoggettivi, emettere dichiarazioni contrattuali e
QHJR]LDOL VRWWRVFULYHUH FRQWUDWWL WXWWR SHU FRQWR GHOO¶LVWLWX]LRQH ,O
Presidente è titolare professionale del suo ufficio e vi è legato da un
rapporto di ufficio, che ha carattere giuridico organizzativo e da uno di
servizio previsto dalla disciplina contrattuale, che si sostanzia
QHOO¶DWWULEX]LRQHGLGLULWWLHGREEOLJKL
/¶LQYHVWLWXUDGHO3UHVLGHQWHVLSUHVHQWDFRPHDWWRRUJDQL]]DWLYR ed
è effettuata dal Ministero. Tale atto consente di attribuirgli funzioni
ULFRQRVFLXWHGDXQ¶DSSRVLWDOHJJHLVWLWXWLYDVHFRQGRODTXDOHODVXa de-
signazione, effettuata dal Consiglio accademico, deve realizzarsi at-
traverso un atto di nomina presidenziale di competenza del MIUR.
Il d.P.R. n. 132/2003 agli artt. 5 e 7 individua ulteriori competenze
SUHVLGHQ]LDOLUHODWLYHDOUDSSRUWRFRQLO&'$GHOO¶LVWLWX]LRQHVHFRQGR
la normativa il Presidente è considerato competente a convocare, a
SUHVLHGHUHLO&'$HGHYHQWXDOPHQWHDILVVDUQHO¶RUGLQHGHO giorno ed
in caso si verifichi parità di voto in occasione delle deliberazioni del
CDA, il voto presidenziale prevale. Tale disciplina mette in evidenza
una serie di contraddizioni, in primo luogo perché, facendo prevalere
la figura del Presidente su quelODGHO&'$HSUHYHGHQGRO¶LQWHUYHQWR
GLUHWWR GHO PLQLVWHUR FRPSURPHWWH O¶HOHPHQWR FDUDWWHULVWLFR
GHOO¶RUJDQRFROOHJLDOHODVXDDXWRQRPLDFKHVLPDQLIHVWDDWWUDYHUVRLO
potere di autogoverno. In secondo luogo perché si verifica un chiaro
contrasto tra la regolamentazione AFAM e quella universitaria in tema
GL&'$LQTXDQWRTXHVW¶XOWLPDSUHYHGHFKHLOSUHVLGHQWHGHO&'$VLD
eletto dai suoi componenti e possa corrispondere anche alla figura del
5HWWRUHPDFKHQRQVLDFRQVHQWLWRO¶LQWHUYHQWRGHOPLQLVWHUR Elemen-
WRFRPXQHDOO¶$)$0HDOOHXQLYHUVLWjqLQYHFHLOUXRORULFRQRVFLXWR
al CDA quale principale organo rappresentativo del potere di autogo-
308 Manuale di diritto delle arti e dello spettacolo

verno delle istituzioni.

16.4.2. Il Direttore artistico

Altro organo di vertice monocratico è il Direttore artistico, il cui tito-


ODUH q XQD SHUVRQD ILVLFD FKH ULFRSUH XQ¶DOWD FDULFD GLUHWWLYD VHFRQGD
soltanto al Presidente. In concreto, il Direttore artistico svolge attività
FKHJOLFRQVHQWRQRGLJHVWLUHO¶LVWLWXWRFRPHVHIRVVHGHWHQWRUHDVVROu-
to dei poteri, il capo indiscusso. Basti pensare che gli può convocare e
presiedere il consiglio accademico, a differenza del Presidente. Inoltre
JOLVLDWWULEXLVFHODUHVSRQVDELOLWjGHOO¶DWWLYLWjGLGDWWLFDVFLHQWLILFDHG
artistica e una rappresentanza legale speciale, ossia la possibilità di
UDSSUHVHQWDUHO¶LVWLWXWRLQJLXGL]LRQHOFDVRLQFXLRJJHWWRGHOFRQWHn-
zioso siano collaborazioni ed attività per conto di terzi nelle materie di
sua responsabilità.
/D OHJJH Q  DOO¶DUW  GLVFLSOLQD O¶HOH]LRQH GHO 'LUettore
artistico, indicando LVRJJHWWLFKHSRVVRQRSDUWHFLSDUHDOO¶HOH]LRQHGi-
retta per la sua investitura. ,O'LUHWWRUHqWLWRODUHRQRUDULRGHOO¶XIILFLRH
vi è legato da un rapporto di ufficio e da un rapporto di amministra-
zione; pertanto, svolge i suoi compiti unicamente a titolo rappresenta-
WLYR UHFHSHQGR OD UHWULEX]LRQH SHU OR VYROJLPHQWR GL XQ¶DWWLYLWj FKH
concretamente non compie ma soltanto perché rappresenta il giusto
FRUULVSHWWLYRSHUODIXQ]LRQHSXEEOLFDHVHUFLWDWD/¶XVRGHOORVWUXPHn-
WR HOHWWLYR SHU O¶LQYestitura del Direttore, però, impedisce che gli sia
attribuita la qualifica di dirigente e i correlati poteri, in quanto la diri-
genza rientra tra i lavori subordinati ai quali non si accede tramite ele-
zione.
Anche la giurisprudenza si è espressa sul tema, confermando che il
Direttore artistico non può che rientrare tra le alte cariche direttive
GHOO¶$)$0VHQ]DSHUzSRWHUJRGHUHGHLSULYLOHJLULFRQRVFLXWLDLGLUi-
genti. La riforma del sistema AFAM, infatti, ha appositamente previ-
sto due organi monocratici che fossero a capo delle istituzioni, per te-
nere separate la gestione amministrativa, tecnica e finanziaria
GHOO¶HQWH GD TXHOOD GLGDWWLFR VFLHQWLILFD 3HU FXL q DSSURSULDWR FKH LO
3UHVLGHQWH VLD O¶RUJDQR GL QRPLQD PLQLVWHULDOH H FRQ UDSSUHVHQWDQ]D
legale che ha carattere dirigenziale e si occupi del lato amministrativo,
PHQWUHLO'LUHWWRUHDUWLVWLFRVLDO¶RUJDQRHOHWWRFRQSRWHULGLUHWWLYLHG
XVI. ,OVLVWHPDGHOO¶$OWD)RUPD]LRQH$UWLVWLFDH0XVLFDOH 309

LQTXDQWRGRFHQWHUDSSUHVHQWLLOFRUSRDFFDGHPLFRFXUDQGRO¶DPELWR
GHOOD GLGDWWLFD GHOOD VFLHQ]D H GHOO¶DUWH &Lò rende evidente la diffe-
renza tra il sistema AFAM e quello universitario per quel che riguarda
la struttura organizzativa degli organi monocratici al vertice, poiché si
realizza una bipartizione dei poteri tra Presidente e Direttore artistico
QHOO¶$)$0Hsi accumulano tutte le funzioni ed i compiti riconosciuti
DOOHGXHILJXUHLQXQXQLFRVRJJHWWRSRVWRDFDSRGHOO¶RUJDQL]]D]LRQH
universitaria, il Rettore.
Il decreto n. 132/2003 ricomprende tra gli organi di vertice
GHOO¶$OWD)RUPD]LRQH$UWLVWLFDH0XVLFDle anche quelli a carattere col-
legiale come il Consiglio di amministrazione (CDA) e il Consiglio
Accademico e ne menziona, poi, alcuni che hanno funzioni minori
come il Collegio dei professori. Quanto al termine collegiale, esso in-
dica una pluralità di persone fisiche che insieme compongono una uni-
tà organizzativa anche detta collegio, che realizza il primo dei due
DVSHWWLVWUXWWXUDOLGHOO¶XIILFLRFROOHJLDOHGLFXLLOVHFRQGRqUDSSUHVHn-
tato dai suoi componenti. In particolare il collegio costituisce una real-
tà giuridica autonoma, disciplinato da un proprio regolamento interno
HDFXLLQVLHPHDLVXRLFRPSRQHQWLqULIHULWRLOUDSSRUWRG¶XIILFLR

16.4.3. Il Consiglio di amministrazione

Tra gli organi di vertice a carattere collegiale il CDA assume una no-
tevole rilevanza per i pieni poteri di cui è investito in campo normati-
vo, finanziario ed organizzativo e per questo si configura come
O¶RUJDQRGLJRYHUQRGHOO¶HQWHVHFRQGRLOGLVSRVWRGHOO¶DUWG35Q
132/2003. Tale normativa, poi, fa riferimento alla composizione del
CDA indicando tra i suoi membri: il Presidente, il Direttore, un docen-
te designato dal Consiglio accademico, uno studente designato dalla
Consulta degli studenti, un esperto di amministrazione nominato dal
MIUR e scelto tra personalità dotate di spiccate abilità professionali.
Prende parte al CDA anche il Direttore amministrativo: nello specifi-
co, egli svolge le funzioni di segretario. Il CDA presenta alcune carat-
teristiche comuni al Consiglio accademico che consentono di qualifi-
carlo, aOODSDULGLTXHVW¶XOWLPRRUJDQRFROOHJLDOHRQRUDULRHYLUWXDOH
sia per la presenza di membri effettivi e di altri soltanto rappresentati-
vi, sia perché il collegio può esprimersi, assumendosi la responsabilità
310 Manuale di diritto delle arti e dello spettacolo

delle proprie scelte, anche attraverso la mera maggioranza e quindi


senza la totalità dei suoi componenti.
Il d.P.R. 132/2003 in tema di organizzazione del CDA delle Istitu-
zioni AFAM, ha posto seri dubbi interpretativi circa il rispetto dei
principi contenuti nella legge di riforma del 1999. Si è temuto che fos-
VHPLQDWDO¶DXWRQRPLDULFRQRVFLXWDDOO¶$)$0DQFKHDOLYHOORFRVWLWu-
zionale, sia ammettendo il frequente intervento ministeriale nei pro-
cessi di composizione del CDA e di nomina del Presidente del CDA;
sia assegnando enormi poteri al Presidente del CDA; sia attribuendo
numerose funzioni al CDA e agli organi esterni per sminuire il potere
GLDXWRJRYHUQRFRVDTXHVW¶XOWLPDFKHDFFDGHDQFKHQHOOHUniversità.
Tuttavia le critiche sollevate in relazione alla normativa AFAM
VXOO¶RUJDQL]]D]LRQHGHO&'$ non sono state adeguatamente smentite
ma hanno creato i presupposti per mettere a confronto la disciplina
AFAM e quella universitaria ed individuare alcuni punti in comune.
La più recente novità riguardante il CDA delle Istituzioni AFAM è
stata introdottD FRQ OD GHFLVLRQH GHO 0LQLVWUR GHOO¶,VWUX]LRQH
GHOO¶8QLYHUVLWjHGHOOD5LFHUFD6WHIDQLD*LDQQLQLGLILUPDUHLOGHFUHWR
con la rosa di esperti da cui selezionare i rappresentanti del MIUR per
L&'$GHOO¶$OWD)RUPD]LRQH$UWLVWLFDH0XVLFDOH6LSDUODGL³URVD´GL
HVSHUWLSHUUHQGHUHO¶LGHDGLFRPHYHQJDQRSUHVHQWDWLLSURILOLSURIHs-
sionali di alte personalità, tra le quali il Ministero sceglierà i propri
rappresentanti presso i CDA delle Istituzioni AFAM.
Per la nomina degli esperti è stata disposta una particolare procedu-
ra, adottata per la prima volta dal Ministero, che mira a garantire il ri-
spetto della trasparenza, professionalità, turnazione e qualità dei can-
didati.
/¶RELHWWLYRqUHQGHUHFRQRVFLELOHVLDLSURILOLSURIHVVLRQDOLGHLFDn-
didati, sia il processo attraverso il quale avviene la loro selezione e per
tale motivo nel mese di maggio del 2014 è stato pubblicato un avviso
contenente quella che è stata definita la rosa di profili degli esperti.
La prima fase della procedura si concentra sulla figura di una
Commissione di valutazione, appositamente nominata nel mese di lu-
glio del 2014, per analizzare le candidature ed ammettere allo step
successivo soltanto quelle che risultano complete e per questo valide.
Lo scorso luglio la Commissione ha individuato 303 profili idonei a
ULFRSULUH O¶LQFDULFR VX  FDQGLGDWXUH ULWHQXWH YDOLGH ,O ULFRQRVFi-
XVI. ,OVLVWHPDGHOO¶$OWD)RUPD]LRQH$UWLVWLFDH0XVLFDOH 311

PHQWR GHOO¶LGRQHLWj KD FRQVHQWLWR O¶LQVHULPHQWR GHL FDQGLGDWL


DOO¶LQWHUQR GHOOD URVD SXEEOLFDWD VXO VLWRGHO 0,85 VHFRQGR O¶RUGLQH
alfabetico e senza attribuzione di punteggio. Infine si esclude che
O¶LQVHULPHQWR QHOOD URVD SRVVD DFFUHVFHUH O¶DVSHWWDWLYD GL RWWHQHUH OD
nomina ad esperto o il riconoscimento di alcun diritto.

16.4.4. Il Consiglio accademico

Il secondo organo collegiale di vertice che si va ad esaminare è il


Consiglio accademico, costituito da un numero variabile di membri
effettivi che può arrivare fino ad un massimo di tredici componenti e
GLFXLIDQQRSDUWHGRFHQWLG¶LVWLWXWRGRWDWLGLFRPSURYDWDSURIHVVLRQa-
lità ed eletti dal corpo docente, due studenti designati dalla consulta
degli studenti e naturalmente il Direttore che lo presiede, come si
HYLQFH GDOO¶DUW  GHO G35 3. Il Direttore artistico
GHOO¶,stituzione, quindi, oltre ad essere un organo monocratico di ver-
tice con specifiche competenze e poteri in ambito didattico-scientifico,
è anche Presidente di diritto del Consiglio accademico in quanto tale
carica gli è riconosciuta dalla legge. Non esiste un rapporto gerarchico
tra Presidente e membri del collegio, ma egli è detentore di poteri tali
che lo rendono primus inter pares rispetto a tutti gli altri. Pertanto,
O¶HVHUFL]LRGHOODSRWHVWjGLUHWWLYDJOLFRQVHQWHGLVYROJHUHDOFXQHDWWLYi-
WjFRPHFRQYRFDUHLOFROOHJLRIRUPDUHO¶RUGLQHGHOJLRUQRFRRUGLQDUH
e moderare discussioni e così tante altre.
Il Consiglio è un organo collegiale onorario con funzioni delibera-
tive e consultive, dove i soli membri del collegio costituenti la mag-
gioranza sono responsabili per le decisioni prese, mentre le opinioni
motivate di coloro che costituiscono la minoranza hanno mero valore
di giudizio alterno.
Il Consiglio è anche un organo collegiale virtuale dal momento che
rappresenta molteplici interessi attraverso la composizione del colle-
gio e mira a perseguirli potendo deliberare pur se i suoi membri non
siano tutti presenti.
Le funzioni demandate al Consiglio accademico dal decreto del
2003 includono attività di indirizzo, programmazione e controllo nel
settore didattico, scientifico, artistico e di ricerca in considerazione
della disponibilità del bilancio finanziario. Si verifica un aumento del-
312 Manuale di diritto delle arti e dello spettacolo

le competenze che sono riconosciute al Consiglio attraverso


O¶DWWULEX]LRQHGHLFRPSLWLGLGHWHUPLQD]LRQHHGLGHOLEHUD]LRQHPDVo-
prattutto assegnandogli una competenza di tipo residuale rispetto a tut-
te quelle materie che non sono espressamente demandate al CDA.
In questo modo, pur attribuendo sempre più poteri consultivi al
Consiglio accademico, si limita il loro ambito di applicazione alla di-
dattica e si conferma la superiorità del CDA in materia di gestione fi-
nanziaria ed organizzazione amministrativa delle Istituzioni AFAM.

16.5. Il personale docente e il sistema di reclutamento

La riforma del sistema AFAM ha inciso, tra le altre cose, sulla disci-
plina del personale docente e sul suo sistema di reclutamento, renden-
dola apparentemente più vicina a quella universitaria. Il personale do-
cente delle Istituzioni AFAM, infatti, è soggetto alla Contrattazione
Collettiva Nazionale di Lavoro (CCNL) del comparto AFAM e rece-
pisce la suddivisone nelle due fasce per i docenti, distinguendo tra co-
loro che appartengono alla prima fascia, ossia i titolari di cattedra e tra
coloro che appartengono alla seconda fascia, come gli assistenti e gli
accompagnatori al pianoforte. Nonostante ciò, esiste una sostanziale
differenza tra personale docente di prima e seconda fascia, a seconda
di se si consideri il trattamento riservato loro nelle Università o nelle
Istituzioni AFAM.
I professori universitari di prima e seconda fascia, anche detti pro-
fessori ordinari e associati, si distinguono per le maggiori responsabi-
lità e i diversi compiti riconosciuti ai primi e dal punto di vista eco-
nomico, per le differenze circa la retribuzione percepita, essendo di
gran lunga minore il compenso riconosciuto ai professori associati.
Quanto ai docenti AFAM, si cerca di superare la differenza tra profes-
sori di prima e seconda fascia dal punto di vista della didattica, attri-
buendo loro stesse competenze e compiti di ricerca, studio e produ-
zione artistica, ma si lascia sopravvivere la distinzione tra professori
ed assistenti per quel che riguarda il riconoscimento del ruolo docente
e il relativo differente trattamento economico. Diritti e doveri del do-
cente sono disciplinati dalla contrattazione collettiva nazionale che, ad
esempio, prescrive al profesVRUH$)$0O¶RVVHUYDQ]DGLVWDWXWLHUHJo-
XVI. ,OVLVWHPDGHOO¶$OWD)RUPD]LRQH$UWLVWLFDH0XVLFDOH 313

ODPHQWLDIILQFKpSUHQGDSDUWHDJOLRUJDQLGLJRYHUQRGHOO¶,VWLWX]LRQH
$TXHVWRSXQWRqSRVVLELOHULYROJHUHO¶DWWHQ]LRQHDGXQSDUWLFRODUH
aspetto del sistema AFAM ± il reclutamento del personale docente e
non docente ± avendo come punto di partenza la normativa sulle pro-
cedure di reclutamento nelle P.A. contenuta nel d.lgs. n. 165/2001.
TaOHQRUPDWLYDqIRQGDWDVXOO¶RVVHUYDQ]DGHLSULQFLSLGLLPSDU]LDOLWj
trasparenza, celerità, economicità ed equità nel trattamento del perso-
nale ed è estesa al sistema di reclutamento AFAM attraverso la ado-
zione di specifiche procedure selettive, finalizzate a garantire la mas-
sima professionalità di coloro che vengono assunti con contratto indi-
viduale di lavoro.
Gli organi di vertice delle amministrazioni possono stabilire se e
quando avviare le procedure di reclutamento, in base alla programma-
zione del fabbisogno di personale a cui sono tenuti ogni tre anni, come
VLHYLQFHGDOO¶DUWGHOODOHJJHQ
In materia di reclutamento AFAM, la più recente regolamentazione
è disposta con decreto legge n. 104/2013 e con la successiva legge di
conversione n. 128/2013 che si pongono come obiettivo quello di as-
VLFXUDUHLOUHJRODUHVYROJLPHQWRGHOO¶DWWLYLWjSHUO¶DQQRDFFDGHPLFRLQ
corVRHO¶DWWXD]LRQHGHOOHGLVSRVL]LRQLGHOODOHJJHGLULIRUPD/DOHJJH
di conversione n. 128 del 2013, facendo espresso rinvio alla legge n.
508QHLQGLFDO¶DUWVHWWLPRFRPPDFKHSUHYHGHO¶HPDQD]LRQH
di un regolamento ministeriale in grado di disciplinare procedure e
modalità di assunzione del personale AFAM. Ancora oggi, mancando
il regolamento a cui si riferisce la legge di riforma del 1999, il reclu-
tamento dei docenti è una materia disciplinata in modo generico che
ULFRQRVFHFRPSHWHQ]HFLUFDO¶DVVXQ]LRQHGHOSHUVRQDOHO¶DWWLYLWjGLGDt-
tica e di ricerca, al Consiglio Accademico ed al CDA, in considera-
zione del bilancio e su approvazione dei Ministri competenti.
Tuttavia, la legge n. 508/1999 di riforma del sistema AFAM ripri-
stina uno strumento in grado di consentire la copertura dei posti che
sono disponibili in organico: le graduatorie QD]LRQDOL HDOO¶DUW  Ve-
condo comma, prevede la loro trasformazione in graduatorie nazionali
ad esaurimento.
È importante approfondire il discorso sulle graduatorie nazionali
AFAM, introdotte e disciplinate già con leggi precedenti ± id est T.U.
n. 297 del 1994, legge n. 124/1999 ± per conoscerne la disciplina e
314 Manuale di diritto delle arti e dello spettacolo

confrontarla con quella applicabile alle Università. Infatti seppur le


Istituzioni AFAM e le Università siano entrambe qualificate istituti di
DOWDFXOWXUDDLVHQVLGHOO¶DUW 33 cost., anche la regolamentazione rela-
tiva al reclutamento docenti presenta rilevanti differenze. Innanzitutto
i docenti AFAM non hanno accesso al ruolo tramite il conseguimento
della abilitazione nazionale, come accade per i professori universitari,
ma facendo ricorso alle graduatorie nazionali ad esaurimento. Le gra-
duatorie AFAM sono graduatorie nazionali permanenti (Graduatoria
QD]LRQDOH DG HVDXULPHQWR QRWD FRQ O¶DFURQLPR *1( H *raduatoria
esami e titoli, con acronimo GET) e le modalità di inserimento in esse
devono essere disposte con regolamento ministeriale, in base a quanto
prescrive la legge n. 124/1999.
In primo luogo, sono automaticamente inseriti nelle graduatorie
permanenti: i docenti che presentano i requisiti necessari per essere
inseriti nelle graduatorie dei concorsi per soli titoli ormai soppressi; i
docenti che abbiano superato il concorso per titoli ed esame per uno
stesso posto o una stessa classe di concorso. Sono inclusi nelle gra-
duatorie permanenti anche i docenti i cui titoli artistici, culturali e pro-
IHVVLRQDOLVLDQRVWDWLYDOXWDWLSHUO¶LQVHULPHQWRLQJUDGXDWRULHQD]LRQDOL
per le supplenze o di istituto, ottenendo il punteggio minimo richiesto
dalla precedente normativa e dopo aver superato il concorso per titoli
e per esami, per lo stesso posto o la stessa classe di concorso, o co-
munque sia stata valutata la loro preparazione culturale e didattica at-
traverso il superamento di un esame orale.
Ad oggi, quindi, il personale docente e i pianisti accompagnatori
che insegnano ed aspirano alla assunzione in ruolo provengono per
XQDPHWjGDOOHJUDGXDWRULHQD]LRQDOLSHUPDQHQWLHSHUO¶DOWUDPHWjVo-
no professori che ogni anno superano concorsi per titoli ed esami e ri-
coprono posti annualmente assegnabili. Seppur la recente legge di
conversione n. 128/2013 rinvii alle disposizioni della legge di riforma
del 1999, confermando la necessità che venga emanato un regolamen-
to ministeriale per disciplinare la materia di reclutamento del persona-
le docente AFAM, tuttavia, tale regolamento non ha ancora preso
forma e si è ancora in attesa della sua emanazione. Per tale motivo, la
legge del 2013 menziona vari provvedimenti di legge e decreti legge
che negli anni hanno disciplinato il reclutamento dei docenti AFAM
ed introduce delle integrazioni alla regolamentazione della materia, al
XVI. ,OVLVWHPDGHOO¶$OWD)RUPD]LRQH$UWLVWLFDH0XVLFDOH 315

fine di assicurare lo svolgimento delle attività didattiche e sopperire


alle lacune normative.
Di particolare importanza è la modifica apportata alla legge di con-
versione n. 143/2004, che ha introdotto delle apposite graduatorie per
una particolare categoria di docenti: i precari. Secondo il disposto del-
ODOHJJHQO¶LQVHULPHQWRQHOOHJUDGXDWRULHGHLGRFHQWLSUe-
cari è consentito esclusivamente dopo che siano stati valutati i titoli
artistico-professionali e culturali, in base alle disposizioni di uno spe-
cifico decreto del MIUR e purché siano stati prestati 360 giorni di la-
voro presso le Istituzioni AFAM. La graduatoria per docenti precari ex
lege n.143/2004 ha consentito di coprire i posti disponibili in organi-
co, attraverso la stipula di contratti a tempo determinato e soltanto do-
SRO¶DVVHJQD]LRQHGHLSRVWLDFRORURFKHHUDQRLQFOXVLQHOODJUDGXDWRULD
QD]LRQDOHDGHVDXULPHQWR&RQO¶HPDQD]LRQHdella legge di conversio-
ne n. 128/2013, le graduatorie nazionali di cui alla legge n. 143/2004
sono trasformate in graduatorie nazionali ad esaurimento, utili per
O¶DWWULEX]LRQH GHJOL LQFDULFKL GL LQVHJQDPHQWR FRQ FRQWUDWWR D WHPSR
indeterminato e determinato.
Tuttavia le innovazioni introdotte dalla legge n. 128/2013 non sono
state risolutive per la regolamentazione del reclutamento del personale
GRFHQWH$)$0PDKDQQRFRQIHUPDWRO¶HVLJHQ]DGLDWWXDUHODQRUPa-
tiva in materia di riforma del sistema AFAM e la necessità che sia
formulata una disciplina legislativa puntuale.

16.6. Il valore giuridico dei titoli di studio

/¶XOWLPR SUREOHPD FKH SDUH RSSRUWXQR DQDOL]]DUH ULJXDUGD LO YDORUH


dei titoli di studio rilasciati dalle Istituzioni AFAM. Per comprendere
le evoluzioni più recenti sul tema è indispensabile ricostruire, seppur
EUHYHPHQWHLOTXDGURGLULIHULPHQWRYLJHQWHSULPDGHOO¶HQWUDWDLQYi-
gore della legge n. 508. Le Istituzioni AFAM, a quel tempo, rilascia-
vano diplomi a seguito di un percorso di studi la cui durata variava in
ragione della difficoltà della disciplina impartita. Per esempio, nei
Conservatori erano attivati percorsi di studio aventi una durata varia-
bile ricompresa tra i 5 anni (si veda il piano di studi previsto per il
canto) e i 10 anni (tale lasso di tempo era prescritto per lo studio del
316 Manuale di diritto delle arti e dello spettacolo

SLDQRIRUWH GHOOD FRPSRVL]LRQH H GHOOD GLUH]LRQH G¶RUFKHVWUD  SHU OH


altre Istituzioni la durata era tendenzialmente più breve, in genere 4
anni.
/¶LQWURGX]LRQHGHOsistema ³3+2´ previsto e disciplinato dalla legge
n. 508/1999, ha determinato una mutamento anche per quanto concer-
ne il valore dei titoli di studio. Il tradizionale diploma, infatti, è stato
sostituito dai diplomi accademici di I e II livello, equiparati dalla leg-
ge agli analoghi titoli di studio rilasciati dalle Università italiane. La
nuova normativa si preoccupava anche di disciplinare quale fosse il
rapporto tra i vecchi titoli di studi ± i quali, a dire il vero, vengono an-
cora rilasciati dalle Istituzioni ± e i nuovi diplomi accademici. A tal
SURSRVLWR VL SUHYHGH HVSUHVVDPHQWH O¶HTXLSROOHQ]D id est:
O¶HTXLSDUD]LRQH tra il diploma di vecchio ordinamento e il diploma ac-
cademico di I livello). Pertanto, una volta terminato il percorso tradi-
zionale di studi, il discente poteva iscriversi senza alcun problema al
biennio specialistico, al fine di conseguire anche il diploma accademi-
co di II livello.
,OTXDGURqULPDVWRVRVWDQ]LDOPHQWHLQYDULDWRILQRDOO¶HQWUDWDLQYi-
gore della legge finanziaria per il 2013 (l. 24 dicembre 2012, n. 228).
In particolare, il tema del valore giuridico dei titoli di studio è ampia-
mente affrontato nei commi 102-GHOO¶DUWGHOODO7DOL
disposizioni, introdotte aOILQHGLYDORUL]]DUHLOVLVWHPDGHOO¶$OWD)Rr-
mazione Artistica e Musicale e favorire la crescita del Paese, prevedo-
QR FKH DO ILQH HVFOXVLYR GHOO¶DPPLVVLRQH DL SXEEOLFL FRQFRUVL SHU
O¶DFFHVVRDOOHTXDOLILFKHIXQ]LRQDOLGHOSXEEOLFRLPSLHJRSHUOHTXDOL
ne è prescritto il possesso, i diplomi accademici di primo livello rila-
sciati dalle istituzioni IDFHQWLSDUWHGHOVLVWHPDGHOO¶Dlta formazione e
specializzazione artisticD H PXVLFDOH GL FXL DOO¶DUW  SULPR FRPPD,
della legge 21 dicembre 1999, n. 508, sono equipollenti ai titoli di lau-
rea rilasciati dalle Università appartenenti alla classe L-3 dei corsi di
laurea nelle discipline delle arti figurative, della musica, dello spetta-
colo e della moda di cui al d.m. 16 marzo 2007.
A ciò, la nuova normativa aggiunge che, sempre al fine esclusivo
GHOO¶DPPLVVLRQHDLSXEEOLFLFRQFRUVLSHUO¶DFFHVVRDOOHqualifiche fun-
zionali del pubblico impiego per le quali ne è prescritto il possesso, i
diplomi accademici di secondo livello rilasciati dalle istituzioni di cui
al comma 102, sono equipollenti ai titoli di laurea magistrale rilasciati
XVI. ,OVLVWHPDGHOO¶$OWD)RUPD]LRQH$UWLVWLFDH0XVLFDOH 317

dalle Università appartenenti alle seguenti classi dei corsi di laurea


magistrale di cui al d.m. 16 marzo 2007:
a) Classe LM-12 (Design) per i diplomi rilasciati dagli Istituti supe-
riori per le industrie artistiche, nonché dalle Accademie di belle
DUWL QHOO¶ambito della scuola di «Progettazione artistica per
O¶LPSUHVDª GL FXL DOOD 7DEHOOD $ GHO d.P.R. 8 luglio 2005, n.
212;
b) Classe LM-45 (Musicologia e beni musicali) per i diplomi rila-
VFLDWL GDL &RQVHUYDWRUL GL PXVLFD GDOO¶$FFDGHPLD QD]LRQDOH GL
danza e dagli Istituti musicali pareggiati;
c) Classe LM-65 (Scienze dello spettacolo e produzione multime-
diale  SHU L GLSORPL ULODVFLDWL GDOO¶Accademia nazionale di arte
GUDPPDWLFD QRQFKp GDOOH $FFDGHPLH GL EHOOH DUWL QHOO¶DPELWR
delle scuole di «Scenografia» e di «Nuove tecnologie GHOO¶DUWHª
di cui alla Tabella A del d.P.R. 8 luglio 2005, n. 212;
d) Classe LM- 6WRULDGHOO¶DUWH per i diplomi rilasciati dalle Ac-
FDGHPLHGLEHOOHDUWLQHOO¶DPELWRGLWXWWHOHDOWUHVFXROHGLFXLDl-
la Tabella A del d.P.R. 8 luglio 2005, n. 212, ad eccezione di
quelle citate alle lettere a) e c).
In base al nuovo quadro, dunque, i diplomi accademici di secondo
livello rilasciati dalle istituzioni di cui all¶DUW 2, primo comma, della
legge 21 dicembre 1999, n. 508 costituiscono titolo di accesso ai con-
corsi di ammissione ai corsi o scuole di dottorato di ricerca o di spe-
cializzazione in ambito artistico, musicale, storico artistico o storico-
musicale istituiti dalle Università.
Il comma 105, inoltre, prevede che entro il termine di dodici mesi
decorrenti dalla data di entrata in vigore della legge, le Istituzioni di
FXL DOO¶DUW  SULPR FRPPD GHOOD OHJJH  GLFHPEUH  Q ,
concludano la procedura di messa a ordinamento di tutti i corsi acca-
demici di secondo livello.
I titoli sperimentali conseguiti al termine di percorsi validati dal
0LQLVWHUR GHOO¶,VWUX]LRQH GHOO¶8QLYHUVLWj H GHOOD 5LFHUFD QHOOH ,stitu-
zioni di cui al comma 102, entro la data di cui al comma 105, sono
equipollenti ai diplomi accademici di primo e di secondo livello, se-
condo una tabella di corrispondenza determinata con decreto del Mi-
QLVWUR GHOO¶,VWUX]LRQH GHOO¶8QLYHUVLWj H GHOOD 5icerca sulla base dei
medesimi principi di cui ai commi 102 e 103, da emanarsi entro tre
318 Manuale di diritto delle arti e dello spettacolo

mesi dalla data di entrata in vigore della legge.


Infine, ed è questa forse la parte più esecrabile della nuova norma-
tiva, si prevede che i diplomi finali rilasciati dalle Istituzioni di cui al
comma 102, al termine dei percorsi formativi del previgente ordina-
PHQWR FRQVHJXLWL SULPD GHOO¶HQWUDWD LQ YLJRUH GHOOD OHgge n. 228 e
congiuntamente al possesso di un diploma di scuola secondaria supe-
riore, siano equipollenti ai diplomi accademici di secondo livello se-
condo una tabella di corrispondenza determinata con decreto del Mi-
QLVWUR GHOO¶,VWUX]LRQH GHOO¶8QLYHUVLWj H della Ricerca sulla base dei
medesimi principi di cui ai commi 102 e 103, da emanarsi entro tre
mesi dalla data di entrata in vigore della presente legge.
Il nuovo quadro normativo lascia aperte molte questioni. In questa
sede riteniamo utile soffermarci su due problematiche ancora irrisolte
e su cui è auspicabile un ulteriore intervento del legislatore.
In primo luogo, sembra davvero assurdo che venga introdotta una
palese discriminazione tra i diplomi conseguiti prima della data di en-
trata in vigore della legge e quelli conseguiti successivamente a tale
momento. Infatti, tale discriminazione non trova, ad avviso di chi
scrive, alcuna giustificazione e, pertanto, costituisce una evidente vio-
OD]LRQHGHOO¶DUW 3 della Costituzione. Dunque, sul punto, si deve rite-
nere che, in attesa di un intervento correttivo del legislatore, debba es-
sere attribuito ai diplomi di vecchio ordinamento conseguiti dopo
O¶HQWUDWDLQYLJRUHGHOODOHJJHLOPHGHVLPRYDORUHGLODXUHDPDJLVWUDOH
riconosciuto ai titoli conseguiti fino al 2012.
In secondo luogo, si pone il problema di capire se il diplomato che
DEELDJLjFRQVHJXLWRXQWLWRORGLVWXGLRVHFRQGRO¶RUGLQDPHQWRSUHYi-
gente possa ancora iscriversi ad un corso di biennio specialistico, così
FRPH DFFDGHYD SULPD GHOO¶HQWUDWD LQ YLJRre della nuova legge. Sul
punto si ritiene di poter formulare una risposta positiva, in ragione del
fatto che i percorsi di biennio hanno generalmente una denominazione
diversa rispetto ai percorsi di studio tradizionali.
In conclusione, però, non si può non sottolineare la disapprovazio-
QHFKHGHVWDODVFHOWDGLRFFXSDUVLGLXQWHPDFRVuGHOLFDWRQHOO¶DPELWR
di una legge ± quale è quella finanziaria ± che ha per sua natura obiet-
tivi e funzioni molto diversi da quelli qui considerati. Per questa ra-
gione, comHJLjDFFHQQDWRO¶DXVSLFLRqFKHLOOHJLVODWRUHSRVVDWRUQDUH
in tempi brevi sulla materia con interventi risolutivi delle questioni
XVI. ,OVLVWHPDGHOO¶$OWD)RUPD]LRQH$UWLVWLFDH0XVLFDOH 319

appena menzionate.

16.7. Conclusioni

'RSR DYHU LQGLFDWR L SXQWL VDOLHQWL GHOO¶DWWXDOH QRUPDWLYD UHODWLYD DO


settore AFAM, sembra opportuno formulare alcune considerazioni
FRQFOXVLYH/¶LQWHURVWXGLRGHOVLVWHPDGHOO¶$OWD)RUPD]LRQH$UWLVWLFD
H0XVLFDOHUXRWDLQWRUQRDOO¶DQDOLVLGHOODOHJJHQFKHVLSo-
QHO¶RELHWWLYRGLULIRUPDUHFRPSOHWDPHQWHODGLVFLSOLQDGHOVHWtore arti-
stico-musicale. Le molteplici innovazioni introdotte dalla legge n.
508, tuttavia, non sono state sufficienti ad attuare una completa rifor-
ma. Se si considera la regolamentazione delle Istituzioni AFAM ex le-
ge n. 508, infatti, appare attribuita loro una limitata autonomia statuta-
ria, regolamentare ed organizzativa, rispetto al dettato normativo che
auspica, invece, una loro equiparazione alle Università. Inoltre vengo-
no alla luce numerose differenze con il sistema universitario, attraver-
VRO¶HVDPHdi specifici aspetti quali: il ruolo dei principali organi am-
ministrativi, la posizione del personale docente e non docente, il valo-
UHGHLWLWROLGLVWXGLRULODVFLDWLHO¶RIIHUWDIRUPDWLYDLQJHQHUH
/H YDOXWD]LRQL FLUFD O¶HIILFDFLD GHOOD GLVFLSOLQD delle Istituzioni
$)$0 QHOO¶HVVHUH LQQRYDWLYD H ULVROXWLYD SHU LO PRQGR DUWLVWLFR-
culturale inducono a considerare la legge n. 508/1999 incompleta e
talvolta contraddittoria rispetto alle esigenze istituzionali. Si pensi al
rapporto tra Istituzioni AFAM ed Università circa la valorizzazione
del personale docente e si consideri che il trattamento riservato ai pro-
fessori GHOO¶AFAM appare spesso non adeguato rispetto a quello rico-
nosciuto ai docenti universitari.
La breve disamina degli elementi che caratterizzano la disciplina
GHOO¶AFAM consente di affermare che è possibile migliorDUHO¶DWWXDOH
situazione, operando su due versanti: è necessario, infatti, garantire la
piena attuazione di quanto già previsto nella legge, nella consapevo-
lezza che bisogna introdurre nuove norme a tutela del settore.
Capitolo XVII

Riflessioni filosofiche sulla comunicazione artistica


di ROSALIA COMPAGNONE

17.1. È impossibile non comunicare

Nel 1967 Paul Watzlawich (1921-2007), psicologo e filosofo statuni-


tense, nonché fondatore della Scuola di Psicoterapia di Palo Alto (dal
nome della località in cui sorge, in California) in collaborazione con
'RQDOGGH$YLOD-DFNVRQH-DQHW+HOPLFN%HDYLQDQFK¶HVVLSVLFRORJL
HSLRQLHULGHOODVXGGHWWDVFXRODSXEEOLFzXQ¶RSHUDGHVWLQDWDDGiventa-
re una pietra miliare della psicologia mondiale, dedicata alla ricostru-
zione della pragmatica della comunicazione umana e allo studio dei
modelli interattivi, delle patologie e dei pDUDGRVVL,QTXHVW¶RSHUDDOGL
OjGHOO¶LQGDJLQHVXOOHGLQDPLFKHGHOO¶DUWHGHOODFRPXQLFD]LRQHHVXOOH
conseguenze pragmatiche delle interazioni comunicative, vi è una par-
te in cui vengono esposti quelli che sono ormai diventati i cinque as-
siomi fondamentali della comunicazione.
,OSULPRGLTXHVWLDVVLRPLUHFLWD³ÊLPSRVVLELOHQRQFRPXQLFDUH´
Gli altri quattro, invece, hanno un carattere più tecnico. Il secondo
VWDELOLVFH O¶HVLVWHQ]D GL XQD PHWDFRPXQLFD]LRQH DOO¶LQWHUQR GL RJQL
comunicazione, la quale regola i rapporti tra chi sta comunicando. Il
terzo indaga sulla punteggiatura che regola i flussi comunicativi. Il
quarto spiega le differenze tra i due tipi di comunicazione, quella ana-
logica e quella digitale. Il quinto distingue gli scambi di comunicazio-
ne in due tipologie: simmetrici FLRqEDVDWLVXOO¶XJXDJOLDQ]DWUDLsog-
getti comunicanti, ad esempio tra due amici) e complementari (cioè

321
322 Manuale di diritto delle arti e dello spettacolo

basati sulla differenza tra i soggetti comunicanti, ad esempio tra un


docente e un discente).
/¶DVVLRPD VXO TXDOH FL VRIIHUPLDPR SHU GDUH DYYLR DOOD QRVWUD Ui-
flessione sul concetto di spettacolo e più in generale di creazione arti-
stica qVLFXUDPHQWHLOSULPR³qLPSRVVLELOHQRQFRPXQLFDUH´&KHFo-
sa significa questo? È davvero impossibile sottrarsi alla comunicazio-
ne? Sembrerebbe proprio di sì! Ogni qualvolta, infatti, che due o più
persone interagiscono tra di loro, anche attraverso il puro silenzio, an-
che guardandosi o non guardandosi negli occhi, anche senza ricorrere
DOO¶XVR GHO OLQJXDJJLR YHUEDOH VWDQQR VHPSUH H FRPXQTXH FRPXQi-
cando qualcosa. Sottrarsi dunque alla comunicazione diventa un atto
LPSRVVLELOHLQTXDQWRVLDODSDURODFKHLOVLOHQ]LRVLDO¶D]LRQHFKHOD
non-azione, hanno valore di interazione tra persone, veicolano un
messaggio e quindi sono forme di comunicazione.
Una forma di comunicazione per eccellenza, antica e immortale, è
sicuramente lo spettacolo. Se consideriamo lo spettacolo, e più in ge-
nerale la creazione artistica, come forma di comunicazione, come la
UDSSUHVHQWD]LRQHGLXQPHVVDJJLRFKHQHOO¶DWWRGLPDQLIHVWDUVLSXzDs-
sumere forme o linguaggi diversi, che vanno dalla pittura alla scultura,
passando per la poesia, il teatro, la musica, il cinema e la fotografia e
se teniamo presente il primo assioma della comunicazione che stabili-
VFHO¶LPSRVVLELOLWjGHOODQRQ-comunicazione (nella misura in cui due o
più persone interagiscono tra di loro), potremmo tranquillamente af-
fermare, attraverso un semplice ragionamento deduttivo, che tutte le
interazioni tra persone creano spettacolo:
a) lo spettacolo è sempre una forma di comunicazione tra due o più
persone che interagiscono tra di loro;
b) la comunicazione è sempre possibile ogni qualvolta due o più
SHUVRQHLQWHUDJLVFRQRWUDGLORUR ³qLPSRVVLELOHQRQFRPXQLFa-
UH´ 
c) lo spettacolo è sempre possibile ogni qualvolta due o più perso-
ne interagiscono tra di loro.
Naturalmente, le premesse di questa inferenza implicano solo logi-
camente la conclusione, la quale però merita una riflessione in più che
possa stabilire la sua reale veridicità. Affermare, infatti, che lo spetta-
colo è sempre possibile ogni qualvolta si stabilisce una interazione tra
SHUVRQH q VLFXUDPHQWH ULGXWWLYR H JHQHULFR '¶DOWUR FDQWR OD VWRULD
XVII. Riflessioni filosofiche sulla comunicazione artistica 323

GHOO¶DUWHGHOODPXVLFDGHOORVSHWWDFRORHGLQJHQHUDOHGHOODFUHD]LRQH
artistica dimostra che margini precisi di definizione, in realtà, non esi-
stono e non sono mai esistiti: sembrerebbe non esserci una regola che
VWDELOLVFD TXDQGR XQ¶RSHUD G¶DUWH q HIIHWWLYDPHQWH XQ¶RSHUD G¶DUWH
TXDQGRXQ¶HVLEL]LRQHSXzGLUVLVSHWWDFRORTXDQGRXQDFRQFDWHQD]LRQH
di suoni può dirsi musica o quando una performance può definirsi arti-
stica. Nel paragrafo che segue sono riportati vari esempi che mostrano
come la comunicazione artistica possa assumere forme in apparenza
assurde e inaudite.

17.2. Esempi di comunicazione artistica

3RFKLDQQLIDO¶DUWLVWDHDWWRUHKROO\ZRRGLDQR-DPHV)UDQFRLQFROOa-
borazione con il duo concettuale Praxis, composto da Brainard e Delia
Carey, ha dato vita al MONA, il Museum of Non-Visible Art. Questo
PXVHR LQVHULWR DOO¶LQWHUQR GL XQD SLDWWDIRUPD FKH ILQDQ]LD SURJHWWL
creativi, è costituito da opere che non si possono vedere o toccare ma
che si possono solo immaginare. Esse sono idee che hanno lo scopo di
VYLOXSSDUHO¶LPPDJLQD]LRQHHGLGLPRVWUDUHFKHLOPRQGRQRQ-visibile
può essere più reale del mondo visibile. Inutile raccontare del succes-
so riscosso dal progetto: nel 2011 una donna ha pagato 10.000 dollari
SHUXQ¶RSHUDGDOWLWRORFresh AirODFXLLGHDFRQVLVWHQHOO¶LQVSLUDUHLQ
qualsiasi luogo ci si trovi la più pulita aria che la Terra possa produrre.
3HUQRQSDUODUHGLXQDGHOOHFRQWURYHUVHRSHUHGHOO¶DUWLVWDLWDliano
Piero Manzoni (1933-1963): nel 1961 sigillò le proprie feci in 90 lat-
WLQHGLODWWDGLFLUFDFPHOHULFRSUuFRQXQ¶HWLFKHWWDFKHULSRUWDYDLQ
italiano, inglese, francese e tedesco la scritta: 0HUGDG¶DUWLVWD&RQWe-
nuto netto gr. 30. Conservata al naturale. Prodotta ed inscatolata nel
maggio 1961 1HO  OD QRWD FDVD G¶DVWH GHO 5HJQR 8QLWR 6o-
WHE\¶VKDYHQGXWRXQDGLTXHVWHVFDWROHDOSUH]]RGLHXUR
Le performance di molti artisti spesso sono ardite, paradossali e in-
comprensibili. Attualmente una delle maggiori interpreti della scena
performativa mondiale è sicuramente Marina Abramovich, artista
PRQWHQHJULQDQDWXUDOL]]DWDVWDWXQLWHQVH/DVXDFDUULHUDG¶DUWLVWDqLQi-
ziata verso la fine degli anni Sessanta, con azioni artistiche avvenute
in svariate parti del mondo. Interessante è sicuramente ciò che accad-
324 Manuale di diritto delle arti e dello spettacolo

GHD1DSROLQHOSUHVVROR6WXGLR0RUUD,QTXHOO¶RFFDVLRQH0a-
rina Abramovich mise in scena una performance davvero coraggiosa,
il cui titolo era Rhythm 0: su di un tavolo erano esposti 72 oggetti,
suddivisi in oggetti di dolore, di piacere e di morte. Il pubblico venne
LQYLWDWRDGXWLOL]]DUHOLEHUDPHQWHTXHVWLRJJHWWLVXOFRUSRGHOO¶DUWLVWD
la quale sarebbe rimasta impassibile e a totale disposizione del pubbli-
co per sei ore, la duraWDGLWXWWDO¶HVLEL]LRQH(FRVuFKHPHQWUHGXUDQWH
le prime tre ore il pubblico incuriosito e titubante si aggirava intorno
DOO¶DUWLVWD OHQWDPHQWH LQL]Lz D VFLRJOLHUVL ILQR DOOD FUXGHOWj WUDVIRr-
PDQGRO¶HVLEL]LRQHLQXQ¶D]LRQHSHULFRORVDHLQFRQWUROODWD Dapprima
le tagliarono i vestiti con le lamette e la denudarono, poi sempre uti-
lizzando le lamette la ferirono e le succhiarono il sangue e infine pose-
ro nelle sue mani una pistola carica puntata verso il collo.
Anche la storia della musica moderna ci ha dimostrato che è possi-
bile generare musica al di là dei mezzi tecnici per farlo o del modo in
cui questi mezzi vengono utilizzati. Le modalità di scrittura della mu-
sica hanno infatti subìto profondi cambiamenti nel corso della storia,
soprattutto nel momento in cui i compositori hanno iniziato a sentire il
bisogno di definire in maniera autonoma le regole per la realizzazione
di un brano musicale.
Agli inizi del secolo scorso, Arnold Schönberg, compositore au-
striaco naturalizzato statunitense, è stato uno dei primi compositori ad
alORQWDQDUVLGDJOLVFKHPLGHOVLVWHPDWRQDOH LQWHVRFRPHO¶LQVLHPHGHL
principi armonici e melodici che regolano i relativi legami tra accordi
e note in un brano musicale) e a scrivere musica al di fuori delle rego-
le classiche. La dodecafonia, ideata ed esposta in un suo articolo del
 GHGLFDWR SURSULR DO PHWRGR FRPSRVLWLYR IRQGDWR VXOO¶LPSLHJR
delle 12 note, GDOXLGHILQLWDFRPHXQDVXD³IDFFHQGDSULYDWD´QRQYD
intesa come una tecnica di composizione in senso stretto, dato che,
come ci spiega il filosofo Theodor W. Adorno, ³qSDUDJRQDELOHSLDG
una disposizione dei colori sulla tavolozza che ad un vero e proprio
SURFHGLPHQWRSLWWRULFR´.
Con la dodecafonia tutto cade sotto il dominio della serie, cioè di
una sequenza che viene determinata di volta in volta e che comprende
tutte le dodici note del sistema temperato. Ogni suono è elaborato te-
maticamente in base al suo rapporto con la serie e pertanto non esisto-
no più note libere in quanto ogni suono in tutta la composizione viene
XVII. Riflessioni filosofiche sulla comunicazione artistica 325

determinato dalla serie. Anche le diverse dimensioni della musica to-


QDOHRFFLGHQWDOHFLRqODPHORGLDO¶DUPRQLDLOFRQWUDSSXQWROD forma
HODVWUXPHQWD]LRQHFKHVHFRQGRODWHRULDGL$GRUQR³VLVRQRHYROXWH
QHOOD VWRULD LQGLSHQGHQWHPHQWH O¶XQD GDOO¶Dltra, senza ordine e quasi
FRPHXQDYHJHWD]LRQHVHOYDJJLD´FRQODGRGHFDIRQLDQRQVRORYHQJo-
QR VWUDYROWH PD YHQJRQR WXWWH XJXDOPHQWH VYLOXSSDWH H ³SURGRWWH LQ
PRGRWDOPHQWHGLVWLQWRGDFRQYHUJHUH´.

17.3. Il ruolo del fruitore

Una composizione musicale può sentirsi libera di stravolgere ogni re-


gola come nel caso di Schönberg e della sua rottura col sistema classi-
co tonale? Può una performance artistica mettere in risalto la crudeltà
GHOO¶DQLPRXPDQRFRPHQHOFDVRGHOO¶HVLEL]LRQHGL0DULQD$EUDPo-
vich a Napoli, raggiungendo anche momenti di reale pericolo per la
vita umana? E poi, per quale motivo 90 lattine di latta contenenti feci
VRQRHQWUDWHDIDUSDUWHDSLHQRWLWRORGHOODVWRULDGHOO¶DUWH"/DGRPDn-
da sembra essere sempre la stessa: quando una creazione artistica può
definirsi tale?
Per trovare una risposta dovremmo iniziare ad interrogarci sul con-
cetto di autore.
In un saggio di Michel Foucault, si analizza la funzione-autore in
senso stretto, cioè inteso come autore di un libro, anche se successi-
vamente si amplia il discorso DWWUDYHUVRO¶LQWURGX]LRQHGHOconcetto di
autore come fondatore di discorsività:

Mi sembra che siano apparsi nel corso del XIX secolo in Europa dei tipi di
autore abbastanza singolari e che non potremmo confondere né con i grandi
autori letterari, né con gli autori di testi religiosi canonici, né con i fondatori
GLVFLHQ]H&KLDPLDPROLLQPDQLHUDXQSR¶DUELWUDULDfondatori di discorsivi-
tà. Detti autori hanno questo di particolare, che non sono soltanto gli autori
delle loro opere, dei loro libri. Essi hanno prodotto qualcosa di più: la possi-
bilità e la regola di formazione di altri testi. In questo senso, essi sono molto
diversi, per esempio, da un autore di romanzi, che non è mai, in fondo, che
O¶DXWRUH GHO VXR SURSULR WHVWR )UHXG QRQ q VHPSOLFHPHQWH O¶DXWRUH GHOOD
Traumdeutung o del Motto di spirito0DU[QRQqVHPSOLFHPHQWHO¶DXWRUHGHO
Manifesto o del Capitale: essi hanno stabilito una possibilità indefinita del di-
VFRUVR>«@(VVLQRQKDQQRUHVRVHPSOLFHPHQWHSRVVLELOHXQcerto numero di
326 Manuale di diritto delle arti e dello spettacolo

analogie, ma hanno reso possibile (in maniera altrettanto completa) un certo


QXPHUR GL GLIIHUHQ]H (VVL KDQQR DSHUWR OR VSD]LR SHU TXDOFRVD G¶DOWUR FKH
per se stessi, che pertanto appartiene a ciò che essi hanno fondato. Dire che
Freud ha fondato la psicoanalisi, non vuol dire (non vuol semplicemente dire)
che si ritrova il concetto di libido, o la tecnica di analisi dei sogni in Abraham
o Melanie Klein, ma vuol dire che Freud ha reso possibile un certo numero di
differenze in rapporto ai suoi testi, ai suoi concetti, alle sue ipotesi, che trag-
gono origine tutte dal discorso psicoanalitico in se stesso.

Fondatori di discorsività sarebbero autori come Freud e Marx che


non solo sono stati gli autori delle loro importanti opere ma con esse
hanno dato la possibilità di innescare un meccanismo di discorsività
sui temi e sulle teorie da loro fondate. A tal proposito, gli artisti intesi
come autori di invenzioni artistiche, possono essere considerati anche
e soprattutto come dei fondatori di discorsività: infatti qualunque sia il
OLQJXDJJLR GD HVVL XWLOL]]DWR TXDQGR FUHDQR O¶RSHUD G¶DUWH SLWWXUD
scultura, letteratura, poesia, teatro, musica, danza, fotografia e cine-
ma), sicuramente trasmettono un messaggio che in modi diversi ma
inevitabili arriverà al fruitore.
/¶DUWLVWDFRPHLQYHQWRUHGHOO¶RSHUDG¶DUWHFRPHPLWWHQWHQHOODFo-
municazione artistica e come fondatore di discorsività, acquista una
ULOHYDQ]D PLQRUH ULVSHWWR DOO¶RSHUD DO PHVVDJJLR DO GLVFRUVR GD OXL
fondato e soprattutto rispetto al modo in cui quel discorso viene rece-
SLWRGDOIUXLWRUHG¶DUWH

Si può immaginare una cultura dove i discorsi circolerebbero e sarebbero ri-


cevuti senza che la funzione-autore apparisse mai. Tutti i discorsi, qualunque
sia il loro statuto, la loro forma, il loro valore e qualunque sia il trattamento
che si fa loro subire, si svolgereEEHURQHOO¶DQRQLPDWRGHO PRUPRULo. Non si
ascolterebbero più le domande così a lungo proposte: chi ha realmente parla-
to? È veramente lui e nessun altro? Con quale autenticità o con quale origina-
lità? E che cosa ha espresso dal più profondo di se stesso nel suo discorso?

$QFKH VH )RXFDXOW UHVWULQJH OD VXD DQDOLVL DOO¶DXWRUH LQWHVR FRPH
autore di un testo, le sue argomentazioni sono estremamente condivi-
sibili soprattutto se le trasliDPRDOPRQGRGHOO¶DUWHHGHOO¶DUWLVWDLQWHVR
FRPHDXWRUHGHOO¶RSHUDG¶DUWH3HUWDQWRODIXQ]LRQH-autore diventa solo
una delle specificazioni possibili della funzione-soggetto e ciò che re-
XVII. Riflessioni filosofiche sulla comunicazione artistica 327

VWD H FKH FRQWD q O¶RSHUD G¶DUWH LQ Vp TXDOXQTXH VLD LO VXR DXWRUH-
artista.
,Q TXHVWR PRGR FDPELD DQFKH OD PRGDOLWj GL DSSURFFLR DOO¶RSHUD
G¶DUWHHVVDQRQqSLLOPRGRLQFXLTXHOO¶DXWRUH-artista vede e inter-
SUHWDODUHDOWjPDqVHPSOLFHPHQWHHSXUDPHQWHXQ¶RSHUDG¶DUWHFKH
vive indipendentemente dal suo autore. Di conseguenza non ci inter-
URJKLDPRSLVXFKLKDFUHDWRTXHOO¶RSHUDHVXOSHUFKpO¶KDIDWWRPDFL
poniamo domande simili alle seguenti:

Quali sono i modi di esistenza di questo discorso? Da dove viene tenuto, co-
me può circolare e chi può appropriarsene? Quali sono le ubicazioni predi-
sposte per dei soggetti possibili? Chi può riempire queste diverse funzioni del
soggetto? E dietro tutte queste domande non si capterebbe altro che il rumore
GLXQ¶LQGLIIHUHQ]DFRVDLPSRUWDFKLSDUOD"

/¶LPSRUWDQWH TXLQGL QRQ q FKL KD FUHDWR TXHOO¶RSHUD G¶DUWH PD q


O¶RSHUDVWHVVDHODPRGDOLWjLQFXLLOIUXLWRUHG¶DUWHLQQHVFDLOPHFFDQi-
smo di discorsività, recependola e interpretandola a suo personalissi-
PR PRGR 6RWWR TXHVWR SXQWR GL YLVWD LO UXROR GHO IUXLWRUH G¶DUWH q
fondamentale perché appare come il coronamento di tutto il processo
artistico.
Il fruitore, destinatario del processo di comunicazione artistica, di
IURQWHDOO¶RSHUDG¶DUWHSHUFHSLVFHGHOOHVHQVD]LRQLHODERUDGHOOHYDOu-
tazioni e attribuisce dei significati. Il suo ruolo non rappresenta soltan-
to il coronamento di tutto il processo artistico ma è, forse, anche il
moWRUHGHOSURFHVVRVWHVVRHODULVSRVWDDLQRVWULLQWHUURJDWLYLVXOO¶DUWH
e sullo spettacolo.
Appendice normativa

Costituzione della Repubblica Italiana

PRINCIPI FONDAMENTALI

Art. 1
/¶,WDOLDqXQD5HSXEEOLFDGHPRFUDWLFDIRQGDWDVXOODYRUR
La sovranità appartiene al popolo, che la esercita nelle forme e nei li-
miti della Costituzione.

Art. 2
La Repubblica riconosce e garantisce i diritti LQYLRODELOLGHOO¶XRPRVLD
come singolo sia nelle formazioni sociali ove si svolge la sua persona-
OLWj H ULFKLHGH O¶DGHPSLPHQWR GHL GRYHUL LQGHURJDELOL GL VROLGDULHWj
politica, economica e sociale.

Art. 3
Tutti i cittadini hanno pari dignità sociale e sono eguali davanti alla
legge, senza distinzione di sesso, di razza, di lingua, di religione, di
opinioni politiche, di condizioni personali e sociali.
È compito della Repubblica rimuovere gli ostacoli di ordine economi-
co e sociale, che, limitando di fatto lDOLEHUWjHO¶HJXDJOLDQ]DGHLFLWWa-
GLQLLPSHGLVFRQRLOSLHQRVYLOXSSRGHOODSHUVRQDXPDQDHO¶HIIHWWLYD
SDUWHFLSD]LRQH GLWXWWL L ODYRUDWRUL DOO¶RUJDQL]]D]LRQH SROLWLFD HFRQo-
mica e sociale del Paese.

329
330 Manuale di diritto delle arti e dello spettacolo

Art. 4
La Repubblica riconosce a tutti i cittadini il diritto al lavoro e pro-
muove le condizioni che rendano effettivo questo diritto.
Ogni cittadino ha il dovere di svolgere, secondo le proprie possibilità
HODSURSULDVFHOWDXQ¶DWWLYLWjRXQDIXQ]LRQHFKHFRQFRUUDDOSURJUHs-
so materiale o spirituale della società.

Art. 5
La Repubblica, una e indivisibile, riconosce e promuove le autonomie
locali; attua nei servizi che dipendono dallo Stato il più ampio decen-
tramento amministrativo; adegua i principi ed i metodi della sua legi-
VOD]LRQHDOOHHVLJHQ]HGHOO¶DXtonomia e del decentramento.

Art. 6
La Repubblica tutela con apposite norme le minoranze linguistiche.

Art. 7
Lo Stato e la Chiesa cattolica sono, ciascuno nel proprio ordine, indi-
pendenti e sovrani.
I loro rapporti sono regolati dai Patti Lateranensi. Le modificazioni
dei Patti, accettate dalle due parti, non richiedono procedimento di re-
visione costituzionale.

Art. 8
Tutte le confessioni religiose sono egualmente libere davanti alla leg-
ge.
Le confessioni religiose diverse dalla cattolica hanno diritto di orga-
nizzarsi secondo i propri statuti, in quanto non contrastino con
O¶RUGLQDPHQWRJLXULGLFRLWDOLDQR
I loro rapporti con lo Stato sono regolati per legge sulla base di intese
con le relative rappresentanze.

Art. 9
La Repubblica promuove lo sviluppo della cultura e la ricerca scienti-
fica e tecnica.
Tutela il paesaggio e il patrimonio storico e artistico della Nazione.
Costituzione della Repubblica Italiana 331

Art. 10
/¶RUGLQDPHQWRJLXULGLFRLWDOLDQRVLFRQIRUPDDOOHQRUPHGHOGLULWWRLn-
ternazionale generalmente riconosciute.
La condizione giuridica dello straniero è regolata dalla legge in con-
formità delle norme e dei trattati internazionali.
/RVWUDQLHURDOTXDOHVLDLPSHGLWRQHOVXRSDHVHO¶HIIHWWLYRHVHUFL]LR
delle libertà democratiche garantite dalla Costituzione italiana, ha di-
ULWWRG¶Dsilo nel territorio della Repubblica, secondo le condizioni sta-
bilite dalla legge.
1RQqDPPHVVDO¶HVWUDGL]LRQHGHOORVWUDQLHURSHUUHDWLSROLWLFL

Art. 11
/¶,WDOLD ULSXGLD OD JXHUUD FRPH VWUXPHQWR GL RIIHVD DOOD OLEHUWj GHJOL
altri popoli e come mezzo di risoluzione delle controversie internazio-
nali; consente, in condizioni di parità con gli altri Stati, alle limitazioni
di sovranità necessarie ad un ordinamento che assicuri la pace e la
giustizia fra le Nazioni; promuove e favorisce le organizzazioni inter-
nazionali rivolte a tale scopo.

Art. 12
La bandiera della Repubblica è il tricolore italiano: verde, bianco e
rosso, a tre bande verticali di eguali dimensioni.

PARTE I - DIRITTI E DOVERI DEI CITTADINI

TITOLO I - RAPPORTI CIVILI

Art. 13
La libertà personale è inviolabile.
Non è ammessa forma alcuna di detenzione, di ispezione o perquisi-
zione personale, né qualsiasi altra restrizione della libertà personale,
VHQRQSHUDWWRPRWLYDWRGDOO¶DXWRULWjJLXGL]LDULDHQHLVROLFDVLHPRGL
previsti dalla legge.
In casi eccezionali di necessità ed urgenza, indicati tassativamente dal-
OD OHJJH O¶DXWRULWj GL SXEEOLFD VLFXUH]]D SXz DGRWWDUH SURYYHGLPHQWL
332 Manuale di diritto delle arti e dello spettacolo

provvisori, che devono essere comunicati entro quarantotto ore


DOO¶DXWRULWj JLXGL]LDULD H VH TXHVWD QRQ OL FRQvalida nelle successive
quarantotto ore, si intendono revocati e restano privi di ogni effetto.
È punita ogni violenza fisica e morale sulle persone comunque sotto-
poste a restrizioni di libertà.
La legge stabilisce i limiti massimi della carcerazione preventiva.

Art. 14
Il domicilio è inviolabile.
Non vi si possono eseguire ispezioni o perquisizioni o sequestri, se
non nei casi e modi stabiliti dalla legge secondo le garanzie prescritte
per la tutela della libertà personale.
Gli accertamenti e le ispezioni per motivi di sanità e di incolumità
pubblica o a fini economici e fiscali sono regolati da leggi speciali.

Art. 15
La libertà e la segretezza della corrispondenza e di ogni altra forma di
comunicazione sono inviolabili.
La loro limitazione può avvenire soltanto per atto motivato
GHOO¶DXWRULWjJLXGL]LDULDFRQOHJDUDQ]LHVWDELOLWHGDOODOHJJH

Art. 16
Ogni cittadino può circolare e soggiornare liberamente in qualsiasi
parte del territorio nazionale, salvo le limitazioni che la legge stabili-
sce in via generale per motivi di sanità o di sicurezza. Nessuna restri-
zione può essere determinata da ragioni politiche.
Ogni cittadino è libero di uscire dal territorio della Repubblica e di
rientrarvi, salvo gli obblighi di legge.

Art. 17
I cittadini hanno diritto GLULXQLUVLSDFLILFDPHQWHHVHQ]¶DUPL
Per le riunioni, anche in luogo aperto al pubblico, non è richiesto
preavviso.
Delle riunioni in luogo pubblico deve essere dato preavviso alle auto-
rità, che possono vietarle soltanto per comprovati motivi di sicurezza
o di incolumità pubblica.
Costituzione della Repubblica Italiana 333

Art. 18
I cittadini hanno diritto di associarsi liberamente, senza autorizzazio-
ne, per fini che non sono vietati ai singoli dalla legge penale.
Sono proibite le associazioni segrete e quelle che perseguono, anche
indirettamente, scopi politici mediante organizzazioni di carattere mi-
litare.

Art. 19
Tutti hanno diritto di professare liberamente la propria fede religiosa
in qualsiasi forma, individuale o associata, di farne propaganda e di
esercitarne in privato o in pubblico il culto, purché non si tratti di riti
contrari al buon costume.

Art. 20
,OFDUDWWHUHHFFOHVLDVWLFRHLOILQHGLUHOLJLRQHRGLFXOWRG¶XQDDVVRFLa-
zione od istituzione non possono essere causa di speciali limitazioni
legislative, né di speciali gravami fiscali per la sua costituzione, capa-
cità giuridica e ogni forma di attività.

Art. 21
Tutti hanno diritto di manifestare liberamente il proprio pensiero con
la parola, lo scritto e ogni altro mezzo di diffusione.
La stampa non può essere soggetta ad autorizzazioni o censure.
6L SXz SURFHGHUH D VHTXHVWUR VROWDQWR SHU DWWR PRWLYDWR GHOO¶DXWRULWj
giudiziaria nel caso di delitti, per i quali la legge sulla stampa espres-
samente lo autorizzi, o nel caso di violazione delle norme che la legge
VWHVVDSUHVFULYDSHUO¶LQGicazione dei responsabili.
In tali casi, quando vi sia assoluta urgenza e non sia possibile il tem-
SHVWLYR LQWHUYHQWR GHOO¶DXWRULWj JLXGL]LDULD LO VHTXHVWUR GHOOD VWDPSD
periodica può essere eseguito da ufficiali di polizia giudiziaria, che
devono immediatamente, e non mai oltre ventiquattro ore, fare denun-
]LDDOO¶DXWRULWjJLXGL]LDULD6HTXHVWDQRQORFRQYDOLGDQHOOHYHQWLTXDt-
WURRUHVXFFHVVLYHLOVHTXHVWURV¶LQWHQGHUHYRFDWRHSULYRG¶RJQLHIIHt-
to.
La legge può stabilire, con norme di carattere generale, che siano resi
noti i mezzi di finanziamento della stampa periodica.
334 Manuale di diritto delle arti e dello spettacolo

Sono vietate le pubblicazioni a stampa, gli spettacoli e tutte le altre


manifestazioni contrarie al buon costume. La legge stabilisce provve-
dimenti adeguati a prevenire e a reprimere le violazioni.

Art. 22
Nessuno può essere privato, per motivi politici, della capacità giuridi-
ca, della cittadinanza, del nome.

Art. 23
Nessuna prestazione personale o patrimoniale può essere imposta se
non in base alla legge.

Art. 24
Tutti possono agire in giudizio per la tutela dei propri diritti e interessi
legittimi.
La difesa è diritto inviolabile in ogni stato e grado del procedimento.
Sono assicurati ai non abbienti, con appositi istituti, i mezzi per agire
e difendersi davanti ad ogni giurisdizione.
La legge determina le condizioni e i modi per la riparazione degli er-
rori giudiziari.

Art. 25
Nessuno può essere distolto dal giudice naturale precostituito per leg-
ge.
Nessuno può essere punito se non in forza di una legge che sia entrata
in vigore prima del fatto commesso.
Nessuno può essere sottoposto a misure di sicurezza se non nei casi
previsti dalla legge.

Art. 26
/¶HVWUDGL]LRQH GHO FLWWDGLQR SXz HVVHUH FRQVHQWLWD VROWDQWR RYH VLD
espressamente prevista dalle convenzioni internazionali.
Non può in alcun caso essere ammessa per reati politici.

Art. 27
La responsabilità penale è personale.
/¶LPSXWDWRQRQqFRQVLGHUDWRFROSHYROHVLQRDOODFRQGDQQDGHILQLWLYD
Costituzione della Repubblica Italiana 335

Le pene non possono consistere in trattamenti contrari al senso di


umanità e devono tendere alla rieducazione del condannato.
Non è ammessa la pena di morte.

Art. 28
I funzionari e i dipendenti dello Stato e degli enti pubblici sono diret-
tamente responsabili, secondo le leggi penali, civili e amministrative,
degli atti compiuti in violazione di diritti. In tali casi la responsabilità
civile si estende allo Stato e agli enti pubblici.

TITOLO II - RAPPORTI ETICO - SOCIALI

Art. 29
La Repubblica riconosce i diritti della famiglia come società naturale
fondata sul matrimonio.
Il matrimonio è ordinaWR VXOO¶HJXDJOLDQ]D PRUDOH H JLXULGLFD GHL Fo-
QLXJLFRQLOLPLWLVWDELOLWLGDOODOHJJHDJDUDQ]LDGHOO¶XQLWjIDPLOLDUH

Art. 30
È dovere e diritto dei genitori mantenere, istruire ed educare i figli,
anche se nati fuori del matrimonio.
Nei casi di incapacità dei genitori, la legge provvede a che siano assol-
ti i loro compiti.
La legge assicura ai figli nati fuori del matrimonio ogni tutela giuridi-
ca e sociale, compatibile con i diritti dei membri della famiglia legit-
tima.
La legge detta le norme e i limiti per la ricerca della paternità.

Art. 31
La Repubblica agevola con misure economiche e altre provvidenze la
IRUPD]LRQH GHOOD IDPLJOLD H O¶DGHPSLPHQWR GHL FRPSLWL UHODWLYL FRQ
particolare riguardo alle famiglie numerose.
3URWHJJH OD PDWHUQLWj O¶LQIDQ]LD H la gioventù, favorendo gli istituti
necessari a tale scopo.
336 Manuale di diritto delle arti e dello spettacolo

Art. 32
La Repubblica tutela la salute come fondamentale diritto
GHOO¶LQGLYLGXR H LQWHUHVVH GHOOD FROOHWWLYLWj H JDUDQWLVFH FXUH JUDWXLWH
agli indigenti.
Nessuno può essere obbligato a un determinato trattamento sanitario
se non per disposizione di legge. La legge non può in nessun caso vio-
lare i limiti imposti dal rispetto della persona umana.

Art. 33
/¶DUWHHODVFLHQ]DVRQROLEHUHHOLEHURQHqO¶LQVHJQDPHQWR
La Repubblica detta le norme JHQHUDOL VXOO¶LVWUX]LRQH HG LVWLWXLVFH
scuole statali per tutti gli ordini e gradi.
Enti e privati hanno il diritto di istituire scuole ed istituti di educazio-
ne, senza oneri per lo Stato.
La legge, nel fissare i diritti e gli obblighi delle scuole non statali che
chiedono la parità, deve assicurare ad esse piena libertà e ai loro alun-
ni un trattamento scolastico equipollente a quello degli alunni di scuo-
le statali.
ÊSUHVFULWWRXQHVDPHGL6WDWRSHUO¶DPPLVVLRQHDLYDULRUGLQLHJUDGL
di scuole o per la coQFOXVLRQHGLHVVLHSHUO¶DELOLWD]LRQHDOO¶HVHUFL]LR
professionale.
Le istituzioni di alta cultura, università ed accademie, hanno il diritto
di darsi ordinamenti autonomi nei limiti stabiliti dalle leggi dello Sta-
to.

Art. 34
La scuola è aperta a tutti.
L¶LVWUX]LRQHLQIHULRUHLPSDUWLWDSHUDOPHQRRWWRDQQLqREEOLJDWRULDH
gratuita.
I capaci e meritevoli, anche se privi di mezzi, hanno diritto di rag-
giungere i gradi più alti degli studi.
La Repubblica rende effettivo questo diritto con borse di studio, asse-
gni alle famiglie ed altre provvidenze, che devono essere attribuite per
concorso.
Costituzione della Repubblica Italiana 337

TITOLO III - RAPPORTI ECONOMICI

Art. 35
La Repubblica tutela il lavoro in tutte le sue forme ed applicazioni.
&XUDODIRUPD]LRQHHO¶HOHYD]LRQHSURIHVVLRQDOHGHLODYoratori.
Promuove e favorisce gli accordi e le organizzazioni internazionali in-
tesi ad affermare e regolare i diritti del lavoro.
Riconosce la libertà di emigrazione, salvo gli obblighi stabiliti dalla
OHJJHQHOO¶LQWHUHVVHJHQHUDOHHWXWHODLOODYRURLWDOLDQRDOO¶HVWHUR

Art. 36
Il lavoratore ha diritto ad una retribuzione proporzionata alla quantità
e qualità del suo lavoro e in ogni caso sufficiente ad assicurare a sé e
DOODIDPLJOLDXQ¶HVLVWHQ]DOLEHUDHGLJQLWRVD
La durata massima della giornata lavorativa è stabilita dalla legge.
Il lavoratore ha diritto al riposo settimanale e a ferie annuali retribuite,
e non può rinunziarvi.

Art. 37
La donna lavoratrice ha gli stessi diritti e, a parità di lavoro, le stesse
retribuzioni che spettano al lavoratore. Le condizioni di lavoro devono
FRQVHQWLUHO¶DGHPSLPHQWRGHOODVXDHVVHQ]LDOHIXQ]LRQHIDPLOLDUHHDs-
sicurare alla madre e al bambino una speciale adeguata protezione.
La legge stabilisce il limite minimo di età per il lavoro salariato.
La Repubblica tutela il lavoro dei minori con speciali norme e garanti-
sce ad essi, a parità di lavoro, il diritto alla parità di retribuzione.

Art. 38
Ogni cittadino inabile al lavoro e sprovvisto dei mezzi necessari per
YLYHUHKDGLULWWRDOPDQWHQLPHQWRHDOO¶DVVLVWHQ]DVociale.
I lavoratori hanno diritto che siano preveduti ed assicurati mezzi ade-
guati alle loro esigenze di vita in caso di infortunio, malattia, invalidi-
tà e vecchiaia, disoccupazione involontaria.
*OLLQDELOLHGLPLQRUDWLKDQQRGLULWWRDOO¶HGXFD]LRQHHDOO¶DYYLDPHQWR
professionale.
Ai compiti previsti in questo articolo provvedono organi ed istituti
predisposti o integrati dallo Stato.
338 Manuale di diritto delle arti e dello spettacolo

/¶DVVLVWHQ]DSULYDWDqOLEHUD

Art. 39
/¶RUJDQL]]D]LRQHVLQGDFDOHqOLEHUD
Ai sindacati non può essere imposto altro obbligo se non la loro regi-
strazione presso uffici locali o centrali, secondo le norme di legge.
È condizione per la registrazione che gli statuti dei sindacati sancisca-
no un ordinamento interno a base democratica.
I sindacati registrati hanno personalità giuridica. Possono, rappresen-
tati unitariamente in proporzione dei loro iscritti, stipulare contratti
collettivi di lavoro con efficacia obbligatoria per tutti gli appartenenti
alle categorie alle quali il contratto si riferisce.

Art. 40
Il diritto di sciopeURVLHVHUFLWDQHOO¶DPELWRGHOOHOHJJLFKHORUHJRODQR

Art. 41
/¶LQL]LDWLYDHFRQRPLFDSULYDWDqOLEHUD
1RQSXzVYROJHUVLLQFRQWUDVWRFRQO¶XWLOLWjVRFLDOHRLQPRGRGDUHFa-
re danno alla sicurezza, alla libertà, alla dignità umana.
La legge determina i programmi e i controlli opportuni perché
O¶DWWLYLWjHFRQRPLFDSXEEOLFDHSULYDWDSRVVDHVVHUHLQGLUL]]DWDHFRRr-
dinata a fini sociali.

Art. 42
La proprietà è pubblica o privata. I beni economici appartengono allo
Stato, ad enti o a privati.
La proprietà privata è riconosciuta e garantita dalla legge, che ne de-
termina i modi di acquisto, di godimento e i limiti allo scopo di assi-
curarne la funzione sociale e di renderla accessibile a tutti.
La proprietà privata può essere, nei casi preveduti dalla legge, e salvo
LQGHQQL]]RHVSURSULDWDSHUPRWLYLG¶LQWHUHVVHJHQHUDOH
La legge stabilisce le norme ed i limiti della successione legittima e
testamentaria e i diritti dello Stato sulle eredità.
Costituzione della Repubblica Italiana 339

Art. 43
A fini di utilità generale la legge può riservare originariamente o tra-
sferire, mediante espropriazione e salvo indennizzo, allo Stato, ad enti
pubblici o a comunità di lavoratori o di utenti determinate imprese o
categorie di imprese, che si riferiscano a servizi pubblici essenziali o a
fonti di energia o a situazioni di monopolio ed abbiano carattere di
preminente interesse generale.

Art. 44
Al fine di conseguire il razionale sfruttamento del suolo e di stabilire
equi rapporti sociali, la legge impone obblighi e vincoli alla proprietà
terriera privata, fissa limiti alla sua estensione secondo le regioni e le
zone agrarie, promuove ed impone la bonifica delle terre, la trasfor-
mazione del latifondo e la ricostituzione delle unità produttive; aiuta la
piccola e la media proprietà.
La legge dispone provvedimenti a favore delle zone montane.

Art. 45
La Repubblica riconosce la funzione sociale della cooperazione a ca-
rattere di mutualità e senza fini di speculazione privata. La legge ne
SURPXRYHHIDYRULVFHO¶LQFUHPHQWRFRQLPH]]LSLLGRQHLHQHDVVLFu-
ra, con gli opportuni controlli, il carattere e le finalità.
/DOHJJHSURYYHGHDOODWXWHODHDOORVYLOXSSRGHOO¶DUWLJLDQDWR

Art. 46
Ai fini della elevazione economica e sociale del lavoro e in armonia
con le esigenze della produzione, la Repubblica riconosce il diritto dei
lavoratori a collaborare, nei modi e nei limiti stabiliti dalle leggi, alla
gestione delle aziende.

Art. 47
La Repubblica incoraggia e tutela il risparmio in tutte le sue forme;
GLVFLSOLQDFRRUGLQDHFRQWUROODO¶HVHUFL]LRGHOFUHGLWR
)DYRULVFH O¶DFcesso del risparmio popolare alla proprietà
GHOO¶DELWD]LRQHDOODSURSULHWjGLUHWWDFROWLYDWULFHHDOGLUHWWRHLQGLUHWWR
investimento azionario nei grandi complessi produttivi del Paese.
340 Manuale di diritto delle arti e dello spettacolo

TITOLO IV - RAPPORTI POLITICI

Art. 48
Sono elettori tutti i cittadini, uomini e donne, che hanno raggiunto la
maggiore età.
Il voto è personale ed eguale, libero e segreto. Il suo esercizio è dove-
re civico.
La legge stabilisce requisiti e modalità per O¶HVHUFL]LR del diritto di vo-
to dei cittadini residenti DOO¶HVWHUR e ne assicura O¶HIIHWWLYLWj A tale fine
è istituita una circoscrizione Estero per O¶HOH]LRQH delle Camere, alla
quale sono assegnati seggi nel numero stabilito da norma costituziona-
le e secondo criteri determinati dalla legge.
Il diritto di voto non può essere limitato se non per incapacità civile o
per effetto di sentenza penale irrevocabile o nei casi di indegnità mo-
rale indicati dalla legge.

Art. 49
Tutti i cittadini hanno diritto di associarsi liberamente in partiti per
concorrere con metodo democratico a determinare la politica naziona-
le.

Art. 50
Tutti i cittadini possono rivolgere petizioni alle Camere per chiedere
provvedimenti legislativi o esporre comuni necessità.

Art. 51
7XWWLLFLWWDGLQLGHOO¶XQRRGHOO¶DOWURVHVVRSRVVRQRDFFHGHUHDJOLXIILFL
pubblici e alle cariche elettive in condizioni di eguaglianza, secondo i
requisiti stabiliti dalla legge. A tale fine la Repubblica promuove con
appositi provvedimenti le pari opportunità tra donne e uomini.
/DOHJJHSXzSHUO¶DPPLVVLRQHDLSXEEOLFLXIILFL e alle cariche eletti-
ve, parificare ai cittadini gli italiani non appartenenti alla Repubblica.
Chi è chiamato a funzioni pubbliche elettive ha diritto di disporre del
tempo necessario al loro adempimento e di conservare il suo posto di
lavoro.
Costituzione della Repubblica Italiana 341

Art. 52
La difesa della Patria è sacro dovere del cittadino.
Il servizio militare è obbligatorio nei limiti e modi stabiliti dalla legge.
Il suo adempimento non pregiudica la posizione di lavoro del cittadi-
QRQpO¶HVHUFL]LRGHLGLULWWLSROLWLFL
/¶RUGLQDPHQWRGHOle Forze armate si informa allo spirito democratico
della Repubblica.

Art. 53
Tutti sono tenuti a concorrere alle spese pubbliche in ragione della lo-
ro capacità contributiva.
Il sistema tributario è informato a criteri di progressività.

Art. 54
Tutti i cittadini hanno il dovere di essere fedeli alla Repubblica e di
osservarne la Costituzione e le leggi.
I cittadini cui sono affidate funzioni pubbliche hanno il dovere di
adempierle con disciplina ed onore, prestando giuramento nei casi sta-
biliti dalla legge.
Regio decreto 18 giugno 1931, n. 773, recante il
³7HVWRXQLFRGHOOHOHJJLGLSXEEOLFDVLFXUH]]D´

TITOLO III - DISPOSIZIONI RELATIVE AGLI SPETTACOLI, ESERCIZI


PUBBLICI, AGENZIE, TIPOGRAFIE, AFFISSIONI, MESTIERI GIROVAGHI,
OPERAI E DOMESTICI

CAPO I - DEGLI SPETTACOLI E TRATTAMENTI PUBBLICI

Art. 68
Senza licenza del Questore non si possono dare in luogo pubblico o
aperto o esposto al pubblico, accademie, feste da ballo, corse di caval-
li, né altri simili spettacoli o trattenimenti, e non si possono aprire o
esercitare circoli, scuole di ballo e sale pubbliche di audizione.
Per le gare di velocità di autoveicoli e per le gare aeronautiche si ap-
plicano le disposizioni delle leggi speciali.

Art. 69
Senza licenza della autorità locale di pubblica sicurezza è vietato dare,
anche temporaneamente, per mestiere, pubblici trattenimenti, esporre
alla pubblica vista rarità, persone, animali, gabinetti ottici o altri og-
getti di curiosità, ovvero dare audizioni all'aperto.

Art. 70
$UWLFROR DEURJDWR GDOO¶DUW  ter del decreto legislativo 13 luglio
1994, n. 480.

Art. 71
Le licenze, di cui negli articoli precedenti, sono valide solamente per
il locale e per il tempo in esse indicati.

Art. 72
$UWLFRORDEURJDWRGDOO¶DUWGHOGHFUHWROHJLVODWLYRPDU]R,
n. 112.

343
344 Manuale di diritto delle arti e dello spettacolo

Art. 73
$UWLFRORDEURJDWRGDOO¶DUWGHOGHFUHWROHJLVODWLYRPDU]R
n. 112.

Art. 74
$UWLFRORDEURJDWRGDOO¶DUWGHOGHFUHWROHJLVODWLYRPDU]R
n. 112.

Art. 75
$UWLFRORDEURJDWRGDOO¶DUWGHOGHFUHWROHJLVODWLYRPDrzo 1998,
n. 112.

Art. 75 bis
Chiunque intenda esercitare, a fini di lucro, attività di produzione, di
duplicazione, di riproduzione, di vendita, di noleggio o di cessione a
qualsiasi titolo di nastri, dischi, videocassette, musicassette o altro
supporto contenente fonogrammi o videogrammi di opere cinemato-
grafiche o audiovisive o sequenze di immagini in movimento, ovvero
intenda detenere tali oggetti ai fini dello svolgimento delle attività an-
zidette, deve darne preventivo avviso al Questore che ne rilascia rice-
YXWDDWWHVWDQGRO¶HVHJXLWDLVFUL]LRQHLQDSSRVLWRUHJLVWUR/¶LVFUL]LRQH
deve essere rinnovata ogni anno.

Art. 76
$UWLFRORDEURJDWRGDOO¶DUWGHOGHFUHWROHJLVODWLYRPDU]R
n. 112.

Art. 77
Articolo abrogato dalla legge 21 aprile 1962, n. 161.

Art. 78
/¶DXWRULWjFRPSHWHQWHDGHVHJXLUHODUHYLVLRQHGHOOHSHOOLFROHSHUVSHt-
tacoli cinematografici decide a quali di questi possono assistere i mi-
nori di anni sedici.
Qualora decida di escluderli, il concessionario o il direttore della sala
cLQHPDWRJUDILFDGHYHSXEEOLFDUQHO¶DYYLVRVXOPDQLIHVWRGHOORVSHWWa-
colo e provvedere rigorosamente alla esecuzione del divieto.
Regio decreto 18 giugno 1931, n. 773 345

Salve le sanzioni prevedute dal codice penale, i concessionari o diret-


tori delle sale cinematografiche, i quali contravvengono agli obblighi
SUHGHWWLVRQRSXQLWLFRQO¶DUUHVWRILQRDWUHPHVLRFRQO¶DPPHQGDGD¼
DG¼

Art. 79
$UWLFRORDEURJDWRGDOO¶DUWOHJJHDSULOHQ

Art. 80
/¶DXWRULWj GL SXEEOLFD VLFXUH]]D QRQ SXz FRQFHGHUH OD OLFHQ]D SHU
O¶DSHrtura di un teatro o di un luogo di pubblico spettacolo, prima di
aver fatto verificare da una commissione tecnica la solidità e la sicu-
UH]]D GHOO¶HGLILFLR H O¶HVLVWHQ]D GL XVFLWH SLHQDPHQWH DGDWWH D VJRm-
brarlo prontamente nel caso di incendio.
Le spese deOO¶LVSH]LRQHHTXHOOHSHULVHUYL]LGLSUHYHQ]LRQHFRQWURJOL
incendi sono a carico di chi domanda la licenza.

Art. 81
$UWLFRORDEURJDWRGDOO¶DUWGHOGHFUHWROHJLVODWLYRPDU]R
n. 112.

Art. 82
Nel caso di tumulto o di disordini o di pericolo per la incolumità pub-
blica o di offese alla morale o al buon costume, gli ufficiali o gli agen-
ti di pubblica sicurezza ordinano la sospensione o la cessazione dello
spettacolo e, se occorre, lo sgombro del locale.
Qualora il disordine avvenga per colpa di chi dà o fa dare lo spettaco-
lo, gli ufficiali o gli agenti possono ordinare che sia restituito agli
spetWDWRULLOSUH]]RG¶LQJUHVVR

Art. 83
$UWLFRORDEURJDWRGDOO¶DUWGHOGHFUHWROHJLVODWLYRPDU]R
n. 112.

Art. 84
$UWLFRORDEURJDWRGDOO¶art. 6 del decreto del Presidente della Repub-
blica 28 maggio 2001, n. 311.
346 Manuale di diritto delle arti e dello spettacolo

Art. 85
È vietato comparire mascherato in luogo pubblico.
,OFRQWUDYYHQWRUHqSXQLWRFRQODVDQ]LRQHDPPLQLVWUDWLYDGD¼
DG¼
Ê YLHWDWR O¶XVR GHOOD PDVFKHUD QHL WHDWUL e negli altri luoghi aperti al
SXEEOLFRWUDQQHQHOOHHSRFKHHFRQO¶RVVHUYDQ]DGHOOHFRQGL]LRQLFKH
SRVVRQRHVVHUHVWDELOLWHGDOO¶DXWRULWjORFDOHGLSXEEOLFDVLFXUH]]DFRQ
apposito manifesto.
Il contravventore e chi, invitato, non si toglie la maschera, è punito
FRQODVDQ]LRQHDPPLQLVWUDWLYDGD¼DG¼

Art. 85 bis
È vietato introdurre, installare o comunque utilizzare abusivamente
nei luoghi di pubblico spettacolo, dispositivi od apparati che consen-
tono la registrazione, la riproduzione, la trasmissione o comunque la
fissazione su supporto audio, video od audiovideo, in tutto od in parte,
GHOOHRSHUHGHOO¶LQJHJQRFKHYHQJRQRLYLUHDOL]]DWHRGLIIXVH
Il concessionario od il direttore del luogo di pubblico spettacolo deve
dare avviso del divieto di cui al primo comma mediante affissione,
DOO¶LQWHUQR GHO OXRJR RYH DYYLHQH OD UDSSUHVHQWD]LRQH GL XQ QXPHUR
idoneo di cartelli che risultino ben visibili a tutto il pubblico.
Restano comunque ferme le norme poste a tutela dei diritti di autore,
in conformità alle leggi speciali che regolamentano la materia.
Legge 22 aprile 1941, n. 633, recante
³1RUPHVXOODSURWH]LRQHGHOGLULWWRG¶DXWRUHHGLDOWULGLULWWLFRn-
QHVVLDOVXRHVHUFL]LR´

TITOLO I - DISPOSIZIONI SUL DIRITTO D¶AUTORE

CAPO I - OPERE PROTETTE

Art. 1
6RQRSURWHWWHDLVHQVLGLTXHVWDOHJJHOHRSHUHGHOO¶LQJHJQRGLFDUDWWHUH
creativo che appartengono alla letteratura, alla musica, alle arti figura-
WLYHDOO¶DUFKLWHWWXUDDOWHDWURHGDOODFLQHPDWRJUDILDTXDOXQTXHQHVLD
il modo o la forma di espressione.
Sono altresì protetti i programmi per elaboratore come opere letterarie
ai sensi della Convenzione di Berna sulla protezione delle opere lette-
rarie ed artistiche ratificata e resa esecutiva con legge 20 giugno 1978,
n. 399, nonché le banche di dati che per la scelta o la disposizione del
materiale costituiscono una creazione intellettuale GHOO¶DXWRUH.

Art. 2
In particolare sono comprese nella protezione:
1) le opere letterarie, drammatiche, scientifiche, didattiche, religio-
se, tanto se in forma scritta quanto se orale;
2) le opere e le composizioni musicali, con o senza parole, le opere
drammatico-musicali e le variazioni musicali costituenti di per
sé opera originale;
3) le opere coreografiche e pantomimiche, delle quali sia fissata la
traccia per iscritto o altrimenti;
4) OHRSHUHGHOODVFXOWXUDGHOODSLWWXUDGHOO¶DUWHGHOGLVHJQRGHOOD
incisione e delle arti figurative similari, compresa la scenografia;
5) LGLVHJQLHOHRSHUHGHOO¶DUFKLWHWWXUD
6) OH RSHUH GHOO¶DUWH FLQHPDWRJrafica, muta o sonora, sempreché
non si tratti di semplice documentazione protetta ai sensi delle
norme del capo quinto del titolo secondo.

347
348 Manuale di diritto delle arti e dello spettacolo

7) le opere fotografiche e quelle espresse con procedimento analo-


go a quello della fotografia sempre che non si tratti di semplice
fotografia protetta ai sensi delle norme del capo V del titolo II.
8) i programmi per elaboratore, in qualsiasi forma espressi purché
RULJLQDOL TXDOH ULVXOWDWR GL FUHD]LRQH LQWHOOHWWXDOH GHOO¶DXWRUH
Restano esclusi dalla tutela accordata dalla presente legge le
idee e i principi che stanno alla base di qualsiasi elemento di un
programma, compresi quelli alla base delle sue interfacce. Il
termine programma comprende anche il materiale preparatorio
per la progettazione del programma stesso.
9) /HEDQFKHGLGDWLGLFXLDOVHFRQGRFRPPDGHOO¶DUWLFRORLQWHVH
come raccolte di opere, dati o altri elementi indipendenti siste-
maticamente o metodicamente disposti ed individualmente ac-
cessibili mediante mezzi elettronici o in altro modo. La tutela
delle banche di dati non si estende al loro contenuto e lascia im-
pregiudicati diritti esistenti su tale contenuto.
10) Le opere del disegno industriale che presentino di per sé caratte-
re creativo e valore artistico.

Art. 3
Le opere collettive, costituite dalla riunione di opere o di parti di ope-
re, che hanno carattere di creazione autonoma, come risultato della
scelta e del coordinamento ad un determinato fine letterario, scientifi-
co, didattico, religioso, politico od artistico, quali le enciclopedie, i di-
zionari, le antologie, le riviste e i giornali, sono protette come opere
originali, indipendentemente e senza pregiudizio dei diritti di autore
sulle opere o sulle parti di opere di cui sono composte.

Art. 4
Senza pregiudizio dei diritti esistenti sull¶RSHUDRULJLQDULDVRQRDOWUHVu
SURWHWWHOHHODERUD]LRQLGLFDUDWWHUHFUHDWLYRGHOO¶RSHUDVWHVVDTXDOLOH
traduzioni in altra lingua, le trasformazioni da una in altra forma lette-
raria od artistica, le modificazioni ed aggiunte che costituiscono un ri-
faciPHQWR VRVWDQ]LDOH GHOO¶RSHUD RULJLQDULD JOL DGDWWDPHQWL OH ULGu-
zioni, i compendi, le variazioni non costituenti opera originale.
Legge 22 aprile 1941, n. 633 349

Art. 5
Le disposizioni di questa legge non si applicano ai testi degli atti uffi-
ciali dello stato e delle Amministrazioni pubbliche, sia italiane che
straniere.

CAPO II - SOGGETTI DEL DIRITTO

Art. 6
,OWLWRORRULJLQDULRGHOO¶DFTXLVWRGHOGLULWWRGLDXWRUHqFRVWLWXLWRGDOOD
FUHD]LRQHGHOO¶RSHUDTXDOHSDUWLFRODUHHVSUHVVLRQHGHOODYRURLQWHOOHt-
tuale.

Art. 7
È consideratR DXWRUH GHOO¶RSHUD FROOHWWLYD FKL RUJDQL]]D H GLULJH OD
FUHD]LRQHGHOO¶RSHUDVWHVVD
ÊFRQVLGHUDWRDXWRUHGHOOHHODERUD]LRQLO¶HODERUDWRUHQHLOLPLWLGHOVXR
lavoro.

Art. 8
ÊUHSXWDWRDXWRUHGHOO¶RSHUDVDOYRSURYDFRQWUDULDFKLqLQHVVDLQGi-
cato coPHWDOHQHOOHIRUPHG¶XVRRYYHURqDQQXQFLDWRFRPHWDOHQHl-
la recitazione, esecuzione, rappresentazione o radiodiffusione
GHOO¶RSHUDVWHVVD
9DOJRQRFRPHQRPHORSVHXGRQLPRLOQRPHG¶DUWHODVLJODRLOVHJQR
convenzionale, che siano notoriamente conosciuti come equivalenti al
nome vero.

Art. 9
&KL DEELD UDSSUHVHQWDWR HVHJXLWR R FRPXQTXH SXEEOLFDWR XQ¶RSHUD
DQRQLPDRSVHXGRQLPDqDPPHVVRDIDUYDOHUHLGLULWWLGHOO¶DXWRUHILn-
ché questi non si sia rivelato.
Questa disposizione non si applica allorché si tratti degli pseudonimi
LQGLFDWLQHOVHFRQGRFRPPDGHOO¶DUWLFRORSUHFHGHQWH
350 Manuale di diritto delle arti e dello spettacolo

Art. 10
6HO¶RSHUDqVWDWDFUHDWDFRQLOFRQWULEXWRLQGLVWLQJXLELOHHGLQVFLQGLEi-
le di più persone, il diritto di autore appartiene in comune a tutti i
coautori.
Le parti indivise si presumono di valore eguale, salvo la prova per
iscritto di diverso accordo.
Sono applicabili le disposizioni che regolano la comunione. La difesa
del diritto morale può peraltro essere sempre esercitata individualmen-
te da ciascun coautore e O¶RSHUDQRQSXzHVVHUHSXEEOLFDWDVHLQHGLWD
né può essere modificata o utilizzata in forma diversa da quella della
ULPDSXEEOLFD]LRQHVHQ]DO¶DFFRUGRGLWXWWLLFRDXWRUL7XWWDYLDLQFa-
so di ingiustificato rifiuto di uno o più coautori, la pubblicazione, la
PRGLILFD]LRQHRODQXRYDXWLOL]]D]LRQHGHOO¶RSHUDSXzHVVHUHDXWRULz-
]DWDGDOO¶DXWRULWjJLXGL]LDULDDOOHFRQGL]LRQLHFRQOHPRGDOLWjGDHVVD
stabilite.

Art. 11
Alle Amministrazioni dello Stato, alle Provincie ed ai Comuni spetta
il diritto di autore sulle opere create e pubblicate sotto il loro nome ed
a loro conto e spese.
Lo stesso diritto spetta agli enti privati che non perseguano scopi di
lucro, salvo diverso accordo con gli autori delle opere pubblicate,
nonché alle Accademie e agli altri enti pubblici culturali sulla raccolta
dei loro atti e sulle loro pubblicazioni.

CAPO III - CONTENUTO E DURATA DEL DIRITTO DI AUTORE

SEZIONE I - PROTEZIONE DELLA UTILIZZAZIONE ECONOMICA


DELL¶OPERA

Art. 12
/¶DXWRUHKDLOGLULWWRHVFOXVLYRGLSXEEOLFDUH O¶RSHUD
+DDOWUHVuLOGLULWWRHVFOXVLYRGLXWLOL]]DUHHFRQRPLFDPHQWHO¶RSHUDLQ
ogni forma e modo, originale o derivato, nei limiti fissati da questa
OHJJHHGLQSDUWLFRODUHFRQO¶HVHUFL]LRGHLGLULWWLHVFOXVLYLLQGLFDWLQe-
gli articoli seguenti.
Legge 22 aprile 1941, n. 633 351

È considerata come prima pubblicazione la prima forma di esercizio


del diritto di utilizzazione.

Art. 12 bis
Salvo patto contrario, il datore di lavoro è titolare del diritto esclusivo
di utilizzazione economica del programma per elaboratore o della
banca di dati creati dal lavoratore dipendente QHOO¶HVHFX]LRQH delle sue
mansioni o su istruzioni impartite dallo stesso datore di lavoro.

Art. 12 ter
Salvo patto contrario, qualora XQ¶RSHUD di disegno industriale sia crea-
ta dal lavoratore dipendente QHOO¶HVHUFL]io delle sue mansioni, il datore
di lavoro è titolare dei diritti esclusivi di utilizzazione economica
GHOO¶RSHUD

Art. 13
Il diritto esclusivo di riprodurre ha per oggetto la moltiplicazione in
copie diretta o indiretta, temporanea o permanente, in tutto o in parte
GHOO¶RSHUD in qualunque modo o forma, come la copiatura a mano, la
stampa, la litografia, O¶LQFLVLRQH la fotografia, la fonografia, la cine-
matografia ed ogni altro procedimento di riproduzione.

Art. 14
Il diritto esclusivo di trascrivere ha SHURJJHWWRO¶XVRGHLPH]]LDWWLD
WUDVIRUPDUH O¶RSHUD RUDOH LQ RSHUD VFULWWD R ULSURGRWWD FRQ XQR GHL
PH]]LLQGLFDWLQHOO¶DUWLFRORSUHFHGHQWH

Art. 15
Il diritto esclusivo di eseguire, rappresentare o recitare in pubblico ha
per oggetto, la esecuzione, la rappresentazione o la recitazione, co-
PXQTXHHIIHWWXDWHVLDJUDWXLWDPHQWHFKHDSDJDPHQWRGHOO¶RSHUDPu-
VLFDOHGHOO¶RSHUDGUDPPDWLFDGHOO¶RSHUDFLQHPDWRJUDILFDGLTXDOVLDVL
DOWUDRSHUDGLSXEEOLFRVSHWWDFRORHGHOO¶RSHUDRUDOH
Non è considerata pubblica la esecuzione, rappresentazione o recita-
]LRQHGHOO¶RSHUDHQWURODFHUFKLDRUGLQDULDGHOODIDPLJOLDGHOFRQYLWWR
GHOODVFXRODRGHOO¶LVWLWXWRGLULFRYHURSXUFKpQRQHIIHWWXDWDDVFRSRGL
lucro.
352 Manuale di diritto delle arti e dello spettacolo

Non è considerata pubblica la recitazione di opere letterarie effettuata,


senza scopo di lucro, DOO¶LQWHUQR di musei, archivi e biblioteche pub-
blici ai fini esclusivi di promozione culturale e di valorizzazione delle
opere stesse individuati in base a protocolli di intesa tra la SIAE e il
Ministero dei beni e delle attività culturali e del turismo.

Art. 15 bis
Agli autori spetta un compenso ridotto quando O¶HVHFX]LRQH rappre-
sentazione o recitazione GHOO¶RSHUD avvengono nella sede dei centri o
degli istituti di assistenza, formalmente istituiti nonché delle associa-
zioni di volontariato, purché destinate ai soli soci ed invitati e sempre
che non vengano effettuate a scopo di lucro. In mancanza di accordi
fra la Società italiana degli autori ed editori (SIAE) e le associazioni di
categoria interessate, la misura del compenso sarà determinata con de-
creto del Presidente del Consiglio dei Ministri, da emanare sentito il
Ministro GHOO¶LQWHUQR
Con decreto del Presidente del Consiglio dei Ministri da emanare ai
sensi GHOO¶DUWLFROR 17, comma 3, della legge 23 agosto 1988, n. 400,
sentite le competenti commissioni parlamentari, sono stabiliti i criteri
e le modalità per O¶LQGLYLGXD]LRQH delle circostanze soggettive ed og-
gettive che devono dar luogo alla applicazione della disposizione di
cui al primo periodo del comma 1. In particolare occorre prescrivere:
a) O¶DFFHUWDPHQWR GHOO¶LVFUL]LRQH da almeno due anni dei soggetti
ivi indicati ai registri istituiti GDOO¶DUWLFROR 6 della legge 11 ago-
sto 1991, n. 266;
b) le modalità per O¶LGHQWLILFD]LRQH della sede dei soggetti e per
O¶DFFHUWDPHQWR della quantità dei soci ed invitati, da contenere in
un numero limitato e predeterminato;
c) che la condizione di socio sia conseguita in forma documentabi-
le e con largo anticipo rispetto alla data della manifestazione di
spettacolo;
d) la verifica che la manifestazione di spettacolo avvenga esclusi-
vamente a titolo gratuito da parte degli artisti, interpreti o esecu-
tori, ed a soli fini di solidarietà QHOO¶HVSOLFD]LRQH di finalità di
volontariato.
Legge 22 aprile 1941, n. 633 353

Art. 16
Il diritto esclusivo di comunicazione al pubblico su filo o senza filo
GHOO¶RSHUD ha per oggetto O¶LPSLHJR di uno dei mezzi di diffusione a
distanza, quali il telegrafo, il telefono, la radio, la televisione ed altri
mezzi analoghi e comprende la comunicazione al pubblico via satelli-
te, la ritrasmissione via cavo, nonché le comunicazioni al pubblico co-
dificate con condizioni particolari di accesso; comprende, altresì, la
messa a disposizione del pubblico GHOO¶RSHUD in maniera che ciascuno
possa avervi accesso dal luogo e nel momento scelti individualmente.
Il diritto di cui al comma 1 non si esaurisce con alcun atto di comuni-
cazione al pubblico, ivi compresi gli atti di messa a disposizione del
pubblico.

Art. 16 bis
Ai fini della presente legge si intende per:
a) satellite: qualsiasi satellite operante su bande di frequenza che, a
norma della legislazione sulle telecomunicazioni, sono riservate
alla trasmissione di segnali destinati alla ricezione diretta del
pubblico o riservati alla comunicazione individuale privata pur-
ché la ricezione di questa avvenga in condizioni comparabili a
quelle applicabili alla ricezione da parte del pubblico;
b) comunicazione al pubblico via satellite: O¶DWWR di inserire sotto il
controllo e la responsabilità GHOO¶RUJDQLVPR di radiodiffusione
operante sul territorio nazionale i segnali portatori di programmi
destinati ad essere ricevuti dal pubblico in una sequenza ininter-
rotta di comunicazione diretta al satellite e poi a terra. Qualora i
segnali portatori di programmi siano diffusi in forma codificata,
vi è comunicazione al pubblico via satellite a condizione che i
mezzi per la decodificazione della trasmissione siano messi a di-
sposizione del pubblico a cura GHOO¶RUJDQLVPR di radiodiffusione
stesso o di terzi con il suo consenso. Qualora la comunicazione
al pubblico via satellite abbia luogo nel territorio di uno stato
non comunitario nel quale non esista il livello di protezione che
per il detto sistema di comunicazione al pubblico stabilisce la
presente legge:
1) se i segnali ascendenti portatori di programmi sono tra-
smessi al satellite da una stazione situata nel territorio na-
354 Manuale di diritto delle arti e dello spettacolo

zionale, la comunicazione al pubblico via satellite si consi-


dera avvenuta in Italia. I diritti riconosciuti dalla presente
legge, relativi alla radiodiffusione via satellite, sono eserci-
tati nei confronti del soggetto che gestisce la stazione;
2) se i segnali ascendenti sono trasmessi da una stazione non
situata in uno Stato membro GHOO¶8QLRQH europea, ma la
comunicazione al pubblico via satellite avviene su incarico
di un organismo di radiodiffusione situato in Italia, la co-
municazione al pubblico si considera avvenuta nel territorio
nazionale purché O¶RUJDQLVPR di radiodiffusione vi abbia la
sua sede principale. I diritti stabiliti dalla presente legge, re-
lativi alla radiodiffusione via satellite, sono esercitati nei
confronti del soggetto che gestisce O¶RUJDQLVPR di radiodif-
fusione;
c) ritrasmissione via cavo: la ritrasmissione simultanea, invariata
ed integrale, per il tramite di un sistema di ridistribuzione via
cavo o su frequenze molto elevate, destinata al pubblico, di
XQ¶HPLVVLRQH primaria radiofonica o televisiva comunque diffu-
sa, proveniente da un altro Stato membro GHOO¶8QLRQH europea e
destinata alla ricezione del pubblico.

Art. 17
Il diritto esclusivo di distribuzione ha per oggetto la messa in com-
mercio o in circolazione, o comunque a disposizione, del pubblico,
con qualsiasi mezzo ed a qualsiasi titolo, GHOO¶RULJLQDOH GHOO¶RSHUD o
degli esemplari di essa e comprende, altresì, il diritto esclusivo di in-
trodurre nel territorio degli Stati della Comunità europea, a fini di di-
stribuzione, le riproduzioni fatte negli Stati extracomunitari.
Il diritto di distribuzione GHOO¶RULJLQDOH o di copie GHOO¶RSHUD non si
esaurisce nella Comunità europea, se non nel caso in cui la prima ven-
dita o il primo atto di trasferimento della proprietà nella Comunità sia
effettuato dal titolare del diritto o con il suo consenso.
Quanto disposto dal comma 2 non si applica alla messa a disposizione
del pubblico di opere in modo che ciascuno possa avervi accesso dal
luogo e nel momento scelti individualmente, anche nel caso in cui sia
consentita la realizzazione di copie GHOO¶RSHUD
Legge 22 aprile 1941, n. 633 355

Ai fini GHOO¶HVDXULPHQWR di cui al comma 2, non costituisce esercizio


del diritto esclusivo di distribuzione la consegna gratuita di esemplari
delle opere, effettuata o consentita dal titolare a fini promozionali, ov-
vero di insegnamento o di ricerca scientifica.

Art. 18
,OGLULWWRHVFOXVLYRGLWUDGXUUHKDSHURJJHWWRODWUDGX]LRQHGHOO¶RSHUD
in altra lingua o dialetto.
Il diritto esclusivo di elaborare comprende tutte le forme di modifica-
]LRQH GL HODERUD]LRQH H GL WUDVIRUPD]LRQH GHOO¶RSHUD SUHYLVWH
QHOO¶DUWLFROR
/¶DXWRUHKDDOWUHVuLOGLULWWRHVFOXVLYRGLSXEEOLFDUHOHVXHRSHUHLQUDc-
colta.
Ha infine il diritto HVFOXVLYRGLLQWURGXUUHQHOO¶RSHUDTXDOVLDVLPRGLIi-
cazione.

Art. 18 bis
Il diritto esclusivo di noleggiare ha per oggetto la cessione in uso degli
RULJLQDOLGLFRSLHRGLVXSSRUWLGLRSHUHWXWHODWHGDOGLULWWRG¶DXWRUH
fatta per un periodo limitato di tempo ed ai fini del conseguimento di
un beneficio economico o commerciale diretto o indiretto.
Il diritto esclusivo di dare in prestito ha per oggetto la cessione in uso
degli originali, di copie o di supporti di opere, tutelate dal diritto
G¶DXWRUHIatta da istituzioni aperte al pubblico, per un periodo di tem-
po limitato, a fini diversi da quelli di cui al comma 1.
/¶DXWRUHKDLOSRWHUHHVFOXVLYRGLDXWRUL]]DUHLOQROHJJLRRLOSUHVWLWR
da parte di terzi.
I suddetti diritti e poteri non si esauriscono con la vendita o con la di-
stribuzione in qualsiasi forma degli originali, di copie o di supporti
delle opere.
/¶DXWRUHDQFKHLQFDVRGLFHVVLRQHGHOGLULWWRGLQROHJJLRDGXQSUo-
duttore di fonogrammi o di opere cinematografiche o audiovisive o
sequenze di immagini in movimento, conserva il diritto di ottenere
XQ¶HTXDUHPXQHUD]LRQHSHULOQROHJJLRGDTXHVWLDVXDYROWDFRQFOXVR
con terzi. Ogni patto contrario è nullo. In difetto di accordo da conclu-
dersi tra le categorie interessate quali individuate daOO¶DUWLFROR 16,
primo comma, del regolamento, detto compenso è stabilito con la pro-
356 Manuale di diritto delle arti e dello spettacolo

cedura di cui DOO¶DUWLFROR 4 del decreto legislativo luogotenenziale 20


luglio 1945, n. 440.
I commi da 1 a 4 non si applicano in relazione a progetti o disegni di
edifici e ad opere di arte applicata.

Art. 19
I diritti esclusivi previsti dagli articoli precedenti sono fra loro indi-
SHQGHQWL /¶HVHUFL]LRGLXQRGLHVVLQRQ HVFOXGHO¶HVHUFL]LRHVFOXVLYR
di ciascuno degli altri diritti.
(VVL KDQQR SHU RJJHWWR O¶RSHUD QHO VXR insieme ed in ciascuna delle
sue parti.

SEZIONE II - PROTEZIONE DEI DIRITTI SULL¶OPERA A DIFESA DELLA PER-


SONALITÀ DELL¶AUTORE (DIRITTO MORALE DELL¶AUTORE)

Art. 20
Indipendentemente dai diritti esclusivi di utilizzazione economica
GHOO¶RSHUD previsti nelle disposizioni della sezione precedente, ed an-
che dopo la cessione dei diritti stessi, O¶DXWRUH conserva il diritto di ri-
vendicare la paternità GHOO¶RSHUD e di opporsi a qualsiasi deformazione,
mutilazione od altra modificazione, ed a ogni atto a danno GHOO¶RSHUD
stessa, che possano essere di pregiudizio al suo onore o alla sua repu-
tazione.
7XWWDYLD QHOOH RSHUH GHOO¶DUFKLWHWWXUD O¶DXWRUH QRQ SXz RSSRUVL DOOH
modificazioni che si rendessero necessarie nel corso della realizzazio-
ne. Del pari non potrà opporsi a quelle altre modificazioni che si ren-
GHVVH QHFHVVDULR DSSRUWDUH DOO¶RSHUD JLj UHDOL]]DWD 3HUz VH DOO¶RSHUD
sia riconosciuta dalla competente autorità statale importante carattere
DUWLVWLFRVSHWWHUDQQRDOO¶DXWRUHORVWXGLRHO¶DWWXD]LRQHGLWDOLPRGLfi-
cazioni.

Art. 21
/¶DXWRUHGLXQ¶RSHUDDQRQLPDRSVHXGRQLPDKDVHPSUHLOGLULWWRGLUi-
velarsi e di far riconoscere in giudizio la sua qualità di autore.
Nonostante qualunque precedente patto contrario, gli aventi causa
GHOO¶DXWRUHFKHVLVLDULYHODWRQe dovranno indicare il nome nelle pub-
Legge 22 aprile 1941, n. 633 357

blicazioni, riproduzioni, trascrizioni, esecuzioni, rappresentazioni, re-


citazioni e diffusioni o in qualsiasi altra forma di manifestazione o an-
nuncio al pubblico.

Art. 22
I diritti indicati nei precedenti articoli sono inalienabili.
7XWWDYLD O¶DXWRUH FKH DEELD FRQRVFLXWH HG DFFHWWDWH OH PRGLILFD]LRQL
della propria opera non è più ammesso ad agire per impedirne
O¶HVHFX]LRQHRSHUFKLHGHUQHODVRSSUHVVLRQH

Art. 23
'RSRODPRUWHGHOO¶DXWRUHLOGLULWWRSUHYLVWRQHOO¶Drticolo 20 può essere
fatto valere, senza limite di tempo, dal coniuge e dai figli e, in loro
mancanza, dai genitori e dagli altri ascendenti e dai discendenti diretti;
mancando gli ascendenti ed i discendenti, dai fratelli e dalle sorelle e
dai loro discendenti.
/¶D]LRQH TXDORUD ILQDOLWj SXEEOLFKH OR HVLJDQR SXz DOWUHVu HVVHUH
HVHUFLWDWDGDO0LQLVWURSHUODFXOWXUDSRSRODUHVHQWLWDO¶$VVRFLD]LRQH
sindacale competente.

Art. 24
,OGLULWWRGLSXEEOLFDUHOHRSHUHLQHGLWHVSHWWDDJOLHUHGLGHOO¶DXWRUHRDi
OHJDWDULGHOOHRSHUHVWHVVHVDOYRFKHO¶DXWRUHDEELDHVSUHVVDPHQWHYLe-
WDWDODSXEEOLFD]LRQHRO¶DEELDDIILGDWDDGDOWUL
4XDORUDO¶DXWRUHDEELDILVVDWRXQWHUPLQHSHUODSXEEOLFD]LRQHOHRSe-
re inedite non possono essere pubblicate prima della sua scadenza.
Quando le persone indicate nel primo comma siano più e vi sia tra lo-
URGLVVHQVRGHFLGHO¶DXWRULWjJLXGL]LDULDVHQWLWRLOSXEEOLFRPLQLVWHUR
È rispettata, in ogni caso, la volontà del defunto, quando risulti da
scritto.
Sono applicabili a queste opere le disposizioni contenute nella sezione
seconda del capo secondo del titolo terzo.
358 Manuale di diritto delle arti e dello spettacolo

SEZIONE III - DURATA DEI DIRITTI DI UTILIZZAZIONE ECONOMICA


DELL¶OPERA

Art. 25
, GLULWWL GL XWLOL]]D]LRQH HFRQRPLFD GHOO¶RSHUD GXUDQR WXWWD OD YLWD
GHOO¶DXWRUH H sino al termine del cinquantesimo anno solare dopo la
sua morte.

Art. 26
1HOOH RSHUH LQGLFDWH QHOO¶DUWLFROR  QRQFKp LQ TXHOOH GUDPPDWLFR-
musicali, coreografiche e pantomimiche, la durata dei diritti utilizza-
zione economica spettanti a ciascuno dei coadiutori o dei collaboratori
si determina sulla vita del coautore che muore per ultimo.
Nelle opere collettive la durata dei diritti di utilizzazione economica
spettante ad ogni collaboratore si determina sulla vita di ciascuno. La
durata dei diritti di utLOL]]D]LRQHHFRQRPLFDGHOO¶RSHUDFRPHXQWXWWRq
di cinquanta anni dalla prima pubblicazione, qualunque sia la forma
nella quale la pubblicazione è stata effettuata, salve le disposizioni
GHOO¶DUWLFRORSHUOHULYLVWHLJLRUQDOLHOHDOWUHRSHUHSHULRGLche.

Art. 27
Nelle opere anonime o pseudonime, fuori del caso previsto nel capo-
YHUVRGHOO¶DUWLFRORODGXUDWDGHLGLULWWLGLXWLOL]]D]LRQHHFRQRPLFDq
GLFLQTXDQW¶DQQLDSDUWLUHGDOODSULPDSXEEOLFD]LRQHTXDOXQTXHVLDOD
forma nella quale essa è stata effettuata.
6HSULPDGHOODVFDGHQ]DGLGHWWRWHUPLQHO¶DXWRUHVLqULYHODWRRODUi-
veOD]LRQH q IDWWD GDOOH SHUVRQHLQGLFDWH GDOO¶DUWLFROR  R GD SHUVRQH
DXWRUL]]DWH GDOO¶DXWRUH QHOOH IRUPH VWDELOLWH GDOO¶DUWLFROR VHJXHQWH VL
applica il termine di durDWDGHWHUPLQDWRQHOO¶DUWLFROR

Art. 27 bis
Articolo abrogato dal decreto legislativo 26 maggio 1997, n. 154.

Art. 28
Per acquistare il beneficio della durata normale dei diritti esclusivi di
utilizzazione economica, la rivelazione deve essere fatta mediante de-
QXQFLD DOO¶8IILFLR GHOOD SURSULHWj OHWWHUDULD VFLHQWLILFD HG DUWLVWLFD
Legge 22 aprile 1941, n. 633 359

presso il Ministero della cultura popolare, secondo le disposizioni sta-


bilite nel regolamento.
La denuncia di rivelazione è pubblicata nelle forme stabilite da dette
disposizioni ed ha effetto a partire dalla data del deposito della denun-
FLDGLIURQWHDLWHU]LFKHDEELDQRDFTXLVWDWLGLULWWLVXOO¶RSHUDFRPHDQo-
nima o pseudonima.

Art. 29
La durata dei diritti esclusivi di utilizzazione economica spettanti, a
WHUPLQL GHOO¶DUWicolo 11, alle Amministrazioni dello Stato, al Partito
Nazionale Fascista, alle Provincie, ai Comuni, alle Accademie, agli
enti pubblici culturali nonché agli enti privati che non perseguano
VFRSLGLOXFURqGLYHQW¶DQQLDSDUWLUHGDOODSULPDSXEEOLFD]LRQe, qua-
lunque sia la forma nella quale la pubblicazione è stata effettuata. Per
le comunicazioni e le memorie pubblicate dalle Accademie e dagli al-
tri enti pubblici culturali tale durata è ridotta a due anni; trascorsi i
TXDOL O¶DXWRUH ULSUHQGH LQWHJUDOPHQte la libera disponibilità dei suoi
scritti.

Art. 30
Quando le parti o i volumi di una stessa opera siano pubblicati separa-
tamente, in tempi diversi, la durata dei diritti di utilizzazione econo-
mica, che sia fissata ad anni, decorre per ciascuna parte o per ciascun
YROXPH GDOO¶DQQR GHOOD SXEEOLFD]LRQH /H IUD]LRQL GL DQQR JLRYDQR
DOO¶DXWRUH
Se si tratta di opera collettiva periodica, quale la rivista o il giornale,
la durata dei diritti è calcolata egualmente a partire dalla fine di ogni
anno dalla pubblicazione dei singoli fascicoli o numeri.

Art. 31
Nelle opere pubblicate per la prima volta dopo la morte GHOO¶DXWRUH
che non ricadono nella previsione GHOO¶DUWLFROR 85 ter, la durata dei di-
ritti esclusivi di utilizzazione economica è di VHWWDQW¶DQQL a partire dal-
la morte GHOO¶DXWRUH
360 Manuale di diritto delle arti e dello spettacolo

Art. 32
Fermo restando quanto stabilito GDOO¶DUWLFROR 44, i diritti di utilizzazio-
ne economica GHOO¶RSHUD cinematografica o assimilata durano sino al
termine del settantesimo anno dopo la morte GHOO¶XOWLPD persona so-
pravvissuta fra le seguenti persone: il direttore artistico, gli autori del-
la sceneggiatura, ivi compreso O¶DXWRUH del dialogo, e O¶DXWRUH della
musica specificamente creata per essere utilizzata QHOO¶RSHUD cinema-
tografica o assimilata.

Art. 32 bis
I diritti di utilizzazione economica GHOO¶RSHUD fotografica durano sino
al termine del settantesimo anno dopo la morte GHOO¶DXWRUH

Art. 32 ter
I termini finali di durata dei diritti di utilizzazione economica previsti
dalle disposizioni della presente sezione si computano, nei rispettivi
casi, a decorrere dal 1 gennaio GHOO¶DQQR successivo a quello in cui si
verifica la morte GHOO¶DXWRUH o altro evento considerato dalla norma.

CAPO IV - NORME PARTICOLARI AI DIRITTI DI UTILIZZAZIONE ECONO-


MICA PER TALUNE CATEGORIE DI OPERE

SEZIONE I - OPERE DRAMMATICO-MUSICALI, COMPOSIZIONI MUSICALI


CON PAROLE, OPERE COREOGRAFICHE E PANTOMIMICHE

Art. 33
In difetto di particolari convenzioni tra i collaboratori, rispetto alle
opere liriche, alle operette, ai melologhi, alle composizioni musicali
con parole, ai balli e balletti musicali, si applicano le disposizioni dei
tre successivi articoli.

Art. 34
/¶HVHUFL]LRGHLGLULWWLGLXWLOL]]D]LRQHHFRQRPLFDVSHWWDDOO¶DXWRUHGHOOD
parte musicale, salvi tra le parti i diritti derivanti dalla comunione.
Legge 22 aprile 1941, n. 633 361

Il profitto della utilizzazione economica è ripartito in proporzione del


valore del rispettivo contributo letterario o musicale.
Nelle opere liriche si considera che il valore della parte musicale rap-
presenti la frazione di tre quarti dHOYDORUHFRPSOHVVLYRGHOO¶RSHUD
Nelle operette, nei melologhi, nelle composizioni musicali con parole,
nei balli e balletti musicali, il valore dei due contributi si considera
uguale.
Ciascuno dei collaboratori ha diritto di utilizzare separatamente e in-
dipendentemente la propria opera, salvo il disposto dei casi seguenti.

Art. 35
/¶DXWRUH GHOOD SDUWH OHWWHUDULD QRQ SXz GLVSRUQH SHU FRQJLXQJHUODDG
DOWURWHVWRPXVLFDOHDOO¶LQIXRULGHLFDVLVHJXHQWL
1) allorché, dopo che egli ha consegnato come testo definitivo il
manoscritto della parte letteraria al compositore, questi non lo
ponga in musica nel termine di cinque anni, se si tratta di libret-
to per opera lirica o per operetta, e, nel termine di un anno, se si
tratta di ogni altra opera letteraria da emettere in musica;
2) DOORUFKp GRSR FKH O¶RSHUD q VWDWD PXVLFDWD H FRQVLGHUDWD GDOOH
parti come pronta per essere eseguita o rappresentata, essa non è
rappresentata od eseguita nei termini indicati nel numero prece-
dente, salvo i maggiori termini che possono essere stati accorda-
ti per la esecuzione o rappresentazione ai sensi degli articoli 139
e 141;
3) allorché, dopo una prima rappresentazione od esecuzione,
O¶RSHUDFHVVLGLHVVHUHUDSSUHVHQWDWDRGHVHJXLWDSHULOSHULRGRGL
dieci anni, se si tratta di opera lirica, oratorio, poema sinfonico
od operetta o per il periodo di dieci anni, se si tratta di altra
composizione.
Il compositore nei casi previsti ai numeri 2 e 3 può altrimenti utilizza-
re la musica.

Art. 36
1HOFDVRSUHYLVWRGDOQGHOO¶DUWLFRORSUHFHGHQWHO¶DXWRUHGHOODSDUWH
letteraria ne riacquista la libera disponibilità, senza pregiudizio
GHOO¶HYHQWXDOHD]LRQHGLGDQQLDFDULFRGHOFRPSRVLWRUH
362 Manuale di diritto delle arti e dello spettacolo

1HLFDVLSUHYLVWLGDLQXPHULHHVHQ]DSUHJLXGL]LRGHOO¶D]LRQHGL
danni prevista nel comma precedente, il rapporto di comunione forma-
WRVLVXOO¶RSHUDJLjPXVLFDWDULPDQHIHUPRPDO¶RSHUDVWHVVDQRQSXz
essere rappresentata od eseguita che con il consenso di entrambi i col-
laboratori.

Art. 37
Nelle opere coreografiche o pantomimiche e nelle altre composte di
musica, di parola e di danze o di mimica, quali le riviste musicali ed
opere simili, in cui la parte musicale non ha funzione o valore princi-
SDOHO¶HVHUFL]LRGHLGLULWWLGLXWLOL]]D]LRQHHFRQRPLFDVDOYRSDWWRFRn-
WUDULRVSHWWDDOO¶DXWRUHGHOODSDUte coreografica o pantomimica e, nelle
ULYLVWHPXVLFDOLDOO¶DXWRUHGHOODSDUWHOHWWHUDULD
Con le modificazioni richieste dalle norme del comma precedente so-
no applicabili a queste opere le disposizioni degli articoli 35 e 36.

SEZIONE II - OPERE COLLETTIVE, RIVISTE E GIORNALI

Art. 38
1HOO¶RSHUDFROOHWWLYDVDOYRSDWWRLQFRQWUDULRLOGLULWWRGLXWLOL]]D]LRQH
HFRQRPLFDVSHWWDDOO¶HGLWRUHGHOO¶RSHUDVWHVVDVHQ]DSUHJLXGL]LRGHUi-
YDQWHGDOO¶DSSOLFD]LRQHGHOO¶DUWLFROR
$LVLQJROLFROODERUDWRULGHOO¶RSHUD collettiva è riservato il diritto di uti-
OL]]DUHODSURSULDRSHUDVHSDUDWDPHQWHFRQO¶RVVHUYDQ]DGHLSDWWLFRn-
venuti, e in difetto, delle norme seguenti.

Art. 39
Se un articolo è inviato alla rivista o giornale, per essere riprodotto, da
persona estranea alla redazione del giornale o della rivista e senza pre-
FHGHQWLDFFRUGLFRQWUDWWXDOLO¶DXWRUHULSUHQGHLOGLULWWRGLGLVSRUQHOi-
EHUDPHQWH TXDQGR QRQ DEELD ULFHYXWR QRWL]LD GHOO¶DFFHWWD]LRQH QHO
WHUPLQHGLXQPHVHGDOO¶LQYLRRTXDQGRODULSURGX]LRQHQRQDYvenga
QHOWHUPLQHGLVHLPHVLGDOODQRWL]LDGHOO¶DFFHWWD]LRQH
Trattandosi di articolo fornito da un redattore, il direttore della rivista
o giornale ne può differire la riproduzione anche al di là dei termini
indicati nel comma precedente. Decorso però il termine di sei mesi
Legge 22 aprile 1941, n. 633 363

GDOOD FRQVHJQD GHO PDQRVFULWWR O¶DXWRUH SXz XWLOL]]DUH O¶DUWLFROR SHU


riprodurlo in volume o per estratto separato, se si tratta di giornale, ed
anche in altro periodico, se si tratta di rivista.

Art. 40
Il collaboratore di opera collettiva che non sia rivista o giornale ha di-
ritto, salvo patto contrario, che il suo nome figuri nella riproduzione
GHOODVXDRSHUDQHOOHIRUPHG¶XVR
Nei giornali questo diritto non compete, salvo patto contrario, al per-
sonale della redazione.

Art. 41
SeQ]D SUHJLXGL]LR GHOO¶DSSOLFD]LRQH GHOOD GLVSRVL]LRQH FRQWHQXWD
QHOO¶DUWLFRORLOGLUHWWRUHGHOJLRUQDOHKDGLULWWRVDOYRSDWWRFRQWUa-
ULR GL LQWURGXUUH QHOO¶DUWLFROR GD ULSURGXUUH TXHOOH PRGLILFD]LRQL GL
forma che sono richieste dalla natura e dai fini del giornale.
1HJOL DUWLFROL GD ULSURGXUVL VHQ]D LQGLFD]LRQH GHO QRPH GHOO¶DXWRUH
questa facoltà si estende alla soppressione o riduzione di parti di detto
articolo.

Art. 42
/¶DXWRUHGHOO¶DUWLFRORRDOWUDRSHUDFKHVLDVWDWRULSURGRWWRLQXQ¶RSHUD
collettiva ha diritto di riprodurlo in estratti separati o raccolti in volu-
PH SXUFKp LQGLFKL O¶RSHUD FROOHWWLYD GDOOD TXDOH q WUDWWR H OD GDWD GL
pubblicazione.
7UDWWDQGRVLGLDUWLFROLDSSDUVLLQULYLVWHRJLRUQDOLO¶DXWRUHVDOYRSDWWR
contrario, ha altresì il diritto di riprodurli in altre riviste o giornali.

Art. 43
/¶HGLWRUHRGLUHWWRUHGHOODULYLVWDRGHOJLRUQDOHQRQKDREEOLJRGLFRn-
servare o di restituire i manoscritti degli articoli non riprodotti, che gli
siano pervenuti senza sua richiesta.
364 Manuale di diritto delle arti e dello spettacolo

SEZIONE III - OPERE CINEMATOGRAFICHE

Art. 44
6L FRQVLGHUDQR FRDXWRUL GHOO¶RSHUD FLQHPDWRJUDILFD O¶DXWRUH GHO VRg-
JHWWRO¶DXWRUHGHOODVFHQHJJLDWXUDO¶DXWRUHGHOODPXVLFDHGLOGLUHWWRUH
artistico.

Art. 45
/¶HVHUFL]LRGHLGLULWWLGLXWLOL]]D]LRQHHFRQRPLFD GHOO¶RSHUDFLQHPDWo-
JUDILFDVSHWWDDFKLKDRUJDQL]]DWRODSURGX]LRQHGHOO¶RSHUDVWHVVDQHL
limiti indicati dai successivi articoli.
6LSUHVXPHSURGXWWRUHGHOO¶RSHUDFLQHPDWRJUDILFDFKLqLQGLFDWRFRPH
WDOHVXOODSHOOLFRODFLQHPDWRJUDILFD6HO¶RSHUDqUHgistrata ai sensi del
VHFRQGR FRPPD GHOO¶DUWLFROR  SUHYDOH OD SUHVXQ]LRQH VWDELOLWD
GDOO¶DUWLFRORPHGHVLPR

Art. 46
/¶HVHUFL]LRGHLGLULWWLGLXWLOL]]D]LRQHHFRQRPLFDVSHWWDQWHDOSURGXt-
WRUH KD SHU RJJHWWR OR VIUXWWDPHQWR FLQHPDWRJUDILFR GHOO¶RSHUD pro-
dotta.
Salvo patto contrario, il produttore non può eseguire o proiettare ela-
ERUD]LRQL WUDVIRUPD]LRQL R WUDGX]LRQL GHOO¶RSHUD SURGRWWD VHQ]D LO
FRQVHQVRGHJOLDXWRULLQGLFDWLQHOO¶DUWLFROR
Gli autori della musica, delle composizioni musicali e delle parole che
accompagnano la musica hanno diritto di percepire direttamente da
FRORUR FKH SURLHWWDQR SXEEOLFDPHQWH O¶RSHUD XQ FRPSHQVR VHSDUDWR
per la proiezione. Il compenso è stabilito, in difetto di accordo fra le
parti, secondo le norme del regolamento.
Gli autori del soggetto e della sceneggiatura e il direttore artistico,
qualora non vengano retribuiti mediante una percentuale sulle proie-
]LRQLSXEEOLFKHGHOO¶RSHUDFLQHPDWRJUDILFDKDQQRGLULWWRVDOYRSDWWR
contrario quando gli incassi abbiano raggiunto una cifra da stabilirsi
contrattualmente col produttore, a ricevere un ulteriore compenso, le
cui forme e la cui entità saranno stabilite con accordi da concludersi
tra le categorie interessate.
Legge 22 aprile 1941, n. 633 365

Art. 46 bis
Fermo restando quanto stabilito GDOO¶DUWLFROo 46, in caso di cessione
del diritto di diffusione al produttore, spetta agli autori di opere cine-
matografiche e assimilate un equo compenso a carico degli organismi
di emissione per ciascuna utilizzazione delle opere stesse a mezzo del-
la comunicazione al pubblico via etere, via cavo e via satellite.
Per ciascuna utilizzazione di opere cinematografiche e assimilate di-
versa da quella prevista nel comma 1 e QHOO¶DUWLFROR 18 bis, comma 5,
agli autori delle opere stesse spetta un equo compenso a carico di co-
loro che esercitano i diritti di sfruttamento per ogni distinta utilizza-
zione economica.
Per ciascuna utilizzazione di opere cinematografiche ed assimilate
espresse originariamente in lingua straniera spetta, altresì, un equo
compenso agli autori delle elaborazioni costituenti traduzione o adat-
tamento della versione in lingua italiana dei dialoghi.
Ciascun compenso tra quelli previsti dai commi 1, 2 e 3 non è rinun-
ciabile e, in difetto di accordo da concludersi tra le categorie interessa-
te quali individuate dDOO¶DUWLFROR 16, primo comma, del regolamento, è
stabilito con la procedura di cui DOO¶DUWLFROR 4 del decreto legislativo
luogotenenziale 20 luglio 1945, n. 440.

Art. 47
,OSURGXWWRUHKDIDFROWjGLDSSRUWDUHDOOHRSHUHXWLOL]]DWHQHOO¶RSHUDFi-
nematografica le modifiche necessarie per il loro adattamento cinema-
tografico.
/¶DFFHUWDPHQWRGHOOHQHFHVVLWjRPHQRGHOOHPRGLILFKHDSSRUWDWHRGD
DSSRUWDUVL DOO¶RSHUD FLQHPDWRJUDILFD TXDQGR PDQFKL O¶DFFRUGR WUD LO
produttore e uno o più degli autori menzionati nell¶DUWLFROR  GHOOD
presente legge, è fatta da un collegio di tecnici nominato dal Ministro
per la cultura popolare, secondo le norme fissate dal regolamento.
Gli accertamenti fatti da tale collegio hanno carattere definitivo.

Art. 48
*OL DXWRUL GHOO¶RSHUD cinematografica hanno diritto che i loro nomi,
FRQO¶LQGLFD]LRQHGHOODORURTXDOLWjSURIHVVLRQDOHHGHOORURFRQWULEXWR
QHOO¶RSHUDVLDQRPHQ]LRQDWLQHOODSURLH]LRQHGHOODSHOOLFRODFLQHPDWo-
grafica.
366 Manuale di diritto delle arti e dello spettacolo

Art. 49
Gli autori delle parti letterarie o musicali delO¶RSHUD FLQHPDWRJUDILFD
possono riprodurle o comunque utilizzarle separatamente, purché non
ne risulti pregiudizio ai diritti di utilizzazione il cui esercizio spetta al
produttore.

Art. 50
6HLOSURGXWWRUHQRQSRUWDDFRPSLPHQWRO¶RSHUDFLQHPDWRJUDILFD nel
termine di tre anni dal giorno della consegna della parte letteraria o
PXVLFDOHRQRQIDSURLHWWDUHO¶RSHUDFRPSLXWDHQWURWUHDQQLGDOFRm-
pimento, gli autori di dette parti hanno diritto di disporre liberamente
GHOO¶RSHUDVWHVVD

SEZIONE IV - OPERE RADIODIFFUSE

Art. 51
In ragione della natura e dei fini della radiodiffusione, come servizio
riservato allo stato, che lo esercita direttamente o per mezzo di con-
cessioni, il diritto esclusivo di radiodiffusione, direttamente o con
qualsiasi mezzo intermediario, è regolato dalle norme particolari se-
guenti.

Art. 52
/¶HQWHHVHUFHQWHLOVHUYL]LRGHOODUDGLRGLIIXVLRQHKDODIDFROWjGLHVe-
JXLUH OD UDGLRGLIIXVLRQH GL RSHUH GHOO¶LQJHJQR GDL WHDWUL GDOOH VDOH GL
concerto e da ogni altro luogo pubblico, alle condizioni e nei limiti in-
dicati nel presente articolo e nei seguenti.
I proprietari, gli impresari e quanti concorrono allo spettacolo sono te-
nuti a permettere gli impianti e le prove tecniche necessarie per prepa-
rare la radiodiffusione.
È necessario il consHQVRGHOO¶DXWRUHSHUUDGLRGLIIRQGHUHOHRSHUHQXo-
ve e le prime rappresentazioni stagionali delle opere non nuove.
1RQqFRQVLGHUDWDQXRYDO¶RSHUDWHDWUDOHUDSSUHVHQWDWDSXEEOLFDPHQWH
in tre diversi teatri, o altro luogo pubblico.
Legge 22 aprile 1941, n. 633 367

Art. 53
Nelle stagioni di rappresentazione o di concerti di durata non inferiore
DGXHPHVLLOGLULWWRGHOO¶HQWHLQGLFDWRQHOSUHFHGHQWHDUWLFRORSXzHs-
sere esercitato per le rappresentazioni una volta la settimana e per i
concerti ogni cinque o frazioni di cinque concerti.
Per GXUDWDGHOODVWDJLRQHWHDWUDOHRGLFRQFHUWRV¶LQWHQGHTXHOODULVXl-
WDQWHGDLPDQLIHVWLRGDLSURJUDPPLSXEEOLFDWLSULPDGHOO¶LQL]LRGHOOD
stagione.

Art. 54
/¶DFFHUWDPHQWRGHOODFRQIRUPLWjGHOOHUDGLRGLIIXVLRQLDOOHEXRQHQRr-
me tecniche, è di esclusiva spettanza degli organi dello stato predispo-
sti alla vigilanza delle radiodiffusioni, con i poteri stabiliti
GDOO¶DUWLFROR  FDSRYHUVR GHOOD OHJJH  JLXJQR -VI, n. 1352, e
GHOO¶DUWLFRORGHO5GHFUHWR-legge 3 febbraio 1936-XIV, n. 654, con-
vertito nella legge 4 giugno 1936, n. 1552.
,O QRPH GHOO¶DXWRUH HG LO WLWROR GHOO¶RSHUD GHYRQR HVVHUH UDGLRGLIIXVL
FRQWHPSRUDQHDPHQWHDOO¶RSHUD

Art. 55
Senza pregiudizio dei diritti GHOO¶DXWRUH sulla radiodiffusione della sua
opera, O¶HQWH esercente è autorizzato a registrare su disco, o su altro
supporto, O¶RSHUD stessa, al fine della sua radiodiffusione differita per
necessità orarie o tecniche, purché la registrazione suddetta sia, dopo
O¶XVR distrutta o resa inservibile.
È consentita la conservazione in archivi ufficiali delle registrazioni di
cui al comma 1 che abbiano un eccezionale carattere documentario,
senza possibilità di ulteriore utilizzazione a fini economici o commer-
ciali salva, per TXHVW¶XOWLPD O¶DXWRUL]]D]LRQH GHOO¶DXWRUH GHOO¶RSHUD e
dei titolari di diritti connessi.

Art. 56
/¶DXWRUHGHOO¶RSHUDUDGLRGLIIXVDDWHUPLQLGHJOLDUWLFROLSUHFHGHQWLKD
LOGLULWWRGLRWWHQHUHGDOO¶HQWHHVHUFHQWHLOVHUYL]LRGHOODUDGLRGLIIXVLRQH
il pagamento di un compenso da liquidarsi, nel caso di disaccordo tra
le partLGDOO¶DXWRULWjJLXGL]LDULD
368 Manuale di diritto delle arti e dello spettacolo

/D GRPDQGD QRQ SXz HVVHUH SURPRVVD GLQDQ]L O¶DXWRULWj JLXGL]LDULD


prima che sia esperito il tentativo di conciliazione nei modi e nelle
forme che saranno stabiliti nel regolamento.

Art. 57
Il compenso è liquidato in base al numero delle trasmissioni.
Il regolamento determina i criteri per stabilire il numero e le modalità
delle trasmissioni differite o ripetute.

Art. 58
3HUO¶HVHFX]LRQHLQSXEEOLFLHVHUFL]LDPH]]RGLDSSDUHFFKLUDGLRULFe-
venti sonori, muniti di altoparlante, di opere radiodiffuse, è dovuto
DOO¶DXWRUH XQ HTXR FRPSHQVR FKH q GHWHUPLQDWR SHULRGLFDPHQWH
G¶DFFRUGR IUD OD Società italiana degli autori ed editori (SIAE) e la
UDSSUHVHQWDQ]DGHOO¶DVVRFLD]LRQHVLQGDFDOHFRPSHWHQWH

Art. 59
La radiodiffusione delle opeUH GHOO¶LQJHJQR GDL ORFDOL GHOO¶HQWH HVHr-
cente il servizio della radiodiffusione è sottoposta al consenso
GHOO¶DXWRUHDQRUPDGHOOHGLVSRVL]LRQLFRQWHQXWHQHOFDSRWHU]RGLTXe-
sto titolo; ad essa non sono applicabili le disposizioni degli articoli
precedenWLVDOYRTXHOOHGHOO¶DUWLFROR

Art. 60
4XDORUD LO 0LQLVWHUR GHOOD FXOWXUD SRSRODUH OR GLVSRQJD O¶HQWH HVHr-
cente effettua trasmissioni speciali di propaganda culturale ed artistica
GHVWLQDWHDOO¶HVWHURFRQWURSDJDPHQWRGLXQFRPSHQVRGDOLTXLGDUVLD
termini del regolamento.

SEZIONE V - OPERE REGISTRATE SU RAPPORTI

Art. 61
/¶DXWRUH ha il diritto esclusivo, ai sensi delle disposizioni contenute
nella sezione I del capo III di questo titolo:
Legge 22 aprile 1941, n. 633 369

a) di adattare e di registrare O¶RSHUD su qualunque supporto ripro-


duttore di suoni, di voci o di immagini, qualunque sia la tecno-
logia utilizzata;
b) di riprodurre, di distribuire, di noleggiare e di dare in prestito gli
esemplari GHOO¶RSHUD così adattata o registrata;
c) di eseguire pubblicamente e di comunicare l¶RSHUD al pubblico
mediante O¶LPSLHJR di qualunque supporto.
La cessione del diritto di riproduzione o dei diritto di distribuzione
non comprende, salvo patto contrario, la cessione dei diritto di esecu-
zione pubblica o di comunicazione al pubblico.
Per quanto riguarda la radiodiffusione, il diritto G¶DXWRUH resta regolato
dalle norme contenute nella precedente sezione.

Art. 62
I supporti fonografici, nei quali O¶RSHUD GHOO¶LQJHJQR è riprodotta, non
possono essere distribuiti se non portino stabilmente apposte le indi-
cazioni seguenti:
a) titolo GHOO¶RSHUD riprodotta;
b) nome GHOO¶DXWRUH
c) nome GHOO¶DUWLVWD interprete od esecutore. I complessi orchestrali
o corali sono indicati col nome G¶XVR
d) data della fabbricazione.

Art. 63
I supporti devono essere fabbricati od utilizzati in modo che venga ri-
spettato il diritto morale GHOO¶DXWRUH ai termini degli articoli 20 e 21.
Si considerano lecite le modificazioni GHOO¶RSHUD richieste dalle neces-
sità tecniche della registrazione.

Art. 64
La concessione in uso a case editrici fonografiche nazionali delle ma-
trici dei dischi della Discoteca di Stato, per trarne dischi da diffondere
PHGLDQWH YHQGLWD VLD LQ ,WDOLD FKH DOO¶HVWHUR D WHUPLQL GHOO¶DUWLFROR 
della legge 2 febbraio 1939-XVII, n. 467, contenente norme per il
riordinamento della Discoteca di Stato, allorché siano registrate opere
tutelate, è sottoposta al pagamento dei diritti di autore, secondo le
norme contenute nel regolamento.
370 Manuale di diritto delle arti e dello spettacolo

SEZIONE VI - PROGRAMMI PER ELABORATORE

Art. 64 bis
Fatte salve le disposizioni dei successivi articoli 64 ter e 64 quater, i
diritti esclusivi conferiti dalla presente legge sui programmi per elabo-
ratore comprendono il diritto di effettuare o autorizzare:
a) la riproduzione, permanente o temporanea, totale o parziale, del
programma per elaboratore con qualsiasi mezzo o in qualsiasi
forma. Nella misura in cui operazioni quali il caricamento, la vi-
sualizzazione, O¶HVHFX]LRQH la trasmissione o la memorizzazione
del programma per elaboratore richiedano una riproduzione, an-
che tali operazioni sono soggette DOO¶DXWRUL]]D]LRQH del titolare
dei diritti;
b) la traduzione, O¶DGDWWDPHQWR la trasformazione e ogni altra mo-
dificazione del programma per elaboratore, nonché la riprodu-
zione GHOO¶RSHUD che ne risulti, senza pregiudizio dei diritti di chi
modifica il programma;
c) qualsiasi forma di distribuzione al pubblico, compresa la loca-
zione, del programma per elaboratore originale o di copie dello
stesso. La prima vendita di una copia del programma nella Co-
munità Economica Europea da parte del titolare dei diritti, o con
il suo consenso, esaurisce il diritto di distribuzione di detta copia
DOO¶LQWHUQR della Comunità, ad eccezione del diritto di controllare
O¶XOWHULRUH locazione del programma o di una copia dello stesso.

Art. 64 ter
Salvo patto FRQWUDULRQRQVRQRVRJJHWWHDOO¶DXWRUL]]D]LRQHGHOWLWRODUH
GHLGLULWWLOHDWWLYLWjLQGLFDWHQHOO¶DUWLFROR bis, lettere a) e b), allor-
FKpWDOLDWWLYLWjVRQRQHFHVVDULHSHUO¶XVRGHOSURJUDPPDSHUHODERUa-
tore conformemente alla sua destinazione da parte del legittimo acqui-
rente, inclusa la correzione degli errori.
Non può essere impedito per contratto, a chi ha il diritto di usare una
copia del programma per elaboratore di effettuare una copia di riserva
del programma, qualora tale copia sia necessaria SHUO¶XVR
Chi ha il diritto di usare una copia del programma per elaboratore può,
VHQ]DO¶DXWRUL]]D]LRQHGHOWLWRODUHGHLGLULWWLRVVHUYDUHVWXGLDUHRVRt-
toporre a prova il funzionamento del programma, allo scopo di deter-
Legge 22 aprile 1941, n. 633 371

minare le idee ed i principi su cui è basato ogni elemento del pro-


gramma stesso, qualora egli compia tali atti durante operazioni di ca-
ricamento, visualizzazione, esecuzione, trasmissione o memorizzazio-
ne del programma che egli ha il diritto di eseguire. Le clausole con-
trattuali pattuite in violazione del presente comma e del comma 2 sono
nulle.

Art. 64 quater
/¶DXWRUL]]D]LRQHGHOWLWRODUHGHLGLULWWLQRQqULFKLHVWDTXDORUDODULSUo-
duzione del codice del programma di elaboratore e la traduzione della
VXDIRUPDDLVHQVLGHOO¶DUWLFROR bis, lettere a) e b), compiute al fine
di modificare la forma del codice, siano indispensabili per ottenere le
LQIRUPD]LRQL QHFHVVDULH SHU FRQVHJXLUH O¶LQWHURSHUDELOLWj FRQ DOWUL
programmi, di un programma per elaboratore creato autonomamente
purché siano soddisfatte le seguenti condizioni:
a) le predette attività siano eseguite dal licenziatario o da altri che
abbia il diritto di usare una copia del programma oppure, per lo-
ro conto, da chi è autorizzato a tal fine;
b) le informazioni necessarie per consegXLUHO¶LQWHURSHUDELOLWjQRQ
siano già facilmente e rapidamente accessibili ai soggetti indica-
ti alla lettera a);
c) le predette attività siano limitate alle parti del programma origi-
QDOHQHFHVVDULHSHUFRQVHJXLUHO¶LQWHURSHUDELOLWj
Le disposizioni di cui al comma 1 non consentono che le informazioni
ottenute in virtù della loro applicazione:
a) siano utilizzate a fini diversi dal conseguimento
GHOO¶LQWHURSHUDELOLWjGHOSURJUDPPDFUHDWRDXWRQRPDPHQWH
b) siano comunicate a terzi, fatta salva la necessità di consentire
O¶LQWHURSHUDELOLWjGHOSURJUDPPDFUHDWRDXWRQRPDPHQWH
c) siano utilizzate per lo sviluppo, la produzione o la commercia-
lizzazione di un programma per elaboratore sostanzialmente si-
mile nella sua forma espressiva, o per ogni altra attività che violi
il diritto di autore.
Le clausole contrattuali pattuite in violazione dei commi 1 e 2 sono
nulle.
Conformemente alla convenzione di Berna sulla tutela delle opere let-
terarie ed artistiche ratificata e resa esecutiva con legge 20 giugno
372 Manuale di diritto delle arti e dello spettacolo

1978, n. 399, le disposizioni del presente articolo non possono essere


interpretate in modo da consentire che la loro applicazione arrechi in-
debitamente pregiudizio agli interessi legittimi del titolare dei diritti o
sia in conflitto con il normale sfruttamento del programma.

SEZIONE VII - BANCHE DI DATI

Art. 64 quinquies
/¶DXWRUH di un banca di dati ha il diritto esclusivo di eseguire o auto-
rizzare:
a) la riproduzione permanente o temporanea, totale o parziale, con
qualsiasi mezzo e in qualsiasi forma;
b) la traduzione, O¶DGDWWDPHQWR una diversa disposizione e ogni al-
tra modifica;
c) qualsiasi forma di distribuzione al pubblico GHOO¶RULJLQDOH o di
copie della banca di dati; la prima vendita di una copia nel terri-
torio GHOO¶8QLRQH europea da parte del titolare del diritto o con il
suo consenso esaurisce il diritto di controllare, DOO¶LQWHUQR
GHOO¶8QLRQH stessa, le vendite successive della copia;
d) qualsiasi presentazione, dimostrazione o comunicazione in pub-
blico, ivi compresa la trasmissione effettuata con qualsiasi mez-
zo e in qualsiasi forma;
e) qualsiasi riproduzione, distribuzione, comunicazione, presenta-
zione o dimostrazione in pubblico dei risultati delle operazioni
di cui alla lettera b).

Art. 64 sexies
Non sono soggetti DOO¶DXWRUL]]D]LRQH di cui DOO¶DUWLFROR 64 quinquies
da parte del titolare del diritto:
a) O¶DFFHVVR o la consultazione della banca di dati quando abbiano
esclusivamente finalità didattiche o di ricerca scientifica, non
svolta QHOO¶DPELWR di XQ¶LPSUHVD purché si indichi la fonte e nei
limiti di quanto giustificato dallo scopo non commerciale perse-
guito. 1HOO¶DPELWR di tali attività di accesso e consultazione, le
eventuali operazioni di riproduzione permanente della totalità o
Legge 22 aprile 1941, n. 633 373

di parte sostanziale del contenuto su altro supporto sono comun-


que soggette DOO¶DXWRUL]]D]LRQH del titolare del diritto;
b) O¶LPSLHJR di una banca di dati per fini di sicurezza pubblica o
per effetto di una procedura amministrativa o giurisdizionale.
Non sono soggette DOO¶DXWRUL]]D]LRQH GHOO¶DXWRUH le attività indicate
QHOO¶Drticolo 64 quinquies poste in essere da parte GHOO¶XWHQWH legittimo
della banca di dati o di una sua copia, se tali attività sono necessarie
per O¶DFFHVVR al contenuto della stessa banca di dati e per il suo norma-
le impiego; se O¶XWHQWH legittimo è autorizzato ad utilizzare solo una
parte della banca di dati, il presente comma si applica unicamente a
tale parte.
Le clausole contrattuali pattuite in violazione del comma 2 sono nulle
ai sensi GHOO¶DUWLFROR 1418 del codice civile.
Conformemente alla Convenzione di Berna per la protezione delle
opere letterarie e artistiche, ratificata e resa esecutiva con legge 20
giugno 1978, n. 399, le disposizioni di cui ai commi 1 e 2 non possono
essere interpretate in modo da consentire che la loro applicazione ar-
rechi indebitamente pregiudizio al titolare del diritto o entri in conflit-
to con il normale impiego della banca di dati.

CAPO V - ECCEZIONI E LIMITAZIONI

SEZIONE I - REPROGRAFIA ED ALTRE ECCEZIONI E LIMITAZIONI

Art. 65
Gli articoli di attualità di carattere economico, politico o religioso,
pubblicati nelle riviste o nei giornali, oppure radiodiffusi o messi a di-
sposizione del pubblico, e gli altri materiali dello stesso carattere pos-
sono essere liberamente riprodotti o comunicati al pubblico in altre ri-
viste o giornali, anche radiotelevisivi, se la riproduzione o
O¶XWLOL]]D]LRQH non è stata espressamente riservata, purché si indichino
la fonte da cui sono tratti, la data e il nome GHOO¶DXWRUH se riportato.
La riproduzione o comunicazione al pubblico di opere o materiali pro-
tetti utilizzati in occasione di avvenimenti di attualità è consentita ai
fini GHOO¶HVHUFL]LR del diritto di cronaca e nei limiti dello scopo infor-
374 Manuale di diritto delle arti e dello spettacolo

mativo, sempre che si indichi, salvo caso di impossibilità, la fonte, in-


cluso il nome GHOO¶DXWRUH, se riportato.

Art. 66
I discorsi su argomenti di interesse politico o amministrativo tenuti in
pubbliche assemblee o comunque in pubblico, nonché gli estratti di
conferenze aperte al pubblico, possono essere liberamente riprodotti o
comunicati al pubblico, nei limiti giustificati dallo scopo informativo,
nelle riviste o nei giornali anche radiotelevisivi o telematici, purché
indichino la fonte, il nome GHOO¶DXWRUH la data e il luogo in cui il di-
scorso fu tenuto.

Art. 67
Opere o brani di opere possono essere riprodotti a fini di pubblica si-
curezza, nelle procedure parlamentari, giudiziarie o amministrative,
purché si indichino la fonte e, ove possibile, il nome GHOO¶DXWRUH

Art. 68
È libera la riproduzione di singole opere o brani di opere per uso per-
sonale dei lettori, fatta a mano o con mezzi di riproduzione non idonei
a spaccio o diffusione GHOO¶RSHUD nel pubblico.
È libera la fotocopia di opere esistenti nelle biblioteche accessibili al
pubblico o in quelle scolastiche, nei musei pubblici o negli archivi
pubblici, effettuata dai predetti organismi per i propri servizi, senza
alcun vantaggio economico o commerciale diretto o indiretto.
Fermo restando il divieto di riproduzione di spartiti e partiture musica-
li, è consentita, nei limiti del quindici per cento di ciascun volume o
fascicolo di periodico, escluse le pagine di pubblicità, la riproduzione
per uso personale di opere GHOO¶LQJHJQR effettuata mediante fotocopia,
xerocopia o sistema analogo.
I responsabili dei punti o centri di riproduzione, i quali utilizzino nel
proprio ambito o mettano a disposizione di terzi, anche gratuitamente,
apparecchi per fotocopia, xerocopia o analogo sistema di riproduzio-
ne, devono corrispondere un compenso agli autori ed agli editori delle
opere GHOO¶LQJHJQR pubblicate per le stampe che, mediante tali appa-
recchi, vengono riprodotte per gli usi previsti nel comma 3. La misura
di detto compenso e le modalità per la riscossione e la ripartizione so-
Legge 22 aprile 1941, n. 633 375

no determinate secondo i criteri posti DOO¶DUWLFROR 181 ter della presen-


te legge. Salvo diverso accordo tra la SIAE e le associazione delle ca-
tegorie interessate, tale compenso non può essere inferiore per ciascu-
na pagina riprodotta al prezzo medio a pagina rilevato annualmente
GDOO¶,67$7 per i libri.
Le riproduzioni per uso personale delle opere esistenti nelle bibliote-
che pubbliche, fatte DOO¶LQWHUQR delle stesse con i mezzi di cui al com-
ma 3, possono essere effettuate liberamente nei limiti stabiliti dal me-
desimo comma 3 con corresponsione di un compenso in forma forfe-
taria a favore degli aventi diritto di cui al comma 2 GHOO¶DUWLFROR 181
ter, determinato ai sensi del secondo periodo del comma 1 del mede-
simo articolo 181 ter. Tale compenso è versato direttamente ogni anno
dalle biblioteche, nei limiti degli introiti riscossi per il servizio, senza
oneri aggiuntivi a carico del bilancio dello Stato o degli enti dai quali
le biblioteche dipendono. I limiti di cui al comma 3 non si applicano
alle opere fuori dai cataloghi editoriali e rare in quanto di difficile re-
peribilità sul mercato.
È vietato lo spaccio al pubblico delle copie di cui ai commi precedenti
e, in genere, ogni utilizzazione in concorrenza con i diritti di utilizza-
zione economica spettanti DOO¶DXWRUH

Art. 68 bis
Salvo quanto disposto in ordine alla responsabilità dei prestatori in-
termediari dalla normativa in materia di commercio elettronico, sono
esentati dal diritto di riproduzione gli atti di riproduzione temporanea
privi di rilievo economico proprio che sono transitori o accessori e
parte integrante ed essenziale di un procedimento tecnologico, eseguiti
DOO¶XQLFR scopo di consentire la trasmissione in rete tra terzi con
O¶LQWHUYHQWR di un intermediario, o un utilizzo legittimo di XQ¶RSHUD o
di altri materiali.

Art. 69
Il prestito eseguito dalle biblioteche e discoteche dello Stato e degli
enti pubblici, ai fini esclusivi di promozione culturale e studio perso-
nale, non e soggetto ad autorizzazione da parte del titolare del relativo
diritto e ha ad oggetto esclusivamente:
376 Manuale di diritto delle arti e dello spettacolo

a) gli esemplari a stampa delle opere, eccettuati gli spartiti e le par-


titure musicali;
b) i fonogrammi ed i videogrammi contenenti opere cinematografi-
FKH R DXGLRYLVLYH R VHTXHQ]H G¶LPPDJLQL LQ PRYLPHQWR VLDQR
esse sonore o meno, decorsi almeno diciotto mesi dal primo atto
di esercizio del diritto di distr