Sei sulla pagina 1di 34

C 350 i-Power

(1188930 230V 50Hz - 1188931 220V 60Hz)

I SEGATRICE
Manuale di uso, manutenzione e ricambi
F SCIEUSE
Manuel d'utilisation et d'entretien et pièces de
rechange
GB SAWING MACHINE
Operation, maintenance, spare parts manual
D SÄGEMASCHINE
Handbuch für Bedienung, Wartung und
Ersatzteile
E SIERRA
Manual de uso, mantenimiento y recambios

3231790 R05 - 2017/03

IMER INTERNATIONAL S.p.A.


Via Salceto, 55 - 53036 Poggibonsi (SI) - Italy
Tel. +39 0577 97341 - Fax +39 0577 983304
www.imergroup.com
IMER INTERNATIONAL S.p.A.
C 350 iPower
I
Gentile Cliente, Tabella 2
ci complimentiamo per il suo acquisto: la segatrice IMER, risultato di Caratteristiche elettriche Motore (230V/50Hz) (220V/60Hz)
DQQLGLHVSHULHQ]DqXQDPDFFKLQDGLPDVVLPDDI¿GDELOLWjHGRWDWDGL
Potenza (kW) 2.5
soluzioni tecniche innovative.
Tensione nominale (V) 220/230
Frequenza (Hz) 50/60
- OPERARE IN SICUREZZA Assorbimento (A) 15
(¶IRQGDPHQWDOHDL¿QLGHOODVLFXUH]]DOHJJHUHDWWHQWDPHQWHOHVH-
Numero poli 2
JXHQWLLVWUX]LRQL
2800 (50Hz)
Giri (rpm)
3400 (60 Hz)
Il presente manuale di USO E MANUTENZIONE deve essere custodito
dal responsabile di cantiere nel cantiere stesso, sempre disponibile per Tipo servizio S6 40%
la sua consultazione. Classe isolamento F
Il manuale è da considerarsi parte della macchina e deve essere con- Grado di protezione IP55
VHUYDWR SHU IXWXUL ULIHULPHQWL (1   ¿QR DOOD GLVWUX]LRQH GHOOD Condensatore (µF) 60 (Ø 95x55)
macchina stessa. In caso di danneggiamento o smarrimento potrà es-
sere richiesto al costruttore un nuovo esemplare. 1250(',352*(772
Il manuale contiene importanti indicazioni sulla preparazione del can- La segatrice C 350 iPower è stata progettata e costruita applicando le
tiere, l’installazione, l’uso, le modalità di manutenzione e la richiesta di seguenti norme: UNI EN 12418:2001; EN 12100-1/2:2005; EN 60204-
parti di ricambio della macchina. Comunque è da ritenersi indispensabi- 1:2006.
le una adeguata esperienza e conoscenza della macchina da parte del
PRQWDWRUHHGHOO¶XWLOL]]DWRUH$I¿QFKpVLDSRVVLELOHJDUDQWLUHODVLFXUH]]D /,9(//2(0,66,21(62125$(9,%5$=,21,75$60(66(
dell’operatore, la sicurezza di funzionamento e una lunga durata della In tabella 3 è riportato il livello di pressione sonora misurato all'orecchio
macchina devono essere rispettate le istruzioni del manuale, unitamen- dell'operatore a vuoto (LpA) e delle vibrazioni trasmesse durante il lavoro.
te alle norme di sicurezza e prevenzione degli infortuni sul lavoro secon-
do la legislazione vigente (uso di calzature e abbigliamento adeguati, Tabella 3
uso di elmetti, guanti, occhiali, ecc).
Modello Tipo motore LpA Aeq
0DQWHQHUHVHPSUHOHJJLELOLOHDYYHUWHQ]H C 350 iPOWER Elettrico 86 dB 2.63 m/s2
(¶YLHWDWRDSSRUWDUHPRGL¿FKHGLTXDOVLDVLQDWXUDDOODVWUXWWX-
UDPHWDOOLFDRLPSLDQWLVWLFDGHOODVHJDWULFH '(6&5,=,21(*(1(5$/(6(*$75,&(

IMER INTERNATIONAL declina ogni responsabilità in caso di non os- 'HVFUL]LRQHJHQHUDOH


servanza delle leggi che regolano l’uso di tale macchina, in particolare: La segatrice C 350 iPower è composta da un telaio (Fig.1,Rif.A)
uso improprio, difetti di alimentazione, carenza di manutenzione, mo- sostenuta delle gambe ripieghevoli (Fig.1,Rif.B). La testa di taglio
GL¿FKH QRQ DXWRUL]]DWH LQRVVHUYDQ]D SDU]LDOH R WRWDOH GHOOH LVWUX]LRQL (Fig.1,Rif.C) è montata su un carrello e puo' traslare verticalmente ed
contenute in questo manuale. RUL]]RQWDOPHQHOXQJRXQSUR¿ODWRGLDOOPLQLRDGDOWDULJLGH]]D,OSUR¿ODWR
,0(5,17(51$7,21$/VLULVHUYDLOGLULWWRGLPRGL¿FDUHOHFDUDWWHULVWLFKH di alluminio è imperniato su due bracci (Fig.1,Rif.D) e tutto il gruppo può
della segatrice o i contenuti del presente manuale, senza l’obbligo di UXRWDUHGLƒ ¿J DOOHQWDQGRLYRODQWLQL )LJ5LI$ . La segatrice è
aggiornare la macchina e/o i manuali precedenti. dotata di carter disco (Fig.1,Rif.E) per garantire la massima sicurezza
durante il funzionamento e proteggere l’utilizzatore durante l’operazio-
'$7,7(&1,&, ne di taglio. Sul piano di taglio e' posto il goniometro (Fig.1,Rif.F) per
I dati tecnici sono riportati nella tabella 1 e le caratteristiche elettriche effettuare tagli con angolazioni diverse. Una vasca (Fig.1,Rif.G) in ma-
nella tabella 2. WHULDOHSODVWLFRDQWLXUWRq¿VVDWDVRWWRLOWHODLR/DSRPSDGHOO¶DFTXDDG
immersione (Fig.1,Rif.H) è alloggiata all'interno della vasca ed alimenta
Tabella 1 - DATI TECNICI gli ugelli (Fig.3,Rif.A) montati sul carter per raffreddare il disco duran-
Modello C 350 iPOWER te il suo funzionamento. Sopra il carter disco è montato un rubinetto
(Fig.3,Rif.B) per regolare la portata di acqua al disco di taglio. La mac-
Diametro max disco diamantato 350 mm
china è dotata di un puntatore laser che riproduce la linea di taglio sul
Diametro foro disco diamantato 25,4 mm
pezzo in lavorazione (Fig.3,Rif.C).
Potenza motore monofase 2.5 kW
Regime massimo di rotazione disco 2.036 rpm 0DWHULDOLODYRUDELOL
Dimensioni del piano 1390 x 696 mm I materiali lavorabili da questa macchina sono: ceramiche, materiali la-
Lunghezza di taglio a 90°(sp= 30mm) 1050 mm pidei, marmo, granito, laterizi e pietra, manufatti in cemento e simili con
Profondità massima di taglio disco Ø 350 con le dimensioni massime compatibili con le lunghezze, profondità di taglio
120/250mm H GLPHQVLRQL GHO SLDQR VSHFL¿FDWH QHOOD WDEHOOD  3HVR PDVVLPR GHL
1-2 passate
Portata pompa dell’acqua 10 L/1’ materiali lavorabili 35 kg.
Capacità vasca acqua 40 L
Dimensioni macchina 760 x1746 /H 1535 mm
Dimensioni macchina con imballo 746 x 1770 /H 1080 mm
Peso con imballo 113 (133) Kg
,6758=,21,25,*,1$/,

2
IMER INTERNATIONAL S.p.A.
C 350 iPower
I
',6326,7,9,',6,&85(==$
6,&85(==$23(5$7,9$ La C 350 iPower è stata realizzata tenendo presente le normative in
materia di sicurezza armonizzate a livello europeo.
3ULPDGLXWLOL]]DUHODVHJDWULFHDFFHUWDUVLFKHVLDPXQLWDGL
I dispositivi di sicurezza, secondo la direttiva macchine 2006/42/CE,
WXWWLLGLVSRVLWLYLGLSURWH]LRQH
sono stati allestiti tenendo conto in primo luogo della salvaguardia
  1RQ GHYH HVVHUH XVDWD LQ DPELHQWL RYH HVLVWD SHULFROR GL dell’operatore.
HVSORVLRQLRLQFHQGLR
5LSDULHGLVSRVLWLYLGLVLFXUH]]D
La segatrice non dispone di illuminazione propria e pertanto il luogo di /D PDFFKLQD q SURYYLVWD GL FDUWHU ¿VVL EORFFDWL FRQ YLWL GL VHUUDJJLR H
ODYRURGHYHHVVHUHVXI¿FLHQWHPHQWHLOOXPLQDWR PLQOX[  protezioni che impediscono l’accesso alle parti in movimento e a quelle
Le linee di alimentazione devono essere posate in modo tale da non SHULFRORVH7XWWLLULSDUL¿VVLFRSHUFKLVFKHUPL¿VVDWLSHUPH]]RGLYLWL
poter essere danneggiate. sono stati previsti tali in quanto devono proteggere gli operatori (ma-
L'allacciamento elettrico deve essere tale da impedire la penetrazione nutentori, tecnici ed altri) da eventuali infortuni provocati da scariche
di acqua nei connettori. Impiegare soltanto connettori ed attacchi muniti elettriche e da organi meccanici in movimento.
di protezione contro gli spruzzi d’acqua. Quindi non è consentito l' utilizzo della macchina quando i ripari risulta-
Non utilizzare linee elettriche inadeguate, provvisorie, prive di condutto- QRHVVHUHPRGL¿FDWLRULPRVVLGDOOHORURSRVL]LRQL
re di terra: eventualmente consultarsi con personale specializzato.
  3ULPD GL HIIHWWXDUH RJQL ODYRUR GL PDQXWHQ]LRQH R GL ULSD-
Le riparazioni degli impianti elettrici devono essere eseguite esclusiva-
UD]LRQH VXOOD PDFFKLQD VL GHYH VSHJQHUH OD PDFFKLQD DJHQGR
mente da personale specializzato. Sconnettere la macchina dall' alimen-
VXOO¶LQWHUUXWWRUH JHQHUDOH H GLVLQVHULUH OD VSLQD GL DOLPHQWD]LRQH
tazione prima di eseguire le operazioni di manutenzione o riparazione.
JHQHUDOHLQPRGRGDSUHYHQLUHO
DYYLDPHQWRDFFLGHQWDOHHGLVRODUH
WXWWLLFLUFXLWLHOHWWULFLGHOODPDFFKLQD
$99(57(1=(',6,&85(==$*(1(5$/,
Si ricorda che questa macchina è stata costruita per offrire, oltre alle mi-
,67$//$=,21('(//$0$&&+,1$
gliori prestazioni, la massima sicurezza: tuttavia, è l’operatore che deve
garantire tale sicurezza, ponendo attenzione in ogni fase del lavoro. Si
consiglia all’operatore di: 6WDFFDUHVHPSUHODVSLQDGLDOLPHQWD]LRQHSULPDGLVSRVWDUH
ODPDFFKLQD
$VVLFXUDUVLGHOODYDOLGLWjGHOO¶LPSLDQWRGLPHVVDDWHUUD
6YXRWDUHODYDVFDSULPDGLRJQLVSRVWDPHQWRGHOODPDFFKLQD
/DYRUDUHVRORFRQWXWWHOHSURWH]LRQLDOSURSULRSRVWRHGLQSHU-
IHWWDHI¿FLHQ]D
3LD]]DPHQWR
7RJOLHUHDQHOOLRURORJLEUDFFLDOHWWLHFUDYDWWHGXUDQWHO
XVRGHOOD
La macchina può essere utilizzata appoggiandola su di un piano ampio
PDFFKLQDO¶HVSHULHQ]DLQVHJQDFKHTXHVWLHGDOWULRJJHWWLSRVVRQR
DOPHQRTXDQWRLOWHODLRHVXI¿FHQWHPHQWHUHJRODUHRDSSRJJLDQGRODVXO-
SURYRFDUHLQIRUWXQL,QROWUHVHUUDUHEHQHOHPDQLFKHDWWRUQRDLSRO-
le propie gambe di supporto.
VLWHQHUHUDFFROWLLFDSHOOLHGXWLOL]]DUHFDO]DWXUHUREXVWH
Avere particolare cura per eventuali spostamenti in cantiere, di bloc-
8VDWHVHPSUHLGLVSRVLWLYLSHUVRQDOLGLSURWH]LRQHRFFKLDOLDQ-
care il carrello serrando il pomello (Fig.4,Rif.A) in corrispondenza del
WLQIRUWXQLVWLFLJXDQWLGLGLPHQVLRQLDGDWWHDTXHOOHGHOODPDQRFXI-
IRURSRVWRVRWWRLOSUR¿ODWRGLDOOXPLQLRLa testa puo'essere bloccata
¿H R LQVHUWL DXULFRODUL H FXI¿H SHU LO FRQWHQLPHQWR GHL FDSHOOL VH
in un altro punto ovvero in corrispondenza di un secondo foro che si
QHFHVVDULR
trova nella posizione (Fig.4,Rif.B)
1RQODYRUDUHSH]]LGLJUDQGH]]DRSHVRQRQDGHJXDWDDOOHFDUDW-
Dopo aver tolto l'alimentazione, sollevare la macchina dalle apposite
WHULVWLFKHLPSRVWHGDOODFDVDFRVWUXWWULFHGHOODPDFFKLQD LQGLFDWH
maniglie ricavate sul telaio (Fig.1,Rif.I).
DOSXQWR 
7HQHUHVHPSUHOHPDQLORQWDQHGDOOH]RQHGLODYRUD]LRQHPHQWUH
$SHUWXUDJDPEHGLVXSSRUWR
OD PDFFKLQD q LQ PRYLPHQWR 3ULPD GL HVHJXLUH TXDOVLDVL RSHUD-
]LRQH GL ULPR]LRQH GHL SH]]L YLFLQR DO GLVFR IHUPDWH OD URWD]LRQH Prima di aprire le gambe, bloccare il carrello con il volantino
SUHPHQGRLOSXOVDQWHGLDUUHVWR (Fig.4,Rif.A) nel lato opposto a cui si alza la macchina, in modo da al-
 7HQHUH SXOLWD OD PDFFKLQD OD SXOL]LD JHQHUDOH GL TXHVWD H GHL leggerire il sollevamento.
VXRLSLDQLGLODYRURLQSDUWLFRODUH UDSSUHVHQWDXQLPSRUWDQWHIDW- Per aprire le gambe procedere come descritto: alzare la macchina po-
WRUHGLVLFXUH]]D steriormente (Fig.6,Rif.1) e seguire in ordine i movimenti dei punti 2-3 e
$UUHVWDUHODPDFFKLQDHVFRQQHWWHUHO
DOLPHQWD]LRQHGHOODPDF- 4, dopodiche' appoggiare la macchina a terra. Successivamente prima
FKLQDSULPDGLSURFHGHUHDOODVXDSXOL]LDRSULPDGLWRJOLHUHTXDOVL- di aprire le altre gambe, ricordarsi di spostare la testa e bloccarla nel lato
DVLSURWH]LRQH SHUSURYYHGHUHDOODPDQXWHQ]LRQHRSHUVPRQWDUH opposto in cui si alza la macchina per elleggerire il sollevamento, alzare
TXDOFKH FRPSRQHQWH  6H OD VXD SXOL]LD YLHQH HVHJXLWD PHGLDQWH la macchina anteriormente ed eseguire la stessa procedura di aperura
JHWWLG¶DFTXDQRQLQGLUL]]DWHTXHVWLXOWLPLGLUHWWDPHQWHVXOJUXSSR utilizzata per le gambe posteriori. Per richiudere le gambe, procedere
GLDOLPHQWD]LRQHRVXOPRWRUHHOHWWULFR all'inverso.
 8VDUH GLVFKL GLDPDQWDWL RULJLQDOL UDFFRPDQGDWL GDOOD FDVD FR-
VWUXWWULFHVHYROHWHRWWHQHUHGDOODYRVWUDPDFFKLQDOHPLJOLRULSUH- 6ROOHYDPHQWRHPRYLPHQWD]LRQH
VWD]LRQL La segatrice C 350 iPower pesa 113 Kg e può essere trasportata
8VDUHHVFOXVLYDPHQWHGLVFKLUHIULJHUDWLDGDFTXDHGHOWLSRDGH- manualmente per mezzo delle maniglie ricavate nel telaio sollevando-
JXDWRDOPDWHULDOHGDWDJOLDUH la da un solo lato effettuando lo spotamento con l'ausilio delle ruote
1RQHIIHWWXDUHWDJOLRGLPDWHULDOHDVHFFRRFRQXQDSRUWDWDGL (Fig.5,Rif.A), o in alternativa con un elevatore agganciandola con delle
DFTXDGLUHIULJHUD]LRQHVFDUVD funi negli appositi punti indicati (Fig.5). Le ruote facilitano le manovre di
1RQXVDUHPDLGLVFKLROWUHLOOLPLWHGLYHORFLWjLQGLFDWRGDOFR- caricamento della macchina su un mezzo attraverso una pedana.
VWUXWWRUH
1RQXWLOL]]DUHDQHOOLGLULGX]LRQHSHUDGDWWDUHLOIRURGHOGLVFR $//$&&,$0(172(/(775,&2
VXOOD ÀDQJLD ,PSLHJDUH VROR GLVFKL FRQ IRUR FRUULVSRQGHQWH DOOD   9HUL¿FDUH FKH OD WHQVLRQH ULVXOWL FRQIRUPH DL GDWL GL WDUJD
ÀDQJLDLQGRWD]LRQHFRQODPDFFKLQD   GHOODPDFFKLQD
1RQLPSLHJDUHPDLGLVFKLGLDPDQWDWLFKHSUHVHQWLQRFULFFKHR
GHIRUPDWL La linea di alimentazione elettrica deve essere provvista di protezione
/HLVWUX]LRQLFRQWHQXWHLQTXHVWRPDQXDOHVRQRGHVWLQDWHDJOL contro le sovracorrenti (es. con un interruttore magnetotermico) e contro
XWLOL]]DWRUL RSHUDWRULPDQXWHQWRUL  i contatti indiretti (es. con un interruttore tipo differenziale). Collegare
la macchina all'impianto di terra. Il dimensionamento dei conduttori del
cavo di alimentazione elettrica deve tener conto delle correnti di funzio-
namento e della lunghezza della linea per evitare eccessive cadute di
tensione (Tabella 4 Pag.4).

3
IMER INTERNATIONAL S.p.A.
C 350 iPower
I
Tabella 4  ,O SXQWDWRUH LPSLHJD XQ HPHWWLWRUH GL OXFH ODVHU D EDVVD
Sezione cavo (mm²) SRWHQ]DPDqFRPXQTXHFRQVLJOLDELOHHYLWDUHGLJXDUGDUHLQPRGR
Modello Tipo di motore
1.5 2.5 4.0 GLUHWWRO¶HPHWWLWRUHVWHVVR

Lunghezza
0$187(1=,21(

cavo (m)
220-230 V
C 350 iPOWER 0 ÷ 22 23 ÷ 26 28 ÷ 43
13.5 A
3UHPHVVD
Le normali operazioni di manutenzione ordinaria sono effettuabili an-
che da personale non specializzato sempre che siano tenute presenti
Collegare l'alimentazione alla spina della segatrice, avvitando la ghiera
OHLQGLFD]LRQLGLVLFXUH]]DHOHQFDWHQHLSDUDJUD¿SUHFHGHQWLHLQTXHOOL
di ritegno meccanico con grado di protezione IP67.
successivi.
La segatrice è così pronta per poter lavorare. ***
3XOL]LDGHOODPDFFKLQD
0(66$,10$5&,$6(*$75,&(
La pulizia della macchina è un operazione da eseguire sempre a mac-
Collegare il cavo di alimentazione elettrica alla spina del quadro elettri-
china ferma.
co. Avviare quindi la segatrice mediante l’interruttore integrato nel qua-
dro elettrico (Fig.3,Rif.D) posto sopra il motore, composto da due tasti: *OLLQWHUUXWWRULGHOO¶HQHUJLDHOHWWULFDGHYRQRHVVHUHLQ
verde per l'avviamento, rosso per l'arresto. SRVL]LRQH³´HOHSUHVHGLVLQVHULWHGDOODUHWHHOHWWULFD
L’interruttore è dotato di protezione di minima tensione: nei casi in cui
VL VLD YHUL¿FDWD XQD PDQFDQ]D G
DOLPHQWD]LRQH SHU FDXVH DFFLGHQWDOL 1. Non usare aria compressa: questa spingerebbe le polveri ed i residui
occorre ripremere il pulsante d'avviamento verde. negli angoli più nascosti.
In caso di emergenza arrestare la macchina premendo sul pulsante di 9HUL¿FDUHFKHJOLXJHOOLGHOODUHIULJHUD]LRQHQRQVLDQRRVWUXLWL
arresto di colore rosso (sporgente), quindi staccare la presa di alimen- 3. Si raccomanda soprattutto, ogni giorno, di cambiare l’acqua per il
tazione elettrica. raffreddamento contenuta nella vasca.
6LUDFFRPDQGDGLQRQXWLOL]]DUHGHWHUJHQWLROXEUL¿FDQWL
3527(=,21(7(50,&$
3XOL]LDGHOODYDVFDVHUEDWRLR
,OPRWRUHHOHWWULFRqSURWHWWRGDLVRYUDFFDULFKLGDXQDVRQGD
Pulire la vasca serbatoio ogni volta che i sedimenti si posano sul fondo,
WHUPLFDLQFDVRGLVXUULVFDOGDPHQWRVLDUUHVWD)DUUDIIUHGGDUHLO
o almeno una volta al giorno, la mancata pulizia della vasca potrebbe
PRWRUHHGDYYLDUHGLQXRYRDJHQGRVXOO
LQWHUUXWWRUH
dare problemi alla pompa ad immersione che mette in circolo l’acqua
per il raffreddamento del disco diamantato.
87,/,==2'(//$0$&&+,1$
Per pulire la vasca togliere il tappo e sciacquare con getto d’acqua diret-
to facendo attenzione alle parti elettriche.
)XQ]LRQDPHQWR
,OODWRFRUUHWWRGLODYRURSHUO¶RSHUDWRUHqLQGLFDWRQHOOD¿JULI;
3XOL]LDGHOFLUFXLWRDOLPHQWD]LRQHDFTXDGLUHIULJHUD]LRQH
Riempire la vasca di acqua sino al massimo della sua capienza (circa
Effettuare periodicamente (o quando la portata dell'acqua di refrigera-
40 litri). Collegare la macchina all’alimentazione elettrica e metterla in
zione del disco diamantato diminuisce) la pulizia del circuito di alimen-
marcia come descritto nel paragrafo 10.
WD]LRQHGHOÀXLGRUHIULJHUDQWHVPRQWDQGRHSXOHQGRFRQDFTXDgli ugelli
$SULUHLOUXELQHWWR )LJ5LI% HYHUL¿FDUHFKHFLVLDXQ
DEERQGDQWHÀXV-
di distribuzione (Fig.3,Rif.A) situati dentro il carter di protezione disco.
so di acqua di refrigerazione sul disco diamantato.
Effettuare periodicamente la pulizia in acqua della tubazione di alimen-
tazione acqua refrigerante dalla pompa al rubinetto al carter di prote-
7DJOLR
zione disco.
6SRVWDUH LO JUXSSR WHVWD YHUVR OD SDUWH RSSRVWD GHOO
RSHUDWRUH ¿QR D
battura, dopodiche' appoggiare il materiale da tagliare (Fig.7,Rif.A) sul
6RVWLWX]LRQHGHOGLVFR
piano accostandolo alla battuta. In caso di taglio inclinato, determinare
l’angolazione desiderata mediante il goniometro o tramite il puntatore 6WDFFDUHVHPSUHODVSLQDGLDOLPHQWD]LRQHSULPDGLVRVWLWXLUH
laser. Per regolare l’altezza della testa di taglio allentare il volantino LOGLVFR
(Fig.7,Rif.B), posizionare la testa all'altezza voluta e stringere a fondo Il disco diamantato è realizzato in materiale che può essere danneggia-
il volantino. Avviare la segatrice come descritto nel paragrafo 10 e per to con la temperatura e deve essere raffreddato con acqua durante la
mezzo della maniglia (Fig.7,Rif.C) far scorrere il carrello per eseguire il fase di lavoro.
taglio. Una velocità di avanzamento eccessiva rispetto allo spessore e Per la sostituzione del disco bisogna seguire la seguente procedura:
alla durezza del materiale può provocare un arresto della rotazione della 1. Bloccare lo scorrimento verticale del gruppo testa di taglio serrando
lama. In questo caso liberare il disco nel più breve tempo possibile tor- il volantino (Fig.1,Rif.D).
nando in dietro con il carrello per allontanare LOGLVFR¿QFKH
TXHVWR non 2. Smontare il carter anteriore di protezione (Fig.1,Rif.E).
abbia recuperato il regime di rotazione nominale. Riprendere il taglio $OOHQWDUHLOGDGRGLEORFFDJJLRUXRWDQGRORLQVHQVRRUDULR ¿OHWWDWXUD
adeguando la velocità di avanzamento alle caratteristiche del materiale. sinistra), utilizzando la chiave da 32 mm in dotazione con la macchina.
  0DQWHQHUH OD YDVFD SLHQD GL DFTXD GXUDQWH OH IDVL GL ODYR- 4. Estrarre il disco eseguendo prima un movimento di traslazione e poi
URHVRVWLWXLUODULSXOHQGRODYDVFDGDLVHGLPHQWLLQFDVRGLODYRUR FRQXQDOLHYHLQFOLQD]LRQHV¿ODUHLOGLVFRGDOODVHGHGLODYRUR
SUROXQJDWR 9HUL¿FDUHFKHQRQFLVLDQRFRUSLHVWUDQHLIUDOHÀDQJLHGLVHUUDJJLRHG
il disco diamantato. Non utilizzare per lo smontaggio o la pulizia utensili
7DJOLRLQFOLQDWR FKHSRWUHEEHURDPPDFFDUHRPRGL¿FDUHODJHRPHWULDGHOODÀDQJLD
$OOHQWDUHLYRODQWLQL(Fig.7,Rif.D)LQFOLQDUHODWHVWDGLWDJOLRHVHUUDUH 6. Inserire il nuovo disco eseguendo l’operazione inversa descritta al
QXRYDPHQWHLYRODQWLQLTXLQGLSURFHGHUHFRPHLQGLFDWRDOSXQWR punto 4. Prestando particolare attenzione al senso di rotazione del disco
SUHFHGHQWH diamantato.
 %ORFFDUH FRUUHWWDPHQWH LO GDGR GL ¿VVDJJLR GHO GLVFR UXRWDQGROR LQ
3XQWDWRUHODVHU VHQVRDQWLRUDULR ¿OHWWDWXUDVLQLVWUD JDUDQWHQGRXQDFRSSLDGL1P
La macchina è dotata di un puntatore laser che riproduce la linea di
taglio sul pezzo in lavorazione. La traccia di luce indica la traiettoria del 6RVWLWX]LRQHFLQJKLDGLWUDVPLVVLRQH
disco diamantato durante il moto di avanzamento. Facendo coincidere La macchina e' dotata di una speciale cinghia pretensionata a lunga
la tracciatura del taglio desiderato con la traccia laser, è possibile ga- durata. Per la sostituzione rivolgersi a un centro assistenza autorizzato.
rantire la massima precisione dell’operazione. Tagli perpendicolari ad
un lato del pezzo in lavorazione non richiedono tracciature preventive: 5HJROD]LRQHJLRFRFDUUHOOR
LQIDWWLqVXI¿FLHQWHDVVLFXUDUVLFKHLOODWRGLULIHULPHQWRVLDLQFRQWDWWR ,O FDUUHOOR VFRUUH OXQJR LO SUR¿OR GL DOOXPLQLR SHU PH]]R GL UXOOL FRQ LO
con la battuta sul piano di appoggio. Analogamente, mediante l’uso del WHPSRH
VRWWRSRVWRDSUHQGHUHGHOJLRFRLQÀXHQGRFRVL
QHOODSUHFLVLRQH
goniometro, si possono effettuare tagli ad inclinazioni predeterminate. del taglio. Per la regolazione dei rulli,rivolgersi a un centro assistenza
La luce laser indicherà la posizione effettiva del taglio. Il puntatore laser autorizzato.
si attiva e si disattiva per mezzo dell'interruttore (Fig.3,Rif.E).
Il puntatore è allineato con il disco e non deve essere spostato dalla
posizione iniziale.

4
IMER INTERNATIONAL S.p.A.
C 350 iPower
I
5LSDUD]LRQL ,1&219(1,(17,&$86(5,0(',
Le riparazioni negli impianti elettrici devono essere eseguite esclusiva-
$77(1=,21(7XWWLJOLLQWHUYHQWLGLPDQXWHQ]LRQHGHYRQR
mente da personale specializzato. I ricambi da utilizzare devono essere
HVVHUHHVHJXLWLGRSRDYHUIHUPDWRODPDFFKLQDHVWDFFDWRODSUHVD
HVFOXVLYDPHQWHULFDPELRULJLQDOL,0(5HQRQSRVVRQRHVVHUHPRGL¿FDWL
GLDOLPHQWD]LRQH
Per la particolare struttura della C 350 iPower non si presentano altre
manutenzioni oltre quelle già elencate. Controllare che i contatti della
VSLQDHGHOJUXSSRVSLQDLQWHUUXWWRUHVLDQRHI¿FLHQWL6HVRQRRVVLGDWL Inconvenienti Cause Rimedi
occorre pulirli immediatamente. Non arriva tensione Controllare la linea *
alla linea di
,QFDVRGLLQWHUYHQWRGHOO
LQWHUUXWWRUHGLIIHUHQ]LDOHIDUHVHJXL- alimentazione
UHLOFRQWUROORGHOODPDFFKLQDHO
HYHQWXDOHULSDUD]LRQHHVFOXVLYD- La presa e la spina Ripristinare il corretto
PHQWHGDSHUVRQDOHVSHFLDOL]]DWR elettrica non sono ben collegamento
collegate
6PDOWLPHQWRGHLPDWHULDOLGLUL¿XWR L'interruttore del Azionare il pulsante ON
3HUORVPDOWLPHQWRGHLPDWHULDOLGLUL¿XWRGHULYDQWLGDOO¶XVRGHOOD differenziale non è del differenziale
macchina, si raccomanda di osservare le vigenti leggi in materia. stato azionato
Premendo Il cavo di Sostituire il cavo *
l’interruttore di alimentazione dalla
5,6&+,5(6,'8,(6(*1$/,',6,&85(==$ marcia, il motore non spina al quadro è
parte interrotto
%HQFKpODVHJDWULFHVLDVWDWDFRVWUXLWDQHOSLHQRULVSHWWRGHOODQRUPDWLYD
vigente, sussistono dei rischi residui ineliminabili che comportano l'uso 8Q¿ORHOHWWULFR Ripristinare il
all’interno della collegamenro *
di opportuni dispositivi di protezione individuale. Una adeguata segna-
morsettiera motore è
letica montata sulla macchina individua sia i rischi che i comportamenti interrotto
da seguire.
8Q¿ORHOHWWULFR Ripristinare il
all’interno del quadro collegamenro *
RISCHIO RUMORE è interrotto
L’interruttore di marcia Sostituire l’interruttore *
2EEOLJRGLSURWHJJHUHO
XGLWR è guasto
Manca acqua nella Ripristinare il livello di
vasca acqua
5,6&+,2',/(6,21,$//(0$1, Non arriva acqua di Filtro pompa otturato 3XOLUH¿OWURSRPSD
refrigerazione alla Non arriva corrente 9HUL¿FDUH
lama alla pompa alimentazione elettrica
2EEOLJRGLLQGRVVDUHLJXDQWL
della pompa *
Pompa guasta Sostituire pompa *
5,6&+,2',/(6,21($*/,2&&+, Lama montata al Smontare la lama e
contrario rispetto al riposizionarla nel senso
La lama non taglia senso di rotazione indicato nell’etichetta
2EEOLJRGLSURWHJJHUHJOLRFFKL della lama
Lama usurata Sostituire la lama
* Operazione a cura di un tecnico elettricista
5,6&+,2',862$120$/2

2EEOLJRGLOHJJHUHLOPDQXDOHSULPDGHOO
XVR

2EEOLJRGLWDJOLRFRQDFTXD

3(5,&2/2',7$*/,2

3(5,&2/2',(/(7752&8=,21(

3(5,&2/25$**,2/$6(5

Si ricorda che il controllo sull'uso dei DPI è demandato al datore di la-


voro.

5
IMER INTERNATIONAL S.p.A.
C 350 iPower
F
Cher Client, Tableau 2
nous vous remercions d'avoir acheté une scieuse IMER qui est le fruit Caractéristiques électriques Moteur (230V/50Hz) (220V/60Hz)
GH QRPEUHXVHV DQQpHV G
H[SpULHQFH GDQV OH VHFWHXU GHV PDFKLQHV
Puissance (kW) 2,5
RXWLOV*UkFHjO
DGRSWLRQGHVVROXWLRQVWHFKQLTXHVOHVSOXVPRGHUQHV
HWOHVSOXVV€UHVFHWWHVFLHJDUDQWLWXQH¿DELOLWpjWRXWHpSUHXYHHWXQH Tension nominale (V) 220/230
HI¿FDFLWpHWXQHVpFXULWpG
XWLOLVDWLRQPD[LPDOHV )UpTXHQFH +] 50/60
Consommation (A) 15
Nombre de pôles 2
75$9$,//(5(17287(6e&85,7e
/LUH DWWHQWLYHPHQW OHV LQVWUXFWLRQV VXLYDQWHV SRXU WUDYDLOOHU HQ 2800 (50Hz)
Vitesse de rotation (tr/min)
3400 (60Hz)
WRXWHVpFXULWpHWDYHFSUpFLVLRQ
Type de service S6 40%
/HSUpVHQWPDQXHOG
87,/,6$7,21(7'
(175(7,(1GRLWrWUHFRQVHUYp Classe d'isolation F
SDUOHUHVSRQVDEOHGXFKDQWLHUHWVXUOHFKDQWLHUPrPHSRXUSRXYRLU 'HJUpGHSURWHFWLRQ IP55
WRXMRXUVrWUHFRQVXOWp Condensateur (µF) 60 (Ø 95x55)
,O GRLW rWUH FRQVLGpUp FRPPH SDUWLH LQWpJUDQWH GH OD PDFKLQH HW GRLW
rWUH FRQVHUYp SRXU WRXWH FRQVXOWDWLRQ IXWXUH (1   MXVTX
j OD 1250(6'()$%5,&$7,21
GHVWUXFWLRQGHODPDFKLQHHOOHPrPH(QFDVG
HQGRPPDJHPHQWRXGH La scieuse C 350 iPower D pWp FRQoXH HW UpDOLVpH HQ DSSOLTXDQW
SHUWHXQQRXYHOH[HPSODLUHSRXUUDrWUHGHPDQGpDXIDEULFDQW les normes suivantes : UNI EN 12418:2001; EN 12100-1/2:2005;
/H PDQXHO FRQWLHQW G
LPSRUWDQWHV LQGLFDWLRQV VXU OD SUpSDUDWLRQ GX EN 60204-1:2006.
FKDQWLHU O¶LQVWDOODWLRQ O¶XWLOLVDWLRQ OHV PRGDOLWpV G
HQWUHWLHQ HW OD
demande de pièces de rechange de la machine En tout cas, il est 1,9($8'
e0,66,2162125((79,%5$7,21675$160,6(6
LQGLVSHQVDEOHTXHO
LQVWDOODWHXUHWO
XWLOLVDWHXUGLVSRVHQWGHO
H[SpULHQFH /HWDEOHDXLQGLTXHOHQLYHDXGHSUHVVLRQDFRXVWLTXHPHVXUpjYLGH
HWGHVFRQQDLVVDQFHVQpFHVVDLUHVFRQFHUQDQWOHVFRQGLWLRQVG
XWLOLVDWLRQ j KDXWHXU GH O
RUHLOOH GH O
RSpUDWHXU /pA) et les vibrations transmises
HWO
HQWUHWLHQGHODPDFKLQH$¿QGHJDUDQWLUODVpFXULWpGHO
RSpUDWHXU pendant le fonctionnement.
OD VpFXULWp GH IRQFWLRQQHPHQW HW OD ORQJpYLWp GH OD PDFKLQH LO IDXW
UHVSHFWHUOHVLQVWUXFWLRQVFRQWHQXHVGDQVOHSUpVHQWPDQXHODLQVLTXH Tableau 3
OHV UqJOHV GH EDVH GH OD VpFXULWp HW GH SUpYHQWLRQ GHV DFFLGHQWV GX
Modèle Type moteur LpA Aeq
WUDYDLOVHORQODUpJOHPHQWDWLRQHQYLJXHXU SRUWG
(3,DSSURSULpV 
C 350 iPower Électrique 86 dB 2,63 m/s2
/HVDYHUWLVVHPHQWVGRLYHQWWRXMRXUVrWUHOLVLEOHV
,OHVWLQWHUGLWG
HIIHFWXHUGHVPRGL¿FDWLRQVRXDGDSWDWLRQVGH '(6&5,37,21*e1e5$/('(/$6&,(86(
ODVWUXFWXUHPpWDOOLTXHRXGHVV\VWqPHVGHODVFLHXVHGHTXHOTXH
QDWXUHTXHFHVRLW 'HVFULSWLRQJpQpUDOH
La scieuse C 350 iPower se compose d'un châssis (Fig.1, Rep.A)
,0(5 ,17(51$7,21$/ GpFOLQH WRXWH UHVSRQVDELOLWp HQ FDV GH PRQWpVXUGHVSLqWHPHQWVUHSOLDEOHV DXVVLDSSHOpSLHGVVXSSRUWV  )LJ
PDQTXHPHQWV DX[ ORLV TXL UpJOHPHQWHQW O
HPSORL GH FHWWH PDFKLQH j Rep.B). /DWrWHGHFRXSH )LJ5HS& HVWPRQWpHVXUXQFKDULRWHWVH
VDYRLUXWLOLVDWLRQLPSURSUHGpIDXWVG
DOLPHQWDWLRQPDQTXHG
HQWUHWLHQ PHXWYHUWLFDOHPHQWHWKRUL]RQWDOHPHQWVXUXQSUR¿OG
DOXPLQLXPjKDXWH
PRGL¿FDWLRQV QRQ DXWRULVpHV LQREVHUYDWLRQ SDUWLHOOH RX WRWDOH GHV ULJLGLWp/HSUR¿OpG
DOXPLQLXPHVWDUWLFXOpVXUGHX[EUDV )LJ5HS' HW
instructions contenues dans ce manuel. tout le groupe peut ainsi pivoter de 45° (Fig.2) en desserrant les volants
,0(5 ,17(51$7,21$/ VH UpVHUYH OH GURLW GH PRGL¿HU OHV (Fig.2,Rep.A). La scieuse est munie d'un carter de disque (Fig.1, Rep.E)
FDUDFWpULVWLTXHV GH OD VFLHXVH RX OHV FRQWHQXV GH FH PDQXHO VDQV SRXUJDUDQWLUOHSOXVKDXWQLYHDXGHVpFXULWpSHQGDQWOHIRQFWLRQQHPHQW
V
HQJDJHUjPHWWUHjMRXUODPDFKLQHHWRXOHVPDQXHOVSUpFpGHQWV HW SURWpJHU O¶XWLOLVDWHXU SHQGDQW O
RSpUDWLRQ GH FRXSH Sur la table de
FRXSHHVWPRQWpOHJRQLRPqWUHLe chariot (Fig.1, Rep.F) recevant les
&$5$&7e5,67,48(67(&+1,48(6 PDWpULDX[jFRXSHUVHGpSODFHVXUOHVJXLGHVGXFKkVVLV/HJRQLRPqWUH
/HVFDUDFWpULVWLTXHVWHFKQLTXHVVRQWLQGLTXpHVGDQVOH7DEOHDXHWOHV )LJ 5HS*  PRQWp VXU FHOXLFL SHUPHW GHV FRXSHV j GLIIpUHQWV
FDUDFWpULVWLTXHVpOHFWULTXHVGDQVOH7DEOHDX DQJOHV8QHFXYH )LJ5HS+ HQSODVWLTXHDQWLFKRFHVW¿[pHVRXVOH
FKkVVLV/DSRPSHjHDX )LJ5HS, LPPHUJpHGDQVODFXYHDOLPHQWH
Tableau 1 - CARACTÉRISTIQUES TECHNIQUES les buses (Fig.3,Rep.A  PRQWpHV VXU OH FDUWHU SRXU OH UHIURLGLVVHPHQW
Modèle C 350 iPower GX GLVTXH SHQGDQW VRQ IRQFWLRQQHPHQW 0RQWp DXGHVVXV GX FDUWHU
de disque, un robinet (Fig.3,Rep.C  SHUPHW GH UpJOHU OH GpELW GH O
HDX
Diamètre maxi disque 350 mm
fournie au disque de coupe. /DPDFKLQHHVWpTXLSpHG
XQWUDFHXUODVHU
'LDPqWUHWURXGLVTXHGLDPDQWp 25,4 mm
qui reproduit le trait de scie sur la pièce à scier (Fig.3, Rep.C).
3XLVVDQFHPRWHXUPRQRSKDVp 2,5 kW
5pJLPHPD[LGHURWDWLRQGXGLVTXH 2036 tr/min 0DWpULDX[XVLQDEOHV
Dimensions du plateau 1390 x 696 mm /HVPDWpULDX[XVLQDEOHVDYHFFHWWHPDFKLQHVRQWFpUDPLTXHPDWpULDX[
/RQJXHXUGHFRXSHjƒ pS PP 1050 mm pierreux, marbre, granit, briques et pierre SURGXLWV PDQXIDFWXUpV HQ
Profondeur maxi de coupe disque Ø 350 avec EpWRQHWVLPLODLUHVD\DQWGHVGLPHQVLRQVPD[LPDOHVFRPSDWLEOHVDYHF
120/250mm les longueurs, les profondeurs de coupe et les dimensions du plan
1-2 passes
INSTRUCTIONS ORIGINALES

'pELWSRPSHjHDX 10 L/1’ LQGLTXpHVGDQVOH7DEOHDX3RLGVPD[LPDOGHVPDWpULDX[XVLQDEOHV


Contenance de la cuve d'eau 40 L 35 kg.
Dimensions de la machine 760 x1746 /H 1535 mm
'LPHQVLRQVGHODPDFKLQHHPEDOOpH 746 x 1770 /H 1080 mm
3RLGVGHODPDFKLQHHPEDOOpH 113 (133) kg

6
IMER INTERNATIONAL S.p.A.
C 350 iPower
F
6e&85,7e'875$9$,/ ',6326,7,)6'(6e&85,7e
La scieuse C 350 iPowerDpWpUpDOLVpHFRQIRUPpPHQWDX[QRUPHV
  $YDQW G
XWLOLVHU OD VFLHXVH V
DVVXUHU TX
HOOH HVW PXQLH GH
HXURSpHQQHVKDUPRQLVpHVHQPDWLqUHGHVpFXULWp
WRXVOHVGLVSRVLWLIVGHSURWHFWLRQ
/HV GLVSRVLWLIV GH VpFXULWp VHORQ OD GLUHFWLYH 0DFKLQHV &((
(OOHQHGRLWSDVrWUHXWLOLVpHGDQVGHVOLHX[SUpVHQWDQWGHV RQW pWp SUpYXV HQ WHQDQW FRPSWH HQ SUHPLHU OLHX GH OD VpFXULWp GH
ULVTXHVG
H[SORVLRQVRXG
LQFHQGLH O¶RSpUDWHXU

/DVFLHXVHQHGLVSRVDQWSDVGHVRQSURSUHV\VWqPHG
pFODLUDJHOHOLHX 3URWHFWHXUVHWGLVSRVLWLIVGHVpFXULWp
GHWUDYDLOGRLWrWUHVXI¿VDPPHQWELHQpFODLUp OX[PLQLPXP  /D PDFKLQH HVW PXQLH GH FDUWHUV ¿[HV HW EORTXpV DYHF GHV YLV GH
/HVOLJQHVG
DOLPHQWDWLRQGRLYHQWrWUHSRVpHVGHIDoRQjQHSDVSRXYRLU VHUUDJHHWGHSURWHFWLRQVTXLHPSrFKHQWO
DFFqVDX[SDUWLHVPRELOHVHW
rWUHHQGRPPDJpHV jFHOOHVTXLVRQWGDQJHUHXVHV7RXVOHVSURWHFWHXUV¿[HVOHVFRXYHUFOHV
/HEUDQFKHPHQWpOHFWULTXHGRLWrWUHUpDOLVpGHIDoRQjHPSrFKHUO
HDX HW OHV pFUDQV ¿[pV DYHF GHV YLV RQW pWp DGRSWpV GH IDoRQ j SURWpJHU
GHSpQpWUHUGDQVOHVFRQQHFWHXUV1
XWLOLVHUTXHGHVFRQQHFWHXUVHWGHV OHVRSpUDWHXUV SUpSRVpVjO
HQWUHWLHQWHFKQLFLHQVHWDXWUHV FRQWUHOHV
prises munis de systèmes de protection contre les projections d’eau pYHQWXHOVDFFLGHQWVGXVjGHVGpFKDUJHVpOHFWULTXHVRXjGHVSLqFHV
1H SDV XWLOLVHU GH OLJQHV pOHFWULTXHV LQDSSURSULpHV SURYLVRLUHV PpFDQLTXHVPRELOHV
GpPXQLHV GH FRQGXFWHXU GH WHUUH &RQVXOWHU pYHQWXHOOHPHQW XQ Il n'est donc pas permis d'utiliser la machine lorsque les protecteurs sont
SURIHVVLRQQHOTXDOL¿p PRGL¿pVRXUHWLUpVGHOHXUSRVLWLRQFRUUHFWH
/HV UpSDUDWLRQV GHV V\VWqPHV pOHFWULTXHV GRLYHQW rWUH H[pFXWpHV
$YDQWG
HIIHFWXHUWRXWHRSpUDWLRQG
HQWUHWLHQRXGHUpSDUDWLRQ
H[FOXVLYHPHQW SDU GX SHUVRQQHO TXDOL¿p 6pSDUHU OD PDFKLQH GH VD
TXHOOHTX
HOOHVRLWVXUODPDFKLQHpWHLQGUHODPDFKLQHHQDJLVVDQW
VRXUFH G
DOLPHQWDWLRQ HQ pQHUJLH pOHFWULTXH DYDQW G
HIIHFWXHU GHV
VXU O
LQWHUUXSWHXU JpQpUDO HW FRXSHU O
DOLPHQWDWLRQ JpQpUDOH GH
RSpUDWLRQVG
HQWUHWLHQRXGHVUpSDUDWLRQV
IDoRQ j HPSrFKHU WRXWH PLVH HQ PDUFKH DFFLGHQWHOOH HW j LVROHU
WRXVOHVFLUFXLWVpOHFWULTXHVGHODPDFKLQH
35e&$87,216*e1e5$/(6'(6e&85,7e
1RWHU TXH FHWWH PDFKLQH D pWp FRQVWUXLWH SRXU RIIULU QRQ VHXOHPHQW
,167$//$7,21'(/$0$&+,1(
GH KDXWHV SHUIRUPDQFHV PDLV DXVVL XQH VpFXULWp GH IRQFWLRQQHPHQW
PD[LPDOH7RXWHIRLVLOLQFRPEHjO
RSpUDWHXUGHJDUDQWLUFHWWHVpFXULWp
HQ SURFpGDQW DYHF DWWHQWLRQ GDQV FKDTXH SKDVH GX WUDYDLO ,O HVW   7RXMRXUV FRXSHU O
DOLPHQWDWLRQ pOHFWULTXH GH OD PDFKLQH
FRQVHLOOpjO¶RSpUDWHXUGHUHVSHFWHUOHVSRLQWVVXLYDQWV DYDQWGHODGpSODFHU
- 9LGHUODFXYHDYDQWGHGpSODFHUODPDFKLQH
6
DVVXUHUTXHOHV\VWqPHGHPLVHjODWHUUHHVWHI¿FDFH
 1H WUDYDLOOHU TXH VL WRXWHV OHV SURWHFWLRQV VRQW HQ SODFH HW
3RVLWLRQQHPHQW
TX
HOOHVVRQWSDUIDLWHPHQWHI¿FDFHV
/DPDFKLQHSHXWrWUHXWLOLVpHHQODSRVDQWVXUXQSODQDXPRLQVDXVVL
1HSDVSRUWHUGHEDJXHVGHPRQWUHVGHEUDFHOHWVRXGHFUDYDWHV
ODUJHTXHODFXYHHWVXI¿VDPPHQWUpJXOLHURXVXUVHVSLqWHPHQWV
SHQGDQW OH IRQFWLRQQHPHQW GH OD PDFKLQH (Q HIIHW O
H[SpULHQFH
/RUVGHVGpSODFHPHQWVpYHQWXHOVVXUFKDQWLHUYHLOOHUjEORTXHUOH
HQVHLJQH TXH FHV GHUQLHUV DLQVL TXH G
DXWUHV REMHWV SHXYHQW
chariot en serrant le bouton à lobes (Fig.4,Rep.A) au niveau du trou
SURYRTXHU GHV DFFLGHQWV (Q RXWUH ELHQ VHUUHU OHV PDQFKHV DX[
SHUFpVRXVOHSUR¿OpG
DOXPLQLXP/DWrWHGHFRXSHSHXWrWUH EOR-
SRLJQHWVQRXHUOHVFKHYHX[HWSRUWHUGHVFKDXVVXUHVUREXVWHV
TXpHGDQVXQGHX[LqPHWURXSRVLWLRQQp )LJ5HS% 
 8WLOLVHU WRXMRXUV GHV (3, DSSURSULpV  OXQHWWHV GH SURWHFWLRQ
6RXOHYHUODPDFKLQHHQXWLOLVDQWOHVSRLJQpHVDSSURSULpHVUpDOLVpHV
JDQWVGHWDLOOHDGpTXDWHFDVTXHVRXWDPSRQVDXULFXODLUHVHW¿OHWV
dans le châssis (Fig.1, Rep.I) DSUqV DYRLU FRXSp O
DOLPHQWDWLRQ
RXFDVTXHVSRXUUHWHQLUOHVFKHYHX[VLEHVRLQHVW
pOHFWULTXHGHODPDFKLQH
 1H SDV XVLQHU GHV SLqFHV G
XQH JUDQGHXU RX G
XQ SRLGV
LQDSSURSULp DX[ FDUDFWpULVWLTXHV ¿[pHV SDU OH IDEULFDQW GH OD
'pSOLDJHGHVSLqWHPHQWV
PDFKLQH YRLUSRLQW 
,OIDXWWRXMRXUVWHQLUVHVPDLQVpORLJQpHVGHV]RQHVG
XVLQDJH $YDQWGHGpSOLHUOHVSLqWHPHQWVLOIDXWEORTXHUOHFKDULRWDYHFOH
ORUVTXH OD PDFKLQH HVW HQ PRXYHPHQW ,O IDXW WRXMRXUV TXH OD YRODQW )LJ5HS$ GXF{WpRSSRVpjFHOXLGXVRXOqYHPHQWGHODPD-
PDFKLQHVRLWDUUrWpH DSSXLVXUOHERXWRQG
DUUrW DYDQWG
HIIHFWXHU FKLQHSRXUUHQGUHFHWWHRSpUDWLRQPRLQVORXUGH
WRXWHRSpUDWLRQG
HQOqYHPHQWGHVSLqFHVSUqVGXGLVTXH 3RXU GpSOLHU OHV SLqWHPHQWV SURFpGHU FRPPH GpFULW FLDSUqV  VRXOH-
7RXMRXUVJDUGHUODPDFKLQHSURSUHODSURSUHWpJpQpUDOHGHOD ver la machine par l'arrière (Fig.6, Rep.1) et effectuer successivement
PDFKLQH QRWDPPHQW GH VHV SODQV GH WUDYDLO  HVW XQ IDFWHXU GH les points 2-3 et 4, puis poser la machine au sol. Après cela, avant de
VpFXULWpHVVHQWLHO GpSOLHUO
DXWUHSLqWHPHQWLOIDXWVHUDSSHOHUGHGpSODFHUODWrWHGHFRXSH
$UUrWHUODPDFKLQHHWODPHWWUHKRUVWHQVLRQDYDQWGHODQHWWR\HU HW GH OD EORTXHU GX F{Wp RSSRVp j FHOXL GX VRXOqYHPHQW SRXU UHQGUH
RX DYDQW G
HQOHYHU WRXWHV OHV SURWHFWLRQV TXHOOHV TX
HOOHV VRLHQW FHWWHRSpUDWLRQPRLQVORXUGHVRXOHYHUODPDFKLQHSDUO
DYDQWHWVXLYUH
SRXU HIIHFWXHU OHV RSpUDWLRQV G
HQWUHWLHQ RX SRXU GpPRQWHU GHV ODPrPHGpPDUFKHDGRSWpHSRXUOHSLqWHPHQWDUULqUH/HUHSOLDJHGHV
SLqFHV  6L VRQ QHWWR\DJH HVW HIIHFWXp DYHF XQ MHW G
HDX QH SDV piètements se fait à l'inverse.
GLULJHUFHOXLFLGLUHFWHPHQWVXUOHJURXSHG
DOLPHQWDWLRQRXVXUOH
PRWHXUpOHFWULTXH 6RXOqYHPHQWHWPDQXWHQWLRQ
 8WLOLVHU GHV GLVTXHV GLDPDQW G
RULJLQH UHFRPPDQGpV SDU OH La scieuse C 350 iPowerSqVHNJHWSHXWrWUHWUDQVSRUWpHjOD
IDEULFDQWSRXUREWHQLUGHKDXWHVSHUIRUPDQFHV PDLQ HQ XWLOLVDQW OHVSRLJQpHV PpQDJpHV GDQV OH FKkVVLV RX EkWL HQ
 8WLOLVHU H[FOXVLYHPHQW GHV GLVTXHV j FRXURQQH FRQWLQXH OD VRXOHYDQW VRLW G
XQ VHXO F{Wp HW HQ OD GpSODoDQW VXU OHV URXOHWWHV
UHIURLGLVjO
HDXHWG
XQW\SHDSSURSULpDXPDWpULDXjFRXSHU (Fig.5,Rep.A), soit à l'aide d'un appareil ou engin de levage après avoir
1HSDVHIIHFWXHUGHFRXSHVGHPDWpULDX[jVHFRXDYHFXQGpELW DFFURFKpGHVpOLQJXHVDX[SRLQWVLQGLTXpV )LJ /HVURXHVIDFLOLWHQW
G
HDXGHUpIULJpUDWLRQLQVXI¿VDQW les manoeuvres de chargement de la machine sur un moyen de tran-
1HMDPDLVXWLOLVHUGHGLVTXHVDXGHOjGHODOLPLWHGHYLWHVVHGH sport en utilisant une rampe d'accès. .
URWDWLRQLQGLTXpHSDUOHIDEULFDQW
1HMDPDLVXWLOLVHUGHVEDJXHVGHUpGXFWLRQSRXUDGDSWHUOHWURX %5$1&+(0(17e/(&75,48(
GXGLVTXHVXUOHÀDVTXH(PSOR\HUXQLTXHPHQWGHVGLVTXHVGRQW 6
DVVXUHUTXHODWHQVLRQHVWFRQIRUPHDX[GRQQpHVLQGLTXpHV
OHWURXFRUUHVSRQGDXÀDVTXHOLYUpDYHFODPDFKLQH   VXUODSODTXHGHODPDFKLQH
1HMDPDLVXWLOLVHUGHGLVTXHVGLDPDQWpVSUpVHQWDQWGHVFULTXHV
RXGHVGpIRUPDWLRQV /DOLJQHG
DOLPHQWDWLRQpOHFWULTXHGRLWrWUHPXQLHG
XQHSURWHFWLRQFRQWUH
/HVLQVWUXFWLRQVFRQWHQXHVGDQVFHPDQXHOVRQWGHVWLQpHVDX[ OHV VXULQWHQVLWpV H[  DYHF XQ LQWHUUXSWHXU PDJQpWRWKHUPLTXH  HW
XWLOLVDWHXUV RSpUDWHXUVSUpSRVpVjO
HQWUHWLHQ  FRQWUHOHVFRQWDFWVLQGLUHFWV H[DYHFXQLQWHUUXSWHXUW\SHGLIIpUHQWLHO 
Raccorder la machine à la prise de terre. Le dimensionnement des
FRQGXFWHXUV GX FkEOH G
DOLPHQWDWLRQ pOHFWULTXH GRLW WHQLU FRPSWH GHV
FRXUDQWVGHIRQFWLRQQHPHQWHWGHODORQJXHXUGHODOLJQHSRXUpYLWHUGH
trop fortes chutes de tension (Tableau 4 Page 4).

7
IMER INTERNATIONAL S.p.A.
C 350 iPower
F
Tableau 4 (175(7,(1
Section câble (mm²) $YDQWSURSRV
Modèle Type moteur
1,5 2.5 4.0 /HVRSpUDWLRQVQRUPDOHVG
HQWUHWLHQRUGLQDLUHSHXYHQWrWUHHIIHFWXpHV
PrPHSDUGXSHUVRQQHOQRQTXDOL¿pjFRQGLWLRQWRXMRXUVGHUHVSHFWHU

Longueur
câble (m)
C 350 220-230 V OHV FRQVLJQHV GH VpFXULWp TXL VRQW pQXPpUpHV GDQV OHV SDUDJUDSKHV
0 ÷ 22 23 ÷ 26 28 ÷ 43
iPower 13,5 A SUpFpGHQWVHWGDQVOHVVXLYDQWV

1HWWR\DJHGHODPDFKLQH
Établir l'alimentation en branchant le cordon de la scieuse et en vissant /HQHWWR\DJHGHODPDFKLQHGRLWrWUHWRXMRXUVHIIHFWXpDSUqVDYRLUDUUrWp
ODGRXLOOHGHUHWHQXHPpFDQLTXH GHJUpGHSURWHFWLRQ,3  la machine.
/DVFLHXVHHVWDLQVLSUrWHjIRQFWLRQQHU
  /HV LQWHUUXSWHXUV GH OD WHQVLRQ G
DOLPHQWDWLRQ pOHFWULTXH
GRLYHQW rWUH VXU OD SRVLWLRQ ³´ HW OHV SULVHV GRLYHQW rWUH
0,6((10$5&+('(/$6&,(86(
GpEUDQFKpHVGXUpVHDXpOHFWULTXH
5DFFRUGHU OH FkEOH G
DOLPHQWDWLRQ pOHFWULTXH j OD SULVH GX FRIIUHW
1HSDVXWLOLVHUG
DLUFRPSULPpSRXUQHSDVVRXIÀHUOHVSRXVVLqUHVHW
pOHFWULTXH 0HWWUH OD VFLHXVH HQ PDUFKH HQ DJLVVDQW VXU O
LQWHUUXSWHXU
OHVUpVLGXVGDQVOHVHQGURLWVOHVSOXVFDFKpV
VLWXp VXU OH FRIIUHW pOHFWULTXH SODFp DXGHVVXV GX PRWHXU TXL SUpYRLW
6
DVVXUHUTXHOHVEXVHVGXV\VWqPHG
DUURVDJHQHVRQWSDVERXFKpHV
GHX[WRXFKHVXQHYHUWHSRXUODPLVHHQURXWHHWXQHURXJHSRXUO
DUUrW
3. On ne saurait trop recommander de changer tous les jours l'eau pour
L’interrupteur est muni d'une protection de tension minimale : en cas de
l'arrosage contenue dans la cuve.
FRXSXUHGHFRXUDQWDFFLGHQWHOOHLOHVWQpFHVVDLUHG
DSSX\HUjQRXYHDX
 ,O HVW UHFRPPDQGp GH QH SDV XWLOLVHU GH SURGXLWV GpWHUJHQWV RX
sur le poussoir de mise en marche vert.
OXEUL¿DQWV
(QFDVG
XUJHQFHDUUrWHUODPDFKLQHHQDSSX\DQWVXUOHERXWRQG
DUUrW
d'urgence rouge (en saillie), puis couper la tension d'alimentation
1HWWR\DJHGHODFXYH
pOHFWULTXHGHODPDFKLQH GpEUDQFKHUVRQFRUGRQG
DOLPHQWDWLRQ 
1HWWR\HUODFXYHGqVTXHGHVGpS{WVVHSRVHQWVXUOHIRQGGHFHOOHFLRX
DXPRLQVXQHIRLVSDUMRXU/HPDQTXHGHSURSUHWpGHODFXYHSRXUUDLW
3527(&7,217+(50,48(
FUpHUGHVSUREOqPHVjODSRPSHLPPHUJpHTXLPHWHQFLUFXODWLRQO¶HDX
/HPRWHXUpOHFWULTXHHVWSURWpJpFRQWUHOHVVXUFKDUJHVSDUXQH G
DUURVDJHGXGLVTXHGLDPDQWp
VRQGHWKHUPLTXHHWLOV
DUUrWHHQFDVGHVXUFKDXIIH/DLVVHUUHIURLGLU Pour nettoyer la cuve, ôter le bouchon et rincer avec un jet d'eau direct
OHPRWHXUHWOHUHPHWWUHHQPDUFKHHQDJLVVDQWVXUO
LQWHUUXSWHXU HQSUHQDQWJDUGHjQHSDVOHGLULJHUYHUVOHVSDUWLHVpOHFWULTXHV

87,/,6$7,21'(/$0$&+,1( 1HWWR\DJHGXFLUFXLWG
DOLPHQWDWLRQGHO
HDXG
DUURVDJH
(IIHFWXHUUpJXOLqUHPHQW RXORUVTXHOHGpELWGHO
HDXG
DUURVDJHGXGLVTXH
)RQFWLRQQHPHQW GLDPDQWpGLPLQXH OHQHWWR\DJHGXFLUFXLWG
DOLPHQWDWLRQGXUpIULJpUDQW
/HF{WpGHWUDYDLOFRUUHFWGHO¶RSpUDWHXUHVWLQGLTXpHQ¿JUHS; HQGpPRQWDQWHWHQQHWWR\DQWjO
HDXODEXVHGHGLVWULEXWLRQTXLVHWURXYH
5HPSOLUODFXYHG
HDXDXPD[LPXPGHVDFDSDFLWp HQYLURQOLWUHV  jO
LQWpULHXUGXFDUWHUGHSURWHFWLRQGXGLVTXH )LJ5HS( 
5DFFRUGHUODPDFKLQHjO¶DOLPHQWDWLRQpOHFWULTXHHWODPHWWUHHQPDUFKH (IIHFWXHUUpJXOLqUHPHQWOHQHWWR\DJHjO
HDXGXWX\DXG
DOLPHQWDWLRQGH
GpFULWSDUDJUDSKH l'eau de refroidissement qui relie la pompe au robinet et au carter de
Ouvrir le robinet (Fig.1, Rep.M) et s'assurer que l'eau d'arrosage arrive protection du disque.
DERQGDPPHQWVXHOHGLVTXHGLDPDQWp
5HPSODFHPHQWGXGLVTXH
&RXSH /H GLVTXH GLDPDQWp HVW UpDOLVp DYHF XQ PDWpULDX TXL SHXW rWUH
3RXU UpJOHU OD KDXWHXU GH OD WrWH GH FRXSH GHVVHUUHU OH ERXWRQ HQGRPPDJpSDUODFKDOHXUHWGRLWGRQFrWUHUHIURLGLSHQGDQWODFRXSH
WULDQJOH )LJ5HS%  SRVLWLRQQHU OD WrWH j OD KDXWHXU GpVLUpH HW 3RXUOHUHPSODFHPHQWGXGLVTXHUHVSHFWHUODSURFpGXUHVXLYDQWH
serrer à fond le bouton triangle. Mettre en marche la scieuse comme  %ORTXHU OH FRXOLVVHPHQW YHUWLFDO GX JURXSH GH OD WrWH GH FRXSH HQ
GpFULWGDQVOHSDUDJUDSKHHWIDLUHDYDQFHUOHFKDULRWjO¶DLGHGHOD serrant le volant (Fig.1, Rep.D).
PDQHWWH )LJ5HS& SRXUH[pFXWHUODFRXSH$WWHQWLRQXQHYLWHVVH 'pPRQWHUOHFDUWHUGHSURWHFWLRQDYDQW )LJ5HS( 
G¶DYDQFHPHQW WURS UDSLGH SDU UDSSRUW j OD GXUHWp GX PDWHULDX GH OD 'HVVHUUHUO
pFURXGHEORFDJHHQOHWRXUQDQWGDQVOHVHQVGHVDLJXLOOHV
SLqFH j FRXSHU SHXW SURYRTXHU XQ DUUrW GH URWDWLRQ GH OD ODPH 'DQV G
XQHPRQWUH ¿OHWDJHJDXFKH jO
DLGHGHODFOpGHPPIRXUQLH
FH FDV GpJDJHU OH GLVTXH OH SOXV UDSLGHPHQW SRVVLEOH HQ UHFXODQW OH ([WUDLUHOHGLVTXHHQH[pFXWDQWG
DERUGXQPRXYHPHQWGHWUDQVODWLRQ
FKDULRWSRXUpORLJQHUOHGLVTXHMXVTX
jUHYHQLUjVRQUpJLPHGHURWDWLRQ SXLV HQ H[HUoDQW XQH OpJqUH LQFOLQDLVRQ GpJDJHU OH GLVTXH GH VRQ
nominal. Reprendre la coupe en adaptant la vitesse d’avancement aux logement.
FDUDFWpULVWLTXHVGXPDWHULDXGHODSLqFHjFRXSHU 6
DVVXUHUTX
LOQ
\DDXFXQFRUSVpWUDQJHUHQWUHOHVEULGHVGHVHUUDJH
/DFXYHGRLWWRXMRXUVrWUHSOHLQHSHQGDQWOHIRQFWLRQQHPHQW HW OH GLVTXH GLDPDQWp 3RXU OH GpPRQWDJH RX OH QHWWR\DJH QH SDV
GHODPDFKLQH(QFDVG
XWLOLVDWLRQSURORQJpHUHPSODFHUO
HDXDSUqV XWLOLVHUG
RXWLOVSRXYDQWERVVHOHUODEULGHRXPRGL¿HUVDIRUPH
DYRLUGpEDUUDVVpODFXYHGHWRXVGpS{WVRXWRXWHDFFXPXODWLRQGH 3ODFHUOHGLVTXHQHXIHQHIIHFWXDQWO
RSpUDWLRQGpFULWHSDUDJUDSKH
VDOHWpVRXDXWUHVLPSXUHWpV GDQVO
RUGUHLQYHUVH3UrWHUSOXVSDUWLFXOLqUHPHQWDWWHQWLRQDXVHQVGH
URWDWLRQGXGLVTXHGLDPDQWp
&RXSHLQFOLQpH  %ORTXHU FRUUHFWHPHQW O
pFURX GH ¿[DWLRQ GX GLVTXH HQ OH WRXUQDQW
'HVVHUUHUOHVERXWRQV(Fig.7, Rep.D)LQFOLQHUODWrWHGHFRXSHHWUHVVHU- GDQVOHVHQVLQYHUVHGHVDLJXLOOHVG
XQHPRQWUH ¿OHWDJHJDXFKH SRXU
UHUOHVERXWRQV3URFpGHUHQVXLWHFRPPHLQGLTXpDXSRLQWSUpFpGHQW obtenir un couple de 40 Nm.
  $YDQW GH UHPSODFHU OH GLVTXH LO IDXW WRXMRXUV FRXSHU OD
7UDFHXUODVHU WHQVLRQ G
DOLPHQWDWLRQ GH OD PDFKLQH GpEUDQFKHU VRQ FRUGRQ
/D PDFKLQH HVW pTXLSpH G
XQ WUDFHXU ODVHU TXL UHSURGXLW OH WUDLW GH VFLH G
DOLPHQWDWLRQ
sur la pièce à scier. Le trait de lumière (le faisceau) indique la trajectoire
G
DYDQFHPHQWGXGLVTXHGLDPDQWp3RXUREWHQLUXQHSUpFLVLRQPD[LPDOH 5HPSODFHPHQWGHODFRXUURLHGHWUDQVPLVVLRQ
GHFRXSHLOIDXWIDLUHFRwQFLGHUOHWUDFpGHODFRXSHGpVLUpHDYHFOHWUDFp /D PDFKLQH HVW pTXLSpH G
XQH FRXUURLH VSpFLDOH SUpWHQGXH GH
ODVHU 1RWHU TXH O
H[pFXWLRQ GH FRXSHV SHUSHQGLFXODLUHV j XQ F{Wp GH OD W\SH ORQJXH GXUpH 3RXU OH UHPSODFHPHQW IDLUH DSSHO j XQ FHQWUH
SLqFHjVFLHUQHQpFHVVLWHG
DXFXQWUDFpSUpDODEOH3UDWLTXHPHQWLOVXI¿WGH G
DVVLVWDQFHDJUpp
V
DVVXUHUTXHOHF{WpGHUpIpUHQFHVHWURXYHDXFRQWDFWGHODEXWpHVXUOD
WDEOHG
DSSXL'HODPrPHPDQLqUHLOHVWSRVVLEOHG
HIIHFWXHUGHVFRXSHV 5pJODJHGXMHXDXFKDULRW
jDQJOHVG
LQFOLQDLVRQSUpUpJOpVHQXWLOLVDQWOHJRQLRPqWUH/DOXPLqUHODVHU /H FKDULRW VH GpSODFH VXU XQ SUR¿O G
DOXPLQLXP DX PR\HQ GH JDOHWV
LQGLTXHUDODSRVLWLRQHIIHFWLYHGHODFRXSH/DPLVHHQPDUFKHHWO
DUUrWGX $X¿OGXWHPSVOHFKDULRWSUHQGGXMHXFHTXLQXLWjODSUpFLVLRQGHOD
traceur laser s'effectue à l'aide de l'interrupteur (Fig.3,Rep.E). coupe. Pour le remplacement des galets, faire appel à un centre d'as-
/HWUDFHXUODVHUHVWDOLJQpDYHFOHGLVTXHHWQHGRLWSDVrWUHGpSODFpGH VLVWDQFHDJUpp
sa position initiale.
/HWUDFHXUXWLOLVHXQpPHWWHXUGHOXPLqUHODVHUGHIDLEOHSXLV-
VDQFH7RXWHIRLVLOHVWSUpIpUDEOHGHQHSDVUHJDUGHUGLUHFWHPHQW
OHIDLVFHDX

8
IMER INTERNATIONAL S.p.A.
C 350 iPower
F
5e3$5$7,216 ,1&219(1,(176&$86(65(0('(6
/HV UpSDUDWLRQV GHV V\VWqPHV pOHFWULTXHV GRLYHQW rWUH H[pFXWpHV   $77(17,21 7RXWHV OHV LQWHUYHQWLRQV G
HQWUHWLHQ GRL-
H[FOXVLYHPHQW SDU GX SHUVRQQHO TXDOL¿p /HV SLqFHV GpWDFKpHV j YHQW rWUH H[pFXWpHV DSUqV DYRLU DUUrWp OD PDFKLQH HQ PHWWDQW OH
XWLOLVHUGRLYHQWrWUHH[FOXVLYHPHQWGHVSLqFHVG
RULJLQH,0(5TX
LOHVW VpOHFWHXUVXUHWHQGpEUDQFKDQWOHFkEOHG
DOLPHQWDWLRQ
LQWHUGLWG
DOWpUHU*UkFHjVDVWUXFWXUHSDUWLFXOLqUHODC 350 iPower ne
QpFHVVLWHSDVG
DXWUHVRSpUDWLRQVG
HQWUHWLHQTXHFHOOHVTXLVRQWGpMj
Anomalies Causes Solutions
pQXPpUpHV 6
DVVXUHU TXH OHV FRQWDFWV GH OD prise et de l'ensemble
SULVHLQWHUUXSWHXU VRQW HQ ERQ pWDW 6
LOV VRQW R[\GpV OHV QHWWR\HU Absence de Contrôler la ligne *
tension sur la ligne
LPPpGLDWHPHQW
d’alimentation
(QFDVG
LQWHUYHQWLRQGHO
LQWHUUXSWHXUGLIIpUHQWLHOFRQ¿HUOH /D¿FKHHVWPDO 5pWDEOLUOHEUDQFKHPHQW
FRQWU{OHGHODPDFKLQHHWO
pYHQWXHOOHUpSDUDWLRQH[FOXVLYHPHQWj EUDQFKpHjODSULVH
XQSHUVRQQHOTXDOL¿p d’alimentation
pOHFWULTXH
e/,0,1$7,21'(60$7e5,$8;'(5(%87 L’interrupteur du Appuyer sur le bouton
3RXUODPLVHDXUHEXWGHVGpFKHWVSURGXLWVSDUODFRXSH En appuyant sur GLIIpUHQWLHOQ¶DSDVpWp 21GXGLIIpUHQWLHO
DFWLRQQp
LOHVWUHFRPPDQGpGHUHVSHFWHUOHVORLVHQYLJXHXUHQODPDWLqUH l’interrupteur de
marche, le moteur Le câble d’alimentation Changer le câble *
ne se met pas en UHOLDQWOD¿FKHDX
5,648(65e6,'8(/6(76,*1$8;'(6e&85,7e
marche. WDEOHDXHVWFRXSp
0DOJUpODFRQVWUXFWLRQGHODVFLHFRQIRUPpPHQWDX[QRUPHVHQYLJXHXU
8Q¿OpOHFWULTXHj 5pWDEOLUOHEUDQFKHPHQW
GHVULVTXHVUpVLGXHOVVXEVLVWHQWQpDQPRLQVTXLLPSRVHQWOHSRUWG
(3,
O¶LQWpULHXUGXERUQLHU
DSSURSULpVFDULOVQHSHXYHQWrWUHpOLPLQpV/HVSODTXHVVLJQDOpWLTXHV PRWHXUHVWFRXSp
¿JXUDQW VXU OD PDFKLQH LQGLTXHQW DXVVL ELHQ OHV ULVTXHV TXH OHV
8Q¿OpOHFWULTXHj 5pWDEOLUOHEUDQFKHPHQW
comportements à adopter : O¶LQWpULHXUGXWDEOHDX
HVWFRXSp
L’interrupteur de Changer l’interrupteur *
5,648(%58,7 PDUFKHHVWGpIHFWXHX[
Absence d’eau dans 5pWDEOLUOHQLYHDXG¶HDX
3URWHFWLRQGHO¶RXwHREOLJDWRLUH la cuve
L’eau de Filtre de la pompe 1HWWR\HUOH¿OWUHGHOD
refroidissement ERXFKp pompe
n’arrive pas à la
5,648('(%/(6685(6$8;0$,16 lame La pompe n’est pas Contrôler l’alimentation
DOLPHQWpH pOHFWULTXHGHODSRPSH
3RPSHGpIHFWXHXVH Changer la pompe *
3RUWGHVJDQWVREOLJDWRLUH
/DPHPRQWpHj 'pPRQWHUODODPHHWOD
l’envers par rapport au remonter dans le sens
La lame ne coupe sens de rotation LQGLTXpVXUO¶pWLTXHWWH
5,648('(%/(6685(6$8;<(8; pas SUpVHQWHVXUODODPH
/DPHXVpH Changer la lame
3URWHFWLRQGHV\HX[REOLJDWRLUH 2SpUDWLRQjFRQ¿HUjXQpOHFWULFLHQ

5,648('¶87,/,6$7,21,035235(

/HFWXUHREOLJDWRLUHGXPDQXHODYDQWXWLOLVDWLRQ

8WLOLVDWLRQG¶HDXREOLJDWRLUHSRXUODFRXSH

'$1*(5'(&28385(

'$1*(5'¶e/(&752&87,21

'$1*(55$<211(0(17/$6(5

Attention: le contrôle de l’utilisation des EPI incombe à l’employeur.

9
IMER INTERNATIONAL S.p.A.
C 350 iPower
GB
Dear Customer, Table 2
Congratulations on your purchase: your IMER saw, the result of years of 6SHFL¿FDWLRQV Motor (230V/50Hz) (220V/60Hz)
H[SHULHQFHRIIHUVPD[LPXPUHOLDELOLW\DQGIHDWXUHVWKHODWHVWWHFKQLFDO
Power (kW) 2.5
innovations.
. Rated voltage (V) 220/230
Frequency (Hz) 50/60
Absorbed current(A) 15
:25.,1*,16$)(7<
Number of poles 2
7RHQVXUHVDIHW\UHDGWKHIROORZLQJLQVWUXFWLRQVFDUHIXOO\
2800 (50Hz)
Motor speed (rpm)
3400 (60Hz)

To work in complete safety, read the following instructions carefully Service type S6 40%
before using the machine. Insulation class F
The manual is considered part of the machine and must be kept for Protection class IP55
future reference (EN 12100-2) until scrapping of the machine itself. Capacitor (µF) 60 (Ø 95x55)
Should the manual be lost or damaged, a copy can be ordered from
the manufacturer. '(6,*1$1'&216758&7,2167$1'$5'6
The manual contains important information regarding site preparation, C 350 iPower saws have been designed and manufactured according
machine use, maintenance procedures, and requests for spare parts. to the following standards: UNI EN 12418:2001; EN 12100-1/2:2005;
Nevertheless, the installer and the operator must both have adequate EN 60204-1:2006.
experience and knowledge of the machine prior to use. In order to ensure
operator safety, safe operation and long service life, all instructions in 12,6(/(9(/$1'9,%5$7,216
this manual must be observed, together with the requirements of current Table 3 gives the sound pressure level of the machine measured at
legislation governing work safety (use of safety footwear and adequate the ear of the operator when running under no load (LpA) and vibrations
clothing, use of helmets, gloves, goggles etc.). transmitted when it is operating.
0DNHVXUHWKDWDOOVLJQVDUHOHJLEOH
Table 3
,WLVVWULFWO\IRUELGGHQWRFDUU\RXWDQ\IRUPRIPRGL¿FDWLRQWR
Model Type of motor LpA Aeq
WKHVWHHOVWUXFWXUHRUZRUNLQJSDUWVRIWKHPDFKLQH
C 350 iPower Electric 86 dB 2.63 m/s2
IMER INTERNATIONAL declines all responsibility for failure to comply
with laws and standards governing the use of this equipment, in *(1(5$/'(6&5,37,212)6$:
particular; improper use, defective power supply, lack of maintenance,
XQDXWKRULVHG PRGL¿FDWLRQV DQG SDUWLDO RU WRWDO IDLOXUH WR REVHUYH WKH *HQHUDOGHVFULSWLRQ
instructions contained in this manual. The C 350 iPower sawing machine is composed of a frame (Fig.1,
IMER INTERNATIONAL reserves the right to modify features of the saw Ref.A) supported by folding legs (Fig.1, Ref.B). The cutting head (Fig.1,
and contents of this manual, without the obligation to update previous Ref.C) is mounted on a carriage and can move vertically and horizontally
machines and/or manuals. along a rigid aluminium section The aluminium section is hinged on two
DUPV )LJ5HI' DQGWKHZKROHDVVHPEO\FDQURWDWHƒ ¿J E\
7(&+1,&$/'$7$ loosening the handwheels (Fig.2,Ref.A).
7HFKQLFDOGDWDDUHVWDWHGLQWDEOHDQGHOHFWULFDOVSHFL¿FDWLRQVLQWDEOH 7KH VDZLQJ PDFKLQH LV ¿WWHG ZLWK D EODGH JXDUG )LJ 5HI(  WR
2. guarantee optimal safety during operation and to protect the user during
cutting cycles. Located on the cutting table is the protractor (Fig.1,
Table 1 - TECHNICAL DATA Ref.G) for making cuts at different angles. A plastic impact-resistant
Model C 350 iPower tank (Fig.1, Ref.G) is mounted under the frame. The immersion water
pump (Fig.1, Ref.H) is housed inside the tank and supplies water to
Max. blade diameter 350 mm
the nozzles (Fig.3, Ref.A) mounted on the blade guard which cool the
Diamond Blade hole diameter 25,4 mm
disc during cutting. A valve (Fig.3, Ref.B) is mounted above the blade
Single phase motor power 2.5 kW JXDUGWRDGMXVWWKHÀRZUDWHRIZDWHUGHOLYHUHGWRWKHFXWWLQJEODGH. The
Max. blade rotation speed 2036 rpm machine is equipped with a laser pointer that marks the cutting line on
Cutting table dimensions 1390 x 696 mm the workpiece (Fig.3,Ref.C).
Length of 90° cuts (thickness= 10mm) 1050 mm
Maximum cutting depth of dia. 350 disc with 1-2 :RUNDEOHPDWHULDOV
120/250mm The sawing machine has been designed for cutting the following
passes
:DWHUSXPSÀRZUDWH 10 L/1’ materials: ceramic, stone materials, marble, granite, brick and stone,
Water tank capacity 40 L cement and similar products of maximum size compatible with the
lengths, cutting depths and dimensions of the table, given in Table 1.
Machine dimensions 760 x1746 /H 1535 mm
Maximum weight of workable materials: 35 kg.
Packed machine dimensions 746 x 1770 /H 1080 mm
Weight with packaging 113 (133) Kg
ORIGINAL INSTRUCTIONS

10
IMER INTERNATIONAL S.p.A.
C 350 iPower
GB
23(5$7,216$)(7< 6$)(7<'(9,&(6
The C 350 iPower has been constructed taking into account current
%HIRUHXVLQJWKHVDZHQVXUHWKDWDOOSURWHFWLRQGHYLFHVDUH
harmonised European safety standards.
¿WWHG
According to the "machinery directive" 2006/42/EEC, all safety devices
  1HYHU XVH WKH VDZ LQ HQYLURQPHQWV VXEMHFW WR WKH ULVN RI have been installed with the aim of safeguarding the operator.
H[SORVLRQVRU¿UH
*XDUGVDQGVDIHW\GHYLFHV
7KHVDZLVQRW¿WWHGZLWKVSHFL¿FOLJKWLQJDQGWKHUHIRUHWKHZRUNSODFH 7KHPDFKLQHLVHTXLSSHGZLWK¿[HGJXDUGVVHFXUHGE\PHDQVRIVFUHZV
PXVWEHVXI¿FLHQWO\OLWIRUWKLVSXUSRVH PLQOX[  and protections that prevent access to moving or dangerous parts. All
The power lines must be laid to prevent any possible damage. ¿[HG JXDUGV FRYHUV VKLHOGV ¿[HG E\ PHDQV RI VFUHZV KDYH EHHQ
Ensure that the electrical connection is protected against the risk of envisaged to protect the operator (maintenance engineers, technicians
water penetration in connectors. Only use connectors and couplings and others) from possible accidents cause by electrical discharge or
equipped with spray guards. moving mechanical parts.
Never use inadequate or makeshift electrical lines or cables without 7KHUHIRUHXVHRIWKHPDFKLQHZLWKJXDUGVUHPRYHGRUPRGL¿HGLQDQ\
earthing; if in doubt consult a specialised technician. way is strictly prohibited.
Repairs to the electrical installation must be performed exclusively by
  %HIRUH SHUIRUPLQJ PDLQWHQDQFH RU UHSDLUV WR WKH PDFKLQH
specialised personnel Disconnect the machine from the power supply
WXUQ LW RII YLD WKH PDLQ VZLWFK DQG GLVFRQQHFW IURP WKH SRZHU
before performing maintenance or repairs.
VXSSO\ WR SUHYHQW LQDGYHUWHQW VWDUWXS DQG LVRODWH DOO PDFKLQH
HOHFWULFDOFLUFXLWV
*(1(5$/6$)(7<:$51,1*6
This machine was designed to provide the best performance and the
0$&+,1(,167$//$7,21
highest degree of safety: however, it is up to the operator to ensure this
safety, by taking due care during all work phases. The following are
recommended: $OZD\VUHPRYHWKHSOXJIURPWKHPDLQVSRZHUEHIRUHPRYLQJ
WKHPDFKLQH
(QVXUHWKDWDQHI¿FLHQWHDUWKLQJV\VWHPLVLQVWDOOHG
$OZD\VHPSW\WKHWDQNEHIRUHPRYLQJWKHPDFKLQH
 :RUN RQO\ ZLWK DOO SURWHFWLRQ GHYLFHV ¿WWHG FRUUHFWO\ DQG LQ
HI¿FLHQWZRUNLQJRUGHU
3RVLWLRQLQJ
 5HPRYH ULQJV ZDWFKHV EUDFHOHWV RU WLHV EHIRUH XVLQJ WKH
The machine must be placed on a smooth surface that is at least as
PDFKLQH WKHVH HOHPHQWV FRQVWLWXWH D VHULRXV KD]DUG WR WKH
large as its frame, or supported on its legs.
RSHUDWRU$OVRHQVXUHWKDWVOHHYHVDUHWLJKWDURXQGWKHZULVWVKDLU
When moving the machine in the workplace make sure to lock
LVWLHGEDFNDQGUREXVWIRRWZHDULVXVHG
the carriage by tightening the knob (Fig.4, Ref.A) at the hole
$OZD\VXVHSHUVRQDOSURWHFWLRQGHYLFHVVXFKDVVDIHW\JRJJOHV
located under the aluminium section. The head can be locked in
VXLWDEO\ VL]HG JORYHV HDU PXIIV RU SOXJV DQG KDLU FDSV ZKHQ
another place, or at a second hole which is located in the position
QHFHVVDU\
(Fig.4,Ref.B)
1HYHUFXWZRUNSLHFHVWKDWKDYHGLPHQVLRQVRUZHLJKWWKDWDUH
Lift the machine by the handles machined into the frame (Fig.1, Ref.I)
QRWVXLWHGWRPDFKLQHLFDSDFLW\DVVSHFL¿HGE\WKHPDQXIDFWXUHU
after having shut off its power supply.
VHHSRLQW
 $OZD\V NHHS \RXU KDQGV DZD\ IURP WKH ZRUN DUHDV ZKHQ WKH
2SHQLQJWKHVXSSRUWOHJV
PDFKLQH LV UXQQLQJ %HIRUH WDNLQJ DQ\ DFWLRQ WR UHPRYH D SLHFH
IURPFORVHWRWKHGLVFVWRSURWDWLRQE\SUHVVLQJWKHVWRSEXWWRQ Before opening the legs, lock the carriage with the handwheel
.HHSWKHPDFKLQHFOHDQWKHJHQHUDOFOHDQOLQHVVRIWKHPDFKLQH (Fig.4, Ref.A) on the opposite side to which the machine is raised, in
HVSHFLDOO\LWVZRUNWDEOHV LVDQLPSRUWDQWIDFWRULQLWVVDIHW\ order to lighten lifting.
 $OZD\V VWRS WKH PDFKLQH DQG GLVFRQQHFW IURP WKH SRZHU To open the legs: raise the machine at the back (Fig.6,Ref.1) and follow
VXSSO\ EHIRUH FOHDQLQJ RU UHPRYLQJ DQ\ SURWHFWLRQ GHYLFH IRU the steps in points 2-3 and 4, then put the machine down. Then, before
PDLQWHQDQFH RU GLVDVVHPEO\ SXUSRVHV  ,I ZDWHU MHWV DUH XVHG opening the other legs, remember to move the head and lock it on the
IRUFOHDQLQJQHYHUSRLQWMHWVGLUHFWO\DWWKHSRZHUVXSSO\XQLWRU opposite side to which the machine is raised, in order to lighten lifting, lift
HOHFWULFPRWRU the machine at the front and carry out the same procedure for opening
 8VH JHQXLQH GLDPRQG EODGHV DV UHFRPPHQGHG E\ WKH the rear legs. To close the legs proceed in reverse order.
PDQXIDFWXUHUWRHQVXUHRSWLPDOSHUIRUPDQFHRIWKHPDFKLQH
 8VH H[FOXVLYHO\ ZDWHUFRROHG GLVFV RI D W\SH VXLWHG WR WKH /LIWLQJDQGKDQGOLQJ
PDWHULDOWREHFXW The C 350 iPower saw weighs 113 kg and can be transported ma-
1HYHUGU\FXWPDWHULDORUFXWZKHQFRROLQJZDWHUOHYHOVDUHORZ nually by means of the handles obtained in the frame, lifting it on one
 1HYHU XVH EODGHV RYHU WKH URWDWLRQ VSHHG VSHFL¿HG E\ WKH side only and moving it with the aid of the wheels (Fig.5,Ref.A) or, al-
PDQXIDFWXUHU ternatively, using a lifting device, hooking it with ropes at the special
 'R QRW XVH UHGXFWLRQ ULQJV WR DGDSW WKH KROH RI WKH GLVF RQ places indicated (Fig.5). The wheels facilitate operations for loading the
WKHÀDQJH2QO\XVHGLVFVZLWKKROHFRUUHVSRQGLQJWRWKHÀDQJH machine on a vehicle using a platform.
VXSSOLHGZLWKWKHPDFKLQH  
1HYHUXVHGLDPRQGEODGHVWKDWDUHFKLSSHGRUGHIRUPHG (/(&75,&$/&211(&7,21
 7KH LQVWUXFWLRQV LQ WKLV PDQXDO DUH DLPHG DW PDFKLQH XVHUV   (QVXUH WKDW YROWDJH FRUUHVSRQGV WR PDFKLQH GDWDSODWH
RSHUDWRUVPDLQWHQDQFHHQJLQHHUV  VSHFL¿FDWLRQV

The power supply line must be equipped with current overload protection
(e.g. thermal cutout) and protection against indirect contact (e.g. residual
FXUUHQW FLUFXLW EUHDNHU  &RQQHFW WKH PDFKLQH WR DQ HI¿FLHQW HDUWKLQJ
system. The size of the power cable wires must be based on operating
current and length of the power line to prevent excessive voltage drops
(table 4 Page 4).

11
IMER INTERNATIONAL S.p.A.
C 350 iPower
GB
Connect the saw plug to the mains and tighten the mechanical retainer 2. Ensure that the cooling water nozzles are not obstructed.
ring with IP67 protection rating. 3. In particular, it is recommended that you change the cooling water in
The saw is now ready for operation. *** the tank every day.
4. Do not use detergents or lubricants.
6$:67$5783
Connect the mains power cable to the plug on the electrical panel Now &OHDQLQJWKHWDQN
start the sawing machine with the switch on the electrical cabinet over Clean the tank in the event of build-up of sediment on the base, or at
the motor, composed of two buttons: green for start, red for stop. least once a day. Failure to clean the tank could impair operation of
7KHVZLWFKLV¿WWHGZLWKORZYROWDJHSURWHFWLRQLQWKHHYHQWRIDFFLGHQWDO the immersion pump used for circulation of the diamond blade cooling
power failure, press the green button again to resume operation. water.
In the event of an emergency, press the protruding red pushbutton to To clean out the tank, remove its plug and rinse it out with a jet of water
shut down the machine and disconnect the plug from the power mains. - take care not to direct water onto electrical equipment.

7+(50$/&87287 &OHDQLQJWKHFRROLQJZDWHUVXSSO\FLUFXLW
$WUHJXODULQWHUYDOV RUZKHQWKHÀRZUDWHRIWKHEODGHFRROLQJZDWHULV
7KHHOHFWULFPRWRULVSURWHFWHGDJDLQVWRYHUORDGE\DWKHUPDO
reduced) clean the cooling water supply circuit.To do this, disassemble
FXWRXW LQ WKH HYHQW RI RYHUKHDWLQJ WKLV GHYLFH VKXWV GRZQ WKH
the delivery nozzle located inside the blade guard (Fig.1, Ref. E) and
PRWRU&RROWKHPRWRUDQGUHVWDUWWKHPDFKLQHZLWKWKHVZLWFK
clean in water.
Periodically clean the cooling water delivery line between the pump and
0$&+,1(86(
valve and blade guard using water.
2SHUDWLRQ
5HSODFLQJWKHGLVF
7KHFRUUHFWVLGHIRUWKHRSHUDWRULVVKRZQLQ¿JUHI;
The diamond blade is made of material that may be damaged when
Fill the water tank to the maximum level (approx. 40 litres). Connect the
subject to high temperatures, and therefore must be cooled during the
machine to the power mains and start as described in paragraph 10.
work phases.
2SHQWKHYDOYH )LJ5HI0 DQGPDNHVXUHWKHUHLVDVXI¿FLHQWÀRZ
To replace the blade, proceed as follows:
of cooling water to the diamond blade.
1. Block the vertical movement of the cutting head by tightening down
the handwheel (Fig.1, Ref.D).
&XWWLQJ
2. Disassemble the front guard (Fig.1, Ref.E).
Move the head assembly towards the opposite side to the operator, up to
3. Loosen the locknut by rotating it clockwise (LH thread), using the 32
stop, then place the material being cut (Fig.7, Ref.A) against the stop on
mm wrench supplied with the machine.
the table. In case of angle cut, establish the desired angle using the pro-
4. Move the cutting head forward slightly and incline to remove the blade
tractor or by means of the laser pointer To adjust the height of the cutting
from its seat.
head, slacken the handwheel (Fig.7,Ref.B), position the head at the desi-
(QVXUHWKDWWKHUHDUHQRIRUHLJQREMHFWVEHWZHHQWKH¿[LQJÀDQJHDQG
red height and tighten the handwheel Start the saw as described in par. 10
diamond blade. During disassembly, avoid use of tools that could dent
and, by means of the handle (Fig.7,Ref.C), slide the carriage to carry out
RUGHIRUPWKHÀDQJH
cutting. A forward speed that is too fast for the thickness and hardness of
6. Fit the new blade by proceeding in reverse order of the operation
the material can cause the blade to stop turning.In this case, free the blade
described at point 4. Take special care to ensure the correct direction of
a quick as possible, shifting the carriage back in order to move the blade
rotation of the diamond blade.
away until it has regained nominal rotation speed. Resume cutting by adju-
7. Tighten the blade locknut fully down by rotating anticlockwise (left
sting the forward speed according to the characteristics of the material.
thread), to a torque of 40 Nm.
(QVXUHWKDWWKHWDQNLVNHSWIXOOGXULQJDOOZRUNSKDVHVDQGLQ
$OZD\VGLVFRQQHFWWKHSRZHUSOXJEHIRUHFKDQJLQJWKHGLVF
WKHHYHQWRISURORQJHGZRUNLQWHUYDOVUHSODFHZDWHUUHJXODUO\DQG
UHPRYHDOOSURFHVVLQJUHVLGXH
5HSODFLQJWKHGULYHEHOW
The machine is equipped with a special long-life pre-tensioned belt. For
&XWWLQJDWDQDQJOH
replacement, contact an authorised service centre.
6ODFNHQ WKH KDQGZKHHOV (Fig.7,Ref.D) WLOW WKH FXWWLQJ KHDG DQG
UHWLJKWHQ WKH KDQGZKHHOV WKHQ SURFHHG DV GHVFULEHG LQ WKH
&DUULDJHSOD\DGMXVWPHQW
SUHYLRXVSRLQW
The carriage slides along the aluminium section by means of rollers;
over time any play will affect cutting precision. To adjust the rollers,
/DVHUSRLQWHU
contact an authorised service centre.
The machine is equipped with a laser pointer that marks the cutting line
on the workpiece. The guide mark indicates the path of the cutting bla-
5HSDLUV
de. Maximum precision is obtained by matching the desired cutting line
Repairs to the electrical installation must be performed exclusively
with the laser guide mark. Perpendicular cuts on a side of the workpiece
by specialised personnel. Use exclusively original IMER spare parts;
do not require previous marking: just make sure the reference side is in
PRGL¿FDWLRQVWRSDUWVDUHVWULFWO\SURKLELWHG7KHVSHFLDOGHVLJQRIWKH
contact with the stop on the support table. Similarly, using the protractor
C 350 iPower ensures that no other maintenance other than that
it is possible to cut at given angles. The laser will indicate the actual
VSHFL¿HGDERYHLVUHTXLUHG(QVXUHWKDWWKHFRQWDFWVRIWKHSRZHUSOXJ
cutting position. The laser pointer is turned on and off by means of the
DQG SOXJVZLWFK DVVHPEO\ DUH HI¿FLHQW. If oxidation is detected, clean
switch (Fig.3,Ref.E).
immediately
The pointer is aligned with the blade and must not be moved from the
initial position. ,QWKHHYHQWRIDFWLYDWLRQRIWKHGLIIHUHQWLDOFLUFXLWEUHDNHU
 7KH SRLQWHU XVHV D ORZSRZHU ODVHU QHYHUWKHOHVV LW LV FKHFNWKHPDFKLQHDQGDUUDQJHIRUUHSDLUVLIQHFHVVDU\H[FOXVLYHO\
DGYLVDEOHQRWWRORRNGLUHFWO\DWWKHHPLWWHU E\VSHFLDOLVHGSHUVRQQHO

0$,17(1$1&( 'LVSRVDORIUHIXVH
As regards disposal of processing waste, observe all current legislation
)RUHZRUG in the country of use.
Routine maintenance operations can also be performed by non-
VSHFLDOLVHGSHUVRQQHOSURYLGHGWKDWDOOVDIHW\VWDQGDUGVVSHFL¿HGLQWKH
relative sections of this manual are observed at all times.
5(6,'8$/5,6.6$1'6$)(7<127,&(6
&OHDQLQJWKHPDFKLQH Although the sawing machine has been manufactured fully in compliance
The machine should be cleaned exclusively when it is stationary. with current regulations, residual risks exist that cannot be eliminated
and involve the use of appropriate individual protection devices. The
$OOSRZHUVZLWFKHVPXVWEH
machine is equipped with notices to indicate the residual risks and how
VHWWR³´DQGSOXJVPXVWEHGLVFRQQHFWHGIURPWKHPDLQV
to avoid them.
 1HYHU XVH FRPSUHVVHG DLU WKLV FRXOG FDXVH LQ¿OWUDWLRQ RI GXVW RU
residue into corners.

12
IMER INTERNATIONAL S.p.A.
C 350 iPower
GB
NOISE RISK 7528%/(6+227,1*
&$87,21$OOPDLQWHQDQFHRSHUDWLRQVPXVWEHSHUIRUPHG
(DUSURWHFWLRQPXVWEHZRUQ H[FOXVLYHO\ZLWKWKHPDFKLQHVZLWFKHGRIIZLWKWKHVHOHFWRUVHWWR
³´DQGWKHSRZHUSOXJGLVFRQQHFWHGIURPWKHPDLQV

5,6.2),1-85<727+(+$1'6 Trouble Causes Remedies


Current does not reach Check the line *
6DIHW\JORYHVPXVWEHZRUQ the supply line
The socket and plug Restore correct
are not connected connection
5,6.2),1-85<727+((<(6 properly
The differential switch Turn the differential
is off switch on
(\HSURWHFWLRQPXVWEHZRUQ
The motor does not The power cable from Change the cable *
start when the start the plug to the panel
switch is pressed is cut off
$%1250$/86(5,6.
An electric wire inside Restore the connection *
the motor terminal strip
5HDGLQJWKHPDQXDOEHIRUHXVHLVFRPSXOVRU\ is cut off
An electric wire inside Change the switch *
the panel is cut off
The start switch is Change the switch *
faulty
&XWWLQJZLWKZDWHULVFRPSXOVRU\
Low water level in tank Restore the water level
3XPS¿OWHUFORJJHG &OHDQWKHSXPS¿OWHU
Cooling water fails
'$1*(52)&877,1* to reach the blade Current fails to reach Check the pump
the pump electrical supply *
Pump failure Change the pump *
%ODGH¿WWHGLQWKH Remove the blade
opposite direction to and reposition it in the
The blade does that of rotation direction shown on the
not cut blade label
'$1*(52)(/(&752&87,21
Worn blade Change the blade
* Operation to be carried out by an electrician

'$1*(5/$6(5%($0

Please be reminded that checking the use of IPDs is delegated to the


employer.

13
IMER INTERNATIONAL S.p.A.
C 350 iPower
D
Sehr geehrte Kundin, sehr geehrter Kunde, Tabelle 2
ZLU EHJOFNZQVFKHQ 6LH ]X ,KUHU :DKO 'LH ,0(56lJHPDVFKLQH LVW Elektrische Eigenschaften Motore (230V/50Hz) (220V/60Hz)
GDV(UJHEQLVODQJMlKULJHU(UIDKUXQJELHWHWK|FKVWH=XYHUOlVVLJNHLWXQG
Leistung (kW) 2.5
LVWPLWLQQRYDWLYHQWHFKQLVFKHQ/|VXQJHQDXVJHVWDWWHW
Nennspannung (V) 220/230
Frequenz (Hz) 50/60
$5%(,766,&+(5+(,7 Stromaufnahme (A) 15
%LWWHOHVHQ6LHDXV6LFKHUKHLWVJUQGHQGLHIROJHQGHQ$QOHLWXQJHQ
Polzahl 2
DXIPHUNVDPGXUFK
2800 (50Hz)
Umdrehungen (rpm)
3400 (60Hz)
Die vorliegende BEDIENUNGS- UND WARTUNGSANLEITUNG muss
vom Baustellenleiter persönlich auf der Baustelle aufbewahrt werden Betriebsart S6 40%
und stets für eventuelles Nachschlagen zur Verfügung stehen. Isolationsklasse F
Diese Anleitung ist als Bestandteil der Maschine zu betrachten und Schutzart IP55
muss für zukünftigen Bedarf bis zu deren Verschrottung (EN 12100-2) Kondensator (µF) 60 (Ø 95x55)
aufbewahrt werden. Im Fall des Verlustes oder der Beschädigung kann
beim Hersteller ein neues Exemplar angefordert werden. 352-(.71250(1
Die vorliegende Anleitung enthält wichtige Hinweise zur Die Sägemaschinen C 350 iPower wurden unter Einhaltung folgender
Baustellenvorbereitung und Installation, zum Einsatz, zu Normen geplant und konstruiert: UNI EN 12418:2001; EN 12100-
Wartungseingriffen und zur Ersatzteilbestellung. Die Monteure und 1/2:2005; EN 60204-1:2006.
Anwender sollten jedoch in jedem Fall über ausreichende Erfahrung und
eingehende Kenntnis der Maschine verfügen. Zur Gewährleistung der *(5b86&+3(*(/81'6&+:,1*81*6h%(575$*81*
Bediener- und Betriebssicherheit sowie einer langen Lebensdauer der In Tabelle 3 sind der am Ohr des Bedieners gemessene Schalldruckpegel
Maschine müssen die vorliegenden Anleitungen und die einschlägigen im Leerlauf (LpA) und die Stärke der während der Arbeit übertragenen
Gesetzesnormen für Arbeitssicherheit und Gesundheitsschutz Schwingungen angegeben.
(Gebrauch spezieller Sicherheitsschuhe und Kleidung, Helme,
Handschuhe, Schutzbrille usw.) unbedingt beachtet werden. Tabelle 3
$OOH$XIVFKULIWHQPVVHQVWHWVHLQZDQGIUHLOHVEDUVHLQ Modell Motortyp LpA Aeq
  $Q GHU 0HWDOONRQVWUXNWLRQ RGHU GHQ $QODJHQWHLOHQ GHU C 350 iPower Elettrico 86 dB 2.63 m/s2
6lJHPDVFKLQH GUIHQ NHLQHUOHL bQGHUXQJHQ YRUJHQRPPHQ
ZHUGHQ $//*(0(,1(%(6&+5(,%81*'(56b*(0$6&+,1(

IMER INTERNATIONAL übernimmt im Fall der Missachtung der Gesetze $OOJHPHLQH%HVFKUHLEXQJ


hinsichtlich des Einsatzes derartiger Maschinen – insbesondere Die Sägemaschine C 350 iPower besteht aus einem Rahmen (Abb.1,
unzweckmäßiger Gebrauch, fälschliche Speisung, mangelhafte Bez.A) auf ausklappbaren Beinen (Abb.1, Bez.B). Der Schneidkopf
Wartung, nicht genehmigte Umrüstungen, teilweise oder gänzliche (Abb.1,Bez.C) ist auf einem Schlitten montiert und kann vertikal und
Nichtbeachtung der vorliegenden Handbuchanleitungen – keinerlei KRUL]RQWDO HQWODQJ HLQHV$OXPLQLXPSUR¿OV PLW KRKHU 6WHL¿JNHLW YHUIDK-
Haftung. ren werden, das auf zwei Auslegern (Abb.1,Bez.D) gelagert ist. Die ge-
IMER INTERNATIONAL behält sich das Recht vor, die Merkmale der samte Baugruppe kann nach Lockern der Handräder (Abb.2,Bez. A) um
Sägemaschine bzw. den Inhalt des vorliegenden Handbuchs zu ändern, 45° gedreht werden (Abb.2).
ohne vorausgehende Maschinen oder Handbücher zu aktualisieren. Die Sägemaschine ist mit einem Scheibenschutzgehäuse (Abb.1,
Bez.E) ausgestattet, das größtmögliche Betriebssicherheit gewährlei-
7(&+1,6&+('$7(1 stet und den Bediener während des Schneidvorgangs schützt. Mithilfe
Die technischen Daten sind in Tabelle 1, die elektrischen Merkmale in des Goniometers (Abb.1,Bez.G) auf dem Schneidetisch lassen sich pro-
Tabelle 2 angegeben. blemlos unterschiedliche Schnittwinkel einstellen.
Unter dem Rahmen ist ein Wasserbecken aus stoßfestem Kunststoff
Tabelle 1 - TECHNISCHE DATEN (Abb.1, Bez.G) angebracht. Im Inneren des Beckens ist eine
Modell C 350 iPower Tauchpumpe (Abb.1, Bez.H) installiert, die während des Betriebs das
Kühlwasser zu den Sprühdüsen am Scheibengehäuse (Abb.3, Bez.A)
Max. Durchmesser der Diamanttrennscheibe 350 mm
EHI|UGHUW 'HU :DVVHUÀXVV ]XU 7UHQQVFKHLEH OlVVW VLFK PLWKLOIH GHV
Lochdurchmesser der Diamanttrennscheibe 25,4 mm
Hahns (Abb.3, Bez.B) über dem Scheibengehäuse regulieren. Die
Motorleistung einphasig 2.5 kW Maschine ist mit einem Laserpointer ausgestattet, der die Schnittlinie
Max. Drehzahl der Diamanttrennscheibe 2036 rpm auf dem Werkstück markiert (Abb.3,Bez.C).
$EPHVVXQJHQGHU$XÀDJHÀlFKH 1390 x 696 mm
Schnittlänge bei 90° (Stärke= 10 mm) 1050 mm
0DWHULDOLHQGLHEHDUEHLWHWZHUGHQN|QQHQ
ORIGINALBETRIEBSANLEITUNG
Max. Schnitttiefe – Trennscheibe Ø 350, 1-2
120/250mm Folgende Materialien können mit dieser Maschine bearbeitet werden:
Durchgänge
Förderleistung der Wasserpumpe 10 L/1’ Ziegel, Keramik, Marmor, Granit, Bauteile aus Zement u. Ä., deren
Fassungsvermögen des Wasserbeckens 40 L Höchstmaße mit den in Tab. 1 angegebenen Längen, Schnitttiefen und
Abmessungen der Arbeitsplatte kompatibel sind. Höchstgewicht des
Maschinenabmessungen 760 x1746 /H 1535 mm
Schneidmaterials: 35 kg.
Maschinenabmessungen mit Verpackung 746 x 1770 /H 1080 mm
Gewicht mit Verpackung 113 (133) Kg

14
IMER INTERNATIONAL S.p.A.
C 350 iPower
D
%(75,(%66,&+(5+(,7 6,&+(5+(,76(,15,&+781*(1
Die Maschine C 350 iPower wurde unter Beachtung der einschlägigen,
9RUGHU9HUZHQGXQJGHU6lJHPDVFKLQHLVWVLFKHU]XVWHOOHQ
europaweit harmonisierten Sicherheitsvorschriften hergestellt.
GDVVDOOH6FKXW]YRUULFKWXQJHQLQVWDOOLHUWVLQG
Die Sicherheitseinrichtungen wurden nach den Vorgaben der
'LH0DVFKLQHGDUIQLFKWLQEUDQGRGHUH[SORVLRQVJHIlKUGHWHQ Maschinenrichtlinie 2006/42/EWG in erster Linie für den Schutz des
%HUHLFKHQYHUZHQGHWZHUGHQ Bedieners installiert.

Die Sägemaschine verfügt über keine eigene Beleuchtung, d. h., die 6FKXW]XQG6LFKHUKHLWVHLQULFKWXQJHQ
Arbeitsumgebung muss stets ausreichend beleuchtet sein (mind. Die beweglichen Maschinenteile und Gefahrenstellen sind
300 Lux). durch ortsfeste, mit Sperrschrauben befestigte Gehäuse und
Die Versorgungsleitungen müssen so verlegt werden, dass ihre Schutzabdeckungen gegen Berührung geschützt. Alle feststehenden
mögliche Beschädigung ausgeschlossen werden kann. Schutzvorrichtungen, Abdeckungen und Abschirmungen, die
Der Stromanschluss muss so erfolgen, dass kein Wasser in die mit Schrauben befestigt sind, dienen zum Schutz der Bediener
Steckverbindungen eindringen kann. Ausschließlich Steckverbindungen (Wartungspersonal, Techniker, usw.) gegen eventuelle Unfälle durch
und Anschlüsse mit Schutzgehäuse gegen Wasserspritzer verwenden. Stromschlag oder mechanische Bewegungsteile.
Keine ungeeigneten, provisorischen Elektroleitungen ohne Erdleiter Daher ist es nicht gestattet, die Maschine zu verwenden, wenn
verwenden: Ggf. mit Fachpersonal Rücksprache halten. Schutzvorrichtungen verändert oder abgenommen wurden.
Reparaturen an der elektrischen Ausrüstung dürfen ausschließlich von
9RUGHU'XUFKIKUXQJYRQ:DUWXQJVRGHU5HSDUDWXUDUEHLWHQ
einem Elektriker durchgeführt werden. Die Maschine vor Wartungs-
PXVVGLH0DVFKLQHPLWGHP+DXSWVFKDOWHUDXVJHVFKDOWHWXQGGHU
oder Reparaturarbeiten stets von der Stromversorgung trennen.
1HW]VWHFNHUJH]RJHQZHUGHQVRGDVVHLQYHUVHKHQWOLFKHV$QODXIHQ
GHU 7UHQQVFKHLEH DXVJHVFKORVVHQ ZLUG XQG DOOH 6WURPNUHLVH GHU
$//*(0(,1(6,&+(5+(,76+,1:(,6(
0DVFKLQHLVROLHUWVLQG
Es sei darauf hingewiesen, dass die Maschine entsprechend ausgelegt
ist, um neben hohen Leistungsabgaben auch höchste Sicherheit zu
,167$//$7,21'(50$6&+,1(
gewährleisten: Der Bediener ist jedoch gehalten, diese Sicherheit
durch angemessene Vorsichtsmaßnahmen in jeder Arbeitsphase zu
garantieren. Erforderliche Kontrollen und Überprüfungen durch den ,PPHUGHQ1HW]VWHFNHU]LHKHQEHYRUGLH0DVFKLQHYHUVHW]W
Bediener: ZLUG
  9RU MHGHP 9HUVWHOOHQ GHU 0DVFKLQH GDV :DVVHU DXV GHP
'LH)XQNWLRQVWFKWLJNHLWGHU(UGXQJVDQODJHVLFKHUVWHOOHQ
%HFNHQDEODVVHQ
 'LH $UEHLW HUVW EHJLQQHQ QDFKGHP DOOH 6FKXW]YRUULFKWXQJHQ
NRUUHNWSRVLWLRQLHUWVLQGXQGHLQZDQGIUHLIXQNWLRQLHUHQ
3RVLWLRQLHUXQJ
9RUGHU$UEHLWPLWGHU0DVFKLQHVWHWV5LQJH8KUHQ$UPElQGHU
Die Maschine kann für den Gebrauch sowohl auf einer ebenen Fläche,
XQG .UDZDWWHQ DEQHKPHQ (UIDKUXQJVJHPl‰ N|QQHQ GLHVH XQG
die mindestens so groß wie das Becken ist, als auch auf ihren Beinen
DQGHUH*HJHQVWlQGH8QIlOOHDXVO|VHQ=XGHPVLQGZHLWHbUPHODQ
aufgestellt werden.
GHQ+DQGJHOHQNHQ]X]XVFKQUHQODQJH+DDUH]XVDPPHQ]XELQGHQ
Bevor die Maschine auf der Baustelle verstellt wird, den Drehgriff
XQGJHHLJQHWH$UEHLWVVFKXKH]XWUDJHQ
$EE%H]$ LQGHU%RKUXQJXQWHUGHP$OXPLQLXPSUR¿OIHVW]LHKHQ
 %HL GHU $UEHLW VWHWV SHUV|QOLFKH 6FKXW]DXVUVWXQJ
und somit den Schlitten sperren. Der Kopf kann ebenfalls in
ZLH 6FKXW]EULOOH +DQGVFKXKHQ LQ SDVVHQGHU *U|‰H
einer weiteren Bohrung (siehe Abb.4,Bez.B) arretiert werden. Die
*HK|UVFKXW]NDSVHOQ RGHU VW|SVHO XQG IDOOV HUIRUGHUOLFK HLQ
Netzspannung unterbrechen und die Maschine an den Tragegriffen
+DDUQHW]WUDJHQ
im Rahmen (Abb.1,Bez.I) anheben.
.HLQH:HUNVWFNHEHDUEHLWHQGHUHQ*U|‰HRGHU*HZLFKWQLFKW
GHQ 9RUJDEHQ GHV +HUVWHOOHUV GHU 0DVFKLQH HQWVSULFKW VLHKH
$XVNODSSHQGHU6WW]EHLQH
3XQNW 
 %HL ODXIHQGHU 0DVFKLQH VWHWV GLH +lQGH YRP $UEHLWVEHUHLFK Vor dem Ausklappen des ersten Beinpaares den Schlitten mit dem
IHUQKDOWHQ 9RU GHP (QWIHUQHQ YRQ 7HLOHQ LQ GHU 1lKH GHU Handrad (Abb.4, Bez.A) auf der entgegengesetzten Tischseite blockie-
7UHQQVFKHLEHGLH'UHKXQJGXUFK'UFNHQGHU6WRSSWDVWHDQKDOWHQ ren, um die Maschine leichter anheben zu können.
 'LH 0DVFKLQH VDXEHU KDOWHQ 'LH DOOJHPHLQH 5HLQKDOWXQJ GHU Die Maschine hinten (Abb.6,Bez.1) anheben, die Beine wie durch die
0DVFKLQH XQG LQVEHVRQGHUH GHU $UEHLWVWLVFKH  VWHOOW HLQHQ Pfeile 2-3-4 angedeutet ausklappen und anschließend die Maschine
ZLFKWLJHQ6LFKHUKHLWVIDNWRUGDU auf dem Boden abstellen. Vor dem Ausklappen der vorderen Beine den
 'LH 0DVFKLQH YRU 5HLQLJXQJVDUEHLWHQ RGHU GHU $EQDKPH Kopf auf der hinteren Tischseite blockieren. Die Maschine vorne anhe-
YRQ 6FKXW]YRUULFKWXQJHQ ]XU :DUWXQJ RGHU ]XP $XVEDX YRQ ben und die Beine nach dem gleichen Verfahren wie für die hinteren
%DXWHLOHQ  VWHWV DXVVFKDOWHQ XQG YRQ GHU 6WURPYHUVRUJXQJ ausklappen. Zum Einklappen der Beine die obigen Schritte in entgegen-
WUHQQHQ:LUGGLH0DVFKLQH]XU5HLQLJXQJPLW:DVVHUDEJHVSULW]W gesetzter Reihenfolge ausführen.
GDUIGHU:DVVHUVWUDKOQLFKWGLUHNWDXIGDV6WURPDJJUHJDWRGHUGHQ
(OHNWURPRWRUJHULFKWHWZHUGHQ $QKHEHQXQG+DQGKDEXQJ
6WHWVGLHYRP+HUVWHOOHUHPSIRKOHQHQ2ULJLQDO'LDPDQWVFKHLEHQ Die Sägemaschine C 350 iPower wiegt 113; zum Transport kann sie
YHUZHQGHQ XP GLH EHVWHQ /HLVWXQJVDEJDEHQ GHU 0DVFKLQH ]X an den Tragegriffen im Rahmen auf einer Seite von Hand angehoben
HU]LHOHQ und auf den Rädern verfahren werden (Abb.5,Bez.A). Alternativ kann
 $XVVFKOLH‰OLFK ZDVVHUJHNKOWH XQG IU GDV MHZHLOLJH sie mit einem Hubwagen transportiert werden, wobei die Tragegurte
6FKQHLGPDWHULDOJHHLJQHWH7UHQQVFKHLEHQYHUZHQGHQ an den abgebildeten Anschlagpunkten (Abb.5) zu befestigen sind. Die
 'HQ 6FKQLWW GHV 0DWHULDOV QLHPDOV WURFNHQ RGHU EHL Räder erleichtern die Verladung der Maschine auf Transportfahrzeuge
XQ]XUHLFKHQGHU.KOZDVVHU]XIXKUDXVIKUHQ mit Auffahrrampe.
 'LH YRP +HUVWHOOHU DQJHJHEHQH K|FKVW]XOlVVLJH
6FKHLEHQGUHK]DKOQLFKWEHUVFKUHLWHQ 67520$16&+/866
 $XI NHLQHQ )DOO 5HGX]LHUULQJH YHUZHQGHQ XP GLH hEHUSUIHQREGHU6SDQQXQJVZHUWPLWGHQ'DWHQDXIGHP
6FKHLEHQERKUXQJ GHP )ODQVFK DQ]XSDVVHQ 1XU 6FKHLEHQ 7\SHQVFKLOGGHU0DVFKLQHEHUHLQVWLPPW
YHUZHQGHQ GHUHQ %RKUXQJ DXI GHQ )ODQVFK GHU 0DVFKLQH SDVVW
=ROO  Die Stromversorgungsleitung muss über eine
 1LHPDOV 'LDPDQWVFKHLEHQ YHUZHQGHQ GLH 5LVVH RGHU Überstromschutzeinrichtung (z. B. Leitungsschutzschalter) verfügen
9HUIRUPXQJHQDXIZHLVHQ und gegen indirekte Kontakte geschützt sein (z. B. FI-Schalter). Die
 'LH $QOHLWXQJHQ LP YRUOLHJHQGHQ +DQGEXFK VLQG IU GLH Maschine an die Erdung anschließen. Bei der Bemessung der Leiter
$QZHQGHU %HGLHQXQJVXQG:DUWXQJVSHUVRQDO EHVWLPPW des Versorgungskabels müssen die Betriebsstromstärke und die Länge
der Leitung berücksichtigt werden, um übermäßige Spannungsabfälle
zu vermeiden (Tabelle 4 S.4).

15
IMER INTERNATIONAL S.p.A.
C 350 iPower
D
Tabelle 4 Der Laser ist genau auf die Scheibe ausgerichtet, seine Position darf
Kabelquerschnitt (mm²)
nicht verändert werden.
Modell Motortyp 'HU3RLQWHULVWPLWHLQHP1LHGULJOHLVWXQJV/DVHUDXVJHVWDWWHW(V
1.5 2.5 4.0
VROOWHGHQQRFKYHUPLHGHQZHUGHQGLUHNWLQGLH/DVHUTXHOOH]XEOLFNHQ

Kabellänge
220-230 V :$5781*

(m)
C 350 iPOWER 0 ÷ 22 23 ÷ 26 28 ÷ 43
13.5 A
9RUEHPHUNXQJ
Die normalen, regelmäßigen Wartungsarbeiten können auch von
nicht spezialisiertem Personal ausgeführt werden, falls die in den
Den Stecker der Sägemaschine am Stromnetz anschließen und die vorhergehenden und nachfolgenden Absätzen beschriebenen
mechanische Sperrnutmutter mit Schutzart IP67 festschrauben. Sicherheitshinweise beachtet werden.
Die Sägemaschine ist nun betriebsbereit. ***
5HLQLJXQJGHU0DVFKLQH
,1%(75,(%1$+0('(56b*(0$6&+,1( Die Reinigung darf nur bei stillstehender Maschine durchgeführt werden.
Das Netzkabel am Stecker der Schalttafel anschließen. Die
Sägemaschine mit dem grünen Schalter auf der Schalttafel über dem 'LH6FKDOWHUGHU6WURPYHUVRUJXQJPVVHQ]XYRU
Motor einschalten, der rote Schalter dient zum Ausschalten. DXIÄ´JHVWHOOWXQGGLH1HW]VWHFNHUJH]RJHQZHUGHQ
Der Schalter verfügt über eine Schutzvorrichtung bei Erreichen einer
Mindestspannung: Nach Stromausfall muss die grüne Start-Taste 1. Keine Druckluft verwenden, da dadurch Staub und Rückstände in
erneut gedrückt werden. schwer erreichbare Ecken geblasen werden.
In Notfällen ist die Maschine durch Drücken der roten Stopp-Taste 2. Überprüfen, ob die Kühlwasserdüsen verstopft sind.
(hervorstehend) anzuhalten; anschließend den Netzstecker ziehen. 3. Insbesondere darauf achten, dass das Kühlwasser im Becken täglich
gewechselt wird.
:b50(6&+87= 4. Es wird davon abgeraten, Reinigungs- oder Schmiermittel zu
verwenden.
  (LQ :lUPHVHQVRU VFKW]W GHQ (OHNWURPRWRU YRU
hEHUEHODVWXQJ %HL hEHUKLW]XQJ ZLUG GHU 0RWRU DQJHKDOWHQ 'HQ 5HLQLJXQJGHV%HFNHQV
0RWRU DENKOHQ ODVVHQ XQG DQVFKOLH‰HQG GXUFK 'UFNHQ GHV Die Reinigung des Beckens ist mindestens einmal täglich bzw. immer
6FKDOWHUVHUQHXWHLQVFKDOWHQ dann auszuführen, wenn sich Ablagerungen am Boden absetzen;
wird die Reinigung unterlassen, sind Probleme an der Tauchpumpe
*(%5$8&+'(50$6&+,1( für die Versorgung der Diamanttrennscheibe mit Kühlwasser nicht
auszuschließen.
%HWULHE Um das Becken zu reinigen, den Verschluss entfernen und mit
'LH NRUUHNWH $UEHLWVVHLWH IU GHQ %HGLHQHU LVW LQ $EE  PLW %H] ; direktem Wasserstrahl ausspülen. Er darf jedoch nicht auf elektrische
gekennzeichnet. Komponenten gerichtet werden.
Das Becken bis zum Erreichen des Höchstfüllstands mit Wasser befüllen
(ca. 40 Liter). Die Maschine an die Stromversorgung anschließen und 5HLQLJXQJGHV.KOZDVVHUNUHLVODXIV
gemäß Beschreibung in Abs. 10 in Betrieb nehmen. Die Reinigung des Kühlwasserkreislaufs muss regelmäßig (oder
Den Hahn (Bez.M, Abb.1) öffnen und überprüfen, ob reichlich bei einer Abnahme der Kühlwassermenge auf die Diamantscheibe)
.KOZDVVHUDXIGLH'LDPDQWVFKHLEHÀLH‰W ausgeführt werden; hierzu die Verteilerdüse im Scheibenschutzgehäuse
(Abb.1, Bez.E) ausbauen und mit Wasser reinigen.
6FKQLWW Die Kühlwasser-Versorgungsleitung, die von der Pumpe zum Hahn und
Die Kopfgruppe nach hinten zum Anschlag (vom Bediener weg) schieben, zum Schutzgehäuse der Scheibe führt, regelmäßig mit Wasser reinigen.
GDV6FKQHLGJXW $EE%H]$ DXIGLH$UEHLWVÀlFKHOHJHQXQGJHJHQGHQ
Anschlag schieben. Für Schrägschnitte den gewünschten Schneidwinkel 6FKHLEHQZHFKVHO
mit dem Goniometer oder dem Laserpointer einstellen. Um die Höhe Die Diamantscheibe ist aus Material gefertigt, das bei hohen
des Schneidkopfes einzustellen, das Handrad (Abb.7, Bez.B) lockern, Temperaturen beschädigt werden kann und deshalb während des
den Kopf auf die gewünschte Höhe einstellen und das Handrad wieder Betriebs gekühlt werden muss.
festziehen. Die Sägemaschine wie in Abschn. 10 beschrieben einschalten Für den Austausch der Scheibe ist folgendermaßen vorzugehen:
und den Schlitten am Griff (Abb.7,Bez.C) verschieben, um den Schnitt 1. Durch Anziehen des Handrads die vertikale Verstellbewegung der
auszuführen. Durch eine für die Dicke und Härte des Materials zu hohe Schneidkopfgruppe blockieren (Abb.1, Bez.D).
Vorschubgeschwindigkeit kann die Scheibendrehung blockiert werden. 2. Das vordere Schutzgehäuse abnehmen (Abb.1, Bez.E).
In diesem Fall den Schlitten so schnell wie möglich zurückfahren und 3. Die Sicherungsmutter mit dem im Lieferumfang der Maschine
die Trennscheibe freigeben, bis sie wieder ihre Nenndrehzahl erreicht enthaltenen 32-mm-Schlüssel durch Drehen im Uhrzeigersinn
hat. Den Schnitt erneut beginnen und die Vorschubgeschwindigkeit den (Linksgewinde) lockern.
Materialeigenschaften anpassen.. 4. Die Trennscheibe zunächst seitlich verschieben und dann leicht
'DV%HFNHQPXVVZlKUHQGGHV%HWULHEVVWHWVJHIOOWVHLQ geneigt aus ihrem Sitz herausziehen.
EHLOlQJHUHQ$UEHLWVSKDVHQGDV:DVVHUUHJHOPl‰LJZHFKVHOQXQG (VGUIHQVLFKNHLQH)UHPGN|USHU]ZLVFKHQGHQ%HIHVWLJXQJVÀDQVFKHQ
GLH$EODJHUXQJHQDXVGHP%HFNHQHQWIHUQHQ XQGGHU'LDPDQWVFKHLEHEH¿QGHQ)UGHQ$XVEDXRGHUGLH5HLQLJXQJ
auf keinen Fall Werkzeuge verwenden, die ein Verbeulen oder die
6FKUlJVFKQLWW Änderung der Geometrie des Flanschs verursachen könnten.
'LH +DQGUlGHU (Abb.7,Bez.D) ORFNHUQ GHQ 6FKQHLGNRSI QHLJHQ 6. Zur Montage der neuen Trennscheibe die Arbeitsschritte unter Punkt
XQG GLH +DQGUlGHU HUQHXW IHVW]LHKHQ DQVFKOLH‰HQG JHPl‰ 4 in umgekehrter Reihenfolge ausführen. Hierbei ist insbesondere auf
%HVFKUHLEXQJXQWHUGHPYRUKHUJHKHQGHQ3XQNWIRUWIDKUHQ die Drehrichtung der Diamantscheibe zu achten.
7. Die Sicherungsmutter der Scheibe durch Drehen gegen den
/DVHUSRLQWHU Uhrzeigersinn (Linksgewinde) mit einem Anzugsmoment von 40 Nm
Die Maschine ist mit einem Laserpointer ausgestattet, der die Schnittlinie korrekt blockieren.
auf das Werkstück projiziert (Abb.3,Bez.C). Der Lichtstrahl gibt die 9RUGHP$XVWDXVFKGHU7UHQQVFKHLEHLPPHUGHQ1HW]VWHFNHU
Schnittlinie der Diamantscheibe während des Vorschubs vor. Durch die ]LHKHQ
Übereinstimmung von Schnittmarkierung und Laserstrahl wird höchste
Schneidpräzision gewährleistet. Für Schnitte im rechten Winkel zu :HFKVHOGHV$QWULHEVULHPHQV
einer Kante des Werkstücks ist keine Markierung erforderlich: Es ist Die Maschine ist mit einem dauerhaft vorgespannten Spezialriemen
ausreichend, dass die Bezugskante am Anschlag des Schneidetischs ausgestattet. Für seinen Austausch bitte eine autorisierte
anliegt. Analog hierzu können mithilfe des Goniometers Schnitte mit der Kundendienststelle kontaktieren.
gewünschten Neigung ausgeführt werden.
Der Laserstrahl zeigt die tatsächliche Schnittposition an. Der Laserpointer
wird mit dem Schalter (Abb.3,Bez.E) ein- und ausgeschaltet.

16
IMER INTERNATIONAL S.p.A.
C 350 iPower
D
(LQVWHOOXQJGHV6FKOLWWHQVSLHOV 67g581*(1856$&+(1$%+,/)(1
'HU6FKOLWWHQZLUGPLWWHOV5ROOHQHQWODQJGHV$OXPLQLXPSUR¿OVYHUIDKUHQ
 $&+781* 6lPWOLFKH :DUWXQJVDUEHLWHQ GUIHQ HUVW QDFK
Mit der Zeit entsteht ein gewisses Spiel, das die Schnittpräzision beein-
GHP$EVFKDOWHQGHU0DVFKLQHGXUFKJHIKUWZHUGHQGK3RVLWLR-
trächtigt. Für die Einstellung der Rollen bitte eine autorisierte Kunden-
QLHUXQJGHV6FKDOWHUVDXIXQG7UHQQXQJGHU6WHFNDQVFKOVVH
dienststelle kontaktieren.
YRP6WURPQHW]
5HSDUDWXUHQ
Die Reparaturenan der elektrischen Ausrüstung dürfen ausschließlich Störungen Ursachen Abhilfen
von Fachpersonal durchgeführt werden. Bei Bedarf sind ausschließlich Die Stromleitung hat Die Leitung kontrollieren *
Original-Ersatzteile von IMER zu verwenden, an denen keine keine Spannung
Änderungen vorgenommen werden dürfen. An der Maschine Die Steckdose und Den korrekten Anschluss
C 350 iPower müssen aufgrund ihrer besonderen Bauweise keine der Stromstecker wieder herstellen
sind nicht richtig
weiteren Wartungsarbeiten als die bereits genannten ausgeführt verbunden
werden. Die Kontakte des Steckers und der Stecker-Schalter-Gruppe
Der Schalter des Die Drucktaste ON des
auf ihren einwandfreien Zustand überprüfen. Falls sie oxidiert sind, Fehlerstromschutzes Fehlerstromschutzes
müssen sie umgehend gereinigt werden. wurde nicht betätigt betätigen
Beim Drücken des
1DFKHLQHP$QVSUHFKHQGHV)HKOHUVWURPVFKXW]VFKDOWHUVLVW Betriebsschalters
Das Stromkabel vom Das Kabel auswechseln *
GLH0DVFKLQHDXVVFKOLH‰OLFKGXUFK)DFKSHUVRQDONRQWUROOLHUHQXQG springt der Motor
Stecker zur Schalttafel
JJIUHSDULHUHQ]XODVVHQ ist unterbrochen
nicht an
Ein Leiter im Inneren Den Anschluss wieder
(QWVRUJXQJGHU$EIlOOH der Klemmleiste herstellen *
des Motors ist
Für die Entsorgung der Abfälle, die mit der Verwendung der unterbrochen
Maschine anfallen, sind die einschlägigen Gesetze und Vorschriften zu
Ein Leiter im Inneren Den Anschluss wieder
beachten. der Schalttafel ist herstellen *
unterbrochen
5(675,6,.(181'6,&+(5+(,76+,1:(,6( Der Betriebsschalter Den Schalter
Obwohl die Sägemaschine unter Beachtung aller geltenden Vorschriften ist defekt auswechseln *
gebaut wurde, weist sie Restrisiken auf, die nicht beseitigt werden In der Wanne fehlt Wasser nachfüllen
können und die Verwendung geeigneter persönlicher Schutzausrüstung Wasser
notwendig machen. Eine angemessene Beschilderung auf der Maschine Es gelangt kein 3XPSHQ¿OWHUYHUVWRSIW 'HQ3XPSHQ¿OWHUUHLQLJHQ
zeigt die Risiken an und gibt Hinweise zum richtigen Verhalten. Kühlwasser zum
Sägeblatt Die Pumpe hat keinen Die Stromversorgung der
Strom Pumpe überprüfen *
/b505,6,.2
Pumpe defekt Die Pumpe auswechseln *
Das Sägeblatt wurde Das Sägeblatt ausbauen
'DV*HK|UPXVVJHVFKW]WZHUGHQ umgekehrt zur und in der auf dem Etikett
Das Sägeblatt Drehrichtung montiert angegebenen Richtung
schneidet nicht einsetzen
9(5/(7=81*65,6,.2$1'(1+b1'(1 Sägeblatt abgenutzt Das Sägeblatt
auswechseln
(VPVVHQ+DQGVFKXKHJHWUDJHQZHUGHQ * Diese Arbeit muss von einem Elektriker ausgeführt werden

9(5/(7=81*65,6,.2$1'(1$8*(1

'LH$XJHQPVVHQJHVFKW]WZHUGHQ

5,6,.2'(50,66%5b8&+/,&+(19(5:(1'81*

9RUGHP*HEUDXFKPXVVGDV+DQGEXFK
JHOHVHQZHUGHQ

'HU6FKQLWWPXVVPLW:DVVHUDXVJHIKUWZHUGHQ

6&+1,77*()$+5

*()$+56&+:(5(56752081)b//(

*()$+5/$6(5675$+/

Wir weisen darauf hin, dass die Kontrolle über die Verwendung der PSA
dem Arbeitgeber obliegt.

17
IMER INTERNATIONAL S.p.A.
C 350 iPower
E
Apreciado Cliente: Tabla 2
(QKRUDEXHQDSRUVXFRPSUDODVLHUUD,0(5HVHOUHVXOWDGRGHDxRVGH Características eléctricas Motor (230V/50Hz) (220V/60Hz)
H[SHULHQFLDHLQFRUSRUDVROXFLRQHVWpFQLFDVLQQRYDGRUDVSDUDRIUHFHU
Potencia (kW) 2.5
ODPi[LPD¿DELOLGDG
Tensión nominal (V) 220/230
Frecuencia (Hz) 50/60
75$%$-(&216(*85,'$' Corriente absorbida (A) 15
3DUD WUDEDMDU HQ FRQGLFLRQHV VHJXUDV HV IXQGDPHQWDO OHHU FRQ
Número de polos 2
DWHQFLyQODVVLJXLHQWHVLQVWUXFFLRQHV
2800 (50Hz)
Revoluciones (rpm)
3400 (60Hz)
El presente manual de USO Y MANTENIMIENTO debe permanecer en
la obra al cuidado del responsable y ha de estar siempre disponible Tipo de servicio S6 40%
para su consulta. Clase de aislamiento F
El manual ha de considerarse parte de la máquina y conservarse para Grado de protección IP55
futuras consultas (EN 12100-2) hasta que la máquina se desguace. Si Condensador (µF) 60 (Ø 95x55)
se pierde o se daña, solicite un nuevo ejemplar al fabricante.
El manual contiene importantes indicaciones sobre la preparación de la 1250$6'(',6(f2
obra y la instalación, el uso, el mantenimiento y el pedido de recambios La sierra C 350 iPower ha sido proyectada y realizada de conformidad
de la máquina. No obstante, es indispensable que el montador y el con las siguientes normas: UNI EN 12418:2001; EN 12100-1/2:2005;
usuario tengan una adecuada experiencia y conozcan la máquina. Para EN 60204-1:2006.
garantizar la seguridad del operador y el funcionamiento correcto de la
máquina durante mucho tiempo, es preciso respetar las instrucciones 1,9(/'((0,6,Ï162125$<9,%5$&,21(675$160,7,'$6
del manual además de las normas vigentes de seguridad y prevención (QOD7DEOD¿JXUDHOQLYHOGHSUHVLyQVRQRUDPHGLGRHQHORtGRGHO
de accidentes laborales (uso de calzado y ropa apropiados, cascos, operador en vacío (LpA) y de las vibraciones transmitidas durante el
mascarillas antipolvo, guantes, gafas, etc.). trabajo.
  0DQWHQJD ODV HWLTXHWDV GH DGYHUWHQFLD GH OD PiTXLQD
VLHPSUHOHJLEOHV Tabla 3
Modelo Tipo de motor LpA Aeq
  6H SURKtEH PRGL¿FDU GH FXDOTXLHU PRGR OD HVWUXFWXUD
PHWiOLFDRODVGLVWLQWDVSDUWHVGHODVLHUUD C 350 iPOWER Elettrico 86 dB 2.63 m/s2

IMER INTERNATIONAL declina toda responsabilidad ante el '(6&5,3&,Ï1*(1(5$/'(/$6,(55$


incumplimiento de las normas que reglamentan el uso de esta máquina;
en particular, por: uso impropio, defectos de alimentación, falta de 'HVFULSFLyQJHQHUDO
PDQWHQLPLHQWRPRGL¿FDFLRQHVQRDXWRUL]DGDVHLQREVHUYDQFLDWRWDOR La sierra C 350 iPowerHVWiFRPSXHVWDSRUXQEDVWLGRU ¿JUHI
parcial de las instrucciones dadas en este manual. A) FRQSDWDVSOHJDEOHV ¿JUHI% (OFDEH]DOGHFRUWH ¿JUHI& 
,0(5 ,17(51$7,21$/ VH UHVHUYD HO GHUHFKR GH PRGL¿FDU ODV está instalado sobre un carro y se desplaza en horizontal y en vertical a
características de la sierra o los contenidos del manual sin obligación ORODUJRGHXQSHU¿OGHDOXPLQLRGHDOWDULJLGH]'LFKRSHU¿OGHDOXPLQLR
de actualizar las máquinas o los manuales precedentes. HVWiHPSHUQDGRDGRVEUD]RV ¿JUHI' \HOJUXSRVHSXHGHJLUDUƒ
¿J DÀRMDQGRORVYRODQWHV ¿JUHI$ . La sierra está provista de un
'$7267e&1,&26 FiUWHU ¿JUHI( SDUDJDUDQWL]DUODPi[LPDVHJXULGDGGHORSHUDGRU
/RVGDWRVWpFQLFRV¿JXUDQHQOD7DEOD\ODVFDUDFWHUtVWLFDVHOpFWULFDV durante el corte. En la mesa de corte está instalado el goniómetro
en la Tabla 2. ¿J  UHI )  TXH SHUPLWH PRGL¿FDU HO iQJXOR GH FRUWH (O GHSyVLWR
¿J  UHI *  GH SOiVWLFR DQWLFKRTXH HVWi ¿MDGR GHEDMR GHO EDVWLGRU
Tabla 1 - DATOS TÉCNICOS /DERPEDGHDJXDGHLQPHUVLyQ ¿JUHI+ HVWiDORMDGDGHQWURGHO
Modelo C 350 iPOWER GHSyVLWR\VHHQFDUJDGHDOLPHQWDUODVERTXLOODV ¿JUHI$ PRQWDGDV
sobre el cárter para refrigerar el disco durante el funcionamiento. Sobre
Diámetro máximo del disco diamantado 350 mm
HO FiUWHU GHO GLVFR VH HQFXHQWUD HO JULIR ¿J  UHI %  TXH UHJXOD HO
'LiPHWURGHORUL¿FLRGHOGLVFRGLDPDQWDGR 25,4 mm
caudal de agua del disco de corte. La máquina incorpora un puntero
Potencia del motor monofásico 2.5 kW láser que reproduce la línea de corte de la pieza que se está trabajando
Velocidad máxima de rotación del disco 2036 rpm (Fig.3,Rif.C).
0HGLGDVGHODVXSHU¿FLH 1390 x 696 mm
Longitud de corte a 90°(esp.= 10 mm) 1050 mm
Profundidad máxima de corte del disco Ø 350 0DWHULDOHVFRPSDWLEOHV
120/250 mm Esta máquina permite cortar cerámica, materiales lapídeos, mármol,
con 1 o 2 pasadas
Caudal de la bomba de agua 10 L/1’ granito, ladrillos y piedra, obras de cemento y materiales similares cuyas
Capacidad del depósito de agua 40 L dimensiones máximas sean compatibles con la longitud, la profundidad
GHFRUWH\HOWDPDxRGHODPHVDHVSHFL¿FDGRVHQODWDEOD(OSHVR
INSTRUCCIONES ORIGINALES

Medidas de la máquina 760 x1746 /H 1535 mm


máximo de las piezas a cortar es de 35 kg.
Medidas de la máquina embalada 746 x 1770 /H 1080 mm
Peso con embalaje 113 (133) Kg

18
IMER INTERNATIONAL S.p.A.
C 350 iPower
E
6(*85,'$'23(5$7,9$ ',6326,7,926'(6(*85,'$'
La sierra C 350 iPower cumple las normativas de seguridad armonizadas
$QWHVGHXWLOL]DUODVLHUUDFHUFLyUHVHGHTXHWHQJDWRGRVORV
para el ámbito europeo.
GLVSRVLWLYRVGHSURWHFFLyQLQVWDODGRV
Con arreglo a la Directiva de Máquinas 2006/42/CE, los dispositivos
  /D VLHUUD QR GHEH HPSOHDUVH HQ DPELHQWHV GRQGH H[LVWD de seguridad se han instalado teniendo en cuenta en primer lugar la
SHOLJURGHH[SORVLyQRGHLQFHQGLR seguridad del operador. C 350 iPower

La sierra no dispone de iluminación propia, por lo cual el lugar de trabajo 3URWHFFLRQHV\GLVSRVLWLYRVGHVHJXULGDG


KDGHHVWDUVX¿FLHQWHPHQWHDOXPEUDGR PtQOX[  /DPiTXLQDHVWiSURYLVWDGHFXELHUWDV¿MDVEORTXHDGDVFRQWRUQLOORV\
Los cables de alimentación se deben tender de manera que no puedan de protecciones que impiden el acceso a las partes en movimiento y a
ser dañados. ODV]RQDVSHOLJURVDV7RGDVODVSURWHFFLRQHV¿MDVFXELHUWDV\SDQWDOODV
/DFRQH[LyQHOpFWULFDVHGHEHUHDOL]DUGHIRUPDTXHHODJXDQRSXHGD ¿MDGDV FRQ WRUQLOORV WLHQHQ OD IXQFLyQ GH SURWHJHU D ORV RSHUDGRUHV
penetrar en los conectores. Utilice exclusivamente conectores provistos PDQWHQHGRUHV WpFQLFRV \ GHPiV SHUVRQDO GH HYHQWXDOHV GHVFDUJDV
de protección contra las salpicaduras de agua. HOpFWULFDV\GDxRVFDXVDGRVSRUSDUWHVPHFiQLFDVHQPRYLPLHQWR
1RXWLOLFHOtQHDVHOpFWULFDVLQDGHFXDGDVSURYLVLRQDOHVRGHVSURYLVWDVGH Por lo tanto, no se permite utilizar la máquina si dichas protecciones han
FRQGXFWRUGHWLHUUDVLHVSUHFLVRFRQVXOWHFRQXQWpFQLFRHVSHFLDOL]DGR VLGRPRGL¿FDGDVRGHVPRQWDGDV
/DVUHSDUDFLRQHVGHODVLQVWDODFLRQHVHOpFWULFDVGHEHQVHUUHDOL]DGDV
  $QWHV GH UHDOL]DU FXDOTXLHU WDUHD GH PDQWHQLPLHQWR R
H[FOXVLYDPHQWH SRU WpFQLFRV HVSHFLDOL]DGRV 'HVFRQHFWH OD PiTXLQD
UHSDUDFLyQHQODPiTXLQDHVSUHFLVRDSDJDUODFRQHOLQWHUUXSWRU
GH OD DOLPHQWDFLyQ HOpFWULFD DQWHV GH UHDOL]DU FXDOTXLHU RSHUDFLyQ GH
JHQHUDO \ GHVHQFKXIDUOD GH OD DOLPHQWDFLyQ JHQHUDO SDUD DLVODU
mantenimiento o reparación.
WRGRV VXV FLUFXLWRV HOpFWULFRV OR TXH HYLWDUi XQ DUUDQTXH
DFFLGHQWDO
$'9(57(1&,$6*(1(5$/(6'(6(*85,'$'
Se recuerda que esta máquina ha sido realizada para ofrecer, además
,167$/$&,Ï1'(/$0È48,1$
de las mejores prestaciones, la máxima seguridad. No obstante, el
operador ha de garantizar dicha seguridad prestando atención en cada
momento del trabajo. Se aconseja a los trabajadores;   $QWHV GH PRYHU OD PiTXLQD GHVHQFK~IHOD VLHPSUH GH OD
FRUULHQWHHOpFWULFD
&RPSUREDUODH¿FDFLDGHOVLVWHPDGHGHVFDUJDDWLHUUD
9DFtHHOGHSyVLWRDQWHVGHWUDVODGDUODPiTXLQD
 7UDEDMDU VLHPSUH FRQ WRGDV ODV SURWHFFLRQHV LQVWDODGDV \ HQ
SHUIHFWDVFRQGLFLRQHVGHIXQFLRQDPLHQWR
(PSOD]DPLHQWR
 4XLWDUVH DQLOORV UHORMHV SXOVHUDV \ FRUEDWDV DQWHV GH XWLOL]DU
3DUD VX XVR OD PiTXLQD GHEH DSR\DUVH HQ XQD VXSHU¿FLH DO PHQRV
OD PiTXLQD OD H[SHULHQFLD GHPXHVWUD TXH HVWRV REMHWRV \ RWURV
WDQDPSOLDFRPRHOEDVWLGRU\VX¿FLHQWHPHQWHUHJXODURELHQVREUHODV
VLPLODUHVSXHGHQSURYRFDUDFFLGHQWHV7DPELpQGHEHDERWRQDUVH
patas de soporte.
ELHQ ORV SXxRV UHFRJHUVH HO FDEHOOR ODUJR \ XWLOL]DU FDO]DGR
Durante el transporte en obra de la máquina, bloquee el carro apre-
UHVLVWHQWH
WDQGRHOSRPR ¿JUHI$ HQFRUUHVSRQGHQFLDFRQHORUL¿FLRVLWXD-
(PSOHDUVLHPSUHORVHTXLSRVGHSURWHFFLyQLQGLYLGXDOJDIDVGH
GRGHEDMRGHOSHU¿OGHDOXPLQLR(VSRVLEOHPRGL¿FDUODSRVLFLyQGH
VHJXULGDGJXDQWHVGHWDPDxRDSURSLDGRSDUDODPDQRDXULFXODUHV
EORTXHRGHOFDEH]DOXWLOL]DQGRHOVHJXQGRRUL¿FLRTXHVHHQFXHQWUD
\JRUURVSDUDVXMHWDUHOFDEHOORFXDQGRVHDQHFHVDULR
HQODSRVLFLyQLOXVWUDGD ¿JUHI%). Interrumpa la alimentación y
1RFRUWDUSLH]DVGHWDPDxRRSHVRQRFRQIRUPHVDORVLQGLFDGRV
OHYDQWHODPiTXLQDVXMHWiQGRODSRUODVPDQLOODVGHOEDVWLGRU ¿J
SRUHOIDEULFDQWH DSDUWDGR 
ref. 1).
1RDFHUFDUODVPDQRVDOD]RQDGHWUDEDMRPLHQWUDVODPiTXLQD
HVWiHQPDUFKD$QWHVGHH[WUDHUFXDOTXLHUWUR]RTXHKD\DTXHGDGR
$SHUWXUDGHODVSDWDVGHVRSRUWH
MXQWR DO GLVFR SUHVLRQDU HO SXOVDGRU GH SDUDGD SDUD GHWHQHU HO
PRYLPLHQWRGHURWDFLyQ $QWHV GH DEULU ODV SDWDV EORTXHH HO FDUUR FRQ HO YRODQWH ¿J 
0DQWHQHUODPiTXLQDOLPSLD/DOLPSLH]DJHQHUDOGHODPiTXLQD ref. A) situado en el lado opuesto al lado por el que se alza la máquina,
HQSDUWLFXODUGHODVPHVDVGHWUDEDMR HVXQIDFWRULPSRUWDQWHGH para facilitar la maniobra.
VHJXULGDG 3DUD DEULU OD SDWDV OHYDQWH OD SDUWH SRVWHULRU GH OD PiTXLQD ¿J 
3DUDUODPiTXLQD\GHVFRQHFWDUODGHODFRUULHQWHHOpFWULFDDQWHV ref. 1) y repita la secuencia de movimientos descrita en los puntos 2,
GH OLPSLDUOD R GH TXLWDU FXDOTXLHU SURWHFFLyQ SRU HMHPSOR SDUD 3 y 4. A continuación, apoye la máquina en el suelo. Antes de abrir las
UHDOL]DU HO PDQWHQLPLHQWR R SDUD GHVPRQWDU DOJ~Q FRPSRQHQWH  SDWDVDQWHULRUHVGHVSODFHHOFDEH]DO\EORTXpHORHQHOODGRRSXHVWRDO
6L OD OLPSLH]D VH UHDOL]D FRQ FKRUURV GH DJXD QR RULHQWDUORV que se debe izar para facilitar la maniobra. Levante la parte anterior de
GLUHFWDPHQWH VREUH HO JUXSR GH DOLPHQWDFLyQ R VREUH HO PRWRU la máquina y repita la secuencia de apertura de las patas posteriores.
HOpFWULFR Para cerrar las patas, repita dichas secuencias de operaciones en
3DUDFRQVHJXLUODVPHMRUHVSUHVWDFLRQHVGHODPiTXLQDXWLOL]DU orden inverso.
ORVGLVFRVGLDPDQWDGRVRULJLQDOHVTXHUHFRPLHQGDHOIDEULFDQWH
(PSOHDUH[FOXVLYDPHQWHGLVFRVUHIULJHUDGRVSRUDJXD\GHWLSR (OHYDFLyQ\WUDQVSRUWH
DGHFXDGRSDUDHOPDWHULDODFRUWDU La sierra C 350 iPower pesa 113 kg y se puede transportar de
1RFRUWDUHQVHFRRFRQEDMRFDXGDOGHDJXDGHUHIULJHUDFLyQ modo manual sujetándola por las manillas del bastidor y levantando
 1R VXSHUDU QXQFD OD YHORFLGDG GH ORV GLVFRV LQGLFDGD SRU HO XQR GH ORV ODGRV SDUD GHVSOD]DUOD FRQ D\XGD GH ODV UXHGDV ¿J 
IDEULFDQWH ref. A) o bien utilizando un elevador y enganchando las eslingas
1RXWLOL]DUDQLOORVGHUHGXFFLyQSDUDDGDSWDUHORUL¿FLRGHOGLVFR GH ¿MDFLyQ HQ ORV SXQWRV LQGLFDGRV ¿J   /DV UXHGDV IDFLOLWDQ ODV
D OD EULGD 8WLOL]DU H[FOXVLYDPHQWH GLVFRV FX\R RUL¿FLR FRLQFLGD maniobras de carga de la máquina en los medios de transporte con
FRQODEULGDVXPLQLVWUDGDFRQODPiTXLQD   plataforma.
1RXWLOL]DUQXQFDGLVFRVGLDPDQWDGRVTXHHVWpQDJULHWDGRVR
GHIRUPDGRV &21(;,Ï1(/e&75,&$
 /DV LQVWUXFFLRQHV FRQWHQLGDV HQ HVWH PDQXDO HVWiQ &RPSUXHEHTXHODWHQVLyQGLVSRQLEOHVHDLJXDODODTXHVH
GHVWLQDGDVDOSHUVRQDOTXHWUDEDMHFRQODPiTXLQD RSHUDGRUHV\ LQGLFDHQODSODFDGHGDWRVGHODPiTXLQD
PDQWHQHGRUHV 
/D OtQHD GH DOLPHQWDFLyQ HOpFWULFD GHEH HVWDU GRWDGD GH SURWHFFLyQ
FRQWUD VREUHFRUULHQWHV S HM FRQ XQ LQWHUUXSWRU PDJQHWRWpUPLFR  \
contra los contactos indirectos (p. ej. con un interruptor diferencial).
Conecte la máquina al sistema de descarga a tierra. Los conductores
GHOFDEOHGHDOLPHQWDFLyQHOpFWULFDGHEHQWHQHUGLPHQVLRQHVDGHFXDGDV
SDUDODVFRUULHQWHVGHIXQFLRQDPLHQWR\SDUDODORQJLWXGGHODOtQHDD¿Q
de evitar caídas excesivas de tensión (tabla 4, pág.4).

19
IMER INTERNATIONAL S.p.A.
C 350 iPower
E
CRQHFWH OD FODYLMD HOpFWULFD GH OD VLHUUD HQ OD WRPD GH FRUULHQWH \ 0$17(1,0,(172
enrosque la tuerca de retención con grado de protección IP67.
Ahora, la sierra está preparada para empezar a trabajar. *** &RQVLGHUDFLRQHVSUHOLPLQDUHV
Las operaciones de mantenimiento ordinario pueden ser realizadas
38(67$(10$5&+$'(/$6,(55$ incluso por personal no especializado, siempre que se respeten las
&RQHFWH HO FDEOH GH DOLPHQWDFLyQ HOpFWULFD D OD FODYLMD GHO FXDGUR indicaciones de seguridad incluidas en este manual.
HOpFWULFR 3RQJD HQ PDUFKD OD VLHUUD SXOVDQGR HO ERWyQ YHUGH GHO
LQWHUUXSWRUGHOFXDGURHOpFWULFRVLWXDGRHQFLPDGHOPRWRU(OERWyQURMR /LPSLH]DGHODPiTXLQD
detiene la sierra. La limpieza debe realizarse siempre con la máquina parada.
El interruptor está dotado de protección contra la tensión mínima. Si se
/RVLQWHUUXSWRUHVGHHQHUJtDHOpFWULFDGHEHQHVWDUVLHPSUH
YHUL¿FDXQDIDOWDGHDOLPHQWDFLyQSRUFDXVDVDFFLGHQWDOHVSXOVH RWUD
en
vez el botón verde de arranque.
SRVLFLyQ\ODVFODYLMDVGHVHQFKXIDGDVGHODUHGHOpFWULFD
En caso de emergencia, pare la máquina con el botón rojo (saliente) y
luego desenchúfela de la toma de corriente.
1. No utilice aire comprimido, ya que empujaría el polvo y los residuos
hacia los rincones menos accesibles.
3527(&&,Ï17e50,&$
 &RPSUXHEH TXH ODV ERTXLOODV GHO DJXD GH UHIULJHUDFLyQ QR HVWpQ
  (O PRWRU HOpFWULFR HVWi SURWHJLGR FRQWUD ODV VREUHFDUJDV obstruidas.
PHGLDQWHXQDVRQGDWpUPLFDTXHLQWHUUXPSHHOIXQFLRQDPLHQWRVL 3. Se recomienda encarecidamente cambiar el agua del depósito todos
VHYHUL¿FDXQUHFDOHQWDPLHQWR(QWDOFDVRGHMHHQIULDUHOPRWRU\ los días.
SyQJDORHQPDUFKDDFWLYDQGRQXHYDPHQWHHOLQWHUUXSWRU 4. No utilice detergentes ni lubricantes.

87,/,=$&,Ï1'(/$0È48,1$ /LPSLH]DGHOGHSyVLWR
Limpie el depósito cada vez que note sedimentos en el fondo o, como
0RGRGHXVR mínimo, una vez al día. La suciedad del depósito puede perjudicar a
(OSXHVWRGHWUDEDMRVHLOXVWUDHQOD¿JUHI; la bomba de inmersión que impulsa el agua para refrigerar el disco
Llene el depósito de agua hasta el nivel máximo (aproximadamente diamantado.
OLWURV &RQHFWHODPiTXLQDDODDOLPHQWDFLyQHOpFWULFD\SyQJDODHQ Para limpiar el depósito, quite el tapón y aclare el depósito con un chorro
marcha como se indica en el apartado 10. GLUHFWRGHDJXDSRQLHQGRDWHQFLyQSDUDQRGDxDUODVSDUWHVHOpFWULFDV
$EUDHOJULIR ¿JUHI0 \FRPSUXHEHTXHKD\DXQDEXQGDQWHÀXMRGH
agua de refrigeración sobre el disco diamantado. /LPSLH]DGHOFLUFXLWRGHODJXDGHUHIULJHUDFLyQ
Periódicamente, o cuando el caudal del agua de refrigeración disminuye,
&RUWH es preciso limpiar el circuito de alimentación de agua. Desmonte y
Desplace el grupo del cabezal hacia la parte opuesta a la del operador OLPSLHODERTXLOODTXHHVWiGHQWURGHOFiUWHUGHOGLVFR ¿JUHI( 
hasta alcanzar el límite de carrera y apoye el material que se ha de cortar Lave la tubería con agua, desde la bomba hasta el grifo que está en
¿JUHI$ VREUHODPHVDHQFRQWDFWRFRQHOWRSH6LGHVHDUHDOL]DU el cárter.
un corte inclinado, localice el ángulo deseado utilizando el goniómetro
RHOSXQWHUROiVHU3DUDUHJXODUODDOWXUDGHOFDEH]DOGHFRUWHDÀRMHHO 6XVWLWXFLyQGHOGLVFR
YRODQWH ¿JUHI% VLW~HHOFDEH]DODODDOWXUDGHVHDGD\DSULHWHD El material con que está realizado el disco se deteriora con las altas
fondo el volante. Ponga en marcha la sierra tal y como se describe en el temperaturas, por lo cual ha de refrigerarse con agua durante el
DSDUWDGR\XWLOL]DQGRODPDQLOOD ¿JUHI& GHVSODFHHOFDUURSDUD funcionamiento.
efectuar el corte. Una velocidad excesiva respecto al grosor y la dureza Para cambiar el disco, proceda del modo siguiente:
del material puede impedir la rotación del disco. En este caso, libere el 1. Bloquee el desplazamiento vertical del cabezal de corte con los
disco lo antes posible desplazando el carro hacia atrás para alejarlo y SRPRV ¿JUHI' 
UHFXSHUDUHOUpJLPHQGHURWDFLyQQRPLQDO5HDOLFHHOFRUWHDGDSWDQGROD 4XLWHODFXELHUWDGHODQWHUDGHSURWHFFLyQ ¿JUHI( 
velocidad de avance a las características del material. 3. Desenrosque la tuerca de bloqueo hacia la derecha (rosca izquierda)
con ayuda de la llave de 32 mm que se suministra con la máquina.
0DQWHQJDHOGHSyVLWROOHQRGHDJXDGXUDQWHWRGRHOWUDEDMR
4. Extraiga el disco. Para ello, primero desplácelo y luego inclínelo
6LpVWHVHSURORQJDOLPSLHORVVHGLPHQWRVTXHVHDFXPXODQHQHO
levemente hasta que se salga de su alojamiento.
GHSyVLWR\FDUJXHPiVDJXD
&RPSUXHEHTXHQRKD\DREMHWRVH[WUDxRVHQWUHODVEULGDVGH¿MDFLyQ
y el disco diamantado. No utilice para el desmontaje o la limpieza
&RUWHLQFOLQDGR
ninguna herramienta que pueda abollar o deformar la brida.
$ÀRMHORVYRODQWHV ¿JUHI' LQFOLQHHOFDEH]DOGHFRUWH\DSULH-
6. Para montar el nuevo disco, efectúe en orden inverso las operaciones
WHORVYRODQWHV$FRQWLQXDFLyQVLJDODVLQVWUXFFLRQHVGHVFULWDVHQ
descritas en el punto 4. Preste especial atención al sentido de rotación
HOSXQWRDQWHULRU
del disco diamantado.
%ORTXHHFRUUHFWDPHQWHODWXHUFDGH¿MDFLyQGHOGLVFRJLUiQGRODKDFLD
3XQWHUROiVHU
la izquierda (rosca izquierda) con un par de apriete de 40 Nm.
La máquina incorpora un puntero láser que reproduce la línea de corte
de la pieza que se está trabajando. La línea de luz indica la trayectoria   'HVFRQHFWH VLHPSUH HO HQFKXIH GH DOLPHQWDFLyQ DQWHV GH
del disco diamantado durante el movimiento de avance. Haciendo coin- VXVWLWXLUHOGLVFR
cidir la línea de corte deseada con la trayectoria del láser, es posible
garantizar la máxima precisión. Cuando se realizan cortes perpendicu- 6XVWLWXFLyQGHODFRUUHDGHWUDQVPLVLyQ
lares a un lado de la pieza, no es necesario utilizar la línea de referencia La máquina incorpora una correa especial pretensada de larga dura-
GHOFRUWH7DQVRORGHEHFRPSUREDUTXHHOODGRGHUHIHUHQFLDHVWpHQ ción. Para sustituirla, contacte con un centro de asistencia autorizado.
FRQWDFWRFRQHOWRSHGHODPHVDGHDSR\R7DPELpQHVSRVLEOHUHDOL]DU
FRUWHV FRQ LQFOLQDFLRQHV SUHGH¿QLGDV XWLOL]DQGR HO JRQLyPHWUR /D OX] 5HJXODFLyQGHODKROJXUDGHOFDUUR
láser indica la posición real del corte. El puntero láser se activa y se (O FDUUR VH GHVOL]D D OR ODUJR GHO SHU¿O GH DOXPLQLR PHGLDQWH URGLOORV
desactiva con el interruptor ¿JUHI( . Con el tiempo, la holgura del carro aumenta y se reduce la precisión
(OSXQWHURHVWiDOLQHDGRFRQHOGLVFR\QRVHGHEHPRGL¿FDUVXSRVLFLyQ del corte. Para regular los rodillos, contacte con un centro de asistencia
inicial. autorizado.
$XQTXHHOSXQWHURLQFRUSRUDXQHPLVRUGHOX]OiVHUGHEDMD
SRWHQFLDVHGHVDFRQVHMDPLUDUOR¿MDPHQWHGHPRGRGLUHFWR

20
IMER INTERNATIONAL S.p.A.
C 350 iPower
E
5HSDUDFLRQHV ,1&219(1,(17(6&$86$65(0(',26
/DVUHSDUDFLRQHVGHODVLQVWDODFLRQHVHOpFWULFDVGHEHQVHUUHDOL]DGDV
- £$17(1&,Ï1$QWHVGHUHDOL]DUFXDOTXLHURSHUDFLyQGHPDQ-
H[FOXVLYDPHQWH SRU XQ WpFQLFR HVSHFLDOL]DGR 8WLOLFH VyOR UHFDPELRV
WHQLPLHQWR SDUH OD PiTXLQD SRQJD HO VHOHFWRU HQ  \ TXLWH OD
RULJLQDOHV,0(5VLQPRGL¿FDUORV3RUHOWLSRGHFRQVWUXFFLyQGH&
FODYLMDGHODWRPDGHFRUULHQWHDOLPHQWD]LRQH
iPower, no hacen falta más tareas de mantenimiento que las indicadas.
Controle que los contactos de la clavija y del grupo clavija-interruptor
VHDQH¿FLHQWHV6LHVWiQR[LGDGRVOtPSLHORVGHLQPHGLDWR Inconvenientes Causas Remedios
No llega tensión a la Controlar la línea *
6LVHGLVSDUDHOLQWHUUXSWRUGLIHUHQFLDOKDJDFRQWURODU\VL línea de alimentación
FRUUHVSRQGHUHSDUDUODPiTXLQDSRUXQWpFQLFRHVSHFLDOL]DGR La toma y el enchufe Restablecer la
HOpFWULFRQRHVWiQELHQ conexión correcta
conectados
(OLPLQDFLyQGHORVPDWHULDOHVGHGHVHFKR El interruptor del Accionar el pulsador
Elimine los materiales de desecho resultantes del uso de la diferencial no ha sido ON del diferencial
máquina como establecen las leyes vigentes. accionado
El cable de Sustituir el cable *
Pulsando el
5,(6*265(6,'8$/(6<6(f$/(6'(6(*85,'$' interruptor de
alimentación del
Aunque la sierra se ha construido respetando totalmente la normativa enchufe al cuadro no
marcha el motor no
vigente, existen ciertos riesgos que no se pueden eliminar y que transmite corriente
parte
H[LJHQ HO XVR GH GLVSRVLWLYRV HVSHFt¿FRV GH SURWHFFLyQ LQGLYLGXDO 8QFDEOHHOpFWULFRHQ Restablecer la
Una señalización adecuada colocada en la máquina indicará tanto los el interior de la caja de conexión *
bornes del motor está
riesgos como los comportamientos a adoptar. dañado
8QFDEOHHOpFWULFRHQHO Restablecer la
5,(6*258,'2 interior del cuadro está conexión *
dañado
2EOLJDFLyQGHSURWHJHUORVRtGRV El interruptor de Sustituir el interruptor *
marcha no funciona
Falta agua en el Restablecer el nivel
5,(6*2'(/(6,21(6(1/$60$126 recipiente de agua
Filtro de la bomba /LPSLDUHO¿OWURGHOD
No llega agua de obturado bomba
2EOLJDFLyQGHXVDUORVJXDQWHV refrigeración a la
hoja No llega corriente a la 9HUL¿FDUOD
bomba DOLPHQWDFLyQHOpFWULFD
de la bomba *
5,(6*2'(/(6,21(6(1/262-26
Bomba dañada Sustituir la bomba *
Hoja montada al Desmontar la hoja y
2EOLJDFLyQGHSURWHJHUORVRMRV contrario respecto al volver a colocarla en el
La hoja no corta sentido de rotación sentido indicado en la
etiqueta de la hoja
5,(6*2'(862$1Ï0$/2 Hoja deteriorada Sustituir la hoja
* Esta operación debe ser realizada por un técnico electricista
REOLJDFLyQGHOHHUHOPDQXDODQWHVGHOXVR

2EOLJDFLyQGHFRUWHFRQDJXD

3(/,*52'(&257(

3(/,*52'((/(&752&8&,Ï1

3(/,*525$<2/È6(5

Se recuerda que el control del uso de los DPI es responsabilidad de la


persona que ordena el trabajo.

21
IMER INTERNATIONAL S.p.A.
C 350 iPower

C FIG.3 D

E
E
D

45°
A A

A
C
G FIG.2
I

F
B
H

FIG.1 FIG.4

B A

3
FIG.6
FIG.5

22
IMER INTERNATIONAL S.p.A.
C 350 iPower

C
B

FIG.7

X A D

23
IMER INTERNATIONAL S.p.A.
C 350 iPower

27
41
28 29
19
31
30
32
33

4 16 10
17
7
11
6
19
20
2

9 8
35 5
19
12
18
1 3

12 34
36 19

9 18
21 40
37
39
22
25
38 39 26 13

23
21
39

24

14

15

FIG.1

24
IMER INTERNATIONAL S.p.A.
C 350 iPower

TAV. 1 - STRUTTURA MACCHINA - STRUCTURE MACHINE - MACHINE STRUCTURE - MASCHINENAUFBAU - ESTRUCTURA DE LA MAQUINA
RIF. COD. I F GB D E NOTE
1 3231400 TELAIO CHÂSSIS FRAME RAHMEN BASTIDOR
2 3231420 LAMIERA DI SCOLO GLISSER EAU WATER SLIDE WASSERRUTSCHE TOBOGAN DE AGUA
3 3231418 3,$126; PLATEAU GAUCE LH TABLE PLATTE LI. MESA DER.
4 3231419 3,$12'; PLATEAU DROITE RH TABLE PLATTE RE. MESA IZQ.
TE 5739
5 2222073 VITE VIS SCREW SCHRAUBE TORNILLO
;=
6 3231412 BATTUTA BUTOIR STOP ANSCHLAG TOPE
6593
7 2224049 RONDELLA RONDELLE WASHER UNTERLEGSCHEIBE ARANDELA
;=
TE 5739
8 2222075 VITE VIS SCREW SCHRAUBE TORNILLO
;=
9 2223570 DADO ÉCROU NUT MUTTER TUERCA 5588-M8
10 3206223 VITE VIS SCREW SCHRAUBE TORNILLO 7%(,;=
11 3205491 FASCETTA COLLIER CLAMP SCHELLE ABRAZADERA
12 3208452 TAPPO BOUCHON PLUG STUTZEN TAPÓN *31*/;
PIÈTEMENT AVANT
VORDERES
13 3230966 GAMBA ANTERIORE (PIED SUPPORT FRONT LEG PATA DELANTERA
BEINPAAR
AVANT)
PIÈTEMENT ARRIÈRE
14 3230969 GAMBA POSTERIORE (PIED SUPPORT REAR LEG HINTERES BEINPAAR PATA TRASERA
ARRIÈRE)
15 2257705 TAPPO BOUCHON PLUG STUTZEN TAPÓN *314;
16 2222061 VITE VIS SCREW SCHRAUBE TORNILLO 7()5;=
17 2222060 VITE VIS SCREW SCHRAUBE TORNILLO 7(;=
DADO ECROU SELBSTSICHERNDE TUERCA
18 3210623 SELF-LOCKING NUT M8 BASSO
AUTOBLOCCANTE AUTOBLOQUANT MUTTER AUTOBLOQUEANTE
6593
19 2224140 RONDELLA RONDELLE WASHER UNTERLEGSCHEIBE ARANDELA
;=
20 3233135 PIASTRINA PLAQUETTE BUTOIR STOP PLATE ANSCHLAG PLATTE PLACA TOPE
DADO ECROU SELBSTSICHERNDE TUERCA
21 2223920 SELF-LOCKING NUT M10
AUTOBLOCCANTE AUTOBLOQUANT MUTTER AUTOBLOQUEANTE
22 3205257 RUOTA GOMMATA ROUE CAOUTCHOUC RUBBER WHEEL GUMMIRAD RUEDA
DADO ECROU SELBSTSICHERNDE TUERCA
23 2223924 SELF-LOCKING NUT M6 ALTO
AUTOBLOCCANTE AUTOBLOQUANT MUTTER AUTOBLOQUEANTE
24 2222547 VITE VIS SCREW SCHRAUBE TORNILLO 7&(,;=
TE 8.8 5737
25 2222148 VITE VIS SCREW SCHRAUBE TORNILLO
;=
TE 8.8 5737
26 2222144 VITE VIS SCREW SCHRAUBE TORNILLO
;=
27 3223279 VOLANTINO BOUTON À LOBES HANDWHEEL HANDRAD POMO 0;
BLOQUER AUCTION AUKTION SUBASTA DE
28 3226360 ASTA GONIOMETRO
GONIOMÈTRE GONIOMETER WINKELMESSER GONIÓMETRO
29 3207939 VOLANTINO BOUTON À LOBES HANDWHEEL HANDRAD POMO /2%,0;
TCEI 8.8 5931
30 1222252 VITE VIS SCREW SCHRAUBE TORNILLO
;=
31 3230616 GONIOMETRO GONIOMÈTRE GONIOMETER GONIOMETER GONIÓMETRO
SUPPORT DE
SUPPORTO GONIOMETER GONIOMETER- SOPORTE DEL
32 3230617 RAPPORTEUR
GONIOMETRO MOUNT HALTERUNG GONIÓMETRO
(GONIOMÈTRE)
33 3215014 VOLANTINO BOUTON À LOBES HANDWHEEL HANDRAD POMO /2%,0;
TSPEI 5933
34 3224269 VITE VIS SCREW SCHRAUBE TORNILLO
;=
35 2223650 DADO ÉCROU NUT MUTTER TUERCA 5588 M10
36 2224204 RONDELLA RONDELLE WASHER UNTERLEGSCHEIBE ARANDELA ;
37 3231034 TIRANTE TIRANT TIE-ROD STREBE TIRANTE 0;
RESSORT DE MUELLE DE LAS
38 3230973 MOLLA GAMBE LEG SPRING BEINFEDER
PIÈTEMENTS PATAS
39 2224340 RONDELLA RONDELLE WASHER UNTERLEGSCHEIBE ARANDELA 6592 10x21 Z
40 2224260 RONDELLA RONDELLE WASHER UNTERLEGSCHEIBE ARANDELA ;=
GONIOMETRO GONIOMÈTRE COMPLETE KOMPLETT GONIÓMETRO
41 3233387
COMPLETO COMPLÉTER GONIOMETER GONIOMETER COMPLETO

25
IMER INTERNATIONAL S.p.A.
C 350 iPower

14

12
13
10
11

7
1
5

17
4
3 6
2 16
18

4 15

5
17

FIG.2

TAV. 2 - GRUPPO BRACCIO - GROUPE BRAS - ARM ASSEMBLY - ARMGRUPPE - GRUPO DEL BRAZO
RIF. COD. I F GB D E NOTE
GUIA DE
1 3229856 GUIDA SCORRIMENTO COULISSE SLIDEWAY GLEITFÜHRUNG
DESLIZAMIENTO
2 3231413 BRACCIO ANTERIORE BRAS AVANT FRONT ARM VORDERER ARM BRAZO ANTERIOR
BRACCIO
3 3231414 BRAS ARRIÈRE REAR ARM HINTERER ARM BRAZO POSTERIOR
POSTERIORE
4 3230323 DISTANZIALE ENTRETOISE SPACER ABSTANDHALTER DISTANCIADOR ;;
TE 8.8 5737
5 2222151 VITE VIS SCREW SCHRAUBE TORNILLO
;=
6 2222480 VITE VIS SCREW SCHRAUBE TORNILLO 77&4;
7 2224260 RONDELLA RONDELLE WASHER UNTERLEGSCHEIBE ARANDELA ;;
8 3204743 VOLANTINO BOUTON À LOBES HANDWHEEL HANDRAD POMO 3 LOBI M10
TE 5739
9 2222190 VITE VIS SCREW SCHRAUBE TORNILLO
;=
SUPPORT &,0;
10 3224801 ANTIVIBRANTE VIBRATION DAMPER HWINGUNGSDÄMPFER ANTIVIBRADOR
ANTIVIBRATILE 60SHORE
DADO ECROU SELBSTSICHERNDE TUERCA
11 3211470 SELF-LOCKING NUT M6 BASSO
AUTOBLOCCANTE AUTOBLOQUANT MUTTER AUTOBLOQUEANTE
12 3224960 FASCETTA COLLIER CLAMP SCHELLE ABRAZADERA
VERSTEIGERUNG
13 3231871 BLOCCO ASTA BLOQUER BARRE AUCTION BLOCK SUBASTA DE BLOQUE
BLOCK
14 3231872 ASTA GUIDA CAVI CABLE DE GUIDAGE CABLE GUIDE KABLEFÜHRUNG GUÍA DE CABLE
UNTERSTÜTZUNG
15 3231927 SUPPORTO CHIAVE SUPPORT DES CLÉS KEY MOUNT SOPORTE CLAVE
WICHTIGER
16 2241472 CHIAVE CLÉS KEY WICHTIGER CLAVE
17 2224340 RONDELLA RONDELLE WASHER UNTERLEGSCHEIBE ARANDELA ';=
18 2265675 PARACOLPO PARE CHOCS BUMPER STOßSTANGE PARACHOQUES

26
IMER INTERNATIONAL S.p.A.
C 350 iPower

10
7
6

6
1

5 8

3
FIG.3
TAV. 3 - GRUPPO VASCA - GROUPE CUVE - TANK ASSEMBLY - WASSERBECKEN - GRUPO DEL DEPÓSITO
RIF. COD. I F GB D E NOTE
1 3231003 VASCA CUVE TANK BECKEN DEPÓSITO
3234427 230V 50Hz
2 POMPA ACQUA POMPE D'ARROSAGE WATER PUMP WASSERPUMPE BOMBA DE AGUA
3234426 220V 60Hz
RESSORT DE MUELLE DE LAS
3 3230973 MOLLA GAMBE LEG SPRING BEINFEDER
PIÈTEMENTS PATAS
4 3231034 TIRANTE TIRANT TIE-ROD STREBE TIRANTE 0;
5 2223570 DADO ECROU NUT MUTTER TUERCA 5588 M8
6 2224204 RONDELLA RONDELLE WASHER UNTERLEGSCHEIBE ARANDELA ‘;
7 2222076 VITE VIS SCREW SCHRAUBE TORNILLO 7(0;
DADO ECROU SELBSTSICHERNDE TUERCA M8
8 3210623 SELF-LOCKING NUT
AUTOBLOCCANTE AUTOBLOQUANT MUTTER AUTOBLOQUEANTE BASSO
9 3231018 TAPPO BOUCHON PLUG STUTZEN TAPÓN
10 3231093 TAPPO COMPLETO BOUCHON COMPLET COMPLETE PLUG STUTZEN KOMPLETT TAPÓN COMPLETO

27
IMER INTERNATIONAL S.p.A.
C 350 iPower

3
4

15
13 14 2

1
16 9
8
21
19
14
20
18

12

15 17
5
10
20
11
7
22 18
6 19

21

FIG.4

TAV. 4 - CARRELLO - CHARIOT - CARRIAGE - SCHLITTEN - CARRO


RIF. COD. I F GB D E NOTE
1 3233136 &$55(//26; CHARIOT GAUCE LH CARRIAGE LH. SCHLITTEN LI. CARRO DER.
2 3233137 &$55(//2'; CHARIOT DROITE RH CARRIAGE RH. SCHLITTEN RE. CARRO IZQ.
TCEI 5931
3 2222514 VITE VIS SCREW SCHRAUBE TORNILLO
;=
4 2228820 SPINOTTO CONNECTEUR PIN STECKER CONDUCTOR ';
TORNILLO
5 3226230 GRANO FILETTATO GOUJON FILETÉ GRUBSCREW GEWINDESTIFT PRISIONERO 0;
ROSCADO
PIASTRA FISSAGGIO
6 3231428 PLAQUE DES BRAS ARM PLATE ARMPLATTE PLACA BRAZO
BRACCIO
7 2222061 VITE VIS SCREW SCHRAUBE TORNILLO 7()5;=
8 2223570 DADO ÉCROU NUT MUTTER TUERCA 5588 M8
9 2284864 VOLANTINO BOUTON À LOBES HANDWHEEL HANDRAD POMO 0;
10 3210629 CUSCINETTO ROULEMENT BEARING LAGER COJINETE 6006 2RS1 - CM
MUELLE DEL
11 3229860 MOLLA TESTA RESSORT DE TÊTE HEAD SPRING KOPFFEDER
CABEZAL
12 3231445 VITE VIS SCREW SCHRAUBE TORNILLO 77&40;=
13 3231422 LEVA CARTER MANETTE LEVER HEBEL PALANCA
14 2224340 RONDELLA RONDELLE WASHER UNTERLEGSCHEIBE ARANDELA ;
DADO ECROU SELBSTSICHERNDE TUERCA
15 2223920 SELF-LOCKING NUT M10
AUTOBLOCCANTE AUTOBLOQUANT MUTTER AUTOBLOQUEANTE
16 2222151 VITE VIS SCREW SCHRAUBE TORNILLO 7(0;=
17 3231484 PERNO $;( PIN BOLZEN MANGUITO
18 3204945 CUSCINETTO ROULEMENT BEARING LAGER COJINETE 601 2RS1
19 3207397 RUOTA ROUE WHEEL RAD RUEDA
20 3207393 DISTANZIALE ENTRETOISE SPACER ABSTANDHALTER DISTANCIADOR
21 3231485 CAPPUCCIO CAPOT CAP HAUBE CAPO'
22 3231981 BOCCOLA DOUILLE BUSHING BUCHSE CASQUILLO

28
IMER INTERNATIONAL S.p.A.
C 350 iPower

12

13

3 29
8 26
9
25

25 16

11

15 10

14
6
19
2
7 4 18
28

5 27
4

26

23 17
22 20 21
24 FIG.5
TAV. 5 - GRUPPO TESTA - GROUPE TÊTE - HEAD ASSEMBLY - KOPFGRUPPE - GRUPO CABEZAL
RIF. COD. I F GB D E NOTE
3223144 230V 50Hz
1 MOTORE EELTTRICO MOTEUR ÉLECTRIQUE ELECTRIC MOTOR ELEKTROMOTOR MOTOR ELÉCTRICO
3231950 220V 60Hz
2 2204540 CUSCINETTO ROULEMENT BEARING LAGER COJINETE 6205 2RSH - CM
3 3231699 BRACCIO BRAS ARM ARM BRAZO
4 3224763 CUSCINETTO ROULEMENT BEARING LAGER COJINETE 6305 2RS1 - CM
5 3231448 ALBERO DISCO ARBRE LAME BLADE SHAFT EJE DISCO
6 2224190 RONDELLA RONDELLE WASHER UNTERLEGSCHEIBE ARANDELA ;
7 2222076 VITE VIS SCREW SCHRAUBE TORNILLO 7(0;
8 3231440 GUARNIZIONE JOINT GASKET DICHTUNG JUNTA
9 3231423 COPERCHIO COUVERCLE COVER ABDECKUNG TAPA
10 3231441 GUARNIZIONE JOINT GASKET DICHTUNG JUNTA
11 3231424 CARTER CARTER GUARD GEHÄUSE CÁRTER
12 3231483 PULEGGIA MOTORE POULIE MOTEUR MOTOR PULLEY MOTOR RIEMENSCHEIBE MOTOR POLEA
13 2227270 ANELLO DI ARRESTO CIRCLIP D'ARRÊT STOP RING ANSCHLAGRING ANILLO DE TOPE 7435 E/24
14 3231443 CINGHIA COURROIE BELT RIEMEN CORREA
15 3204743 VOLANTINO BOUTON À LOBES HANDWHEEL HANDRAD POMO 3 LOBI M10
16 2224260 RONDELLA RONDELLE WASHER UNTERLEGSCHEIBE ARANDELA ;;
17 3210954 MANOPOLA BOUTON KNOB KNOB MANDO
PULEGGIA ALBERO
18 3231449 POULIE ARBRE LAME PULLEY DISC SHAFT SCHEIBENWELLE POLEA EJE DISCO
DISCO
19 2227280 ANELLO DI ARRESTO CIRCLIP D'ARRÊT STOP RING ANSCHLAGRING ANILLO DE TOPE 7435 E/25
20 3231446 FLANGIA FLASQUE FLANGE FLANSCH BRIDA
21 2207355 PARAOLIO BAGUE D'ÉTANCHÉITÉ OIL RETAINER ÖLDICHTUNG RETÉN DE ACEITE 52x25x7
22 3231009 ANELLO V-RING JOINT V-RING V-RING V-RING JUNTA V-RING D.I 31
23 2224140 ANELLO V-RING JOINT V-RING V-RING V-RING JUNTA V-RING ;
24 2222176 VITE VIS SCREW SCHRAUBE TORNILLO 7(;=
TRILOB. TSP PH
25 3210105 VITE VIS SCREW SCHRAUBE TORNILLO
0;=
26 2222514 VITE VIS SCREW SCHRAUBE TORNILLO 7&(,;=
27 3231427 MANIGLIA POIGNÉE HANDLE GRIFF MANIJA
28 2229450 LINGUETTA LANGUETTE KEY FEDER LENGÜETA ;;
29 2229310 LINGUETTA LANGUETTE KEY FEDER LENGÜETA ;;

29
IMER INTERNATIONAL S.p.A.
C 350 iPower

14
17
18 13 16 28
31
19
15
29 25

27

12 4

6 23
22 26
30 1
24

32
5
2
21
22
10 7

14 8

9
11
3 33

32

20

FIG.6

30
IMER INTERNATIONAL S.p.A.
C 350 iPower

TAV.6 - MONTAGGIO MOTORE E CARTER DISCO - MONTAGE DU MOTEUR ET DU CARTER DISQUE - DISC GUARD AND MOTOR ASSEMBLY
MONTAGE VON MOTOR UND SCHEIBENSCHUTZGEHÄUSE - MONTAJE MOTOR CÁRTER DISCO
RIF COD. I F GB D E NOTE
1 3231873 CARTER DISCO CARTER DISQUE DISC GUARD SCHEIBENSCHUTZGEHÄUSE CÁRTER DEL DISCO
2 2224049 RONDELLA RONDELLE WASHER UNTERLEGSCHEIBE ARANDELA ;=
3 3206223 VITE VIS SCREW SCHRAUBE TORNILLO 7%(,;=
4 2224531 RONDELLA RONDELLE WASHER UNTERLEGSCHEIBE ARANDELA ;
DADO ECROU SELBSTSICHERNDE TUERCA
5 3211470 SELF-LOCKING NUT M6 BASSO
AUTOBLOCCANTE AUTOBLOQUANT MUTTER AUTOBLOQUEANTE
GROWER
6 1224780 RONDELLA GROWER RONDELLE GROWER GROWER WASHER ARANDELA GROWER D.5
UNTERLEGSCHEIBE
7 3230965 FLANGIA INTERNA FLASQUE INTERNE INNER FLANGE INTERNER FLANSCH BRIDA INTERNA
8 3231078 DISCO DISQUE ARM SCHEIBE DISCO Ø 350mm
9 3230964 FLANGIA ESTERNA )/$648((;7(51( OUTER FLANGE (;7(51(5)/$16&+ %5,'$(;7(51$
ABDECKUNG DES
COPERCHIO CARTER COUVERCLE DE TAPA DEL CÁRTER
10 3231372 DISC GUARD COVER SCHEIBENSCHUTZ-
DISCO CARTER DISQUE DEL DISCO
GEHÄUSES
11 3208541 DADO ÉCROU NUT MUTTER TUERCA 0;6;=
ANELLO DI
12 3231431 %$*8('(),;$7,21 RETAINER RING BEFESTIGUNGSRING ANILLO DE FIJACIÓN
FISSAGGIO
PROTECCIÓN
FLASQUE ANTI-
13 3230975 PARASCHIZZI SPLASH GUARD SPRITZSCHUTZ CONTRA
PROJECTIONS
SALPICADURAS
14 3224366 RACCORDO ARIA RACCORD AIR AIR CONNECTOR LUFTANSCHLUSS EMPALME DEL AIRE 90° GIR.1/4"F.
FIJACIÓN DE
15 3228674 PORTAGOMMA EMBOUT DE TUYAU PIPE HOLDER SCHLAUCHHALTER F.1/4" x Ø12
MANGUERA
16 3224206 VALVOLA A SFERA SOUPAPE À BILLE BALL VALVE KUGELVENTIL VÁLVULA DE ESFERA 1/4" M.F.
17 3231015 RACCORDO ARIA RACCORD AIR AIR CONNECTOR LUFTANSCHLUSS EMPALME DEL AIRE DIRITTO 1/4" DOPPIO
PLAQUETTE
PIASTRINA SPLASH GUARD PLACA CONTRA
18 3231004 FLASQUE ANTI- SPRITZSCHUTZPLATTE
PARASCHIZZI PLATE SALPICADURAS
PROJECTIONS
19 2222022 VITE VIS SCREW SCHRAUBE TORNILLO 7(0;=
20 3231012 VOLANTINO BOUTON À LOBES HANDWHEEL HANDRAD POMO 4 LOBI M6
PANNELLO PANNEAU SOUND-ABSORBENT PANEL
21 3231373 SCHALLDÄMMPLATTE
INSONORIZZANTE INSONORISANT PANEL FONOABSORBENTE
22 3231014 RACCORDO ARIA RACCORD AIR AIR CONNECTOR LUFTANSCHLUSS EMPALME DEL AIRE DIRITTO 1/4" M
23 3231776 SUPPORTO SUPPORT LASER LASER SUPPORT LASER HALTERUNG SOPORTE LASER
BLOCCHETTO BLOC DE BLOQUE DE
24 3227483 ADJUSTMENT BLOCK EINSTELLBLOCK
REGOLAZIONE RÉGULATION REGULACIÓN
25 3227489 DADO ÉCROU NUT MUTTER TUERCA 0;
26 3228250 EMETTITORE LASER ÉMETTEUR LASER LASER EMITTER LASERSTRAHLER EMISOR LÁSER
27 2222002 VITE VIS SCREW SCHRAUBE TORNILLO 7(;=
CARTER SUPPORTO CARTER SUPPORT GUARD LASER CÁRTER SOPORTE
28 3231775 SCHEIBENSCHUTZGEHÄUSE
LASER LASER SUPPORT LASER
29 2222458 VITE VIS SCREW SCHRAUBE TORNILLO 75,/2%$7$;=
30 3209797 VITE VIS SCREW SCHRAUBE TORNILLO 7(0;=
31 3201217 RACCORDO ARIA RACCORD AIR AIR CONNECTOR LUFTANSCHLUSS EMPALME DEL AIRE
32 1272701 78%2‘; 78<$8‘; +26(',$; 6&+/$8&+‘; TUBO Ø 6 x 8 0.9 mt
WATER HOSE DIA. WASSERSCHLAUCH Ø TUBO DE AGUA Ø
33 3227803 78%2$&48$‘; 78<$8($8‘; 3,7 mt
; ; 10 x 14

31
IMER INTERNATIONAL S.p.A.
C 350 iPower

17

15
16

14
11

13

12
9
10

8
18
6
7

4
19

3
1

FIG.7 2
TAV. 7 - QUADRO ELETTRICO - TABLEAU ELECTRIQUE - ELECTRIC PANEL - CHALTSCHRANK - CUADRO ELÉCTRICO
RIF. COD. I F GB D E NOTE
3234570 MOTEUR 230V 50Hz
1 MOTORE ELETTRICO ELECTRIC MOTOR ELEKTROMOTOR MOTOR ELÉCTRICO
3231950 ÉLECTRIQUE 220V 60Hz
MOTOR
2 3231483 PULEGGIA MOTORE POULIE MOTEUR MOTOR PULLEY MOTOR POLEA
RIEMENSCHEIBE
3 2227270 ANELLO DI ARRESTO CIRCLIP D'ARRÊT STOP RING ANSCHLAGRING ANILLO DE TOPE 7435 E/24
4 2223352 DADO ÉCROU NUT MUTTER TUERCA 5588 - M5
GROWER
5 1224780 RONDELLA GROWER RONDELLE GROWER GROWER WASHER ARANDELA GROWER D.5
UNTERLEGSCHEIBE
6 2222465 VITE VIS SCREW SCHRAUBE TORNILLO 75,/2%7&3+0;
PIASTRA SUPPORTO
7 3231429 PLAQUE PLATE PLATTE PLACA
QUADRO
8 3231442 GUARNIZIONE JOINT GASKET DICHTUNG JUNTA
9 3231995 CONDENSATORE CONDENSATEUR CAPACITOR KONDENSATOR CONDENSADOR 60mF 450V
ALIMENTATORE ALIMENTATEUR LASER POWER
10 3228251 LASER NETZTEIL ALIMENTADOR LASER
LASER LASER SUPPLY
FACH DER
CASSETTA COFFRET ELECTRICAL
11 3231770 ELEKTRISCHEN CAJA ELÉCTRICA
ELETTRICA ÉLECTRIQUE ENCLOSURE
ANLAGE
12 3207152 VITE VIS SCREW SCHRAUBE TORNILLO 7&%3+;=
13 3201217 PRESSACAVO PRESSE-CÂBLE CABLE CLAMP PASACABLES PG11
14 3209692 PRESSACAVO PRESSE-CÂBLE CABLE CLAMP PASACABLES PG13.5
15 3209337 INTERRUTTORE INTERRUPTEUR SWITCH SCHALTER INTERRUPTOR
16 3206170 INTERRUTTORE INTERRUPTEUR SWITCH SCHALTER INTERRUPTOR
PROTEZIONE PROTECTION PROTECCION
17 3206171 SWITCH PROTECTION SCHUTZ SCHALTER
INTERRUTTORE INTERRUPTEUR INTERRUPTOR
TABLEAU
18 3231700 QUADRO ELETTRICO ELECTRIC PANEL SCHALTSCHRANK CUADRO ELÉCTRICO 220-230V 50/60Hz
ELECTRIQUE
19 3203504 SPINA 2P+T FICHE 2P+T PLUG 2P+GND STECKER 2P+E CLAVIJA 2P+T

32
IMER INTERNATIONAL S.p.A.
C 350 iPower

1107616 2 3

5
1
4

4
FIG.8

TAV.8 - 1107616 :KIT RUOTE MAGGIORATE - ROUE KIT ACCRUE- WHEEL KIT INCREASED - RAD KIT ERHÖHT - KIT DE RUEDA DE INCREMENTO
RIF. COD. I F GB D E NOTE
1 3209809 RUOTA GOMMATA ROUE RUBBER WHEEL RÄDER RUEDA D.200
2 3235360 PIASTRINA PLAQUE PLATE PLATTE PLACA
3 2222077 VITE VIS SCREW SCHRAUBE TORNILLO 5737 M12x10
4 2226700 COPIGLIA GOUPILLE SPLIT PIN SPLINT PASADOR AMA 3.5/72
5 3235350 ASSALE ESSIEU $;/( ACHSE EJE

33
IMER INTERNATIONAL S.p.A.
C 350 iPower

S1
X1-1 X5-1 24 23 X7-2 X7-1
L1
X6 A1

u<
X5-2 13 X8-2 X8-1
X3 N LINEA
14 13

C1 PE
X12
X7-3
X4
S2
X1-2 X1-3 X2-1 X2-2 X2-3
ON - OFF LASER
BIANCO
ROSSO

GRIGIO

L N
NERO

PE X9-1
GIALLO/VERDE

T1 X8-3 X9-2
AVVIAMENTO
MARCIA

TR1

X10-1 X11-1
MOTORE PRINCIPALE POMPA ACQUA
M1 M2

X10-2 X11-2

LASER D1

34