01wknm19 Week01 2019

Notices
27--139/19
Updates to ADMIRALTY Sailing Directions in Force
ADMIRALTY
NOTICES TO MARINERS
Weekly Edition 01
03 January 2019
(Published on the ADMIRALTY website 18 December 2018)
CONTENTS
I Explanatory Notes. Publications List

II ADMIRALTY Notices to Mariners. Updates to Standard Nautical Charts
III Reprints of NAVAREA I Navigational Warnings
IV Updates to ADMIRALTY Sailing Directions
V Updates to ADMIRALTY List of Lights and Fog Signals
VI Updates to ADMIRALTY List of Radio Signals
VII Updates to Miscellaneous ADMIRALTY Nautical Publications
VIII Updates to ADMIRALTY Digital Services
For information on how to update your ADMIRALTY products using ADMIRALTY Notices to
Mariners, please refer to NP294 How to Keep Your ADMIRALTY Products Up--to--Date.
Mariners are requested to inform the UKHO immediately of the discovery of new or suspected
dangers to navigation, observed changes to navigational aids and of shortcomings in both paper
and digital ADMIRALTY Charts or Publications.
The H--Note App helps you to send H--Notes to the UKHO, using your device’s camera, GPS and
email. It is available for free download on Google Play and on the App Store.
The Hydrographic Note Form (H102) should be used to forward this information and to report any
ENC display issues.
H102A should be used for reporting changes to Port Information.
H102B should be used for reporting GPS/Chart Datum observations.
Copies of these forms can be found at the back of this bulletin and on the UKHO website.
The following communication facilities are available:
NMs on ADMIRALTY website: Web: admiralty.co.uk/msi
Searchable Notices to Mariners: Web: www.ukho.gov.uk/nmwebsearch
Urgent navigational information: e--mail: navwarnings@btconnect.com
Phone: +44(0)1823 353448
Fax: +44(0)1823 322352
H102 forms e--mail: sdr@ukho.gov.uk
(see back pages of this Weekly Edition) Post: UKHO, Admiralty Way, Taunton,
Somerset, TA1 2DN, UK
All other enquiries/information e--mail: customerservices@ukho.gov.uk
Phone: +44(0)1823 484444 (24/7)
 Crown Copyright 2018. All rights Reserved. Permission is not required to make analogue or PDF copies
of these Notices, but such copies may not be sold without the permission of the UKHO. For permission to
sell copies of the Notices or to make (non -- PDF) digital copies please email
intellectual.property@ukho.gov.uk
For UKHO use only 219401

,
*8,'$1&(127(6)257+(86(2)$'0,5$/7<127,&(6720$5,1(56
217+(8.+2:(%6,7(
7KH:HHNO\1RWLFHVWR0DULQHUV10XSGDWHVIRUSDSHU&KDUWVDQG3XEOLFDWLRQVFDQEHDFFHVVHGYLD
DGPLUDOW\FRXNPVL RU WKH VHDUFKDEOH 10 :HEVLWH ZZZXNKRJRYXNQPZHEVHDUFK 7KH ODWHVW
GLJLWDO 10 :HHNO\ XSGDWH LV DYDLODEOH GD\V SULRU WR WKH SDSHU SXEOLFDWLRQ GDWH WKHUH DUH QR
VXEVFULSWLRQIHHVIRUDFFHVVWRWKH8.+21RWLFHVWR0DULQHUV:HEVLWH

1%7KH10GDWDEDVHLQFOXGHVKLVWRULFDO10GDWDIURP-DQXDU\IRU10VSULRUWRWKH
&XPXODWLYH/LVWRI1RWLFHVWR0DULQHUV13%PXVWEHXVHG

6RIWZDUHUHTXLUHG
$GREH$FUREDW5HDGHU9HUVLRQRUODWHU5HDGHUVRIWZDUHFDQEHREWDLQHGGLUHFWIURPWKH$GREH

ZHEVLWHZZZDGREHFRP

6($5&+$%/(127,&(6720$5,1(56

(QWHU WKH ZZZXNKRJRYXNQPZHEVHDUFK ZHEVLWH DQG VHOHFW WKH VHDUFK RSWLRQ WKDW \RX UHTXLUH
IROORZLQJWKHRQVFUHHQLQVWUXFWLRQV

6HDUFK10VE\&KDUW1XPEHURQO\
6HDUFK10VE\&KDUW1XPEHU3UHYLRXV101XPEHU<HDU
6HDUFK10VE\&KDUW1XPEHU%HWZHHQ3UHYLRXVDQG3UHVHQW'DWHV
6HDUFKIRU6LQJOH10E\101XPEHU<HDU

7RYLHZWKH10101RWHRUIXOOFRORXU10%ORFNVFOLFNRQWKHUHOHYDQWOLQN

127,&(6720$5,1(5621/,1(

(QWHUWKHDGPLUDOW\FRXNPVLZHEVLWHDQGWKHQVHOHFW1RWLFHVWR0DULQHUV7KLVZLOOJLYH\RXDFFHVV
WRWKHIROORZLQJUDQJHRI1RWLFHWR0DULQHUVVHUYLFHV
$'0,5$/7<10:HE6HDUFK
:HHNO\10V
10%ORFN1RWHVDQG'LDJUDPV
$QQXDO10V
&XPXODWLYH10/LVW
)857+(5*8,'$1&(127(6

)RU IXUWKHU GHWDLOV RI WKH RQOLQH 10 IDFLOLWLHV SOHDVH VHH WKH 10 *XLGDQFH 1RWHV RQ WKH ZHEVLWH
DGGLWLRQDOGHWDLOLQFOXGHV
)LOHFRQWHQWDQGGHVFULSWLRQ
3&DQGSULQWHUVSHFLILFDWLRQV

&86720(56(59,&(

,I\RXH[SHULHQFHDQ\GLIILFXOWLHVSOHDVHFRQWDFWWKH8.+2&XVWRPHU6HUYLFHRQ
7HO
HPDLOFXVWRPHUVHUYLFHV#XNKRJRYXN
Wk01/19
,
ADMIRALTY NOTICES TO MARINERS

7KLV $'0,5$/7< 1RWLFHV WR 0DULQHUV %XOOHWLQ $10% LV SXEOLVKHG E\ WKH 8.
+\GURJUDSKLF2IILFH8.+27KH8.0DULWLPHDQG&RDVWJXDUG$JHQF\DFFHSWVWKDWERWK
WKH SDSHU DQG GLJLWDO IRUPV RI WKH $10% FRPSO\ ZLWK FDUULDJH UHTXLUHPHQW IRU 1RWLFHV WR
0DULQHUV ZLWKLQ 5HJXODWLRQ RI WKH UHYLVHG &KDSWHU 9 RI WKH 6DIHW\ RI /LIH DW 6HD
&RQYHQWLRQ DQG WKH 0HUFKDQW 6KLSSLQJ 6DIHW\ RI 1DYLJDWLRQ 5HJXODWLRQV ERWK RI ZKLFK
FDPHLQWRIRUFH-XO\
:KLOHHYHU\HIIRUWLVPDGHWRHQVXUHWKDWWKHGDWDSURYLGHGWKURXJKWKH1RWLFHVWR0DULQHUV
VHUYLFHLVDFFXUDWHWKHXVHUQHHGVWREHDZDUHRIWKHULVNVRIFRUUXSWLRQWRGDWD,WLVLPSRUWDQW
WKDWWKHXVHUVKRXOGRQO\XVHWKHGDWDRQVXLWDEOHHTXLSPHQWDQGWKDWRWKHUDSSOLFDWLRQVVKRXOG
QRW EH UXQQLQJ RQ WKH XVHU¶V PDFKLQH DW WKH VDPH WLPH 8VHUV VKRXOG H[HUFLVH WKHLU
SURIHVVLRQDOMXGJHPHQWLQWKHXVHRIGDWDDQGDOVRFRQVXOWWKH0DULQHUV¶+DQGERRN13
IRUIXUWKHUGHWDLOV
7KH XVHU QHHGV WR EH DZDUH WKDW WKHUH LV D SRVVLELOLW\ WKDW GDWD FRXOG EH FRUUXSWHG GXULQJ
WUDQVPLVVLRQRULQWKHSURFHVVRIGLVSOD\RUSULQWLQJRQWKHXVHU¶VHTXLSPHQWRULIFRQYHUWHG
WR RWKHU VRIWZDUH IRUPDWV DQG LV DFFRUGLQJO\ DGYLVHG WKDW WKH 8.+2 FDQQRW DFFHSW
UHVSRQVLELOLW\ IRU DQ\ VXFK FKDQJH RU DQ\ PRGLILFDWLRQV RU XQDXWKRULVHG FKDQJHV PDGH E\
OLFHQVHHVRURWKHUSDUWLHV
Planning for the future

Plan with ADMIRALTY Maritime Data Solutions, brought to you by the UK Hydrographic Office.
Admiralty Way, Taunton, Somerset

TA1 2DN, United Kingdom
Telephone +44 (0)1823 484444
customerservices@ukho.gov.uk MANAGEMENT
SYSTEMS
gov.uk/ukho
013
Find out more about our market-leading

ADMIRALTY Maritime Data Solutions:
admiralty.co.uk
and are trademarks of the Secretary of State for Defence
© Crown Copyright 2018. All rights reserved. Correct at the time of publishing.
Wk01/19
,
EXPLANATORY NOTES
Dating
Weekly Notices are dated for the Thursday appropriate to the week that the printed version is despatched from the UKHO.
They are available earlier from the UKHO website.
Section I - Publications List
At the beginning of the Publications List is an index of ADMIRALTY Charts affected by the Publications List. Thereafter
there are a number of standard lists which contain details and announcements concerning charts and publications relevant for
the particular Weekly Notice. Full details of how to use the various lists contained in Section I are available in NP294.
Special Announcements and Errata are occasionally included at the end of this Section.
Section IA - Temporary and Preliminary (T&P) Notices
A list of T&P Notices in force (along with a list of those cancelled during the previous month), is included in the Weekly NM
each month (see below).
Section IB - Current Nautical Publications
Information about Publications including the current edition numbers is included in the Weekly NM at the end of March,
June, September and December.
Section II - Updates to Standard Nautical Charts
The notices in Section II give instructions for the updating of standard nautical charts and selected thematic charts in the
ADMIRALTY series. Geographical positions refer to the horizontal datum of the current edition of each affected chart
which is stated in the notice alongside the appropriate chart number. Positions are normally given in degrees, minutes and
decimals of a minute, but may occasionally quote seconds for convenience when plotting from the graduation of some older-
style charts. Where Leisure Products are referred to different horizontal datums from the standard nautical charts for that
geographical area, positions in the notices cannot be plotted directly on these products. Bearings are true reckoned clockwise
from 000° to 359°; those relating to lights are from seaward. Symbols referred to are those shown in NP5011. Depths and
heights are given in metres or fathoms and/or feet as appropriate for the chart being updated (abbreviated where necessary to
m, fm and ft respectively). Blocks and notes accompanying notices in Section II are placed towards the end of the section.
T&P Notices. These are indicated by (T) or (P) after the notice number and are placed at the end of Section II. They are
printed on one side of the paper in order that they may be cut up and filed. To assist in filing, the year is indicated after the
notice number and an in-force list is published monthly. Information from these notices is not included on charts before
issue; charts should be updated in pencil on receipt. Associated diagrams are reproduced with Blocks at the end of Section II.
Original Information. A star (*) adjacent to the number of a notice indicates that the notice is based on original
information.
Section III - Navigational Warnings
NAVAREA I Navigational Warnings in force at the specified time quoted in the header are reprinted in Section III. It is
recommended that this reprint should be kept in a file or book, followed by subsequent weekly reprints. Only the most
convenient ADMIRALTY Chart is quoted. The full text of all Warnings in force is included in Weeks 1, 13, 26 and 39 each
year.
Section IV - Sailing Directions
Updates to all Sailing Directions are given in Section IV of ADMIRALTY Notices to Mariners. Those in force at the end of
the year are reprinted in NP247(2) Annual Summary of ADMIRALTY Notices to Mariners Part 2. A list of updates in force is
published in Section IV of the Weekly Edition quarterly. Full details of how to keep Sailing Directions up-to-date can be
found in NP294 How to Keep Your ADMIRALTY Products Up-to-Date.
Section V - Lights
Updates to all the List of Lights are given in Section V and may be published in an earlier edition than the chart-updating
notice. The entire entry for each light updated will be printed (including minor changes) and an asterisk (*) will denote which
column contains a change. In the case of a new light, or where a new sequence is added below the main light, an asterisk (*)
will appear under all columns. All Section V entries are intended to be cut out and pasted into the appropriate volume. It is
emphasised that the List of Lights is the primary source of information on lights and that many alterations, especially those of
a temporary but operational nature, are promulgated only as updates to the List of Lights. Light positions should be
regarded as approximate and are intended to indicate the relative positions of lights only. Charts should be consulted for a
more authoritative position. When a light is affected by a separate chart-updating notice, its Light List number is always
included in the relevant text contained in Section II. The range of a light is normally the nominal range, except when the
responsible authority quotes luminous or geographical range - see special remarks for ranges used by each country.
Wk01/19
,

6HFWLRQ9,5DGLR6LJQDOV
8SGDWHVWRDOOWKH5DGLR6LJQDOVDUHJLYHQLQ6HFWLRQ9,:KHQDFKDUWXSGDWLQJQRWLFHLVLVVXHGIRULQIRUPDWLRQWKDWLVDOVR
LQFOXGHG ZLWKLQ WKH 5DGLR 6LJQDOV WKH DSSURSULDWH YROXPH UHIHUHQFH QXPEHU LV TXRWHG IROORZHG LQ SDUHQWKHVHV E\ WKH
QXPEHURIWKH:HHNO\(GLWLRQFRQWDLQLQJLQ6HFWLRQ9,WKHFRUUHVSRQGLQJXSGDWHWRWKHVHUYLFHGHWDLOV7KHXSGDWHVLQ
6HFWLRQ9,VKRXOGEHFXWRXWDQGSDVWHGLQWRWKHDSSURSULDWHYROXPHV
6HFWLRQ9,,0LVFHOODQHRXV3XEOLFDWLRQV
8SGDWHVWRWKHIROORZLQJVHOHFWHGPLVFHOODQHRXV1DXWLFDO3XEOLFDWLRQVDUHFRQWDLQHGLQ6HFWLRQ9,,
13 7KH0DULQHU¶V+DQGERRN
13$ 3DSHU&KDUW0DLQWHQDQFH5HFRUG
13& (1&0DLQWHQDQFH5HFRUG
13 $'0,5$/7<*XLGHWRWKH3UDFWLFDO8VHRI(1&V
13 $'0,5$/7<*XLGHWR,PSOHPHQWDWLRQ3ROLF\DQG3URFHGXUHV
13 +RZWR.HHS\RXU$'0,5$/7<3URGXFWV8SWRGDWH
13 $'0,5$/7<2FHDQ3DVVDJHVIRUWKH:RUOG±$WODQWLF2FHDQ
13 $'0,5$/7<2FHDQ3DVVDJHVIRUWKH:RUOG±,QGLDQDQG3DFLILF2FHDQV
13 $'0,5$/7<'LVWDQFH7DEOHV±$WODQWLF2FHDQ
13 $'0,5$/7<'LVWDQFH7DEOHV±3DFLILF2FHDQ
13 $'0,5$/7<'LVWDQFH7DEOHV±,QGLDQ2FHDQ
13 ,$/$0DULWLPH%XR\DJH6\VWHP
13 6\PEROVDQG$EEUHYLDWLRQVXVHGRQ$'0,5$/7<3DSHU&KDUWV
13 $'0,5$/7<*XLGHWR(1&6\PEROVXVHGLQ(&',6
$OO7LGHV3XEOLFDWLRQV
1DXWLFDO$OPDQDF3XEOLFDWLRQVLQFOXGLQJ6LJKW5HGXFWLRQ7DEOHV
6HFWLRQ9,,,±$'0,5$/7<'LJLWDO6HUYLFHV
,QIRUPDWLRQUHOHYDQWWR$'0,5$/7<'LJLWDO6HUYLFHV
)XUWKHU*XLGDQFH
7KH0DULQHU¶V+DQGERRN13JLYHVDIXOOHUH[SODQDWLRQRIWKHOLPLWDWLRQVRIFKDUWVDQGGHWDLOVRIWKH8.+2SROLF\IRU
WKHSURPXOJDWLRQDQGVHOHFWLRQRIQDYLJDWLRQDOO\VLJQLILFDQWLQIRUPDWLRQIRUFKDUWV'HWDLOVRIFKDUWXSGDWLQJPHWKRGVFDQEH
IRXQG LQ ³+RZ WR .HHS <RXU $'0,5$/7< 3URGXFWV 8SWRGDWH´ 13 $OO XVHUV DUH DGYLVHG WR VWXG\ WKHVH
SXEOLFDWLRQV
&$87,21$5<127(6
8SGDWLQJ
8SGDWLQJ LQIRUPDWLRQ LV SXEOLVKHG E\ :HHNO\ 1RWLFHV WR 0DULQHUV VXSSOHPHQWHG E\ QDYLJDWLRQDO ZDUQLQJV IRU LWHPV RI
LPPHGLDWHLPSRUWDQFH,WVKRXOGEHERUQHLQPLQGWKDWWKH\PD\EHEDVHGRQUHSRUWVZKLFKFDQQRWDOZD\VEHYHULILHGEHIRUH
SURPXOJDWLRQDQGWKDWLWLVVRPHWLPHVQHFHVVDU\WREHVHOHFWLYHDQGSURPXOJDWHRQO\WKHPRUHLPSRUWDQWLWHPVWRDYRLG
RYHUORDGLQJXVHUVWKHUHPDLQGHUEHLQJLQFOXGHGLQUHYLVHGHGLWLRQVRIWKHFKDUWVDQGSXEOLFDWLRQVFRQFHUQHG
/DZVDQG5HJXODWLRQV
:KLOHLQWKHLQWHUHVWVRIWKHVDIHW\RIVKLSSLQJWKH8.+2PDNHVHYHU\HQGHDYRXUWRLQFOXGHLQLWVSXEOLFDWLRQVGHWDLOVRIWKH
ODZVDQGUHJXODWLRQVRIDOOFRXQWULHVDSSHUWDLQLQJWRQDYLJDWLRQLWPXVWEHFOHDUO\XQGHUVWRRG
aWKDWQROLDELOLW\ZKDWVRHYHUFDQEHDFFHSWHGIRUIDLOXUHWRSXEOLVKGHWDLOVRIDQ\SDUWLFXODUODZRUUHJXODWLRQDQG
bWKDWSXEOLFDWLRQRIWKHGHWDLOVRIDODZRUUHJXODWLRQLVVROHO\IRUWKHVDIHW\DQGFRQYHQLHQFHRIVKLSSLQJDQGLPSOLHVQR
UHFRJQLWLRQRIWKHLQWHUQDWLRQDOYDOLGLW\RIWKHODZRUUHJXODWLRQ
5HOLDQFHRQ&KDUWVDQG$VVRFLDWHG3XEOLFDWLRQV
:KLOH HYHU\ HIIRUW LV PDGH WR HQVXUH WKH DFFXUDF\ RI WKH LQIRUPDWLRQ RQ $'0,5$/7< FKDUWV DQG ZLWKLQ QDXWLFDO
SXEOLFDWLRQVLWVKRXOGEHDSSUHFLDWHGWKDWLWPD\QRWDOZD\VEHFRPSOHWHDQGXSWRGDWH7KHPDULQHUPXVWEHWKHILQDOMXGJH
RIWKHUHOLDQFHKHFDQSODFHRQWKHLQIRUPDWLRQJLYHQEHDULQJLQPLQGKLVSDUWLFXODUFLUFXPVWDQFHVORFDOSLORWDJHJXLGDQFH
DQGWKHMXGLFLRXVXVHRIDYDLODEOHDLGVWRQDYLJDWLRQ
&KDUWV
&KDUWVVKRXOGEHXVHGZLWKSUXGHQFH WKHUHDUHDUHDVZKHUH WKHVRXUFHGDWDDUHROG LQFRPSOHWHRURISRRUTXDOLW\7KH
PDULQHUVKRXOGXVHWKHODUJHVWVFDOHDSSURSULDWHIRUKLVSDUWLFXODUSXUSRVHDSDUWIURPEHLQJWKHPRVWGHWDLOHGWKHODUJHU
VFDOHVDUHXVXDOO\XSGDWHGILUVW:KHQH[WHQVLYHQHZLQIRUPDWLRQVXFKDVDQHZK\GURJUDSKLFVXUYH\LVUHFHLYHGVRPH
PRQWKV PD\ HODSVH EHIRUH LW FDQ EH IXOO\ LQFRUSRUDWHG LQ SXEOLVKHG FKDUWV 2Q VPDOO VFDOH FKDUWV RI RFHDQ DUHDV ZKHUH
K\GURJUDSKLFLQIRUPDWLRQLVLQPDQ\FDVHVVWLOOVSDUVHFKDUWHGVKRDOVPD\EHLQHUURUDVUHJDUGVSRVLWLRQOHDVWGHSWKDQG
H[WHQW8QGLVFRYHUHGGDQJHUVPD\H[LVWSDUWLFXODUO\DZD\IURPZHOOHVWDEOLVKHGURXWHV
6DWHOOLWH'HULYHG3RVLWLRQVDQG&KDUW$FFXUDF\
0DULQHUVPXVWQRWDVVXPHWKDWFKDUWVZKLFKDUHUHIHUUHGWR:*6'DWXPRUWKRVHIRUZKLFKVKLIWVWR:*6'DWXPDUH
SURYLGHGKDYHEHHQVXUYH\HGWRPRGHUQVWDQGDUGVRIDFFXUDF\2QVRPHFKDUWVRZLQJWRWKHDJHDQGTXDOLW\RIWKHVRXUFH
LQIRUPDWLRQVRPHRIWKHFKDUWHGGHWDLOPD\QRWEHSRVLWLRQHGDFFXUDWHO\,QVXFKFDVHVPDULQHUVDUHDGYLVHGWRH[HUFLVH
SDUWLFXODUFDXWLRQZKHQQDYLJDWLQJLQWKHYLFLQLW\RIGDQJHUVHYHQZKHQXVLQJDQHOHFWURQLFSRVLWLRQLQJV\VWHPVXFKDV*36
)RUIXUWKHUGHWDLOVVHH7KH0DULQHU¶V+DQGERRN137KLVDSSOLHVWRERWKSDSHUDQGGLJLWDO$'0,5$/7<5DVWHU
&KDUW6HUYLFHDQG(1&YHUVLRQVRIFKDUWV
Wk01/19

I
[01/19]
ADMIRALTY Charts affected by the Publication List
ADMIRALTY Charts International Chart
210 INT 1288

946
1912 ADMIRALTY Publications
2688
3692 NP 82
4932 NP 131
5127
8217 Erratum
8219
8251 IND 259
 denotes chart available in the ADMIRALTY Raster Chart Service series.
Wk01/19 1.6
I
ADMIRALTY CHARTS AND PUBLICATIONS NOW PUBLISHED AND AVAILABLE
NEW EDITIONS OF ADMIRALTY CHARTS AND PUBLICATIONS
New Editions of ADMIRALTY Charts 03 January 2019
Chart Title, limits and other remarks Scale Folio 2019 Catalogue
page
946 Indonesia, Ports in Eastern Jawa, Bali, Lombok and Pulau - Pulau 60 72
Kangean.
A Jawa, Probolinggo. 1:50,000
B Bali, Benoa. 1:10,000
C Bali, Celukanbawang. 1:10,000
D Bali, Approaches to Benoa. 1:50,000
E Lombok, Teluk Labuhantereng. 1:30,000
F Jawa, Tanjung Wangi. 1:10,000
G Bali, Padang. 1:50,000
H Java Sea, Pulau – Pulau Kangean, Pagerungan Terminal. 1:60,000
I Lombok, Approaches to Teluk Labuhantereng. 1:100,000
Includes significant safety-related information as follows: changes to

depths, aids to navigation, coastline, jetties, dolphins and a restricted
area.
Note: On publication of this New Edition former Notice 5829(P)/18 is

cancelled. This chart remains affected by Notices 1216(T)/17 and
4938(T)/18.
1912 Morocco, Approaches to Tanger. 1:30,000 20 40, 52

Port of Tanger. 1:10,000

lights and works in progress.
2688 International Chart Series, Baltic Sea – Poland, Approaches to Gdynia 1:75,000 10 36
INT 1288 and Gdańsk.
A Approaches to Władysławowo. 1:15,000
B Port Władysławowo. 1:6,000
Includes changes to depths, wrecks, obstructions, fouls and maritime

limits. (A modified reproduction of INT1288 published by Poland.)

cancelled. This chart remains affected by Notices 3637(T)/15,
4650(T)/17, 1008(T)/18, 4633(T)/18 and 5933(T)/18.
1.7 Wk01/19
I
ADMIRALTY CHARTS AND PUBLICATIONS NOW PUBLISHED AND AVAILABLE
NEW EDITIONS OF ADMIRALTY CHARTS AND PUBLICATIONS
New Editions of ADMIRALTY Charts 03 January 2019 (continued)
Chart Title, limits and other remarks Scale Folio 2019 Catalogue
page
4932 Canada, British Columbia/Colombie-Britannique, Grenville Channel. 1:40,000 91 108

A-B 1:40,000
Union Passage. 1:20,000
Baker Inlet. 1:12,000

depths and rocks.

cancelled.
5127 Routeing Chart North Pacific Ocean. 1:20,000,000 - 142
Meteorological data has been updated throughout these routeing charts.

Principal ports, shipping routes, ocean current flow and load line zones
are also shown on the charts to facilitate trans-oceanic passage
planning. (All twelve monthly versions of the chart are being published
simultaneously).
8251 Port Approach Guide Casablanca and Mohammedia. - 20 144

A Casablanca.
Includes new port developments and channel and changes to restricted

area and lights.
Note: On publication of this New Edition former Notice 465(P)/17,

2300(P)/18, 3947(P)/18, 4600(P)/18 and 5070(P)/18 are cancelled.
ADMIRALTY Publications
NP No. Title and other remarks Date Remarks
NP82 ADMIRALTY List of Lights and Fog Signals Volume J 2018/19. 03/01/2019 Updated to Week 47/18
Western Side of the North Atlantic Ocean (22/11/18).
From Maine to Cabo Orange, including Gulf of Mexico, Caribbean First updates in week 01/19.
Sea and Panama Canal. Volume J 2017/18 is cancelled.
ISBN Number: 978-0-70-772-3945
Wk01/19 1.8
I
ADMIRALTY CHARTS AND PUBLICATIONS TO BE PUBLISHED
ADMIRALTY CHARTS TO BE PUBLISHED 17 January 2019
New Editions of ADMIRALTY Charts

Charts to be
Chart Title, limits and other remarks Scale WITHDRAWN Folio
210 Scotland - East Coast, Newburgh to Montrose. 1:75,000 210 6
Includes significant safety-related information as follows: A new

under construction offshore wind farm.
3692 United States - East Coast, Florida, Approaches to Port Canaveral. 1:80,000 3692 81
Port Canaveral. 1:10,000
Includes significant safety-related information as follows: changes

to coastline, dredged areas and channel limits.
8217 Port Approach Guide Ningbo Gang, Beilun. - 8217 50
Includes changes to coastline and depth areas.
8219 Port Approach Guide Zhoushan. - 8219 50
Includes changes to coastline and depths.
ADMIRALTY CHARTS AND PUBLICATIONS PERMANENTLY WITHDRAWN
ADMIRALTY Charts
Chart to be On publication of
WITHDRAWN Main Title New Chart/New Edition
946 Indonesia , Ports in Eastern Jawa, Bali, Lombok and Pulau - Pulau Kangean. 946
1912 Morocco, Approaches to Tanger. 1912
2688 International Chart Series, Baltic Sea – Poland, Approaches to Gdynia and 2688
INT 1288 Gdańsk. INT 1288
4932 Canada, British Columbia/Colombie-Britannique, Grenville Channel. 4932
5127 Routeing Chart North Pacific Ocean. 5127
8251 Port Approach Guide Casablanca and Mohammadia. 8251
1.9 Wk01/19
I
ADMIRALTY CHART AGENT / DISTRIBUTOR INFORMATION
NP131 - Catalogue of ADMIRALTY Charts (NP131), 2019 Edition

Amendments to Part 1, ADMIRALTY Authorised Chart Agents / Distributors
Page 6, Distributor Section,
Amend:
Wärtsilä Voyage Middle East

#120 Al Nasr Plaza, Oud Metha Road
Dubai, 117148
T: +97 14 357 3625
F: +97 14 357 3626
tme@transas.com
www.wartsila.com/transas
Digital
This is an amendment to current listing Transas Middle East.
Amend:
Wärtsilä Voyage Shanghai Co., Ltd

1702 West Tower
Lilacs International Commercial Center
No. 1299 Minsheng Road, Pudong
Shanghai, 200135
T: +86 21 3392 6750
F: +86 21 3392 6790
info.china@transas.com
Digital
This is an amendment of current listing Transas Marine Shanghai Co., Ltd.
Amend:
Wärtsilä Voyage Greece Branch

1 Posidonos Ave. & Goumi
Athens, Alimos
17456
T: +30 96574260
F: +30 2108995218
housakos@netone.gr
Digital
This is an amendment of current listing Transas Marine Hellas.
Amend:
Wärtsilä Voyage Germany GmbH

Luruper Chaussee 125
Hamburg
D-22761
T: +49 40 890 6660
F: +49 40 891 1379
info@transas.de
Digital
This is an amendment of current listing Transas Marine GmbH.
Wk01/19 1.10
I

Page 6, Distributor Section, (continued)
Amend:
Wärtsilä Voyage Mediterranean Sas

Les 2 Arcs, 1800 Route des Cretes
Valbonne 06560
T: +33 489 864 100
F: +33 489 864 129
med-sales@transas.com
Digital
This is an amendment to current listing Transas Mediterranean Sas.
Amend:
Wärtsilä Voyage Mediterranean Branch
Via de Commercio, 27/5A
Genova, 16167
T: +39 010 3200 576
F: +39 010 3200 576
info-it@transas.com
Digital
This is an amendment to current listing Transas Mediterranean SAS.
Page 7, Distributor Section,
Amend:
Wärtsilä Voyage Sweden AB

Datavagen 37
Askim
43632
T: +46 31 769 56 80
F: +46 31 69 41 84
charts@transas.com
Digital
This is an amendment to current listing Transas Scandanavia.
Amend:
Wärtsilä Software Technologies (AO)

54-4 Maly pr., VO
St Petersburg
199178
T: +7 812 325 3131
F: +7 812 325 3132
sea@transas.com
Digital
This is an amendment of current listing Transas Marine (Russia)
1.11 Wk01/19
I

Page 7, Distributor Section, (continued)
Amend:
Wärtsilä Voyage Pacific Pte Ltd

Cyber Centre, 16/18 Jalan Kilang Barat
159358
T: +65 627 10 200
F: +65 627 17 300
info.asia@transas.com
Digital
This is an amendment of current listing Transas Marine Shanghai Co., Ltd.
Page 8, Distributor Section
Amend:
Wärtsilä Voyage UK Limited

Building 2000
Lakeside North Harbour
Western Road
Portsmouth
PO6 3EN
T: +44 2392 674000
F: +44 2392 677554
tmuk.sales@transas.com
Digital
This is an amendment to current listing Transas Marine UK Ltd.
ERRATA
Notice to Mariners Week 49/18
Section 1, page 1.7
Reproductions of Indian Government Charts
The publication date of Chart IN259 should read 31/03/2015.
Wk01/19 1.12
II
GEOGRAPHICAL INDEX
(1) Miscellaneous . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(2) British Isles . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.6
(3) North Russia, Norway, The Færoe Islands and Iceland . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.6
(4) Baltic Sea and Approaches . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.7 – 2.10
(5) North Sea and North and West Coasts of Denmark, Germany, Netherlands and Belgium . . . . . . . . 2.11 – 2.12
(6) France and Spain, North and West Coasts, and Portugal . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.12 – 2.13
(7) North Atlantic Ocean. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(8) Mediterranean and Black Seas. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.13 – 2.16
(9) Africa, West Coast and South Atlantic . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.17 – 2.18
(10) Africa, South and East Coasts, and Madagascar . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(11) Red Sea, Arabia, Iraq and Iran. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.19
(12) Indian Ocean, Pakistan, India, Sri Lanka, Bangladesh and Burma . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.20
(13) Malacca Strait, Singapore Strait and Sumatera . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.21
(14) China Sea with its West Shore and China . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.21 – 2.23
(15) Japan . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.24 – 2.26
(16) Korea and the Pacific Coasts of Russia . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.26 – 2.27
(17) Philippine Islands, Borneo and Indonesia except Sumatera . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.27 – 2.31
(18) Australia and Papua New Guinea . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(19) New Zealand . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(20) Pacific Ocean . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.31 – 2.32
(21) Aleutian Islands, Alaska and West Coast of North America including Mexico . . . . . . . . . . . . . . . . . . . . . . . 2.32
(22) West Coasts of Central and South America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.33
(23) Antarctica. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(24) East Coast of South America and The Falkland Islands . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.34
(25) Caribbean Sea, West Indies and the Gulf of Mexico. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.34
(26) East Coast of North America and Greenland . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.35
(27) T & P Notices . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.36 – 2.45
2.1
Wk01/19
II
INDEX OF NOTICES AND CHART FOLIOS
Notice No. Page Admiralty Chart Folio Notice No. Page Admiralty Chart Folio
27 2.24 54 84 2.34 87
28 2.24 54 85(T)/19 2.37 10
29 2.24 54 86 2.13 17
30 2.24 54 87 2.6 8
31 2.25 53 88(P)/19 2.45 60
32 2.25 53 89 2.22 47, 50
33 2.25 53 90 2.35 81
34 2.26 53 91 2.31 73
35(T)/19 2.43 55 92 2.8 10
36(T)/19 2.44 55 93 2.16 31
37(T)/19 2.44 53 94* 2.11 6, 7
38(T)/19 2.44 54 95 2.29 58
39 2.21 50 96 2.29 47, 48
40 2.17 34 97 2.30 60
41 2.13 26 98(T)/19 2.36 6
42 2.7 10 99 2.18 20
43 2.34 83 100 2.33 89
44(P)/19 2.42 50 101 2.33 98
45(P)/19 2.42 52 102 2.11 9
46 2.7 10 103(P)/19 2.39 20
47(P)/19 2.43 52 104 2.9 10
48 2.7 10 105(P)/19 2.41 43
49 2.35 81 106 2.31 58, 59, 60
50 2.27 58, 60 107 2.9 10
51 2.7 10 108(P)/19 2.37 10
52 2.33 98 109 2.12 9
53 2.6 7 110 2.9 10
54 2.21 47 111 2.26 52
55 2.34 83 112 2.12 9
56 2.14 27 113 2.22 50, 53
57 2.34 83 114 2.23 52
58 2.28 48 115 2.32 56, 92
59 2.19 40 116(T)/19 2.36 14
60 2.14 27 117 2.16 25
61 2.14 27 118 2.23 52
62 2.14 31 119 2.35 83
63 2.22 50 120 2.20 43, 45
64 2.26 53 121 2.26 52
65(P)/19 2.38 26 122 2.32 57, 74, 88, 89, 92
66 2.15 26 123 2.21 45
67 2.11 9 124 2.16 25
68(P)/19 2.43 52 125 2.16 24
69 2.15 26 126 2.10 10
70(T)/19 2.44 52 127 2.19 40
71 2.12 9 128 2.10 10
72(T)/19 2.36 10 129 2.27 53
73(P)/19 2.41 41 130 2.10 10, 11
74 2.13 16 131 2.23 52
75(T)/19 2.43 47 132 2.6 14
76(T)/19 2.45 52 133 2.18 18, 20
77(T)/19 2.39 31 134(P)/19 2.39 40
78 2.17 20 135(P)/19 2.36 14
79 2.17 20 136 2.34 95
80 2.13 18 137 2.10 10
81 2.15 25 138(T)/19 2.37 10
82 2.15 25 139 2.21 45
83(T)/19 2.38 7, 9
2.2
Wk01/19
II
INDEX OF CHARTS AFFECTED
Admiralty Chart No. Notices

Notices Admiralty
Admiralty Chart
Chart No.
No. Notices
110 83T 2014 85T

115 98T 2015 85T, 108P
116 83T 2075 130
120 83T 2115 108P
126 83T 2120 124
127 64, 113, 129 2135 74
130 83T 2182B 94
161 96 2182C 94
163 96 2217 62
187 61 2232 62
188 61 2241 130
220 60 2244 69
266 83T 2247 117
278 94 2257 52
291 94 2276 46, 72T
319 105P 2282 77T
329 136 2284 77T
355 41 2344 107
356 41 2347 32, 34
473 81 2409 63
491 84 2412 32, 34
525 119 2471 106
580 125 2472 106
655 100 2473 50
802 137 2523 127
810 137 2595 104
811 48 2645 68P
820 138T 2679 85T
823 120 2682 135P
830 120 2683 116T, 132, 135P
839 92 2684 135P
843 51 2685 135P
844 92 2728 90
846 51 2747 86
856 133 2799 52
862 78, 133 2816 110
863 99 2817 130
869 126 2834 82
876 128 2837 59
917 66 2857 42
946 88P 2858 59
998 91 2875 97
1250 45P 2876 97
1253 118 2886 59, 127
1259 76T 2887 59, 127
1270 121 2889 127
1271 121 2903 106
1281 131 2915 97
1286 47P 3089 101
1336 96 3100 40
1350 71 3101 40
1382 91 3103 40
1409 98T 3132 133
1467 60 3133 99, 133
1473 56 3134 99
1633 83T 3204 49
1635 83T 3236 113
1688 79 3237 32, 34
1700 81 3267 102
1705 124 3316 93
1719 63 3337 87
1731 80 3449 44P
1862 99 3480 131
1872 71 3497 53
1873 71 3617 112
1912 103P 3625 109
1913 41 3631 83T
1965 75T 3658 113
1974 124 3666 70T
2.3
Wk01/19
II

Notices International
Chart No.
3690 114 INT 50 122
3696 114 INT 51 122
3706 97 INT 52 122
3726 97 INT 53 122
3766 67 INT 100 132
3768 43 INT 654 91
3772 134P INT 657 91
3835 96 INT 750 59
3836 96 INT 756 120
3849 43 INT 809 122
3852 57 INT 810 115
3896 55 INT 813 115
3901 139 INT 814 115
3921 139 INT 1041 94
3924 50, 95 INT 1042 94
3925 50 INT 1201 85T, 108P
3928 111 INT 1210 130
3931 58 INT 1219 85T
3933 123 INT 1229 51
3950 127 INT 1230 51
3959 136 INT 1233 92
3989 54 INT 1238 138T
4050 122 INT 1239 48
4051 122 INT 1311 126
4052 122 INT 1328 42
4053 122 INT 1332 104
4100 132 INT 1365 107
4121 89 INT 1411 67
4124 39 INT 1413 83T
4127 89 INT 1417 83T
4491 58 INT 1423 83T
4654 91 INT 1453 109
4657 91 INT 1454 102
4809 122 INT 1456 112
4810 115 INT 1461 83T
4813 115 INT 1468 83T
4814 115 INT 1473 83T
4977 115 INT 1477 83T
5384 135P INT 1479 83T
8116 134P INT 1480 71
8225 65P INT 1482 71
INT 1503 98T
Japanese INT 1504 98T
Notices INT 1554 53
Chart No.
INT 1765 92
JP 31 35T, 36T INT 1771 137
JP 126 27, 38T INT 1772 137
JP 141 29 INT 1858 80
JP 142 29 INT 1939 99
JP 221 31 INT 1991 79
JP 1067 37T INT 2805 40
JP 1102 30 INT 2872 40
JP 1106 27 INT 2873 40
JP 1222 31, 32, 33, 34 INT 3167 81
JP 1263 28 INT 3190 69
JP 1265 28 INT 3360 41
INT 3362 41
INT 5251 70T
Indian INT 5363 121
Notices
Chart No. INT 7017 59
INT 7211 127
IN 31 120 INT 7232 59, 127
IN 211 73P INT 7243 59, 127
IN 255 73P INT 7244 127
IN 3009 105P INT 7249 134P
INT 7250 127
INT 7334 73P
INT 7407 105P
2.4
Wk01/19
II
International
Admiralty Chart No. Notices Admiralty Chart No. Notices
Notices
Chart No.
INT 7408 105P
INT 7438 120
2.5
Wk01/19
II
53 ENGLAND - East Coast - Drying height. Depths. Buoyage.
Source: ABP Humber
Chart 3497 (INT 1554) [ previous update 6025/18 ] ETRS89 DATUM

Insert drying height, 0 2 , enclosed by 0m low water line 53° 42´·83N., 0° 23´·04W.
depth, 02 (a) 53° 43´·03N., 0° 22´·78W.
Delete depth, 04 , close S of: (a) above
Insert depth, 03 (b) 53° 43´·07N., 0° 22´·60W.
Delete depth, 07 , close NE of: (b) above
Move
Cb Fl.G.2s No 23, from:
53° 42´·76N., 0° 23´·11W.
to: 53° 42´·87N., 0° 22´·74W.
Bd Fl.R.4s No 28, from: 53° 43´·43N., 0° 22´·15W.
to: 53° 43´·49N., 0° 21´·92W.
87 ENGLAND - East Coast - NM Block.

Source: Port of London Authority
Chart 3337 [ previous update 6036/18 ] ETRS89 DATUM

Insert the accompanying block, centred on: 51° 30´·1N., 0° 03´·9W.
132 NORWAY - North Coast - Buoyage.

Source: Norwegian Notice 22/59586/18
Chart 2683 [ previous update 6035/18 ] WGS84 DATUM

Delete
B Fl(5)Y.20s ODAS 74° 00´·0N., 34° 58´·8E.
72° 33´·0N., 34° 51´·0E.
71° 58´·8N., 31° 58´·8E.
72° 32´·4N., 21° 58´·2E.
73° 30´·0N., 23° 22´·8E.
Ef Fl(5)Y.20s ODAS 71° 35´·0N., 28° 28´·3E.
73° 55´·0N., 24° 49´·9E.
Chart 4100 (INT 100) [ previous update 5315/18 ] WGS84 DATUM

Delete
B Fl(5)Y.20s ODAS 73° 30´·0N., 23° 22´·8E.
72° 32´·4N., 21° 58´·2E.
2.6
Wk01/19
II
42 SWEDEN - South Coast - Works. Legend.

Source: Swedish Notice 731/13599/18

Insert maritime limit, pecked line, joining: (a) 56° 09´·66N., 15° 37´·99E.
(b) 56° 09´·56N., 15° 38´·07E.
56° 09´·52N., 15° 38´·69E.
56° 09´·60N., 15° 38´·74E.
legend, Works in progress, close W of: (a)-(b) above
46 LITHUANIA - NM Block.
Source: Lithuanian Navigational Warning 77/18
.
Chart 2276 (Panel B, Continuation of Klaipeda) [ previous update 2368/18 ] WGS84 DATUM
Insert the accompanying block, centred on: 55° 39´·4N., 21° 09´·0E.
48 SWEDEN - East Coast - Depths.


Delete 6m contour, joining: 59° 18´·80N., 18° 01´·86E.
59° 18´·81N., 18° 01´·90E.
and
59° 18´·78N., 18° 01´·92E.
59° 18´·77N., 18° 01´·93E.
51 SWEDEN - East Coast - Buoyage.


Replace
Jdwith J Fl R 3s 58° 39´·01N., 17° 07´·50E.
JXwith JX Q(9)15s 58° 38´·82N., 17° 08´·18E.

Replace
Jdwith J Fl R 3s 58° 39´·01N., 17° 07´·50E.
JXwith JX Q(9)15s 58° 38´·82N., 17° 08´·18E.
2.7
Wk01/19
II
92 SWEDEN - East Coast - Submarine power cables.


Insert submarine power cable, ÉÊÉ, joining: 58° 50´·81N., 17° 38´·65E.
58° 51´·31N., 17° 38´·03E.
58° 51´·52N., 17° 38´·06E.
58° 51´·64N., 17° 38´·18E.
58° 51´·71N., 17° 38´·19E.
and
58° 51´·73N., 17° 38´·22E.
58° 51´·71N., 17° 38´·36E.
58° 51´·78N., 17° 38´·47E.
58° 51´·86N., 17° 38´·37E.
58° 52´·16N., 17° 37´·43E.
58° 52´·18N., 17° 37´·22E.
58° 52´·41N., 17° 36´·93E.

58° 51´·31N., 17° 38´·03E.
58° 51´·52N., 17° 38´·06E.
58° 51´·64N., 17° 38´·18E.
58° 51´·71N., 17° 38´·19E.
and
58° 51´·73N., 17° 38´·21E.
58° 51´·71N., 17° 38´·36E.
58° 51´·78N., 17° 38´·47E.
58° 51´·86N., 17° 38´·37E.
58° 52´·16N., 17° 37´·43E.
58° 52´·18N., 17° 37´·22E.
58° 52´·41N., 17° 36´·93E.
2.8
Wk01/19
II
104 DENMARK - East Coast - NM Blocks. Restricted areas. Legends. Note.

Source: Danish Chart Corrections 47/522-524/18.
Chart 2595 (INT 1332) [ previous update New Edition 04/10/2018 ] WGS84 DATUM
Delete limit of restricted area, entry prohibited, pecked line, joining: 55° 27´·48N., 12° 12´·70E.
55° 27´·45N., 12° 12´·40E.
55° 27´·49N., 12° 12´·30E.
55° 27´·68N., 12° 12´·30E.
and
55° 27´·19N., 12° 11´·92E.
55° 27´·26N., 12° 12´·12E.
55° 27´·25N., 12° 12´·24E.
55° 27´·34N., 12° 12´·52E.
55° 27´·44N., 12° 12´·68E.
legend, Bns, centred on: 55° 27´·78N., 12° 11´·50E.
legend, Works in progress (see Note), centred on: 55° 27´·33N., 12° 13´·37E.
note, WORKS IN PROGRESS, centred on: 55° 32´·77N., 13° 09´·98E.
Chart 2595 (INT 1332) (Panel A, Køge) [ previous update New Edition 04/10/2018 ] WGS84 DATUM
Insert the accompanying block A, centred on: 55° 27´·5N., 12° 12´·3E.
Chart 2595 (INT 1332) (Panel B, Approaches to Køge) [ previous update New Edition 04/10/2018 ] WGS84 DATUM
Insert the accompanying block B, centred on: 55° 27´·4N., 12° 12´·5E.
107 GERMANY - Baltic Coast - Buoyage.

Source: German Notice 48/34/18
Chart 2344 (INT 1365) (Panel G, Ostseekai to Bahnhofskai) [ previous update 4050/18 ] WGS84 DATUM
Insert symbol, yellow and red spherical buoy 54° 19´·662N., 10° 08´·908E.
54° 19´·641N., 10° 08´·925E.
54° 19´·624N., 10° 08´·916E.
110 BALTIC SEA - Platforms. Depth.

Source: Danish Chart Correction 47/519/18
Note: This update will be included in the New Edition of Chart 2115 to be published 7 February 2019.

Insert
¼{ 55° 01´·6N., 12° 51´·0E.
(a) 55° 02´·9N., 12° 56´·7E.
Delete depth, 15, close W of: (a) above
2.9
Wk01/19
II
126 SWEDEN - West Coast - Submarine power cables.


58° 16´·72N., 11° 39´·42E.
58° 16´·65N., 11° 39´·94E.
58° 16´·55N., 11° 40´·04E.
and
58° 16´·79N., 11° 39´·16E.
58° 16´·70N., 11° 39´·24E.
128 SWEDEN - West Coast - Depth.

Chart 876 (Panel C, Landskrona) [ previous update New Chart 04/10/2018 ] WGS84 DATUM
Insert depth, 109 55° 52´·859N., 12° 46´·871E.
130 ESTONIA - Light.

Source: Estonian Notice 12/141/18
Chart 2075 (INT 1210) [ previous update New Chart 26/07/2018 ] WGS84 DATUM
Amend range of light to, 12M 58° 56´·40N., 22° 03´·32E.


137 SWEDEN - East Coast - Vertical clearance.


Amend vertical clearance to, 40·5m 59° 31´·60N., 17° 07´·79E.

Amend vertical clearance to, 40·5m 59° 31´·60N., 17° 07´·78E.
2.10
Wk01/19
II
67 DENMARK - North Sea Coast - Spoil ground. Legend.

Source: Danish Chart 94

Insert limit of spoil ground, pecked line, joining: (a) 55° 27´·02N., 8° 01´·28E.
(b) 55° 26´·47N., 8° 01´·28E.
(c) 55° 26´·50N., 8° 02´·20E.
(d) 55° 27´·02N., 8° 02´·22E.
legend, Spoil Ground, within: (a)-(d) above
94* NORTH SEA - United Kingdom Sector - Wells.

Source: UKHO

Delete
84, Well 57° 17´·14N., 0° 45´·91E.
83, Well 57° 09´·58N., 0° 37´·18E.
57° 09´·10N., 0° 33´·08E.

Delete
141- Well 58° 14´·64N., 0° 21´·65E.
Chart 2182B (INT 1042) [ previous update 6191/18 ] WGS84 DATUM

Delete
å Well 57° 09´·5N., 0° 33´·3E.
57° 09´·2N., 0° 37´·2E.
Chart 2182C (INT 1041) [ previous update 6106/18 ] WGS84 DATUM

Delete
å Well 58° 14´·7N., 0° 21´·6E.
57° 17´·1N., 0° 46´·2E.
57° 09´·5N., 0° 37´·2E.
57° 09´·1N., 0° 33´·0E.
102 GERMANY - North Sea Coast - Depths.

Insert depth, 124 (a) 53° 43´·42N., 9° 27´·96E.
Delete depth, 129 , close SE of: (a) above
Insert depth, 131 (b) 53° 42´·83N., 9° 28´·52E.
Delete depth, 13 7 , close S of: (b) above
2.11
Wk01/19
II
109 GERMANY - North Sea Coast - Depths.


Insert depth, 77 (a) 53° 51´·67N., 9° 00´·46E.
Delete depth, 85 , close W of: (a) above
Insert depth, 62 (b) 53° 51´·32N., 8° 57´·69E.
Delete depth, 71 , close W of: (b) above
Insert depth, 58 (c) 53° 51´·40N., 8° 57´·27E.
Delete depth, 69 , close SW of: (c) above
Insert depth, 75 (d) 53° 51´·17N., 8° 56´·83E.
Delete depth, 81 , close W of: (d) above
112 GERMANY - North Sea Coast - Depths. Foul.


Insert depth,135 (a) 53° 47´·71N., 8° 08´·37E.
Delete depth, 139, close S of: (a) above
Insert depth,139 (b) 53° 45´·13N., 8° 11´·90E.
Delete depth,147 , close E of: (b) above
Insert depth,145 (c) 53° 45´·86N., 8° 03´·00E.
Delete depth,15, close S of: (c) above
« 53° 53´·64N., 7° 50´·48E.
71 FRANCE - North Coast - Buoy.

Source: French Notice 48/45/18

Delete
Gf Statue syrène 51° 04´·33N., 2° 21´·27E.

Delete
Gf 51° 04´·33N., 2° 21´·27E.

Delete
Gf 51° 04´·33N., 2° 21´·27E.
2.12
Wk01/19
II
74 FRANCE - North Coast - Restricted area.


Insert circular limit of restricted area, entry prohibited, radius 200m,
Ç , centred on:
49° 27´·85N., 1° 05´·50W.
80 SPAIN - West Coast - Lights.

Source: Spanish Lights List

Amend light to, Fl(4)R.11s5m1M 42° 13´·715N., 8° 44´·968W.
Delete
· Q(2)R.3s5m1M
42° 13´·729N., 8° 44´·995W.
86 FRANCE - West Coast - Beacon. Light-beacon.

Note: Light-beacon designation remains Q.
Chart 2747 (Panel A, Port-des-Barques to Rochefort) [ previous update New Edition 08/03/2018 ] WGS84 DATUM
Replace
Kk Q with Tk Q.G Q 45° 57´·697N., 1° 00´·816W.
41 ITALY - West Coast - Light-beacon.

Source: Italian Notice 24.14/18

Delete
TlFl.Y.3s8m3M
Ü 44° 22´·562N., 8° 58´·847E.

Delete
TlFÜ l.Y.3s8m3M 44° 22´·56N., 8° 58´·85E.

Delete
TlFÜ l.Y.3s8m3M 44° 22´·56N., 8° 58´·86E.
2.13
Wk01/19
II
56 ITALY - East Coast - Restricted area.

Chart 1473 (Panel A, Trieste) [ previous update 1669/18 ] WGS84 DATUM

Insert limit of restricted area, entry prohibited, pecked line, joining: 45° 37´·73N., 13° 46´·40E.
45° 37´·73N., 13° 46´·38E.
45° 37´·60N., 13° 46´·29E.
45° 37´·61N., 13° 46´·26E.
45° 37´·55N., 13° 46´·22E.
45° 37´·52N., 13° 46´·30E.
Delete former limit of restricted area, entry prohibited, pecked line,
joining: 45° 37´·60N., 13° 46´·30E.
45° 37´·56N., 13° 46´·28E.
45° 37´·55N., 13° 46´·32E.
60 ITALY - East Coast - Marine farm.


Insert
Ì (buoyed) 44° 00´·1N., 12° 49´·3E.

Insert
Ì (buoyed) 44° 00´·12N., 12° 49´·33E.
61 ITALY - East Coast - Wreck.


Delete
^ PA 40° 09´·4N., 18° 30´·6E.

Delete
^ PA 40° 09´·4N., 18° 30´·6E.
62 UKRAINE - Legend.
Source: UKHO
Chart 2217 [ previous update 5154/18 ] PULKOVO 1942 DATUM

Amend legend to, 032°-212°, centred on: 44° 34´·18N., 33° 20´·33E.

Amend legend to, 032°-212°, centred on: 44° 34´·8N., 33° 20´·2E.
2.14
Wk01/19
II
66 ITALY - Sicilia - Depths.


Replace depth, 188 enclosed by 20m contour, with depth, 48 38° 13´·43N., 15° 34´·47E.
69 MONACO - Mooring buoys.

Insert
R 43° 44´·159N., 7° 25´·712E.
43° 44´·191N., 7° 25´·704E.
81 SPAIN - Mediterranean Sea Coast - Wrecks.

Source: Spanish Notice 48/397/18

Insert
41,û Wk (a) 38° 18´·17N., 0° 22´·96W.
Delete
50,û Wk PA, close NW of: (a) above
Chart 1700 [ previous update New Edition 22/11/2018 ] WGS84 DATUM

Replace
50,û Wk PA, with 41,û Wk 38° 18´·2N., 0° 23´·0W.
82 SPAIN - Islas Baleares - Pilot boarding places.

Source: Spanish Notice 48/398/18
Chart 2834 (Panel A, Channels Between Ibiza and Formentera ) [ previous update 3669/18 ] WGS84 DATUM
Insert
ÂE 38° 53´·52N., 1° 28´·40E.
ÂS 38° 52´·80N., 1° 26´·80E.
Delete
Â 38° 53´·88N., 1° 28´·43E.

Insert
Â 38° 53´·50N., 1° 28´·40E.
38° 52´·70N., 1° 26´·85E.
Delete
Â 38° 53´·90N., 1° 28´·42E.
2.15
Wk01/19
II
93 RUSSIA - Black Sea Coast - Wreck. Depth.

Source: UKHO

Insert
22$, Wk (a) 44° 39´·64N., 37° 36´·63E.
Delete depth, 234 , close SW of: (a) above
117 FRANCE - South Coast - Submarine pipeline.

Chart 2247 (Panel D, Port Pierre Canto) [ previous update 4734/18 ] WGS84 DATUM
Insert submarine pipeline, È, joining: 43° 32´·111N., 7° 02´·221E.
43° 32´·040N., 7° 02´·165E.

Insert submarine pipeline, È, joining: 43° 32´·11N., 7° 02´·22E.
43° 32´·00N., 7° 02´·14E.
43° 31´·44N., 7° 02´·49E.
124 FRANCE - South Coast - Restricted area. Legend.

Source: French Chart 7407

Insert circular limit of restricted area, radius 1M, Ç, centred on: 42° 56´·0N., 6° 19´·0E.
legend, Area to be Avoided, centred on: 42° 56´·0N., 6° 16´·4E.

Insert circular limit of restricted area, radius 1M, Ç, centred on: 42° 56´·0N., 6° 19´·0E.
legend, Area to be Avoided, centred on: 42° 55´·9N., 6° 16´·4E.

Insert circular limit of restricted area, radius 1M, Ç, centred on: (a) 42° 56´·00N., 6° 19´·01E.
legend, Area to be Avoided, centred on: (a) above
125 MOROCCO - North Coast - NM Block.

Source: Spanish Notice 48/400/18, French Lights List & UKHO
Chart 580 (Panel D, Approaches to Melilla and Port Nador) [ previous update 6189/18 ] WGS84 DATUM
2.16
Wk01/19
II
40 IVORY COAST - NM Blocks. Hulk. Depth. Legends. Light.

Note: Former Notice 5104(T)/18 is cancelled and Chart 3100 is to be deleted from the list of charts affected by Notice 1183(P)/
18
Chart 3100 (INT 2805) [ previous update 5310/18 ] UNDETERMINED DATUM

Delete
· Oc(2)R 5° 14´·7N., 4° 00´·2W.
Chart 3101 (INT 2872) (Panel A, Approaches to Port d’Abidjan) [ previous update 1482/17 ] WGS84 DATUM
Chart 3101 (INT 2872) [ previous update 1482/17 ] UNDETERMINED DATUM

Delete
¶ Oc(2)R.11M 5° 14´·82N., 4° 00´·11W.

hulk, length 150m, width 40m, orientated 332°/152° (bows
NW), centred on: (a) 5° 17´·801N., 4° 02´·590W.
legend, Hulk, close W of: (a) above
Delete depth, 115 , close NE of: (a) above
legend, Dredged to 13,5m, centred on: 5° 15´·581N., 4° 00´·939W.
78 MOROCCO - West Coast - Lights. Fog signal.

Chart 862 (Panel E, Safi) [ previous update 1513/18 ] WGS84 DATUM

Amend light to, Iso.G.4s10m8M (a) 32° 18´·819N., 9° 15´·387W.
Delete fog signal, Horn, at light (a) above
Amend light to, Fl.R.4s6m6M 32° 18´·767N., 9° 15´·090W.
light to, Fl.G.4s4m3M 32° 18´·685N., 9° 15´·190W.
light to, Fl(2)R.6s7m6M 32° 18´·569N., 9° 14´·986W.
light to, Fl(2)G.6s8m6M 32° 18´·535N., 9° 15´·076W.
Chart 862 (Panel D, Approaches to Safi) [ previous update 1513/18 ] WGS84 DATUM
Amend light to, Iso.G.4s10m8M (a) 32° 18´·82N., 9° 15´·39W.
Delete fog signal, Horn, at light (a) above
79 MAURITANIA - Buoy.
Chart 1688 (INT 1991) (Panel, Port de Nouakchott and Port de l’Amitié) [ previous update 4783/18 ] WGS84 DATUM
Delete
Df B1 17° 59´·060N., 16° 01´·998W.
2.17
Wk01/19
II
99 MOROCCO - West Coast - Lights.

Chart 863 (Panel B, Approaches to Essaouira) [ previous update New Edition 25/01/2018 ] WGS84 DATUM
Amend light to, Fl(3)12s6m12M 31° 30´·35N., 9° 46´·55W.
light to, Oc.WRG.12s19m14-9M 31° 29´·54N., 9° 45´·85W.
Delete
¶ Fl(2)15s48m20M and associated circular white arc 31° 41´·79N., 9° 39´·93W.
Chart 863 (Panel C, Essaouira) [ previous update New Edition 25/01/2018 ] WGS84 DATUM
Amend light to, Fl(3)12s6m12M 31° 30´·351N., 9° 46´·518W.
light to, Oc.R.4s3m6M 31° 30´·422N., 9° 46´·509W.
light to, Iso.G.4s3m5M 31° 30´·438N., 9° 46´·468W.
light to, Oc.WRG.12s19m14-9M 31° 29´·531N., 9° 45´·845W.

Amend light to, Fl(3)15s25M 27° 55´·5N., 12° 56´·4W.

Amend light to, Fl(3)25M 27° 55´·1N., 12° 56´·7W.
Delete
¶ Fl(2)20M and associated circular white arc 31° 42´·1N., 9° 40´·0W.

133 MOROCCO - West Coast - Lights.


Insert
¶Q.R.13m6M 34° 02´·43N., 6° 50´·28W.
¶ Q.G.13m6M 34° 02´·34N., 6° 50´·45W.
Chart 862 (Panel B, Jorf Lasfar) [ previous update 78/19 ] WGS84 DATUM
Insert
¶ Dir.Fl(3)WRG.6s14m6M 33° 08´·18N., 8° 37´·52W.


2.18
Wk01/19
II
59 QATAR - Wreck.
Source: MENAS Navigational Warning 158/18

Insert
´ 26° 05´·6N., 53° 03´·5E.

Insert
´ 26° 05´·6N., 53° 03´·5E.

Insert
´ 26° 05´·6N., 53° 03´·5E.

Insert
´ 26° 05´·6N., 53° 03´·5E.
127 QATAR - NM Blocks. Maritime limit. Restricted area. Legends.

Source: Qatar Petroleum

maritime limit, pecked line, joining: (a) 25° 55´·38N., 52° 15´·80E.
(b) 25° 55´·38N., 52° 17´·60E.
(c) 25° 53´·78N., 52° 17´·60E.
(d) 25° 53´·78N., 52° 15´·80E.
legend, Waiting Area, within: (a)-(d) above
Delete limit of restricted area, Ç, and associated legend, Waiting
Area, joining: 26° 02´·48N., 52° 11´·47E.
26° 02´·47N., 52° 13´·28E.
26° 00´·89N., 52° 13´·28E.
26° 00´·89N., 52° 11´·47E.

maritime limit, pecked line, joining: (a) 25° 55´·4N., 52° 15´·8E.
(b) 25° 55´·4N., 52° 17´·6E.
(c) 25° 53´·8N., 52° 17´·6E.
(d) 25° 53´·8N., 52° 15´·8E.
Delete maritime limit, pecked line, and associated legend, Waiting
Area, joining: 26° 02´·5N., 52° 11´·5E.
26° 02´·5N., 52° 13´·3E.
26° 00´·9N., 52° 13´·3E.
26° 00´·9N., 52° 11´·5E.
2.19
Wk01/19
II
127 QATAR - NM Blocks. Maritime limit. Restricted area. Legends. (continued)

Insert maritime limit, pecked line, joining: 25° 55´·4N., 52° 17´·1E.
(a) 25° 55´·4N., 52° 17´·6E.
(b) 25° 53´·8N., 52° 17´·6E.
25° 53´·8N., 52° 17´·1E.
legend, Waiting Area, close E of: (a)-(b) above

Insert maritime limit, pecked line, joining: (a) 25° 55´·4N., 52° 15´·8E.
(b) 25° 55´·4N., 52° 17´·6E.
(c) 25° 53´·8N., 52° 17´·6E.
(d) 25° 53´·8N., 52° 15´·8E.

Delete maritime limit, pecked line, and associated legend, Waiting
Area, joining: 26° 02´·00N., 52° 13´·27E.
26° 00´·93N., 52° 13´·27E.
26° 00´·93N., 52° 11´·46E.
26° 02´·00N., 52° 11´·47E.
120 BURMA - Platform.

Source: Polarcus Limited OSE
Chart IN 31 (INT 756) [ previous update 4333/18 ] WGS84 DATUM

Insert
¼{ 15° 09´·6N., 94° 43´·0E.

Insert
¼{WP4 15° 09´·6N., 94° 43´·0E.

Insert
¼{ 15° 09´·6N., 94° 43´·0E.
2.20
Wk01/19
II
123 INDONESIA - Sumatera - Depths. NM Block.

Source: Indonesian Chart 18A
Chart 3933 (Panel A, Dumai) [ previous update 1102/17 ] WGS84 DATUM

depth, 95 , enclosed by 10m contour 1° 43´·91N., 101° 23´·10E.
depth, 134 1° 43´·78N., 101° 24´·72E.
depth, 128 (a) 1° 43´·59N., 101° 24´·96E.
Delete depth, 137 , close NW of: (a) above
Insert depth, 148 (b) 1° 42´·87N., 101° 26´·67E.
Delete depth, 16, close N of: (b) above
Insert depth, 164 (c) 1° 41´·80N., 101° 29´·22E.
Delete depth, 186 , close S of: (c) above
Insert depth, 14 (d) 1° 41´·15N., 101° 28´·98E.
Delete depth, 182 , close NW of: (d) above
139 INDONESIA - Sumatera - NM Block. Buoy. Legend.

Source: Indonesian Chart 341 and Indonesian Notice 49/541/18

Insert legend, Buoyed Channel, orientated N/S, between: (a) 3° 30´·4N., 99° 27´·7E.
(b) 3° 24´·6N., 99° 27´·7E.
Delete former legend, Buoyed Channel, close E of: (a)-(b) above
HpZ Fl.5s 3° 30´·9N., 99° 32´·0E.

39 CHINA - South Coast - Depths.

Source: Hong Kong Notice 24/55/18

Insert depth, 146 , and extend 15m contour E to enclose 22° 25´·872N., 113° 52´·974E.
22° 25´·777N., 113° 52´·970E.
54 VIETNAM - Depths.
Source: VMS-North Notice 239/18

Insert depth, 61 (a) 18° 48´·4N., 105° 45´·1E.
Delete depth, 94 , close N of: (a) above
2.21
Wk01/19
II
63 TAIWAN STRAIT - Submarine cables.

Source: UKHO
Chart 1719 [ previous update 5611/18 ] CGCS 2000 DATUM

Insert submarine cable, É, joining: 24° 25´·47N., 118° 27´·30E.
24° 24´·95N., 118° 28´·45E.
24° 24´·67N., 118° 29´·73E.
24° 24´·33N., 118° 30´·36E.
24° 07´·00N., 118° 51´·03E.

22° 59´·12N., 120° 08´·25E.
22° 59´·04N., 120° 07´·73E.
23° 00´·85N., 120° 01´·76E.
23° 03´·94N., 119° 58´·93E.
23° 28´·81N., 119° 39´·43E.
23° 31´·99N., 119° 38´·39E.
23° 32´·14N., 119° 38´·89E.
23° 32´·80N., 119° 38´·75E.
23° 33´·31N., 119° 38´·43E.
89 CHINA - South Coast - Obstruction.

Source: Hong Kong Notice 24/54/18

Insert
+ Obstn PA, drying height 0 2
22° 13´·184N., 114° 06´·872E.

Insert
+ Obstn PA, drying height 0 2
22° 13´·18N., 114° 06´·87E.
113 TAIWAN - Submarine cables.

Source: UKHO

34° 43´·0N., 128° 50´·9E.
34° 39´·5N., 128° 52´·6E.
34° 36´·7N., 128° 51´·9E.
34° 34´·2N., 128° 48´·7E.
34° 14´·0N., 128° 37´·1E.
33° 49´·2N., 128° 12´·8E.
2.22
Wk01/19
II
113 TAIWAN - Submarine cables. (continued)

25° 35´·2N., 121° 22´·7E.
25° 37´·6N., 121° 23´·8E.
25° 58´·5N., 121° 15´·9E.
26° 22´·5N., 120° 41´·9E.

25° 35´·24N., 121° 22´·72E.
25° 37´·57N., 121° 23´·76E.
25° 38´·39N., 121° 23´·76E.
Delete former submarine cable, É, joining: 25° 26´·25N., 121° 23´·60E.
25° 35´·10N., 121° 23´·16E.
25° 37´·47N., 121° 24´·20E.
25° 38´·39N., 121° 24´·23E.
114 CHINA - Yellow Sea Coast - Depths. Rock.

Source: Chinese Notice 48/2083/18

Insert depth, 124 39° 01´·562N., 121° 52´·183E.

Delete depth, 54 , with seabed type, R 38° 58´·327N., 121° 54´·118E.
118 CHINA - Yellow Sea Coast - Obstruction.


Insert
+ Obstn Rep(2018) PA 34° 16´·3N., 120° 32´·4E.
131 CHINA - East Coast - Wreck.


Insert
´ PA Rep (2018) 34° 03´·99N., 121° 53´·65E.

Insert
´ PA Rep (2018) 34° 04´·0N., 121° 53´·7E.
2.23
Wk01/19
II
27 JAPAN - Seto Naikai - NM Blocks.

Source: Japanese Notice 49/848/18
Chart JP 126 [ previous update 5588/18 ] WGS84 DATUM


Insert the accompanying block, centred on: 34° 01´ 37"N., 131° 46´ 38"E.
28 JAPAN - Seto Naikai - NM Blocks. Legend.

Chart JP 1263 [ previous update New Edition 01/11/2018 ] WGS84 DATUM

Amend legend to, Dredged to 10m (1973-2018), centred on: 33° 55´ 57·1"N., 130° 50´ 49·8"E.

29 JAPAN - Seto Naikai - Marine farm.


Insert limit of marine farm, pecked line, joining: (a) 34° 10´·54N., 132° 33´·86E.
34° 10´·62N., 132° 34´·02E.
34° 10´·93N., 132° 33´·90E.
(b) 34° 10´·86N., 132° 33´·77E.
Delete former limit of marine farm, pecked line, joining: (a) above
(b) above

Insert limit of marine farm, pecked line, joining: (a) 34° 10´·54N., 132° 33´·86E.
34° 10´·62N., 132° 34´·02E.
34° 10´·93N., 132° 33´·90E.
(b) 34° 10´·86N., 132° 33´·77E.
Delete former limit of marine farm, pecked line, joining: (a) above
(b) above
30 JAPAN - Seto Naikai - Overhead cable. Vertical clearance.


Insert overhead power cable, pecked line, joining: (a) 33° 57´·82N., 132° 11´·15E.
33° 57´·25N., 132° 11´·45E.
symbol, vertical clearance (46m), close NE of: (a) above
2.24
Wk01/19
II
31 JAPAN - Kyu- shu- - Light.


Delete
· Iso 6s 5M 31° 16´·34N., 130° 12´·99E.

Delete
· Iso 5M 31° 16´·33N., 130° 13´·01E.
32 JAPAN - Kyu- shu- - Depths.


Insert depth, 34 (a) 30° 31´·47N., 129° 29´·88E.
Delete depth, 39, close SW of: (a) above
depth, 71, close NE of: (a) above

Replace depth, 39, with depth, 34 30° 31´·5N., 129° 29´·9E.


33 JAPAN - Kyu- shu- - Depth.


Insert depth, 99 30° 19´·37N., 129° 22´·72E.
2.25
Wk01/19
II
34 JAPAN - Kyu- shu- - Depths.


Insert depth, 135 30° 17´·40N., 130° 07´·17E.

Insert depth, 135 (a) 30° 17´·4N., 130° 07´·2E.
Delete depth, 151, close E of: (a) above

Insert depth, 135 (a) 30° 17´·4N., 130° 07´·2E.
Delete depth, 151, close E of: (a) above

Insert depth, 135 30° 17´·4N., 130° 07´·2E.
64 KOREA - South Coast - Automatic Identification Systems.

Source: Korean Notices 48/1056-1058/18 and 48/1061/18

Delete Automatic Identification System, AIS, at light 34° 27´·9N., 127° 26´·6E.
34° 22´·7N., 127° 16´·4E.
34° 19´·9N., 127° 22´·5E.
34° 19´·5N., 127° 19´·1E.
34° 17´·7N., 127° 21´·1E.
34° 12´·8N., 127° 15´·8E.
111 KOREA - West Coast - Depths.

Source: ENC KR3F4G00

Insert depth, 57 (a) 34° 56´·78N., 126° 03´·01E.
121 KOREA - West Coast - Buoy.

Source: Korean Notice 48/1070/18
Amend No 7 light-buoy to, Q.G 37° 21´·26N., 126° 30´·70E.
Chart 1271 (Panel C, Incheon New Port) [ previous update 5641/18 ] WGS84 DATUM
Amend No 7 light-buoy to, Q.G 37° 21´·30N., 126° 30´·70E.
2.26
Wk01/19
II
129 KOREA - South Coast - Buoy.

Source: Korean Notice 48/1062/18

Insert
Ef; ODAS 34° 09´·1N., 127° 13´·1E.
50 INDONESIA - Papua - Submarine cable.

Source: Indonesian Notice 48/535/18

Insert submarine cable, É, joining: 2° 11´·9S., 136° 14´·9E.
2° 10´·7S., 136° 24´·2E.
(a) 2° 12´·5S., 136° 27´·1E.
and
(a) above
2° 02´·0S., 136° 16´·8E.
1° 53´·5S., 136° 16´·0E.
and
1° 56´·3S., 136° 16´·3E.
1° 59´·0S., 136° 20´·2E.
1° 59´·3S., 136° 24´·2E.
1° 54´·8S., 136° 47´·4E.
1° 52´·9S., 136° 50´·0E.
and
1° 40´·1S., 136° 50´·0E.
1° 37´·0S., 136° 42´·5E.
2.27
Wk01/19
II
50 INDONESIA - Papua - Submarine cable. (continued)

3° 20´·7S., 135° 28´·0E.
and
2° 11´·9S., 136° 14´·9E.
2° 10´·7S., 136° 24´·2E.
(a) 2° 12´·5S., 136° 27´·1E.
and
(a) above
2° 02´·0S., 136° 16´·8E.
(b) 1° 53´·5S., 136° 16´·0E.
and
(b) above
1° 56´·3S., 136° 16´·3E.
1° 59´·0S., 136° 20´·2E.
1° 59´·3S., 136° 24´·2E.
1° 54´·7S., 136° 49´·1E.
1° 47´·8S., 136° 55´·8E.
1° 41´·4S., 136° 52´·7E.
1° 37´·1S., 136° 42´·7E.
Chart 3925 [ previous update New Chart 06/04/2017 ] WGS84 DATUM

1° 54´·7S., 136° 47´·3E.
1° 50´·2S., 136° 53´·6E.
1° 47´·0S., 136° 55´·6E.
1° 43´·4S., 136° 53´·8E.
1° 39´·5S., 136° 49´·3E.
1° 37´·1S., 136° 42´·7E.
58 PHILIPPINE ISLANDS - Luzon - Obstruction. Depth.

Source: NAVPHIL 175/18.

Insert
3!+ Obstn Rep (2018) 14° 31´·96N., 120° 56´·67E.

Insert
3!+ Obstn Rep (2018) (a) 14° 31´·96N., 120° 56´·67E.
Delete depth,119 , close W of: (a) above
2.28
Wk01/19
II
95 INDONESIA - Papua - Submarine cable.

Source: Indonesian Notice 49/546/18

0° 55´·3S., 134° 50´·0E.
0° 54´·7S., 134° 50´·5E.
0° 54´·4S., 134° 52´·3E.
0° 54´·6S., 134° 54´·4E.
96 MALAYSIA - Sarawak - Depths. Drying height. Wrecks. Buoy.

Source: Malaysian Chart 7257

Insert depth, 49 , enclosed by 5m contour 2° 07´·69N., 111° 05´·75E.
depth, 46 , enclosed by 5m contour 2° 08´·14N., 111° 08´·36E.
drying height, 0 1 , enclosed by 0m low water line 2° 10´·36N., 111° 08´·24E.
´ 2° 08´·10N., 111° 07´·54E.
Replace
7"+ Wk with 0&+ Wk 2° 06´·40N., 111° 19´·10E.
Chart 163 (Panel B, Tanjung Gelang to Tanjung Penasu) [ previous update New Chart 22/03/2012 ] WGS84 DATUM
Insert depth, 4, enclosed by 5m contour (a) 2° 22´·79N., 111° 26´·46E.
Delete depth,117 , and associated 10m contour, close W of: (a) above
Insert depth, 04 , enclosed by 2m contour (b) 2° 22´·55N., 111° 25´·92E.
Delete depth, 34 , close E of: (b) above
Chart 163 (Panel A, Kuala Paloh to Tanjung Gelang) [ previous update New Chart 22/03/2012 ] WGS84 DATUM
Insert
Fp Oc.4s 2° 29´·61N., 111° 10´·04E.
depth, 4, enclosed by 5m contour (a) 2° 22´·79N., 111° 26´·46E.
Delete depth,117 , and associated 10m contour, close W of: (a) above
Insert depth, 04 , enclosed by 2m contour (b) 2° 22´·55N., 111° 25´·92E.
Delete depth, 34 , close E of: (b) above

Insert
Fp Oc.4s 2° 29´·6N., 111° 10´·0E.
2.29
Wk01/19
II
96 MALAYSIA - Sarawak - Depths. Drying height. Wrecks. Buoy. (continued)
Chart 3835 [ previous update 4279/18 ] TIMBALAI 1948 DATUM

Insert depth, 49 , enclosed by 5m contour (a) 2° 07´·73N., 111° 05´·54E.
´ 2° 08´·13N., 111° 07´·33E.
Fp Oc.4s 2° 29´·65N., 111° 09´·84E.

Insert depth, 49 , enclosed by 5m contour (a) 2° 07´·69N., 111° 05´·75E.
´ 2° 08´·10N., 111° 07´·54E.
Fp Oc.4s 2° 29´·61N., 111° 10´·04E.
97 INDONESIA - Nusa Tengarra - Depths. NM Block.

Source: Indonesian Chart 291

Insert depth, 26 (a) 8° 38´·8S., 116° 00´·9E.
Replace depth, 86 , with depth, 74 8° 39´·6S., 115° 58´·2E.

Insert depth, 74 (a) 8° 39´·6S., 115° 58´·2E.
Delete depth, 45 , close S of: (a) above
Insert depth, 26 (b) 8° 38´·8S., 116° 00´·9E.
Delete depth, 45 , close SE of: (b) above

Insert depth, 26 (a) 8° 38´·8S., 116° 00´·9E.
Replace depth, 86 , with depth, 74 8° 39´·6S., 115° 58´·2E.
2.30
Wk01/19
II
97 INDONESIA - Nusa Tengarra - Depths. NM Block. (continued)

Insert the accompanying block, centred on: 8° 38´·87S., 115° 54´·67E.
Insert depth, 658 (a) 8° 09´·55S., 115° 29´·42E.
Delete depth, 884, close SE of: (a) above
Insert depth, 86 (b) 8° 44´·19S., 115° 23´·25E.
Delete depth, 104, close N of: (b) above
Insert depth, 109 (c) 8° 45´·13S., 115° 20´·45E.
Delete depth, 210, and associated 200m contour, close SE of: (c) above
Replace depth, 663, with depth, 468 8° 08´·69S., 115° 27´·30E.

Insert depth, 86 (a) 8° 44´·19S., 115° 23´·25E.
Delete depth, 104, close N of: (a) above
Insert depth, 109 (b) 8° 45´·13S., 115° 20´·45E.
Delete depth, 210, and associated 200m contour, close SE of: (b) above
106 INDONESIA - Timor - Depths.

Source: ENC ID300457

Insert depth, 881, enclosed by 1000m contour 11° 03´·8S., 120° 57´·7E.

Insert depth, 881, enclosed by 1000m contour 11° 03´·8S., 120° 57´·7E.

Insert depth, 881, enclosed by 1000m contour (a) 11° 03´·8S., 120° 57´·7E.
Delete depth, 1713, close NW of: (a) above
91 SOUTH PACIFIC OCEAN - Polynésie Française - Light.

Source: French Chart 6658
Chart 998 [ previous update 5834/17 ] UNDETERMINED DATUM

Amend light to, Fl(3)15s18M 17° 36´·3S., 149° 48´·9W.

Amend light to, Fl(3)15s12m18M 17° 36´·22S., 149° 48´·99W.

Amend light to, Fl(3)18M 17° 36´·1S., 149° 49´·3W.

Amend light to, Fl(3)18M 17° 36´·3S., 149° 49´·0W.
2.31
Wk01/19
II
122 NORTH PACIFIC OCEAN - Hawaiian Islands - Superbuoys. Buoy.

Source: US Coast Guard District 14 LNM 47/530/18

Delete
ê Fl(4)Y.20s ODAS 51001 PA 23° 27´·2N., 162° 16´·7W.

Move
Pf Fl(4)Y.20s ODAS 51001, from: 23° 23´·3N., 162° 16´·6W.
to: 24° 27´·2N., 162° 00´·0W.

Move
to: 24° 27´·2N., 162° 00´·0W.

Move
to: 24° 27´·2N., 162° 00´·0W.

Insert
Pf Fl(4)Y.20s ODAS 51001 PA 24° 27´·2N., 162° 00´·0W.
Pf Fl(4)Y.20s ODAS 51101 PA (a) 24° 21´·7N., 162° 04´·5W.
Delete
Gf Fl(4)Y.20s, close S of: (a) above
former Pf Fl(4)Y.20s ODAS 51001 PA
23° 27´·4N., 162° 12´·8W.
115 UNITED STATES OF AMERICA - Alaska - Buoyage. Obstructions.


Replace
58, Subm buoy, with 8+ Subm buoys (a) 56° 52´·0N., 164° 03´·6W.
Delete
Ef Fl.Y , close N of: (a) above
2.32
Wk01/19
II
115 UNITED STATES OF AMERICA - Alaska - Buoyage. Obstructions. (continued)

Insert
13Ó, Subm buoy 59° 54´·2N., 171° 42´·1W.
Replace
58, Subm buoy, with 8+ Subm buoys (a) 56° 52´·0N., 164° 03´·6W.
Delete
Gf Fl.Y , close N of: (a) above

Insert
13Ó, Subm buoy 59° 54´·2N., 171° 42´·1W.
Replace
18", Subm buoy with 10, Subm buoys
62° 12´·0N., 174° 41´·1W.
Chart 4977 [ previous update 5988/18 ] NAD83 DATUM

Replace
å Subm buoy, depth, 32 ,with, å Subm buoys, depth, 5 (a) 56° 52´·0N., 164° 03´·4W.
Delete
Ef Fl.Y , close N of: (a) above
52 ECUADOR - Light.
Source: ENC EC300104
Chart 2257 (Continuation to Golfo de Guayaquil) [ previous update 5960/18 ] WGS84 DATUM
Amend range of light to, 20M 0° 57´·5S., 80° 49´·3W.
Chart 2799 (Panel C, Approaches to Manta) [ previous update 5454/18 ] WGS84 DATUM
Amend range of light to, 20M 0° 57´·43S., 80° 49´·73W.
100 MEXICO - Pacific Ocean Coast - Lights.

Source: ENCs MX651111, MX651112 and UKHO
Chart 655 (Panel, Puerto Lazaro Cardenas) [ previous update 5792/18 ] WGS84 DATUM
Amend light to, Iso.R.2s12m5M 17° 55´·877N., 102° 10´·237W.
light to, Iso.R.2s12m5M 17° 55´·776N., 102° 10´·071W.
range of light to, 10M 17° 55´·343N., 102° 09´·850W.
Delete
¶Iso.R.2s8m 17° 56´·451N., 102° 10´·412W.

Amend range of light to, 10M 17° 55´·34N., 102° 09´·85W.
101 PERU - Buoy.

Source: Peruvian Notice 11/135/18
Chart 3089 (Panel F, Paita) [ previous update 5782/18 ] WGS84 DATUM

Insert
GYo Fl(2)5s 5° 04´·24S., 81° 06´·54W.
2.33
Wk01/19
II
136 BRAZIL - North Coast - Radar beacon.

Source: Brazilian Notice 22/160(P)/18

Delete symbol, radar beacon, Racon(K) 0° 37´·08S., 47° 21´·31W.

Delete radar beacon, Racon(K), at light 0° 36´·8S., 47° 21´·4W.
43 UNITED STATES OF AMERICA - Gulf of Mexico - Fish haven.

Source: ENC US3GC01M

Insert
Á (9 ) 1
26° 16´·7N., 97° 03´·0W.

Insert
Á (4 ) 5
26° 16´·7N., 97° 03´·0W.
55 UNITED STATES OF AMERICA - Gulf of Mexico - Obstruction.

Source: ENC US3LA02M

Insert
å Obstn PA 29° 03´·28N., 90° 13´·57W.
57 UNITED STATES OF AMERICA - Gulf of Mexico - Wreck.


Insert
´ PA 29° 30´·3N., 85° 07´·2W.
84 WEST INDIES - Leeward Islands - Restricted area.

Note: Limit of restricted area remains unchanged.
Chart 491 (Panel F, Les Saintes) [ previous update 4535/18 ] WGS84 DATUM
Replace symbol Å with symbol entry prohibited 15° 52´·64N., 61° 34´·05W.
2.34
Wk01/19
II
49 UNITED STATES OF AMERICA - East Coast - Channel limits. Depths.

Source: ENC US4NY1AM

Insert limit of channel, pecked line, joining: 40° 28´·40N., 73° 52´·12W.
40° 27´·48N., 73° 49´·79W.
and
40° 28´·13N., 73° 52´·40W.
40° 27´·19N., 73° 49´·99W.
Delete depth, 12 40° 27´·92N., 73° 51´·22W.
depth, 13 40° 27´·63N., 73° 50´·72W.
90 UNITED STATES OF AMERICA - East Coast - Dredged depth.

Source: OCS
Chart 2728 (Panel, New Haven Harbor) [ previous update 6129/18 ] NAD83 DATUM
Amend dredged depth to, 30ft (2018), centred on: 41° 17´·444N., 72° 54´·710W.

Amend dredged depth to, 30ft (2018), centred on: 41° 17´·44N., 72° 54´·70W.
119 UNITED STATES OF AMERICA - East Coast - Depths.

Source: ENC US5FL91M
Chart 525 [ previous update 6075/18 ] UNDETERMINED DATUM

Insert depth, 3½, enclosed by 5fm contour (a) 24° 34´·07N., 82° 55´·79W.
Delete depth, 6¼, close N of : (a) above
depth, 5¾, close E of: (a) above
2.35
Wk01/19
II
98(T)/19 SCOTLAND - East Coast - Buoy.

Source: Moray West Offshore Windfarm
1. A special purpose light-buoy, Fl(5)Y.20s, has been established in position 58° 05´·38N., 3° 00´·88W.
(WGS84 DATUM)
Charts affected - 115 (INT 1503) - 1409 (INT 1504)
116(T)/19 NORWEGIAN SEA - Obstruction.

Source: Norwegian Notice 22/59576(T)/18
1. An obstruction, consisting of an abandoned well rising 3·5m above the seabed, has been reported to exist in position
73° 57´·5N., 24° 05´·0E.
2. The well head is scheduled to be removed in August 2019.
(WGS84 DATUM)
Chart affected - 2683
135(P)/19 ARCTIC OCEAN - Magnetic variation.

Source: British Geological Survey
1. There has been an unexpected change in the Magnetic Variation in the North Polar region.
2. Magnetic variation values and rates of annual change on charts in the polar region may not be reliable.
3. Charts will be updated when full details are available in 2020.
(WGS84 DATUM)
Charts affected - 2682 - 2683 - 2684 - 2685 - 5384
72(T)/19 LITHUANIA - Buoy.

Source: Lithuanian Navigational Warning 78/18
1. The starboard-hand lateral light-buoy, Fl.G.3s No 35, in position 55° 39´·74N., 21° 08´·83E. has been temporarily removed.
(WGS84 DATUM)
2.36
Wk01/19
II
85(T)/19 POLAND - Measuring instruments.

Source: Polish Notices 3/37(T)/18 and 48/610(T)/18
1. Measuring instruments have been temporarily established in the following positions:
54° 29´·40N., 15° 54´·34E.

54° 18´·19N., 15° 01´·05E.
54° 25´·18N., 15° 14´·48E.
54° 19´·09N., 15° 14´·63E.
54° 20´·55N., 15° 36´·26E.
*53° 59´·00N., 14° 16´·68E.
2. Former Notice 5941(T)/18 is cancelled.
* Indicates new or revised entry
(WGS84 DATUM)
Charts affected - 2014 (INT 1219) - 2015 (INT 1201) - 2679
108(P)/19 DENMARK - East Coast - Restricted areas. Lights. Platforms. Buoyage.

Source: Danish Chart Correction 47/519/18
1. Entry prohibited areas and associated buoyage, centred on the following positions, have been discontinued:
55° 01´·64N., 12° 51´·05E.

55° 02´·72N., 12° 56´·76E.
2. Lit platforms, 2 Mo(U)15s10M, have been established in the following positions:
55° 01´·64N., 12° 51´·05E.

55° 02´·91N., 12° 56´·71E.
3. Mariners are advised to navigate with caution in the area.
4. These changes will be included in the New Edition of Chart 2115 to be published 7 February 2019.
5. Chart 2015 will be updated by NM following New Edition publication on 20 December 2018.
(WGS84 DATUM)
Charts affected - 2015 (INT 1201) - 2115
138(T)/19 SWEDEN - East Coast - Wreck.

Source: Swedish Notice 732/13369(T)/18
1. A wreck, marked by buoys, exists in position 59° 23´·65N., 18° 20´·48E.
(WGS84 DATUM)
Chart affected - 820 (INT 1238)
2.37
Wk01/19
II
83(T)/19 NORTH SEA - Netherlands Sector - Measuring instruments. Buoyage.

Source: Netherlands HO
1. Measuring instruments have been established temporarily in the positions shown below. They are marked by either unlit
yellow buoys or yellow light-buoys, Fl(5)Y.20s, Fl.Y.5s or Fl(2)Y.5s, and will be on station until further notice. Only the
largest scale Admiralty chart is quoted. This list will be updated as necessary by Temporary Notices to Mariners.
Position Largest Scale Chart(s)

51° 45´·83N., 3° 05´·13E. 110
51° 45´·45N., 3° 03´·24E. 110
51° 44´·85N., 3° 03´·29E. 110
51° 44´·89N., 3° 01´·72E. 110
51° 44´·11N., 3° 00´·78E. 110
51° 44´·59N., 2° 58´·20E. 110
51° 42´·41N., 3° 02´·08E. 110
51° 43´·20N., 3° 02´·78E. 110
51° 43´·36N., 3° 03´·00E. 110
51° 42´·68N., 3° 03´·33E. 110
51° 42´·36N., 3° 04´·02E. 110
51° 42´·30N., 3° 04´·90E. 110
51° 23´·63N., 3° 35´·41E. 116
51° 25´·27N., 3° 36´·85E. 116
51° 23´·95N., 3° 56´·89E. 120
51° 24´·48N., 3° 55´·13E. 120
52° 43´·55N., 4° 37´·42E. 126
52° 41´·21N., 4° 16´·66E. 126
52° 41´·54N., 4° 14´·53E. 126
52° 18´·71N., 4° 00´·81E. 130
52° 17´·39N., 4° 00´·56E. 130
55° 01´·41N., 3° 41´·11E. 266
53° 31´·80N., 5° 28´·66E. 1633
53° 32´·49N., 5° 39´·55E. 1633
53° 44´·25N., 6° 37´·58E. 1635
53° 37´·26N., 6° 22´·12E. 3631
53° 32´·44N., 6° 27´·04E. 3631
53° 29´·74N., 6° 27´·60E. 3631
53° 27´·49N., 6° 27´·60E. 3631
53° 37´·22N., 6° 31´·33E. 3631
53° 34´·22N., 6° 37´·95E. 3631
53° 30´·79N., 6° 40´·64E. 3631
53° 29´·28N., 6° 43´·59E. 3631
2. Mariners are advised to navigate with caution in these areas.
(WGS84 DATUM)
Charts affected - 110 (INT 1473) - 116 (INT 1477) - 120 (INT 1479) - 126 (INT 1468) - 130 (INT 1423) - 266 - 1633
(INT 1417) - 1635 (INT 1413) - 3631 (INT 1461)
65(P)/19 ITALY - West Coast - Light-beacon.

1.
Update Feature Position

Delete symbol, yellow light-beacon with 44° 22´·562N., 8° 58´·847E.
cross topmark
2.38
Wk01/19
II
77(T)/19 ROMANIA - Buoyage.

Source: Romanian Notice 10/273/18
1. The south cardinal light-buoy, Q(6)+LFl.15s, in position 43° 47´·77N., 28° 36´·30E. is reported unlit.
2. The east cardinal light-buoy, Q(3)10s, in position 44° 06´·22N., 28° 42´·85E. is reported unlit.
(WGS84 DATUM)
Charts affected - 2282 - 2284
103(P)/19 MOROCCO - North Coast - Lights. Buoyage. Works.

Source: French Notices 43/131/18, 48/138/18 and Spanish Light List
1. Numerous changes to lights have taken place in Tanger, the most significant are as follows:
2. Lights have been established in the following positions:
Characteristic Position
Fl(2)G.10s11m6M 35° 47´·599N., 5° 48´·221W.
Fl(2)R.10s11m6M 35° 47´·522N., 5° 48´·307W.
Iso.6s3M 35° 47´·516N., 5° 48´·460W.
Fl(3)R.10s11m6M 35° 47´·013N., 5° 47´·786W.
Fl(3)G.10s12m6M 35° 47´·012N., 5° 47´·691W.
3. The light in position 35° 47´·470N., 5° 47´·598W. has been amended to Fl(3)G.12s20m12M.
4. The light in position 35° 47´·295N., 5° 47´·872W. has been amended to Fl(3)R.12s12m6M.
5. The north cardinal light-buoy, VQ, has moved NE to 35° 49´·810N., 5° 45´·460W.
6. The isolated danger light-buoy, Fl(2)10s, has moved NW to 35° 47´·660N., 5° 47´·082W.
7. *A west cardinal light buoy, Q(9)15s, has been established in 35° 47´·43N., 5° 46´·69W.
8. A works in progress area exists, bounded by the following positions:
35° 47´·472N., 5° 47´·670W.

35° 47´·458N., 5° 47´·671W.
35° 47´·466N., 5° 47´·774W.
9. Full details of light changes are included in ADMIRALTY Lights List Volume D.
10. Former Notice 5674(P)/18 is cancelled.
11. These changes will be included in a New Edition of Chart 1912 to be published 3 January 2019. Charts 142 and 773 will be
updated by Notice to Mariners.
*indicates new or revised entry.
(WGS84 DATUM)
134(P)/19 QATAR - Anchorage areas.

Source: Qatar Petroleum
1. A small craft anchorage area with a circular limit, radius 0·5M, has been established, centred on the following position:
25° 52´·00N., 51° 42´·00E.
2. The C4 anchorage area, bounded by the following positions, has been removed:
25° 53´·00N., 51° 48´·00E.

25° 53´·00N., 51° 49´·00E.
25° 52´·00N., 51° 49´·00E.
25° 52´·00N., 51° 48´·00E.
2.39
Wk01/19
II
134(P)/19 QATAR - Anchorage areas. (continued)
3. New anchorage areas have been established in the approaches to the Ra’s Laffa- n Port, bounded by the following positions:
Designation Position
D5 25° 52´·00N., 51° 51´·00E.
25° 52´·00N., 51° 52´·00E.
25° 51´·00N., 51° 52´·00E.
25° 51´·00N., 51° 51´·00E.
D6 25° 52´·00N., 51° 52´·00E.
25° 52´·00N., 51° 53´·00E.
25° 51´·00N., 51° 53´·00E.
25° 51´·00N., 51° 52´·00E.
E5 25° 51´·00N., 51° 51´·00E.
25° 51´·00N., 51° 52´·00E.
25° 50´·00N., 51° 52´·00E.
25° 50´·00N., 51° 51´·00E.
4.
E6 25° 51´·00N., 51° 52´·00E.

25° 51´·00N., 51° 53´·00E.
25° 50´·00N., 51° 53´·00E.
25° 50´·00N., 51° 52´·00E.
E7 25° 51´·00N., 51° 53´·00E.
25° 51´·00N., 51° 54´·00E.
25° 50´·00N., 51° 54´·00E.
25° 50´·00N., 51° 53´·00E.
F5 25° 50´·00N., 51° 51´·00E.
25° 50´·00N., 51° 52´·00E.
25° 49´·00N., 51° 52´·00E.
25° 49´·00N., 51° 51´·00E.
5.
F6 25° 50´·00N., 51° 52´·00E.

25° 50´·00N., 51° 53´·00E.
25° 49´·00N., 51° 53´·00E.
25° 49´·00N., 51° 52´·00E.
F7 25° 50´·00N., 51° 53´·00E.
25° 50´·00N., 51° 54´·00E.
25° 49´·00N., 51° 54´·00E.
25° 49´·00N., 51° 53´·00E.
G5 25° 49´·00N., 51° 51´·00E.
25° 49´·00N., 51° 52´·00E.
25° 48´·00N., 51° 52´·00E.
25° 48´·00N., 51° 51´·00E.
G6 25° 49´·00N., 51° 52´·00E.

25° 49´·00N., 51° 53´·00E.
25° 48´·00N., 51° 53´·00E.
25° 48´·00N., 51° 52´·00E.
G7 25° 49´·00N., 51° 53´·00E.
25° 49´·00N., 51° 54´·00E.
25° 48´·00N., 51° 54´·00E.
25° 48´·00N., 51° 53´·00E.
H5 25° 48´·00N., 51° 51´·00E.
25° 48´·00N., 51° 52´·00E.
25° 47´·00N., 51° 52´·00E.
25° 47´·00N., 51° 51´·00E.
2.40
Wk01/19
II
134(P)/19 QATAR - Anchorage areas. (continued)
6.
H6 25° 48´·00N., 51° 52´·00E.

25° 48´·00N., 51° 53´·00E.
25° 47´·00N., 51° 53´·00E.
25° 47´·00N., 51° 52´·00E.
H7 25° 48´·00N., 51° 53´·00E.
25° 48´·00N., 51° 54´·00E.
25° 47´·00N., 51° 54´·00E.
25° 47´·00N., 51° 53´·00E.
I5 25° 47´·00N., 51° 51´·00E.
25° 47´·00N., 51° 52´·00E.
25° 46´·00N., 51° 52´·00E.
25° 46´·00N., 51° 51´·00E.
7.
I6 25° 47´·00N., 51° 52´·00E.

25° 47´·00N., 51° 53´·00E.
25° 46´·00N., 51° 53´·00E.
25° 46´·00N., 51° 52´·00E.
I7 25° 47´·00N., 51° 53´·00E.
25° 47´·00N., 51° 54´·00E.
25° 46´·00N., 51° 54´·00E.
25° 46´·00N., 51° 53´·00E.
8. These changes will be included in a New Edition of Chart 3772 to be published 7 February 2019.
9. Chart 2523, 3950, 2886, 2887 and 2889 will be updated by Notice to Mariners.
(WGS84 DATUM)
Charts affected - 3772 (INT 7249) - 8116
73(P)/19 INDIA - West Coast - Depths. Buoy.

Source: ENC IN3211SD
1. Numerous depths less than charted exist within the approaches to Mumbai and Revadanda Port. The most significant are as
follows:
Depth Position
0·3m 18° 56´·32N., 72° 52´·39E.
0·1m 18° 59´·87N., 72° 57´·58E.
0·7m 18° 32´·59N., 72° 54´·15E.
1·1m 18° 33´·42N., 72° 52´·79E.
2. The safe water light-buoy in position 18° 32´·98N., 72° 53´·03E. has been amended to Fl.5s.
3. These changes will be included in the next New Editions of Charts IN211 and IN255.
(WGS84 DATUM)
Charts affected - IN 211 - IN 255 (INT 7334)
105(P)/19 INDIA - East Coast - Channel limit. Buoyage. Dredged depths. Berth. Floating dock. Pilot boarding
places.
Source: ENCs IN63009A and IN53009A
1. Extensive changes have taken place within Ka- kina- da Port and approaches. The most significant are as follows:
2. The approach channel to Ka- kina- da Port has been extended to position 17° 01´·39N., 82° 22´·09E.
2.41
Wk01/19
II
105(P)/19 INDIA - East Coast - Channel limit. Buoyage. Dredged depths. Berth. Floating dock. Pilot boarding
places. (continued)
3. The safe water light-buoy, Fairway Mo(A)5s No1, in position 17° 01´·16N., 82° 21´·60E. has been moved to position
17° 01´·44N., 82° 22´·63E. There are also numerous changes to aids to navigation throughout the port.
4. A new maintained area, depth 15·5m, has been established between positions 17° 01´·39N., 82° 22´·09E. and
17° 00´·17N., 82° 20´·25E.
5. A new maintained area, depth 14·5m, has been established between positions 17° 00´·17N., 82° 20´·25E. and
16° 57´·55N., 82° 16´·92E.
6. A new maintained area, depth 12·5m, has been established in the vicinity of position 16° 58´·51N., 82° 17´·12E.
7. Pilot boarding points have been moved to new positions as follows:
Former Position New Position

17° 00´·10N., 82° 20´·84E. 17° 00´·60N., 82° 20´·50E.
17° 01´·17N., 82° 22´·66E. 17° 01´·44N., 82° 23´·19E.
8. A new berth, Berth No 7, has been established between the following approximate positions:
16° 57´·78N., 82° 16´·87E.

16° 57´·56N., 82° 16´·82E.
9. A floating dock has been established in position 16° 58´·64N., 82° 17´·08E.
10. Mariners are advised to navigate with caution in the area and contact the port authority for the latest information.
11. Charts will be updated when full details are available.
12. Former Notice 3505(P)/17 is cancelled.
(WGS84 DATUM)
Charts affected - 319 (INT 7408) - IN 3009 (INT 7407)
44(P)/19 CHINA - East Coast - Anchorage area.

1. The limits of No 3 anchorage have been amended and are now as follows:
24° 23´·90N., 118° 04´·57E.

24° 24´·22N., 118° 05´·10E.
24° 24´·04N., 118° 05´·81E.
24° 23´·46N., 118° 06´·38E.
24° 22´·55N., 118° 06´·82E.
24° 22´·36N., 118° 06´·39E.
2. Chart 3449 will be updated by NM following New Edition publication on 13 December 2018.
(CGCS 2000 DATUM)
45(P)/19 CHINA - Bo Hai - Wreck. Buoy.

Source: Chinese Notices 47/2047/18 and 48/2082/18
1. A stranded wreck exists in position, 37° 48´·9N., 119° 19´·2E., marked by an isolated danger light-buoy, Fl(2)5s.
2. Chart 1250 will be updated by NM following New Edition publication on 20 December 2018
(CGCS 2000 DATUM)
2.42
Wk01/19
II
47(P)/19 CHINA - Bo Hai - Light.

1. A light, Fl.G.4s6m3M, has been established in position 40° 41´·76N., 122° 16´·22E.
2. Chart 1286 will be updated by NM following New Edition publication on 20 December 2018
(CGCS 2000 DATUM)
68(P)/19 CHINA - Bo Hai - Wreck.

1. A stranded wreck exists in position 38° 40´·83N., 117° 48´·16E.
3. Chart 2645 will be updated by Notice to Mariners following New Edition publication on 20 December 2018.
(CGCS 2000 DATUM)
75(T)/19 VIETNAM - Wreck.

Source: Vietnamese Notice 237(T)/18
1. A dangerous wreck exists in position 20° 31´·46N., 106° 37´·13E.
(WGS84 DATUM)
35(T)/19 JAPAN - Hokkaido- - Scientific instruments.

Source: Japanese Notice 49/5611(T)/18
1. Observation instrument sets have been established from 20 December 2018 until 28 February 2019, in the following
positions:
Position Depth
42° 59´ 03·4"N., 144° 18´ 17·4"E. 6m
42° 59´ 13·1"N., 144° 17´ 41·1"E. 6m
42° 59´ 03·3"N., 144° 17´ 15·7"E. 7m
(WGS84 DATUM)
Chart affected - JP 31
2.43
Wk01/19
II
36(T)/19 JAPAN - Hokkaido- - Depths.

1. Depths of 1m to 1·5m less than charted exist on and in the vicinity of a line joining the following positions:
42° 59´ 40·0"N., 144° 20´ 05·2"E.

42° 59´ 32·8"N., 144° 20´ 04·5"E.
42° 59´ 32·1"N., 144° 19´ 58·8"E.
2. Depths of 2m to 3m less than charted exist on and in the vicinity of a line joining the following positions:
42° 59´ 30·8"N., 144° 20´ 05·2"E.

42° 59´ 32·2"N., 144° 19´ 39·4"E.
(WGS84 DATUM)
37(T)/19 JAPAN - Honshu- - Depths.

1. Depths of 0·5m less than charted exist within an area bounded by the following positions:
35° 22´ 22·7"N., 139° 53´ 33·8"E.

35° 22´ 23·9"N., 139° 53´ 34·4"E.
35° 22´ 25·7"N., 139° 53´ 33·2"E.
35° 22´ 25·1"N., 139° 53´ 31·7"E.
2. A depth of 10·5m exists in position 35° 22´ 15·2"N., 139° 53´ 15·8"E.
(WGS84 DATUM)
38(T)/19 JAPAN - Seto Naikai - Works.

1. Pier construction works are taking place, until 29 June 2019, within an area bounded by the following positions:
33° 58´·52N., 131° 53´·53E.

33° 58´·30N., 131° 53´·45E.
33° 58´·35N., 131° 53´·27E.
33° 58´·57N., 131° 53´·33E.
(WGS84 DATUM)
70(T)/19 KOREA - East Coast - Buoy.

Source: Korean Notice 48/1078(T)/18
1. The special purpose light-buoy Fl(5)Y.20s ODAS, in position 36° 30´·30N., 130° 00´·00E. has been extinguished.
(WGS84 DATUM)
Chart affected - 3666 (INT 5251)
2.44
Wk01/19
II
76(T)/19 KOREA - South Coast - Buoyage.

Source: Korean Notices 43/923(T)/18 and 48/1077(T)/18
1. Special purpose light-buoys, Fl(4)Y.8s, have been temporarily established in the following positions:
Designation Position
*A 35° 10´·80N., 128° 35´·42E.
*B 35° 10´·80N., 128° 35´·31E.
*C 35° 10´·90N., 128° 35´·27E.
*D 35° 12´·05N., 128° 35´·25E.
E 35° 12´·34N., 128° 35´·45E.
*indicates new or revised entry.
(WGS84 DATUM)
88(P)/19 INDONESIA - Nusa Tengarra - Depths.

Source: Indonesian Chart 291
1. Numerous depths less than charted exist within the Approaches to Teluk Labuhantereng. The most significant are as
follows:
Depth Position
2·6m 8° 38´·85S., 116° 00´·88E.
6·6m 8° 39´·10S., 116° 00´·07E.
7·4m 8° 39´·35S., 115° 59´·47E.
3·5m 8° 39´·55S., 116° 01´·60E.
7·8m 8° 39´·47S., 116° 02´·38E.
2·6m 8° 42´·86S., 116° 01´·65E.
8·1m 8° 42´·82S., 115° 59´·50E.
12·4m 8° 42´·10S., 115° 58´·64E.
3. These changes will be included in a New Edition of Chart 946 to be published 3 January 2019. Charts 2875, 2876, 2915,
3706 and 3726 will be updated by Notice to Mariners.
(WGS84 DATUM)
2.45
Wk01/19
To accompany Notice to Mariners 27/19. Image Size (mm) 61.3 by 68.7
Wk01/19
Wk01/19
Wk01/19
Wk01/19
Wk01/19
Wk01/19
To accompany Notice to Mariners 46/19. Image Size (mm) 118 by 64.3
Wk01/19
Wk01/19
Wk01/19
Wk01/19
Wk01/19
Wk01/19
Wk01/19
Wk01/19
Wk01/19
To accompany Notice to Mariners 127/19. Image Size (mm) 95.1 by 161
Wk01/19
To accompany Notice to Mariners 139/19. Image Size (mm) 127 by 174
Wk01/19
III
NAVIGATIONAL WARNINGS
See The Mariner’s Handbook (2016 Edition). It is recommended that the warnings reprinted below should be kept in a file or
book, followed by subsequent weekly reprints. Only the most convenient ADMIRALTY Chart is quoted. All warnings issued
within the previous 42 days are broadcast via SafetyNET and/or NAVTEX.
The complete texts of all in-force NAVAREA I warnings, including those which are no longer being broadcast, are
available from www.admiralty.co.uk/RNW. Additionally, a quarterly cumulative list of the complete text of all in-force
NAVAREA I Warnings is included in Section III of the Weekly NM Bulletin in Weeks 1, 13, 26 and 39 each year.
Alternatively, these may be requested by e-mail from NAVAREA I Co-ordinator at: navwarnings@btconnect.com
The RNW web page also contains a link to the IHO website which allows direct access to all the other NAVAREA
Co-ordinators around the world who have made their NAVAREA warnings available on the web.
----------------------------------------------------------------------------------------------------------------------------------------------------------
Weekly Edition 1, 03 January 2019 (published on the UKHO website 18 December 2018).
----------------------------------------------------------------------------------------------------------------------------------------------------------
Navarea I (NE Atlantic) Weekly Edition 1
The following NAVAREA I warnings were in force at 180500 UTC Dec 18.
2017 series: 163.

2018 series: 153 172 174.
172 1. Navarea I warnings in force at 141000 UTC Dec 18. 2. Cancel 169/18.
173 Cancelled. Cancel 149/18.
174 1. RIGLIST. Correct at 180500 UTC Dec 18.
Southern North Sea: 51N to 55N

52-15.0N 002-30.5E GMS Endurance 6101 ACP East Anglia One Windfarm
53-00.6N 002-11.1E Seafox 4 ACP Leman Gas Field
53-14.0N 003-14.5E 590021
53-21.4N 002-02.4E Ensco 92 ACP North Valiant Gas Field
NEW 53-27.7N 001-55.2E Ensco 122 ACP Galleon Gas Field
NEW 53-31.5N 001-09.6E Energy Endeavour ACP Pickerill B
53-32.4N 002-00.9E Paragon B391 ACP Audrey Gas Field
53-42.2N 001-09.0E Seafox 1 ACP West Sole Gas Field
53-42.9N 003-25.9E Paragon C20051 ACP K5-B
53-43.3N 001-53.4E Seajacks Leviathan ACP Saturn Gas Field
53-56.4N 002-44.8E Noble Hans Deul ACP Chiswick Gas Field
54-37.7N 002-20.2E Ensco 101
North Sea: 55N to 60N, East of 5W

55-24.0N 003-48.7E Maersk Resolute ACP A12
55-28.1N 005-08.1E Noble Sam Turner ACP Dan Oil Field
55-43.4N 004-48.0E Maersk Guardian ACP Tyra Gas Field
56-16.8N 003-24.0E Maersk Reacher ACP Valhall Oil Field
56-30.7N 003-54.8E Rowan Viking
56-43.5N 002-12.5E Ensco 120 ACP Jasmine Gas Field
56-50.2N 001-50.9E Wilphoenix
56-58.0N 001-52.2E Rowan Gorilla 5 ACP Franklin Gas Field
57-00.8N 001-50.4E Noble Sam Hartley ACP Elgin Gas Field
57-04.3N 003-03.8E Maersk Interceptor
57-06.9N 002-50.6E Safe Scandinavia ACP Ula Oil Field
57-10.7N 001-06.6E Prospector 5
57-11.7N 001-54.8E Maersk Highlander ACP u/c Pierce Oil Field Westward
57-48.6N 000-58.3W Maersk Innovator ACP Buzzard Oil and Gas Field.
57-48.9N 004-32.1E Rowan Stavanger ACP Yme Oil Field
57-58.2N 000-53.7E Paul B Loyd Jnr
58-01.7N 001-42.9E Rowan Gorilla 7
58-34.3N 001-41.8E Maersk Integrator ACP Gina Krog under construction
59-02.2N 002-13.5E Maersk Intrepid
59-27.0N 001-37.2E Ocean Patriot
59-34.9N 001-39.3E Ocean Valiant
59-35.2N 001-03.2E Safe Boreas ACP u/c Mariner Oil Field
59-35.4N 001-03.4E Noble Lloyd Noble ACP u/c Mariner Oil Field
59-55.9N 001-15.1E Transocean Leader
3.1 Wk01/19
III
Norwegian Sea: 60N to 65N, East of 5W
60-20.2N 004-02.1W Deepsea Aberdeen
60-48.0N 003-26.5E Songa Endurance
60-54.9N 003-31.2E Songa Equinox
60-55.8N 003-39.8E COSL Promoter
60-55.9N 002-14.1W Stena Don
61-02.0N 001-07.8E Paragon MSS1
61-05.0N 003-20.9E Deepsea Bergen
61-17.6N 001-28.3E Transocean 712
63-55.0N 007-18.0E Leiv Eiriksson
64-35.8N 006-51.3E Scarabeo 8
64-48.5N 006-26.9E West Phoenix
64-52.0N 006-50.3E Transocean Enabler
64-53.4N 007-04.3E Songa Encourage
South and West Coasts of the British Isles.

53-32.2N 003-34.8W Irish Sea Pioneer ACP Douglas Oil Field
NOTES:
A. Rigs are protected by a 500 metre safety zone.
B. ACP - Adjacent to Charted Platform; u/c - under construction
C. For Rigs located North of 65N, East of 5W, refer to Navarea XIX Warnings or visit www.navarea-xix.no
2. Cancel 171/18.
----------------------------------------------------------------------------------------------------------------------------------------------------------
Cumulative list of other NAVAREA I Warnings in-force at 180500 UTC Dec 18
----------------------------------------------------------------------------------------------------------------------------------------------------------
2017 series:
163 SOUTHWESTERN APPROACHES TO THE BRITISH ISLES. Chart GB 2 (INT 160).
ODAS light-buoy K1 reported off station in 48-47.4N 012-24.2W.
2018 series:
153 ENGLISH CHANNEL. Off Casquets TSS. Chart GB 2454 (INT 1702).
East Channel light-buoy 49-58.7N 002-28.9W permanently discontinued.
Wk01/19 3.2
IV
[01/19]
UPDATES TO ADMIRALTY SAILING DIRECTIONS
NP1 Africa Pilot Volume 1 (2017 Edition) 8 Terminal Croisière (Cruise Terminal) (333690N
73614W), situated on Jetée Moulay Youssef, has a
length of 680 m, the depths alongside being
Morocco -- Casablanca — Berths unsurveyed (2018).
156 Correspondence [NP1--No 34--Wk 01/19]
Paragraph 5.100 including existing Section IV Notice

Week 18/18 Replace by:
1 East Container Terminal (333659N 73578W) NP5 South America Pilot Volume 1
comprises Berths 70 to 74. Total quay length 600 m (2017 Edition)
with a reported depth of 109 m.
Berth A5 (333649N 73578W) is a RoRo berth
with a length of 200 m and a depth of 80 m. Brazil -- East Coast -- Aracaju --
Sergipe Terminal — Pilotage
Container Terminal TC3 (333646N 73588W)
comprises Berths 81 to 83. Total quay length of 530 m
171
with a depth of 125 m.
2 Phosphate Terminal (333652N 73627W) has Paragraph 5.157 2 line 7 For 105100S 365400W Read
four berths. Berth T7, which lies at the head of the 105328S 365190W
pier, is 120 m in length with a depth of 94 m.
Berths 64 to 66, which lie on the W of the pier, have
a total length of 575 m and depths from 82 to 101 m.
3 Berths 60 to 63 (333626N 73610W), which lie Brazilian Notice 22/E161/18 [NP5--No 68--Wk 01/19]
S of the Phosphate Terminal, have a total length of
480 m and a depth of 100 m.
Berths R4 and R5 (333614N 73608W) have a
total length of 200 m and a depth of 48 m. NP7A South America Pilot Volume 4
Container Terminal Somaport (333630N
(2018 Edition)
73624W) comprises Berths 51 to 55 and has a total
length of 700 m and a depth of 89 m. RoRo Berth RH
lies at the base of the Terminal. Guyana -- Waini River — Directions; wreck
4 Berths T5 and T6 (333645N 73642W) are
220 m in length with a depth of 92 m. 90
Cruise Terminal (333626N 73640W) comprises
Berths 40 to 44 and has a total length of 570 m with a Paragraph 2.234 2 line 5 Replace by:
depth of 85 m.
Berths R2 and R3 (333614N 73638W) are ...(red and yellow stripes).
200 m in length with a depth of 59 m. A dangerous wreck (82690N 594842W)
5 Multi--purpose Terminal (333639N 73659W) reported (2018).
comprises Berths 30 to 36 and Berths T3 and T4.
Berths 30 to 36 has a total length of 820 m and
UKHO [NP7A--No 18--Wk 01/19]
depths from 94 to 97 m. Berths T3 and T4 lie at the
head of the Terminal and have a length of 200 m and
a depth of 102 m.
6 Berths 20 to 24 (333631N 73672W) have a
total length of 570 m and depths of 76 to 95 m. NP19 Baltic Pilot Volume 2 (2018 Edition)
Berth A3 (333622N 73669W) is a RoRo berth
with a length of 350 m and a depth of 22 m.
Multi--purpose Terminal Somaport (333627N Estonia -- Roomassaare — Directions;
73679W) has three berths. Berths 10 to 12 have a light sector
total length of 380 m and a depth of 82 m. Berth T2
is 170 m in length with a depth of 68 m. 405
7 Quai de la Marine Royale (333675N 73646W),
Paragraph 11.120 1 line 4 For 024--030 Read
situated on Jetée Moulay Youssef, has three berths
0295--0325
for use by military vessels. Berth D is 600 m in length,
depths from 10 to 85 m. Berth E is 160 m in length,
depth of 123 m. Berth F is 200 m in length with a
depth of 58 m. Estonian Notice 12/147/18 [NP19--No 46--Wk 01/19]
4.1 Wk01/19
IV
NP21 Bay of Bengal Pilot (2013 Edition) WNW of Godºvari Point. A drying shoal extends W of
the headland and lies immediately SE of the
dredged channel. A light buoy marks the danger.
India -- East coast -- Kºkinºda Port — Thence the track leads to a position SSE of a
Controlling depths; pilotage detached breakwater (165924N 821821E). The
track then leads 5 cables WSW into the turning circle,
85 thence W to the berths.
4 Kºkinºda Canal. The entrance of the canalised
Paragraph 2.145 1 lines 1--2 Replace by: Kºkinºda River is approached on the line of bearing
1 Controlling depth. The approach to Kºkinºda has 2285 of Kºkinºda N Groyne light (white metal
a number of dredged depths throughout the buoyed framework, black bands, 2 m in height) (165710N
821663E), between two sets of lateral marks. The
channel. Maintained depths reduce at No 8 Light Buoy
(port hand) (170014N 822028E), No 16 Light Buoy channel is reported to be marked by conical floats.
(port hand) (165842N 821810E), and vary in the The entrance and S side of the seaward end of the
approaches to the berths as follows: canal are formed by training walls. The canal, with
depths of 2 m, is used to transfer cargo by lighter and
Channel section Maintained depth small vessels between the port and an extensive
2 Entrance to No 8 Light warehousing and storage area close W of the canal
155 m
Buoy entrance; it also provides a route between the port
No 8 to No 16 Light Buoy 145 m and the city and connection to inland waterways.
N part of turning area 125 m ENC IN63009A [NP21--No 65--Wk 01/19]

and berth Nos 1 to 3
India -- East coast -- Kºkinºda Port — Berths
S part of turning area 145 m
and berth Nos 4 to 7 86
OSV channel 120 m Paragraph 2.149 2 lines 1--11 Replace by:
Paragraph 2.146 4 lines 3--6 Replace by: 2 Alongside berths. The principal commercial berths
are provided by the quay, 610 m in length with a
...entering the anchorage. The pilot boards in position depth of 125 m, and wharf to the S, 1300 m in length
170144N 822319E, 5 cables E of the Fairway Light with a depth of 145 m, on the W side of Kºkinºda
Buoy No 1 (safe water) (170144N 822262E), or in Bay.
position 170060N 822051E, 5 cables NNE of No 8 Caution. Depths alongside may be reduced due to
Light Buoy (170014N 822028E). For further details siltation. Mariners are advised to contact the port
see Admiralty List of Radio Signals Volume 6(4). authority for the latest information.
ENC IN63009A [NP21--No 64--Wk 01/19] ENC IN63009A [NP21--No 66--Wk 01/19]
India -- East coast -- Kºkinºda Port — Directions NP32A China Sea Pilot Volume 3 (2018 Edition)
86 China -- South--east--coast -- Quanzhou Wan —

Arrival information; VTS
Paragraph 2.148 1--4 Replace by: 154
1 Landmarks: After Paragraph 4.174 4 line 9 Insert:
Water tower (165870N 821609E).
Chimney (165842N 821614E). Vessel Traffic Service
Fertilizer plant chimneys (165923N 821628E). 4.174a
Major light: 1 VTS is available in Quanzhou Wan and
Vºkalapødi Light (170090N 821695E) (2.140). approaches. For further information see ADMIRALTY
2 Racon: List of Radio Signals Volume 6(6).
Vºkalapødi Light (170090N 821695E). For Chinese Notice 48/2088/18 [NP32A--No 88--Wk 01/19]
further details, see Admiralty List of Radio Signals
Volume 2(1).
Entrance channel. From a position in the vicinity of NP32B China Sea Pilot Volume 4 (2018 Edition)
Fairway Light Buoy No 1 (safe water) (170144N
822262E), the track leads generally WSW through a North Korea -- Approaches to Haeju Hang —
channel marked by buoys (lateral). Directions; shoal
3 Kakinada Bay Leading Lights:
225
Front light (165781N 821730E).
Rear light (4¾ cables from front light). Paragraph 7.26 2 line 6 Replace by:
Thence, from a position 2¾ miles NE of Godºvari ...17 m in height), is exhibited, and:
Point Light (white tower, black stripes, 10 m in height) NW of a 29 m shoal (374435N 1253775E),
(165941N 821958E), the alignment (230) of thence:
Kºkinºda Bay Leading Lights leads through the outer
part of the dredged entrance channel, passing: ENC KR3F2J00 [NP32B--No 80--Wk 01/19]
Wk01/19 4.2
IV
NP39 South Indian Ocean Pilot (2017 Edition) Directions for entering harbour
5.64d
1 Principal marks. See 5.54.
Madagascar -- North--west coast -- Mahajanga — The chart is sufficient guide.
Directions; buoy Useful marks. See 5.57.
133 French Notice SD L9 49/18 [NP39--No 15--Wk 01/19]
Paragraph 5.58 2 including existing Section IV Notice

Week 11/18. Replace by: NP42B Japan Pilot Volume 3 (2016 Edition)
2 Thence, from a position about 6¼ cables WNW of
Mahajanga Gas Terminal (153827S 462008E) Kii Suido – East side – Wakayama--Shimotsu Ko
(5.64a) marked by a buoy (special), the line of bearing — Harbour; development
217 of Massif de Kandrany (154712S 461238E)
leads through the S part of the channel, marked by 389
light buoys (lateral), passing:
NW of the coastal bank on which there is a drying After Paragraph 12.144 1 line 14 Insert:
reef, thence:
NW of Roche Antsahambingo (154148S Development
461719E), thence: 12.144a
NW of Digue Schneider (154270S 461768E). 1 Hokko Offing South Breakwater extension, is under
The track then leads into the inner end of the main construction (2018), in the approaches to Kita Ku
channel. (12.153).
French Notice SD L9 49/18 [NP39--No 14--Wk 01/19] Japanese Chart JP1150 [NP42B--No 29--Wk 01/19]
Madagascar -- North--west coast -- Mahajanga —

Directions; gas terminal NP44 Malacca Strait and West Coast of Sumatera
Pilot (2017 Edition)
134
After Paragraph 5.64 1 line 4 Insert: Sumatera -- Pulau Rupat -- Morong —

Pilot boarding position
111
Mahajanga Gas Terminal
Paragraph 4.137 1 lines 5--6 For 15647N 1015120E
General information Read 15644N 1015046E
5.64a
1 Position and function. The terminal (153827S
462008E) is situated off the coast N of Mahajanga ENC ID400018 [NP44--No 30--Wk 01/19]
and consists of four mooring buoys and a submarine
pipeline connected to a PLEM (Pipeline End Manifold)
buoy. Sumatera -- Selat Rupat -- Approaches to Dumai
— Directions; wreck
2 Approach and entry. The terminal is approached
from Chenal du Nord--Est (5.58). 113
Terminal operator. VITOGAZ, Mahajanga
Amborovy Depot, BP552. Paragraph 4.160 4 lines 1--2 Replace by:
Website. www.vitogaz.mg
4 NNE of a dangerous wreck (14073N
Limiting conditions 1013174E), and:
5.64b SSW of the shallow bank marked by No 23 Light
1 Local weather. The berth is particularly sensitive to Buoy (14110N 1013174E).
the effects of W winds and the swell accompanying
them. For further information contact the terminal ENC ID400018 [NP44--No 31--Wk 01/19]
operator.
Arrival information Sumatera -- Pulau Rupat -- Morong —

5.64c Pilot boarding position
1 Port operations. Berthing during daylight hours
only. For further information contact the terminal 114
operator. Paragraph 4.170 1 line 7 For 15647N 1015120E Read
Pilotage is compulsory. 15644N 1015046E
Speed limit in the approach is 8 kn.
Maximum size of vessels handled is 106 m in
length and 7 m in draught. ENC ID400018 [NP44--No 32--Wk 01/19]
4.3 Wk01/19
IV
Singapore -- Singapore Strait -- South--west of Thence the track leads in a generally WNW
Jurong Island — Directions; wrecks direction, in a gentle turn, for a distance of 8 cables
directly into the turning basin and jetty area.
201 6 A channel extension continues WNW and WSW for
about 1 mile to a second basin. The alignment (103),
Paragraph 7.117 6 lines 1--6 Replace by: astern, of the Channel A Outer Range Leading Lights
6 Clear of a dangerous wreck (11149N leads WNW through the centre of the channel.
1033722E), thence:
Clear of a dangerous wreck (11125N US Notice 49/11309/18 [NP69A--No 50--Wk 01/19]
1033542E), thence:
SSW of a dangerous wreck (11276N
1033507E), thence:
NP71 West Indies Pilot Volume 2
SSE of a dangerous wreck (11294N 1033463E),
thence: (2017 Edition)
Singaporean Notice 12/96/18 [NP44--No 33--Wk 01/19]

Martinique — Regulations
253
NP50 Newfoundland and Labrador Pilot
(2016 Edition) After Paragraph 7.1 2 line 3 Insert:
Labrador -- Strait of Belle Isle Approaches — Regulations

Caution; ODAS 7.1a
1 Anchoring in the coastal waters of Martinique is
375 strictly regulated. For further details, see Appendix IX.
After Paragraph 11.2 4 line 7 Insert: Port Authorities Préfect of La Martinique 11/18
[NP71--No 31--Wk 01/19]
Caution. There is a subsurface Ocean Data
Acquisition System (ODAS), with a depth of 25 m, NE
of Belle Island in position 524239N 534687W. Martinique -- Rade de Saint--Pierre —
Prohibited area; anchorages
Canadian Eastern Notice 11/4006/18
[NP50--No 15--Wk 01/19] 255
Paragraphs 7.21--7.22 including headings Replace by:

NP69A East Coasts of Central America and
Gulf of Mexico Pilot (2015 Edition) Arrival information
7.21
1 Prohibited area. Rade de Saint -- Pierre is
United States of America -- Corpus Christi -- encumbered by wrecks of archaeological interest. To
La Quinta — Directions; lights
ensure the protection of the site, anchoring is
prohibited in an area bounded by the end of the
161
Saint--Pierre jetty (144451N 611064W) and three
Paragraph 7.74 3--4 including existing Section IV Notices buoys (special marks) situated in the following
Week 47/18. Replace by: positions:
144421N 611075W
3 La Quinta Channel Leading Lights: 144437N 611095W
Inbound front light (red vertical mark, white stripe, on 144464N 611069W
framework tower, on piles) (275253N
971502W). Basins and berths
Rear light (similar structure) (1 mile from front light). 7.22
Outbound front light (similar structure) (274874N 1 Anchorages and moorings. Vessels over 50 m in
971319W). length may anchor within an area, with a radius of
4 Rear light (similar structure) (4½ cables from 1 cable, centred on 144417N 611088W. For further
front light). details see Appendix IX.
Channel A Outer Range front light (red square, white Mooring buoys, for the use of lighters and barges,
stripe, on framework tower, on piles) (275244N are situated near the head of the pier.
971494W). Alongside berths. A pier (144451N 611064W)
Rear light (similar structure) (4¾ cables from front extends from the coast about 5 cables NNE of Pointe
light). Sainte--Marthe (144400N 611073W). Surf affects
5 The alignment (3368), ahead, of the Inbound the berths at the pier.
Leading Lights, and (1562), astern, of the Outbound
Leading Lights leads NNW through the centre of the Port Authorities Préfect of La Martinique 11/18
channel for a distance of 3½ miles. [NP71--No 32--Wk 01/19]
Wk01/19 4.4
IV
Martinique -- Baie de Fort--de--France — Martinique -- Cul--de--Sac du Marin and

Outer anchorages Anse d’Arlets — Anchorages
262
256
Paragraph 7.76 including heading Replace by:
Paragraph 7.34 1 lines 4--9 Replace by:
West of Pointe du Bout (143372N 610312W) Basins and berths

(7.53a). 7.76
Mouillage des Flamands (143565N 610465W) 1 Anchorages for vessels over 50 m in length are
(7.54). available as follows:
Mouillage de la Dillon (143545N 610340W) Within an area, with a radius of 1½ cables, centred
(7.55). on 142730N 605290W.
Mouillage des Trois Îlets (143298N 610191W) Within an area, with a radius of 1½ cables centred on
(7.56). 142747N 605275W.
For further details, see Appendix IX.
After Paragraph 7.34 2 line 6 Insert: 2 Alongside berths. The fishing and commercial
dock, at the W end of Le Marin, is enclosed by two
For further details on anchorages in the coastal piers, each with a length of 30 m and marked by a
waters of Martinique, see Appendix IX. light at its outer end. There are depths of 25 to 30 m
within the dock.
Port Authorities Préfect of La Martinique 11/18 Paragraph 7.78 including headings and existing Section IV
[NP71--No 33--Wk 01/19] Notice Week 30/17. Replace by:
Anchorages and harbours

Martinique -- Pointe du Bout — Anchorages
Anse d’Arlets
7.78
258
1 Two anchorages are available for vessels over
50 m in length within Grande Anse d’Arlets
After Paragraph 7.53 1 line 9 Insert: (143007N 610557W) as follows:
Within an area, with a radius of 1 cable, centred on
143020N 610575W.
West of Pointe du Bout Within an area, with a radius of 1 cable, centred on
7.53a 143007N 610557W.
1 Three anchorages are available for vessels over 2 A further anchorage is available for vessels over
50 m in length as follows: 50 m in length in Petite Anse d’Arlets as follows:
Within an area, with a radius 1 cable, centred on Within 1½ cables of a position centred on
143320N 610397W. 142904N 610523W.
Within an area, with a radius of 1 cable, centred on For further details, see Appendix IX.
143341N 610406W.
Within an area, with a radius of 1½ cables, centred Port Authorities Préfect of La Martinique 11/18
on 143319N 610433W. [NP71--No 36--Wk 01/19]
Port Authorities Préfect of La Martinique 11/18 Martinique -- Havre de la Trinité — Anchorages

[NP71--No 34--Wk 01/19]
265
Paragraph 7.93 Replace by:

Martinique -- Mouillage des Trois Îlets —
Anchorage 1 Anchorage off the port for vessels over 50 m in
length is available, in about 16 m, within 1½ cables of
position 144526N 605747W. It is recommended
259
that both anchors should be used if the wind is well
established.
Paragraph 7.58 3 lines 5--7 Replace by: 2 Anchorage inside the port is available, with the E
side of Îlet Saint--Aubin (7.89) bearing 349 and Pointe
Anchorage, for vessels over 50 m in length, is Sainte Catherine bearing 310, clear of the submarine
available within an area, with a radius of 1½ cables, outfall extending 4 cables NNE from the S end of the
centred on 143298N 610191W. bay to 1 cable W of TR8 buoy (7.92).
For further details see, Appendix IX.
Port Authorities Préfect of La Martinique 11/18 Port Authorities Préfect of La Martinique 11/18
[NP71--No 35--Wk 01/19] ‘ [NP71--No 37--Wk 01/19]
4.5 Wk01/19
IV
Martinique -- Havre du Robert — Anchorages Martinique -- Baie du Vauclin —

Directions; anchorages
266
Paragraph 7.105 2 lines 3--5 Replace by: 268
Commercial anchorages. The commercial
anchorages (144025N 605555W), for vessels over After Paragraph 7.118 1 line 9 Insert:
50 m in length, lie in the bay W of Pointe Royale
(7.98), in about...
Baie du Vauclin
After Paragraph 7.105 3 line 8 Insert: 7.118a
1 Directions. From a position ENE of V2 Light Buoy
4 The anchorages are positioned as follows:
(starboard hand) (143421N 604865W), the track
Within an area, with a radius of 1½ cables, of position
leads SW within the white sector (230--232) of Port
144025N 605497W.
Vauclin N Point Light (white tower, red top, 7 m in
Within an area, with a radius of 1½ cables, of position
height) (143309N 605017W) to a position NE of
144022N 605519W.
Within an area, with a radius of 1½ cables, of position V4 Light Buoy (starboard hand) (143320N
143998N 605538W. 604979W).
For further details, see Appendix IX. Anchorage for vessels over 50 m in length is
available within an area, with a radius of 1 cable,
Port Authorities Préfect of La Martinique 11/18 centred on 143332N 604958W.
[NP71--No 38--Wk 01/19] For further details, see Appendix IX.
Martinique -- Îlet Long — Anchorages Port Authorities Préfect of La Martinique 11/18

[NP71--No 40--Wk 01/19]
267
After Paragraph 7.113 1 line 8 Insert: Appendix IX
Three anchorages for vessels over 50 m in length
are available N of Îlet Long (143675N 605124W) 368
as follows:
Within 1 cable of position 143717N 605104W. After Appendix VIII Insert new Appendix IX which is printed
Within 1 cable of position 143688N 605157W. at the end of Section IV of this week’s notices.
Within 1 cable of position 143679N 605172W.
Port Authorities Préfect of La Martinique 11/18 Port Authorities Préfect of La Martinique 11/18
[NP71--No 39--Wk 01/19] [NP71--No 41--Wk 01/19]
Wk01/19 4.6
IV
APPENDIX IX
REGULATIONS FOR THE ANCHORAGE OF VESSELS ALONG THE COASTAL

REGION OF MARTINIQUE OUTSIDE AREAS REGULATED BY PORT AUTHORITIES
This appendix contains extracts from the Regulations 3 area within a radius of
for the Anchorage of Vessels Along the Coastal 0.15M centred on the
Region of Martinique Outside Areas Regulated by Port position 1429042N
Authorities issued by the Préfect of La Martinique. 06105232W
(Petite Anse d’Arlets)
DECREE
baie du Marin area within a radius of
0.15M centred on the
Article 1. position 1427468N
Anchoring in the French inland and territorial waters 06052755W
located around the shores of the island of Martinique
but outside of the administrative boundaries of the 4 area within a radius of
ports and of the regulated maritime and river areas is 0.15M centred on the
subject to the provisions laid down in the Articles position 1427305N
below. Those provisions do not prevent a vessel from 06052899W
anchoring outside of the areas and procedures baie du Vauclin area within a radius of
provided for under this Decree, if it is obliged to do so 0.10M centred on the
as a result of an ordinary navigational incident, a position 1433324N
situation of force majeure or distress or for the 06049581W
purpose of lending assistance to a person, vessel or baie du FranÈis area within a radius of
aircraft indanger or distress. Nevertheless, any such 0.10M centred on the
vessel must immediately notify CROSS position 1437170N
Antilles--Guyane of its situation and of the effective 06051040W
position of its anchorage. (E of Ilet Long)
5 area within a radius of
Article 2.
The anchorage of any vessel more than fifty metres in position 1436880N
length overall is prohibited outside of the following 06051569W
areas (positions in accordance with the geodesic (E of Ilet Long)
system WGS84, distances measured in nautical
miles): area within a radius of
1 baie de Saint--Pierre area within a radius of position 1436792N
0.10M centred on the 06051724W
position 1444175N (E of Ilet Long)
06110883W
havre du Robert area within a radius of
baie de Fort--de--France area within a radius of 0.15M centred on the
0.15M centred on the position 1440255N
position 1432985N 06054974W
06101909W
(bourg des Trois--Ilets) 6 area within a radius of
area within a radius of position 1440219N
0.10M centred on the 06055186W
position 1433199N
06103973W area within a radius of
(W of Pointe du Bout) 0.15M centred on the
position 1439975N
2 area within a radius of 06055376W
position 1433411N havre de la Trinité area within a radius of
06104057W 0.15M centred on the
(W of Pointe du Bout) position 1445256N
06057474W
area within a radius of
0.15M centred on the Article 3.
position 1433194N The anchorage of vessels measuring up to fifty metres
06104331W in length overall is permitted outside of the areas
(W of Pointe du Bout)
defined in Article 2, subject to the condition that the
anses d’Arlets area within a radius of area is not subject to any specific prohibition and on
0.10M centred on the condition that neither the anchor nor the anchoring
position 1430198N chain is resting on the reefs composed of coral
06105754W protected under the aforementioned Decree of 25
(Grande Anse d’Arlets) June 2017. It is the responsibility of the Master of the
4.7 Wk01/19
IV
APPENDIX IX
vessel to verify the nature of the seabed, either by The Masters of vessels must specify the reason for
visually examining it from the surface, or, whenever which they are requesting such authorisation. Their
visibility does not allow, by consulting geographical request may be included within the message sent in
data provided on government internet websites. advance of a stay inside French territorial waters if the
deadlines for advance notification are compatible with
Article 4. those laid down in the aforementioned Decree of 17
Vessels of any length must only anchor inside the December 2018.
areas defined in Article 2 if prior authorisation has
Article 9.
been obtained from the Director of CROSS
Antilles--Guyane. The Director will authorise or refuse Masters will remain responsible for selecting the
anchorage on behalf of the Government Delegate for location of their point of anchorage. They will select
State Maritime Activities in the Antilles and will specify that position inside the area authorised by CROSS
the period of time during which anchorage is granted. Antilles--Guyane in a way that ensures the safety of
That period may only exceed thirty--six hours in their vessel and that ensures that their anchor chain is
exceptional circumstances, which must be notified to not resting on the seabed situated outside the areas
the Government Delegate for State Maritime Activities concerned. They shall notify CROSS Antilles--Guyane
in the Antilles. without delay of the position at which their vessel is at
anchor, of their casting off and of any incident that
arises. For the entire period spent at anchor, they
Article 5. must enforce compliance with the stipulations of
The Director of CROSS Antilles -- Guyane may Articles 51 and 82 of Chapter VIII of Part A of the
authorise cargo vessels to anchor inside the areas Convention on Standards of Training, Certification and
defined in Article 2, either during a waiting period that Watchkeeping for Seafarers (the STCW code).
cannot reasonably take place inside the regulated
maritime and river areas, or in connection with a Article 10.
commercial operation that cannot be achieved inside The Masters of vessels will continue to be subject to
the administrative boundaries of the main maritime the reporting obligations laid down in other maritime
port of Martinique, especially due to the origin of the regulations and, if applicable, to the regulations
goods on board or due to the destination of the goods governing passage inside the regulated maritime and
being offloaded, or due to the need to perform river areas of Fort--de--France. They may only
handling operations in a sheltered area. Two cargo disembark passengers onto land if they are in
vessels of a length in excess of one hundred and compliance with the obligations laid down in the
twenty metres anchored in the same bay may not International Ship and Port Facility Security Code
carry out a commercial operation simultaneously. (ISPS code).
Article 6. Article 11.

By way of derogation from Article 2, pleasure yachts The anchorage of any vessel over fifty metres in
not involved in any commercial traffic and measuring length in order to seek shelter from meteorological
more than fifty metres in length overall, but less than conditions also requires an authorisation issued by the
eighty meters, are permitted to anchor outside the Director of CROSS Antilles--Guyane, who must, if
areas listed in this Article, on condition that the appropriate and reasonably possible, favour the areas
position of their anchorage is more than 2.5M from defined in Article 2. The Masters of vessels at anchor
one of the anchorage areas listed under Article 2, on in order to seek shelter from meteorological conditions
condition that the anchorage is carried out in will remainresponsible for selecting their point of
accordance with the conditions specified in Article 3 anchorage and must expressly report to CROSS
and on condition that CROSS Antilles--Guyane is Antilles--Guyane any reservation they may have as to
notified of the anchorage without delay. the suitability of the anchorage area, given the current
and future conditions. Unless compelled to do so for
safety reasons, they may not carry out any operation
Article 7.
or transfers to land when making use of these
The Director of CROSS Antilles--Guyane may ask the anchorages.
Maritime Director of Martinique to convene a local
CROSS Antilles--Guyane will inform the Government
nautical committee in order to validate the nautical Delegate for State Maritime Activities in the Antilles
criteria for the authorisation or refusal of permission to and the Maritime Director of Martinique (Centre for the
anchor that are adopted for a specific sector. Safety of Shipping) of these authorisations to anchor.
Article 8. Article 12.

The Masters of vessels must ensure that their request Vessels required, under this Decree, to notify CROSS
for authorisation to anchor in one of the areas listed in Antilles--Guyane will be considered as making a stop
Article 2 has been sent to CROSS Antilles--Guyane: at a port, as far as any inspections of vessel safety
at least six hours before the vessel enters the and security are concerned. Masters must provide
French territorial waters surrounding Martinique vessel safety and security inspectors with a means of
at least one hour before casting off from a port or transfer for the purpose of carrying out such
anchorage situated inside the French territorial inspections. With the exception of pleasure yachts not
waters surrounding Martinique involved in any commercial traffic, any vessel obliged
at least seventy--two hours before loading or to report to CROSS Antilles--Guyane must have
unloading goods from the anchorage recourse to a maritime agent representing its interests
requested. in France, before anchoring.
Wk01/19 4.8
IV
APPENDIX IX
Article 13. diploma or certificate, as laid down in the

The costs of any disputes that may result from the aforementioned Decree of 7 November 1960
carrying out, inside one of the areas defined in Article in the case of professional mariners in charge of
2, of emergency manoeuvring measures in the sense pleasure craft of French, or non--French
of Article L.5141--2--1 of the French Transport Code nationality, render them liable to the temporary
will be borne by the petitioner. or final withdrawal of their pleasure craft
licence, or, in the case of those who do not
hold any such licence, to a prohibition to sail
Article 14. a vessel from a French port or in French
Failure to comply with this Decree will expose the territorial waters, in the sense of the
perpetrator to the proceedings and penalties provided aforementioned Decree of 2 August 2007.
for in Articles L.5242--1 et seq. of the French
Transport Code and in Articles 131--13.1 et seq. and Article 15.
Article R.610--5 of the French Penal Code. The Commander of the maritime area of the Antilles,
Independently of the criminal penalties that may be the Maritime Director of Martinique, the Director of
applied, any failure to fulfil the obligations listed in this CROSS Antilles--Guyane, the officers and agents
Decree will: authorised in matters relating to the policing of
in the case of professional mariners of French, or navigation and the commissioned environmental
non--French nationality, render them liable to inspectors are tasked, each one of which in his/her
the suspension or prohibition from performing relevant capacity, with the execution of this Decree,
the functions laid down in Articles L.5524--1 et which will be published in the collection of
seq. of the French Transport Code and to a administrative acts of the Préfecture of Martinique and
temporary, partial or total withdrawal of the will be notified to the Masters of the vessels
rights associated with their Master’s certificate, concerned, by CROSS Antilles--Guyane.
4.9 Wk01/19
IV
[01/19]
UPDATES TO ADMIRALTY SAILING DIRECTIONS
In force 28 th December 2018
NP no Page(s) Title Weekly

Edition
1 Africa 1 18th Edition (2017) 47/17
v preface page Africa Pilot Volume 1 — Closure date 47/17
114 Spain -- Islas Canarias -- Isla de la Gomera — Wreck 42/18
121 Arquipélago de Cabo Verde — Regulations; anchorage 18/18
122 Cabo Verde -- Ilha do Sal — Directions; shoal 34/18
130 Arquipélago de Cabo Verde -- Ilha de São Vicente -- Baía de San Pedro — 18/18
Anchorage
132 Arquipélago de Cabo Verde -- Ilha de São Vicente -- Porto Grande — Depths 18/18
133 Arquipélago de Cabo Verde -- Ilha de Santo Antão -- Porto Novo — Anchorage 18/18
137 Arquipélago de Cabo Verde -- Ilha de Santiago -- Baía do Tarrafal — Anchorage 18/18
141 Arquipélago de Cabo Verde -- Ilha Brava -- Porto de Furna — Anchorages 18/18
147 Morocco -- West coast -- Larache — Pilotage 36/18
152 Morocco -- Mohammadia — Directions; oil terminal 36/18
152--153 Morocco -- Mohammadia — Directions; inner port 36/18
154 Morocco -- Casablanca — Directions; buoyage 34/18
154 Morocco -- Casablanca — Outer anchorages; wrecks 33/18
154--155 Morocco -- Casablanca — Pilotage 34/18
155 Morocco -- Casablanca — Buoyage 38/18
156 Morocco -- Casablanca — Directions; buoyage 34/18
156 Morocco -- Casablanca — Berths 18/18
159 Morocco – Jorf Lasfar — Anchorages 12/18
160 Morocco – Jorf Lasfar — Directions; buoyage 02/18
163 Morocco -- Cap Hadid — Major light 52/18
163 Morocco -- Cap Hadid — Directions; major light 52/18
175 Morocco -- West coast -- Laâyoune — Pilotage 47/18
175 Morocco -- West coast -- Laâyoune — Directions; leading marks 47/18
183 Morocco -- Ad Dakhla — Arrival information; outer anchorages 51/17
189 Mauritania -- Nouadhibou -- Point Central to Pointe de Cansado — Directions 05/18
189 Mauritania -- Nouadhibou -- Baie de Cansado — Directions; wrecks, buoy 05/18
194 Mauritania -- Port de l’Amitié — Anchorage 40/18
194 Mauritania -- Port de l’Amitié — Directions; leading lights 40/18
296 Africa -- Ivory Coast -- Abidjan — Limiting conditions; depth 50/18
323 Togo -- Port de Lomé — Directions; wreck 18/18
326 Republic of Benin -- Cotonou — Outer anchorages; obstruction 33/18
357 Nigeria -- Bight of Biafra — Offshore terminals 23/18
6 Republic of South Africa — Regulations; PSSA 28/18
99 Isla de Bioko -- Puerto de Malabo — Berths; depths 07/18
159 Gabon -- South--south--west of Pointe Tishibobo — Terminal 34/18
171 Angola -- Malongo Terminal — Pilotage 48/17
173 Angola -- Futila Terminal — Directions; buoyage 39/17
185 Angola -- River Congo -- Ponta Kimongoa — Directions; caution 21/18
193 Angola -- Kaombo Field — Restricted areas 01/18
196 Angola -- Palanca Terminal — Pilotage 39/17
263 Republic of South Africa -- Saldanha Bay — Prohibited area 47/17
263 Republic of South Africa -- Saldanha Bay — MBM; submarine gas pipeline 47/17
Wk01/19 4.10
IV

Edition
6 South Africa — Regulations; PSSA 28/18
158 Mozambique -- Ponta do Ouro to Baía de Maputo -- Cabo Inhaca — Anchorage 24/17
158, 159 Mozambique – Baía de Maputo — General information; depths; vessel traffic service; 17/17
directions; anchorages
160 Mozambique – Maputo — Port information 17/17
160 Mozambique -- Maputo — Vertical clearances 52/17
160 Mozambique -- Maputo — Pilotage 12/18
160 Mozambique -- Maputo — Pilotage 16/18
160 Mozambique -- Maputo — Regulations 52/17
160 Mozambique -- Maputo — Regulations 40/18
160 Mozambique -- Maputo — Directions; leading lights 02/17
160, 161, 162 Mozambique – Maputo — Port information 17/17
162 Mozambique -- Maputo — Berths; vertical clearance 52/17
169, 170, 171, 173 Mozambique – Beira approaches — General information; directions; Racon; buoy 37/16
176 Mozambique – Quelimane approaches — Directions; wreck 26/17
189 Mozambique -- Nacala — Alongside berths 25/18
204 Tanzania -- Mtwara — Depth 46/18
205 Tanzania -- Mtwara — Directions; depth 46/18
262 Kenya -- Mombasa — Maritime security zone 28/17
267 Kenya -- Mombasa — Anchorage berths 12/17
267 Kenya -- Mombasa -- Port Reitz — LPG Terminal 08/18
269 Kenya -- Mombasa -- Port Reitz — Berths 26/17
4 South--East Alaska 8th Edition (2015) 16/15
169 Kake -- Security Bay — Patch 41/17
365 Cook Inlet – Approaches to Anchorage — Directions; V--AIS 47/15
5 South America 1 19th Edition (2017) 22/17
6 Brazil — Regulations; Extractive Reserves 24/18
71 Brazil -- South Coast -- Porto de Santos — Marine exploration 48/18
81 Brazil -- Rio Amazonas — Regulations 48/17
88 Brazil -- Porto de Santana — Berths; anchorage 41/17
88 Brazil -- North coast -- East of Ilha Do Oiapoque — Directions 50/17
93 Brazil -- North coast -- Rio Pará -- Ilha dos Guarás — Directions; light 31/18
93 Brazil -- Rio Pará -- Canal do Espadarte — Directions; depths 48/17
94 Brazil -- North coast -- Rio Pará -- Salinópolis to Chapéu Virado — Directions 05/18
97 Brazil -- Belém -- Ilha do Mosqueiro — Directions; shoal depth 22/18
99 Brazil -- Rio Pará -- Baía de Marajó — Directions; wreck 01/18
101 Brazil -- Rio Pará -- Porto de Vila do Conde — Directions; wreck 01/18
109 --110 Brazil -- River Amazon -- Ilha das Garças — Directions; depths 48/17
115 Brazil -- Rio Negro -- Porto de Manaus — Vertical clearance 48/17
115 Brazil -- Rio Negro -- Porto de Manaus — Anchorages 48/17
116 Brazil -- Rio Negro -- Porto de Manaus — Bridge 48/17
125 Brazil – North coast – Cabo Gurupi to Ilhas de São João — Directions; wreck 30/18
126 Brazil – North coast – Ilha Mangunça — Directions; light 29/18
129 Brazil -- Baía de São Marcos -- Terminal da Ponta da Madeira — Berth 23/17
4.11 Wk01/19
IV

Edition
137 Brazil -- Pecém Terminal — Anchorages; berths 50/17
162 Brazil -- East coast -- South of Recife — Directions; wreck 27/18
171 Brazil -- Aracaju -- Sergipe Terminal — Anchorage 39/18
175 Brazil -- East coast -- Salvador — Anchorages; pilotage 36/18
175 Brazil -- East coast -- Porto de Salvador — Anchorages 38/18
188 Brazil -- East coast -- Porto de Ilhéus — Controlling depths 31/18
199 Brazil -- Barra do Riacho — Anchorage 20/18
199 Brazil – Terminal de Barra do Riacho — Prohibited anchorage; harbour 01/18
200 Brazil – Terminal de Barra do Riacho — Berths 01/18
201 Brazil -- Porto de Vitória —Vessel traffic service 01/18
202 Brazil -- Porto de Vitória —Vessel traffic service 01/18
209 Brazil -- East coast -- Guaxindiba — Directions; lights 46/17
210 Brazil -- East coast -- Approaches to Porto do Açu — Danger area 31/18
211 Brazil -- Porto do Açu — Directions; light beacons; buoys 24/18
214 Brazil -- Cabo Búzios -- Enseada de Búzios — Anchorage 46/17
227 Brazil -- Porto de Rio de Janerio — Directions 50/17
228 Brazil -- Porto de Rio de Janeiro — Anchorages 01/18
234 Brazil -- East coast -- Ponta de Castelhanos — Directions; Pilot 05/18
236 Brazil -- Baía de Sepetiba -- Porto de Itaguaí — Directions; channels 52/17
236 Brazil -- Baía de Sepetiba -- Porto de Itaguaí — Directions; channels; depths 52/17
237 Brazil -- East coast -- Baía de Sepetiba — Directions; wreck 12/18
237 Brazil -- South coast -- Porto de Itaguaí — Depths 25/18
237 Brazil -- Porto de Itaguaí — Anchorages 52/17
254 Brazil -- Approaches to Porto de Santos — Directions; wreck 17/18
256 Brazil -- East coast -- Barra de Icapara — Directions; light 01/18
257 Brazil -- East coast -- Barra de Icapara — Directions; light 01/18
260 Brazil -- East Coast -- Porto de Antonina — Position; limiting conditions; berths 22/18
266 Brazil -- South coast -- Itajaí — Terminals; alongside berths 26/18
273 Brazil -- South coast -- Barra do Rio Grande Approaches — Directions; wrecks 27/18
276 Brazil -- Porto Do Rio Grande — Berths 43/17
290 Uruguay -- Isla de Flores — ESSA 39/18
290 Uruguay – Río de La Plata — Directions; wreck 27/17
294 Uruguay -- Montevideo -- Antepuerto — Depth 11/18
295 Uruguay -- Puerto de Montevideo — Prohibited area 45/17
298 Uruguay -- Montevideo -- Antepuerto — Depth 11/18
298 Uruguay -- Puerto de Montevideo — Alongside berths; Muelle C 23/17
300 Uruguay -- Río de La Plata — Under keel clearance 46/18
303 Argentina – Río de La Plata — Directions; Canal Punta Indio Sudeste 22/17
304 Argentina -- Puerto La Plata — Anchorages 46/18
307 Uruguay -- West--north--west of Montevideo — ESSA 39/18
319 Uruguay – Río de La Plata – Paso de San Juan and Pozos de San Juan — 22/17
Directions; emergency anchorage; passing areas
326 Uruguay -- Río Uruguay -- Puerto de Nueva Palmira — Light; berths 41/17
335 Argentina -- Puerto Bunge Ramallo — Directions; name change; new route 41/17
336 Argentina -- Puerto Bunge Ramallo — Name change 41/17
336 Argentina -- Río Parana -- Puerto San Nicolás — Anchorages 13/18
337 Argentina -- Río Paraná -- Punta Alvear — Terminals 47/18
337 Argentina -- Río Paraná -- Puerto Rosario — Berths 47/18
352 Argentina -- Bahía Blanca -- Puerto Galván — Berths 16/18
353 Argentina -- Bahía Blanca — Anchorages 16/18
Wk01/19 4.12
IV

Edition
108 Falkland Islands -- Choiseul Sound — Pilotage 14/18
113 Falkland Islands -- East Falkland -- Hecate Channel -- East Cove — Buoy 14/18
220--221 Chile -- Canal Beagle – West Part – Canal Thomson — General information; 25/12
directions
221 Chile – Canal Thomson — Directions; AIS 14/14
220--221 Chile -- Canal Beagle – West Part – Canal Thomson — General information; 25/12
directions
235 Chile – Bahía Cook — Pilot boarding position 10/12
235--236 Chile – Bahía Cook – General information — Directions 25/12
235 Chile – Bahía Cook — Directions; AIS 14/14
243, 244, 252 Chile – Canal Cockburn — Directions; light 10/12
273, 275 Chile – Primera Angostura — Directions; AIS 14/14
275--276 Chile – Estrecho de Magallanes – Puerto Sara — General information; directions; 42/12
leading lights
204 Chile -- Puerto San Antonio — Berth draught 49/18
204--205 Chile -- Puerto San Antonio — Prohibited areas; outer anchorage; pilotage 49/18
205--206 Chile -- Puerto San Antonio — Moorings; berths 49/18
258 Chile -- Bahia Chiquinata -- Punta Gruesa — Prohibited area 49/18
260 Chile -- Bahia Chiquinata -- Punta Gruesa — Prohibited area 49/18
291 Peru -- Callao – Ensenada de Chorrillos — Anchorage 49/18
291--292 Peru -- Callao — Anchorages 49/18
299 Peru – Puerto Chancay — Anchorages 49/18
300 Peru – Puerto Chancay — Berths 49/18
300 Peru -- Puerto Huacho — Outer anchorage 51/18
341 Ecuador – Manta — Directions; light 51/18
342 Ecuador – Manta — Directions; Light 51/18
7A South America 4 8th Edition (2018) 51/18
93 Venezuela -- Boca Grande -- South Channel — Light buoy 51/18
94 Venezuela -- Boca Grande -- South Channel — Light buoy 51/18
94 Venezuela -- Boca Grande -- South Channel — Light buoy; precautionary area 51/18
95 Venezuela -- Boca Grande -- South Channel — Controlling depths 51/18
95 Venezuela -- Boca Grande -- South Channel — Directions; wreck; light buoy 51/18
98 Venezuela -- Río Grande -- San Felix — Directions; leading lights 51/18
98 Venezuela -- Río Orinoco — Anchorages 51/18
98 Venezuela -- Río Orinoco -- Punta de Piedra — Anchorage 51/18
98 Venezuela -- Río Orinoco -- Los Castillos — Anchorage 51/18
98 Venezuela -- Río Orinoco -- San Félix — Anchorages 51/18
98 Venezuela -- Río Orinoco -- San Félix — Directions; leading light 51/18
99 Venezuela -- Río Orinoco -- Puerto Matanzas — Anchorage 51/18
221 Venezuela – Bahía de Amuay — Anchorage 51/18
252 Colombia -- North coast -- Puerto Barranquilla -- Terminal Maritimo — Directions; 51/18
leading lights
277 Panama – Bahía de San Cristobal to Bahía de Portobelo — Marine reserve 51/18
278 Panama – Bahía de Portobelo — Marine reserve 51/18
297 Panama -- Panama Canal -- Gatún Lake — Anchorage 52/18
4.13 Wk01/19
IV

Edition
8 Pacific Coasts of 14th Edition (2016) 46/16
Central America and
United States
6 Mexico — Regulations; protected areas 33/18
6 Mexico — National regulations 42/18
75 Mexico -- Islas Revillagigedo — Regulations 05/18
75 Mexico -- West coast -- Islas Revillagigedo — Protected area 33/18
77 Mexico -- West coast -- Rocas Alijos — Protected area 33/18
77 Mexico -- West coast -- Isla de Guadalupe — Protected area 33/18
85 Panama -- South--west coast -- Isla de Coiba — Traffic regulations 23/18
86 Panama -- Canal de Jicaron — Anchorages 23/18
89 Panama -- South--west coast -- Isla de Coiba — Caution 23/18
96 Costa Rica -- South--west coast -- Golfo Dulce — Traffic regulations 23/18
97 Costa Rica -- Puerto Golfito — Anchorages 23/18
98 Costa Rica – Peninsula de Osa — Traffic regulations; ATBA 01/18
99 Costa Rica -- Isla del Caño — Anchorage 23/18
100 Costa Rica -- Golfo de Nicoya — TSS 27/18
103 Costa Rica -- Puerto Caldera — Berths; depths 27/18
130 El Salvador -- Acajutla — Outer anchorage; wreck 05/18
134 Guatemala -- Puerto Quetzal — Berths; depths 01/18
135 Guatemala -- Puerto Quetzal — Directions; Berths 49/17
141 Mexico -- West coast -- Puerto Chiapas — Depths 52/17
142 Mexico -- West coast-- Puerto Chiapas — Berths 52/17
144 Mexico -- Pacific coast -- Salina Cruz -- Directions; Leading lights 17/17
155 Mexico -- West Coast -- Lázaro Cárdenas — Directions; TSS 38/18
156--157 Mexico -- West Coast -- Lázaro Cárdenas — Anchorage; pilotage; regulations 38/18
158 Mexico -- Lázaro Cárdenas — Harbour; development 48/17
157--158 Mexico -- Lázaro Cárdenas — Port layout 45/18
158 Mexico -- West Coast-- Lázaro Cárdenas — Directions; TSS 38/18
158 Mexico -- Lázaro Cárdenas — Directions; basins and berths 45/18
160 Mexico -- Puerto de Láguna de Cuyutlán — Directions; general information 13/18
165, 166 Mexico -- Bahía de Manzanillo to Cabo Corrientes — Directions; light 46/16
179 Mexico -- West coast -- Golfo de California — General information; Protected areas 33/18
180 Mexico -- West coast -- Golfo de California Southern part -- Offshore route — 33/18
Protected areas
189 Mexico -- West coast -- Golfo de California -- Cabo Falso to Punta Arena — Protected 33/18
areas
190 Mexico -- West coast -- Golfo de California -- Bahía San Lucas — Protected areas 33/18
191 Mexico -- West coast -- Golfo de California -- Bahía Frailes — Protected areas 33/18
191 Mexico -- West coast -- Golfo de California -- Punta Arena to Bahía de la Paz — 33/18
Protected areas
197 Mexico -- West coast -- Golfo de California -- La Paz — Anchorages 33/18
197--198 Mexico -- West coast -- Golfo de California -- Bahía de la Paz to Isla Coronados — 33/18
Protected areas
207 Mexico -- West coast -- Golfo de California -- Isla San Pedro Mátir — Protected areas 33/18
212 Mexico -- West coast -- Golfo de California -- Northern part -- West side — Protected 33/18
areas
215 Mexico -- Golfo de California -- Isla Ángel de la Guarda and Puerto Refugio — 33/18
Restrictions
215 Mexico -- Golfo de California -- Canal Salsipuedes and Canal de Ballenas — 33/18
Protected areas
221 Mexico -- West coast -- Baja California — General Information; protected areas 33/18
242 Mexico -- Bahía de Todos Santos -- Ensenada — Pilotage 15/18
Wk01/19 4.14
IV

Edition
242, 243 Mexico – Bahía De Todos Santos – Ensenada — Development 06/17
245 Mexico -- Energia Costa Azul LNG Terminal — Directions; light alignment 11/18
246 Mexico -- West Coast -- Rosarito — Directions; wreck 37/18
254 United States – San Diego Bay – Entrance channel — Directions; dangerous wreck 10/17
268 USA -- California -- Long Beach Harbor -- Back Channel — Vertical clearance; 31/17
bridges
268 United States of America -- California -- Long Beach Harbor -- Back Channel — 45/18
Vertical clearance; bridges
287 United States -- Port Hueneme — Controlling depths 45/17
287 United States of America -- California -- Channel Islands Harbor — Depths 50/17
287 United States of America -- California -- Channel Islands Harbor — Depths 40/18
331 United States America -- San Francisco Bay -- Yerba Buena Island — Wreck 29/17
335 United States of America – San Francisco Bay – Hunters Point to Coyote Creek — 46/16
Directions; San Bruno Shoal Channel depth and width
342 United States of America -- San Francisco -- San Pablo Bay — Directions; 04/18
submerged piles
346 United States of America – Pacific Coast – Suisun Bay — Anchorages; wrecks 46/16
347 United States -- California -- Suisun Bay -- Antioch — Vertical clearance 47/17
349 United States of America – Port of Sacramento — vertical clearances 51/16
349 United States -- California -- Port of Sacramento -- Sacramento River — Vertical 47/17
clearance
386 United States of America – Coos Bay to Yaquina Bay — Directions; major light 05/17
400 United States of America – Oregon – Columbia River — Pilotage 21/17
403 United States -- Washington -- Columbia River -- Chinook — Controlling depth 49/17
421 United States of America – Washington – Grays Harbor — Berths 21/17
9 Antarctic 8th Edition (2014) 38/14
139 Îles Kerguelen – Baie Norvégienne — Directions; channel 01/18
221 British Antarctic Territory – South Orkney Islands – Signy Island — Directions; light 21/17
229 British Antarctic Territory – South Shetland Islands – Clarence Island to Low Island 01/16
through Bransfield Strait — Directions
289 Antarctica – Hope Bay — Grunden Rock Light 09/15
291 Antarctic -- Trinity Peninsula -- Antarctic Sound to Montravel Rock — Directions; 13/17
shoal
297 Orleans Strait -- Mikkelsen Harbour — Directions; shoal 14/18
310 Antarctic Peninsula -- Gerlache Strait -- North North West of Useful Island — 52/17
Directions; shoal
320 Antarctica – Port Lockroy — Bills Island Light 09/15
335 Antarctic Peninsula -- Lavoisier Island -- Cape Leblond — Directions; position 05/18
336 Antarctic Peninsula -- Biscoe Islands -- Pendleton Strait — Directions; positions 05/18
355 Antarctic Peninsula -- Biscoe Islands -- Lavoisier Island — Directions; positions 05/18
356 Antarctic Peninsula -- Biscoe Islands -- Pendleton Strait to Matha Strait — Directions; 05/18
positions
357 Antarctic Peninsula -- Crystal Sound — Directions; positions 05/18
358 Antarctic Peninsula -- Crystal Sound — Directions; positions; depth 05/18
359 Antarctic Peninsula -- Crystal Sound — Directions; positions 05/18
360 Antarctic Peninsula -- Crystal Sound -- Bragg Islands — Directions; positions 05/18
361 Antarctic Peninsula -- Crystal Sound -- Bragg Islands — Positions 05/18
371 Antarctic Peninsula W coast – Liard Island — Directions; rock 06/17
424 Ross Sea – Scott Island — Position 11/17
4.15 Wk01/19
IV

Edition
10 Arctic 1 9th Edition (2016) 07/16
8 Navigation and Regulations -- Russian pilotage — Icebreaker pilotage 32/16
86 Russia -- Kara Sea -- Ostrov Belyy — Directions; recommended routes 48/18
275 Obskaya Guba – Mys Belyy to Mys Drovyanov — Directions; anchorages and 52/16
harbours
275 Russia -- Kara Sea -- Mys Belyy to Mys Drovyanoy — Directions; recommended 48/18
route
275, 276 Mys Drovyanov to Mys Shtormovoy — General information; directions 52/16
277 Mys Shtormovoy to Mys Khonarasalya — Directions 52/16
278 Kara Sea -- Obskaya Guba -- Port Sabetta — Development 12/17
278--279 Kara Sea -- Obskaya Guba — Directions; DW route; landmarks; depths 29/17
279--280 Kara Sea -- Obskaya Guba — Directions; DW route; landmarks; depths 29/17
289 Kara Sea – South Part — Aids to navigation; lights 04/17
311 Reka Yenisey – Mouth of river to Igarka — General information; navigation; lights 04/17
319, 322 Kara Sea -- Reka Yenisey -- Mys Krestovskiy to Dudinka — Pilot boarding positions; 16/16
anchorages
322 Kara Sea -- Reka Yenisey -- Dudinka to Igarka — Pilot boarding position 16/16
473, 474 Reka Kolyma – Protoka Kamennaya — Depths; directions 07/16
126--127 Iceland -- Akranes — Directions; lights 45/18
247 Svalbard -- Spitsbergen -- Adventfjorden — Anchorage 34/18
322 Greenland -- Kong Christian IX Land -- Kap Gustav Holm — Directions; shoal 49/18
181 Greenland -- West coast -- Sarfartoq -- Kangerlussuaq — Berth 42/18
13 Australia 1 5th Edition (2017) 17/17
10 Australian Regulations — Protection of historic features and areas 36/18
97 Queensland -- Gulf of Carpentaria -- Albatross Bay -- Amrun Port — Port 52/18
114 Melville Bay -- Gove Harbour — Outer anchorages 08/18
129 Arnhem Land -- North and north--east of Maningrida — Outlying dangers; wrecks 08/18
130 Northern Territory -- Arafura Sea -- South Goulburn Island — Depths 45/17
146 Western Australia -- Ashmore Reef — Prohibited area 35/18
147 Western Australia -- North Coast -- Browse Island — FLNG Terminal 19/18
156 Northern Territory -- Port Darwin — Regulations; restricted areas 21/18
159 Northern Territory -- Port Darwin -- Wickham Shoal — Wreck 26/18
166 Australia -- North coast -- Cambridge Gulf — Pilotage 08/18
168 Western Australia -- Cambridge Gulf -- Cawston Bay — Directions; depth 01/18
168 Western Australia -- Cambridge Gulf -- Wyndham Wharf — Directions; light buoys 49/18
183 Western Australia -- Brunswick Bay -- Hanover Bay — Anchorage 17/17
213 Western Australia -- Broome — Directions; controlling depth 46/18
221 Western Australia -- Port Hedland — Traffic Regulaltions 38/17
223 Western Australia -- Port Hedland -- Goldsworthy Front — Directions; light 35/18
223 Western Australia -- Port Hedland — Berths 38/17
224 Western Australia -- Port Hedland — Tug haven 48/17
235 Western Australia -- Port Walcott — Pilot boarding place 17/17
236 Port Walcott -- Outer North Channel — Emergency waiting areas 42/17
241 Western Australia -- Dampier -- East Intercourse Island -- Radome 17/17
279 Western Australia -- Shark Bay -- Denham Sound — Directions; wreck 28/18
281 Geelvink Channel -- Shoal Point — Directions; Racon 44/17
284 Geelvink Channel -- Shoal Point — Directions; Racon 44/17
291 Western Australia -- Port Denison — Directions; leading lights 37/17
Wk01/19 4.16
IV

Edition
347 South Australia -- Great Australian Bight -- Cape Adieu — Environmentally sensitive 37/18
sea area
356 South Australia -- Streaky Bay -- Blanche Port — Directions 11/18
359 South Australia -- Great Australian Bight -- Venus Bay — Directions 11/18
383 South Australia -- Germein Bay — ESSA 40/18
383 South Australia -- Germein Bay -- Port Pirie — ESSA 40/18
398 South Australia -- Kangaroo Island -- Hog Bay — Anchorage 35/17
5 Australia — Regulations; Australian Quarantine and Inspection Service; website 52/17
9 Australian Regulations — Protection of historic features and areas 36/18
10 Distress and Rescue -- Ship reporting systems — MASTREP 08/17
68 Bass Strait — Regulations; restricted area 33/17
87 Chappell Islands -- East side — Directions; Minnie Carmichael 46/16
111--112 Point Grey to Port Phillip Heads — Anchorages and harbours 52/16
115 Victoria -- Approaches to Port Philip -- South--south--west of Point Lonsdale — 14/18
Pilotage
133 Victoria -- Port Philip -- Geelong — Directions for Point Henry Pier; leading beacons 28/16
137 Victoria -- Melbourne -- Port Phillip — Anchorages 26/18
138 Port Phillip -- Werribee River — Directions; leading lights 37/17
150 Victoria -- Philip Island -- Cape Woolamai — Depth 14/18
152 Western Port -- Hastings -- West Head — Pilotage 25/18
156 Western Port -- Hastings to Sandy Point — Directions; under keel clearance; speed 25/18
165 Bass Strait -- Cape Woolamai to Cape Liptrap -- Anderson Inlet — Prohibited 10/17
anchorage
169--170 Bass Strait — Regulations; restricted area 33/17
171 Victoria -- Gabo Island — Racon 14/17
182 Victoria – Port Albert — Directions; buoy 32/18
191 Victoria -- Gabo Island — Racon 14/17
197, 200 North coast of Tasmania -- Circular Head -- Stanley Harbour — Prohibited anchorage 10/17
201 Tasmania -- Port Latta — Anchorage 20/17
205, 206 Tasmania North coast – Burnie — Arrival information; pilotage; directions 17/17
209, 212 Tasmania -- Devonport — Limiting conditions; berths 39/16
215 Tasmania -- North Coast -- Port Dalrymple — Directions; radio masts 42/18
231 Tasmania West coast – Cape Grim — Directions; shoal 30/17
265 Port Arthur — Restricted area; anchorage 27/17
266 Port Arthur — Restricted area; anchorage 27/17
269 Hobart — Arrival information; outer anchorages 27/17
270 Hobart — Arrival information; restricted area 27/17
290 West coast of Tasmania -- Wineglass Bay — Anchorage 27/17
292 Tasmania -- Spring Bay -- Paddys Point — Leading lights 14/17
293 West coast of Tasmania -- Wineglass Bay — Anchorage 27/17
294, 296 Cape Tourville to Eddystone Point — Anchorages and harbours 52/16
301 New South Wales -- Eden — UKC 24/18
301 New South Wales -- Eden — Anchorages 24/18
303 New South Wales -- Eden — Berths; depths 24/18
303 New South Wales -- Eden -- Munganno Point — Caution; obstructions 30/18
303--304 New South Wales -- Eden — Berths; depths 24/18
338 New South Wales – Port Botany — Limiting conditions; controlling depths; berths 01/17
341 New South Wales – Botany Bay — Berths 30/16
341 New South Wales – Port Botany — Limiting conditions; controlling depths; berths 01/17
347 New South Wales – Sydney Harbour — Arrival information; anchorages 01/17
4.17 Wk01/19
IV

Edition
360, 361, 364 New South Wales – Sydney Harbour – Glebe Island – White Bay – Gore Cove — 01/17
Directions; naval berths; commercial basins and berths
366 New South Wales -- Port Jackson — Vertical clearances 44/18
366 Sydney -- Paramatta River — Wreck 41/16
366 New South Wales -- Port Jackson — Directions; vertical clearances 44/18
112 Australia -- New South Wales -- Newcastle -- Stockton Bight — Pilotage 40/18
124 Australia -- New South Wales -- Perpendicular Point — Directions; ESSA 42/18
129 Australia -- East Coast -- Coffs Harbour to Evans Head — Environmentally Sensitive 41/18
Sea Area
156 Australia -- Queensland -- Moreton Bay -- St Helena Island — Directions; wreck 24/18
178 Australia -- Queensland – Port Bundaberg — Directions; lights 47/18
241 Australia -- East Coast -- Whitsunday Passage — Tidal streams 27/18
251 Australia -- Queensland -- Whitsunday Passage -- Grassy Island — Anchorage 42/18
266--267 Australia -- Queensland – Lucinda — Directions; lights 24/18
268 Australia -- East coast -- Queensland -- Hinchinbrook Channel — Directions; leading 52/18
lights
369 Papua New Guinea – Port Moresby — Directions; lights 24/18
18 Baltic 1 18th Edition (2018) 43/18
386 Denmark -- Egernsund -- Egernsundbroen — Vertical clearance 43/18
86 Poland -- Baltic Sea -- North of Rozewie — Submarine pipeline 36/18
92 Denmark -- Bornholm -- Rønne — Directions; Buoy 15/18
92 Denmark -- Bornholm -- Rønne — Prohibited area 10/18
92 Denmark -- Bornholm -- Rønne — Directions; Buoy 15/18
96 Denmark -- Bornholm -- Gudhjem — Pilotage 26/18
97 Denmark -- Bornholm -- Rønne — Prohibited area 23/18
97 Denmark -- Bornholm -- Rønne — Directions; wreck, shoal, pilotage 23/18
97 Denmark -- Bornholm -- Bakkegrund — Directions; dangerous wreck 50/18
105 Sweden -- Gotland -- Visby — Development; pier 19/18
126 Sweden -- Åhus — Photograph 13/18
140 Sweden -- Approaches to Ronneby — Directions; lights; beacons; alignment 31/18
144 Sweden -- Approaches to Karlskrona -- Hasslö -- Hasslöbron — Horizontal clearance; 44/18
lights
155 Sweden -- Kalmarsund -- Kristianopel — Directions; alignment 19/18
167 Sweden -- North Kalmarsund -- Jättersön — Directions; buoys 27/18
257 Sweden -- Stockholms Skärgård -- Söderarm — Draught 30/18
262 Sweden -- Stockholms Skärgård -- Landsort entrance — Traffic regulations 30/18
265 Sweden -- Nynäshamn -- Furholmen — Restricted area 22/18
274 Sweden -- Stockholms Skärgård -- Approaches to Sandhamn — Traffic regulations 30/18
275 Sweden -- Stockholms Skärgård -- Approaches to Sandhamn — Traffic regulations 30/18
281 Sweden -- Stockholms Skärgård -- Oxdjupet — Directions; wreck 30/18
287 Sweden -- Stockholm -- Karl Johansslussen — Restricted area 31/18
287 Sweden -- Stockholm — Regulations 12/18
288 Sweden -- Stockholm -- Södrahamnen — Development 12/18
289 Sweden -- Stockholm -- Ulvsundasjön — Directions; vertical clearance 06/18
290 Sweden -- Port of Stockholm — Basins and berths; alongside depth 19/18
296 Sweden -- Stockholms Skärgård -- Söderarm entrance — Traffic regulations 30/18
Wk01/19 4.18
IV

Edition
296 Sweden -- Stockholms Skärgård -- Tjärven fairway — Traffic regulations 30/18
299 Sweden -- East Coast -- Kapellskär — Berths 37/18
304 Sweden -- Stockholms Skärgård -- Simpnäs fairway — Traffic regulations 30/18
323 Germany -- Approaches to Wolgast — Speed limit 42/18
325 Germany -- Wolgast Hafen — Speed limit 42/18
328 Germany -- Baltic South Shore -- Zatoka Pomorska — Prohibited area 51/18
340 Poland -- Szczecin -- Parnica — Berths; depths 36/18
341 Poland -- West and north--north--west of Mrzeÿyno — Directions; wrecks 10/18
345 Poland -- Rowy to Łeba — Nature reserve 24/18
355 Poland -- Gdynia — Pilotage 36/18
355 Poland -- Gdynia — Tugs 36/18
355 Poland -- Gdynia — Restricted area 40/18
357 Poland -- Gdynia — Obstructions 36/18
357 Poland -- Gdynia — Berths; obstructions 40/18
358 Poland -- Gdamsk — Anchorage; wreck 29/18
359 Poland -- Gdamsk — Pilotage 36/18
361 Poland -- PóÞnocny — Pilotage 36/18
361--362 Poland -- Port PóÞnocny -- Basen Paliw PÞynnych — Draughts 13/18
398 Latvia -- SalacgrØva — Controlling depths 36/18
404 Estonia -- Saaremaa -- Suur Katel — Directions; wrecks 31/18
101--102 Estonia -- Paldiski — Anchorage; prohibited areas 48/17
102 Estonia -- Väike--Pakri — Obstruction 41/17
109--110 Estonia – Muuga Sadam and Approaches — Arrival information; anchorages 05/17
109--110 Estonia -- Gulf of Finland -- East of Agena saar — Obstruction 46/17
112 Estonia – Muuga Sadam to Letipea Neem — Directions; AIS 05/17
117 Estonia – Narva Bay and Approaches — General information; hazards 05/17
118 Estonia -- Narva Bay -- Directions; buoy 26/18
119 Estonia -- Narva Bay -- Directions; buoy 26/18
126 Russia -- Sankt Peterburg approaches -- North of Krasnava Gorka — Anchorage; 09/18
obstructions
126 Russia -- Sankt Peterburg approaches -- North of Krasnaya Gorka — Anchorage 30/18
128 Russia -- Sankt Peterburg approaches -- Kronshtadtskiy Korabel’nyy Farvater — 30/18
Depth
128 Russia – Sankt Peterburg – Outer Approaches — General information; 07/17
traffic regulations
128 Russia -- Approaches to Sankt Peterburg — Speed restrictions 47/17
131 Russia -- Sankt Peterburg and approaches -- Port Bronka — Depths; directions 28/16
135 Russia -- Sankt Peterburg — Vertical clearance 02/18
147 Finland -- Hanko approaches — Directions; draught; beacons 33/17
148 Finland -- Hanko approaches — Directions; light 33/17
149 Finland -- Gulf of Finland -- Hanko — Limiting conditions; draught 44/17
152 Finland -- Tammisaari Approaches — Directions; beacon 40/17
153 Finland -- Tammisaari Approaches — Directions; beacon 40/17
153 Finland -- Tammisaari Approaches -- Odensö — Directions; beacons 16/18
156 Finland -- Gulf of Finland -- Julö — Directions; light 50/17
158 Finland -- Porkkalanselkä — Pilotage 16/18
167 Finland -- Helsinki Approaches — Pilotage 16/18
167 Finland -- Helsinki Approaches — Pilotage 20/18
195 Finland -- Loviisa Approaches -- Orrengrund — Pilotage 16/18
202 Finland – Approaches to Kotka — Outer anchorage 47/16
4.19 Wk01/19
IV

Edition
203 Finland – Kotka — Anchorages 47/16
203--204 Finland – Kotka — Anchorages 47/16
204 Finland -- Gulf of Finland -- Kotka — Directions for western harbours; authorised 26/16
draughts
205 Finland -- South coast -- Kotka — Basins and berths; depths and maximum draughts 31/16
208 Finland -- Approaches to Hamina -- Hamina bypass channel — Directions; maximum 19/17
draught
211 Finland – Hamina -- Eastern entrance; Pieni--Musta to Haminanlahti — Directions 47/16
212 Finland – Hamina — Directions; draught restriction; leading lights 09/17
214 Finland -- North of Harvajanniemi -- Klamilanlahti — Directions; draught 13/17
218 Finland -- Malyy Tranzundskiy Reyd -- Banka Yalkamatala to Banka Khallikivi — 07/18
Directions; obstructions
219 Russia -- Malyy Tranzundskiy Reyd -- West of Ostrov Krepysh — Anchorages; 46/17
wrecks and obstruction
229 Finland -- South west coast -- Saaristomeri — Pilotage 41/18
229 Finland -- Hanko Approaches — Pilotage 16/18
231 Finland -- Saaristomeri — Directions; other aids to navigation 26/16
239 Finland – Hanko to Salo -- Route East of Kemiö — Bridge clearances 50/16
244 Finland -- Saaristomeri -- Isokari--Lövskär channel — Directions; light 50/17
252 Finland -- Lövskär to Purha — Directions; light 13/17
253 Finland -- Kråkholm to Kyrkfjärden — Directions; link channel; leading beacons 48/17
255 Finland -- South--west coast -- Maarianhamina — Pilotage 25/18
257 Finland – Rödhamnsfjärden — Anchorage 47/16
264 Finland -- Isokari and approaches — Directions; depth 13/17
267 Finland -- South--west -- Laupunen to Rajakari — Directions; light 26/16
272 Finland -- Naantali — Anchorage position 17/18
275 Finland -- Maarianhamina -- Granöklubb — Directions; caution; leading lights 13/18
275 Finland -- Maarianhamina -- Granöklubb — Directions; caution; track; draught 23/18
275 Finland -- Maarianhamina -- Granöklubb — Directions; caution; leading lights 13/18
276 Finland -- Maarianhamina -- Granö to Hackorna Beacon — Directions 13/18
276 Finland -- Maarianhamina Approach -- Stora Skivgrund — Directions; buoys 23/18
278 Finland -- Ahvenanmaa -- Berghamn — Light sector 13/18
278 Finland -- Åland Hav -- Signilskär — Directions; lights; beacons 39/17
279 Finland – Avenanmaa — General information; draught regulations 42/16
280 Finland – Ahvenanmaa – 25 m route to Maarianhamina — Directions 47/16
292 Finland -- Rauma Approaches — Pilotage 16/18
297 Finland -- Rauma to Porin Majakka — Directions; other aids to navigation 27/16
297 Finland -- Rauma to Porin Majakka — Directions; buoys 13/17
299 Finland -- Pori Approaches — Pilotage 16/18
299, 300, 301 Finland -- Pori and Approaches — Directions; other aids to navigation 27/16
302 Finland -- Porin Majakka to Kristiinankaupunki — Directions; other aids to navigation 27/16
303 Finland -- Porin Majakka to Kristiinankaupunki — Directions; rock awash 13/17
303 Finland -- Porin Majakka to Kristiinankaupunki — Directions; shoals 13/17
303 Finland -- Gulf of Bothnia -- Kristiinankaupunki — Directions; buoyage 28/18
303 Finland -- Porin Majakka to Kristiinankaupunki — Directions; other aids to navigation 27/16
303 Finland -- Tahkoluoto — Wind farm 45/17
315 Finland -- Gulf of Bothnia -- Norra Kvarken -- Helsingkallan — Directions; Buoys 28/18
316 Finland -- South approaches to Vaasa -- Gåshällan to Bergö — Directions; lights 28/16
322 Finland -- North approaches to Vaasa — Vertical clearance 27/16
Wk01/19 4.20
IV

Edition
322 Finland – North approaches to Vaasa — Vertical clearances 44/16
329 Finland -- Gulf of Bothnia -- Kokkola — Firing practise areas 02/18
331 Finland – Stubben to Raahe – Pietarsaari — Directions; general information; light 39/16
331 Finland -- Stubben to Kokkola Majakka — Other aids to navigation; racon 13/17
331, 331--332 Finland – Stubben to Raahe – Pietarsaari — Directions; general information; light 39/16
335 Finland -- Kokkola — Anchorage 30/17
336 Finland -- Rahja Approaches — Pilotage 16/18
340 Finland -- Raahe and approaches -- Roska Roads to Lapaluote — 13/17
Directions; maximum draught
343 Finland -- Oulu Approaches — Pilotage 16/18
344 Finland -- Gulf of Bothnia -- Hailuoto -- Merikallat — Directions; draught 26/18
346 Finland -- Oulu -- Toppila — Toppilansalmi Leading lights 45/17
348 Approaches to Oulu -- Kropsu — Directions; light 26/17
349 Approaches to Oulu -- Kropsu — Directions; light 26/17
363 Sweden – Gulf of Bothnia – Singösund — vertical clearance 48/16
368 Sweden – Väddö Kanal — Bridge clearances 52/16
373 Sweden -- Gulf of Bothnia -- Slada Hamn — Anchorage; shoal 41/18
435 Sweden -- Gulf of Bothnia -- Örnsköldsvik -- Råskärsön — Anchorages 50/18
442 Sweden -- Norra Kvarken -- Hörnefors --Lögaren — Directions; light 26/18
457 Sweden -- Gulf of Bothnia -- Bjurön — Directions; light position 31/18
459 Sweden -- Gulf of Bothnia -- Lövsele — Directions; leading lights 52/17
460 Sweden -- Gulf of Bothnia -- Bjurön — Light position 31/18
461 Sweden -- Gulf of Bothnia -- Bjurön — Light position 31/18
462 Sweden – Gulf of Bothnia – Skelleftehamn — Draught 17/17
463 Sweden -- East approach to Gåsören --Skötgrönnan — Directions; shoals, wreck; 21/18
buoy; depths
463 Sweden -- East approach to Gåsören --Skötgrönnan — Directions; shoals, wreck; 21/18
buoy; depths
464 Sweden – Skelleftehamn – Gåsören to Sörfjärden — Directions 07/17
465 Sweden – Gulf of Bothnia – Skelleftehamn — Draught 17/17
466--467 Sweden -- Approaches to Kågehamn — Directions; depths 21/18
467 Sweden -- Furuögrund — Directions; depths 21/18
468 Sweden -- Åbyfjärden — Directions; shoal; positions 21/18
468 Sweden -- Kinnbäcksfjärden -- South--west of Rönnskär — Directions; shoal; 21/18
positions
469 Sweden -- Piteå and approaches — Depths 11/17
470 Sweden -- Gulf of Bothnia -- Bondöfjärden — Directions; leading lights 19/17
470 Sweden -- Gulf of Bothnia -- Bondöfjärden — Leading lights; alignment; position; 41/18
distance
470 Sweden -- Gulf of Bothnia -- Bondöfjärden — Directions; leading lights 19/17
470 Sweden -- Gulf of Bothnia -- Bondöfjärden — Leading lights; position; distance; rock 41/18
471 Sweden -- Piteå and approaches — Directions 11/17
471 Sweden -- Piteå and approaches -- Skuthamn to Piteå Södra Hamn — Directions 11/17
472 Sweden -- Piteå and approaches — Berths 11/17
478 Sweden -- Approaches to Luleå -- Sandön — Directions; sector light 49/18
4.21 Wk01/19
IV

Edition
21 Bay of Bengal 12th Edition (2013) 05/14
73 India – Coromandel Coast — Directions; major light 31/14
73 India – East coast – Coleroon Point to Palºr River — Directions; wreck 42/14
80 India – East coast – Kamarajar (Ennore) Port — Depths; harbour; directions 09/18
80 India -- Ennore Port — Arrival information; fairway buoy 31/16
80 India -- Ennore Port — Arrival information; pilotage 04/17
80 India -- East coast -- Kamarajar (Ennore) Port — Designated waiting area and 10/18
pilotage
80 India -- Ennore Port — Directions; fairway buoy 31/16
80--81 India – East coast – Kamarajar (Ennore) Port — Directions 09/18
81 India – East coast – Kamarajar (Ennore) Port — Basins and berths 09/18
82 India -- East Coast -- Krishnapatnam — Anchorages 43/17
82 India -- Krishnapatnam Port — Arrival information; pilot station 12/16
88 India – East coast – Kºkinºda Bay to Vishºkhapatnam — Directions; wreck; SPM 42/14
88 India – East coast – Kºkinºda Bay to Vishºkhapatnam — Directions; dangerous 04/16
wreck
91 India -- Bay of Bengal -- Vishºkhapatnam -- Leading lights; alignment 41/17
92 India -- Bay of Bengal -- Vishºkhapatnam -- Leading lights; alignment 41/17
98--99 India -- East Coast -- Gopalpur — Port information 47/17
98--99 India -- East Coast -- Gopalpur — Port 14/18
99 India -- East coast -- Gopºlpur Port — Anchorage 27/18
101 India – Bay of Bengal Bengal of Bay -- South of Pºrºdip — Directions; shoal 31/17
101 India -- Bay of Bengal -- Pºrºdip — Depth 40/17
101 India -- East coast -- Pºrºdip — Anchorages 24/18
101,102 India – East coast – Pºrºdip — Berth 43/16
102 India -- Pºrºdip — Directions for entering harbour 06/16
102, 103 India – East coast – Pºrºdip — Berth 43/16
104 India -- Pºrºdip — Directions; wreck 34/17
105 India -- East coast -- Dhºmra Port — Depths 14/18
112, 112--113 India – Hugli River — Directions 23/17
112--113 India -- Sºgar Roads to Haldia Port — Directions 10/18
113 India – Hugli River — Directions 23/17
113 India -- Tigris Sand to Ghorºmºra Island — Directions 10/18
113, 113--114, 114 India – Hugli River — Directions 23/17
115 India – Haldia Port — Directions; landmark 23/17
115 India -- East coast -- Haldia Port — Directions; marks 27/18
116 India -- Hugli River -- Brul Reach — Directions; beacon alignment 29/18
127 Bangladesh -- Pussur River to Sandwip Channel — Directions; stranded wreck 12/16
127 Bangladesh -- Chittagong -- Patenga Point — Directions; light 37/18
129 Bangladesh -- Chittagong Coast — General information; stranded wreck 12/16
130 Bangladesh -- Chittagong Coast -- Maiskhali Island — Directions; restricted areas; 36/18
wreck
130 Bangladesh – Chittagong Coast – Kutubdia Island — Directions; well 25/17
130 Bangladesh -- Chittagong Coast — Directions; stranded wreck 12/16
133 Bangladesh -- Chittagong — Directions for entering harbour; stranded wreck 12/16
Wk01/19 4.22
IV

Edition
141 Burma -- Sittwe — Directions; stranded wrecks 39/15
142, 143, 144, 144--145, Burma – Combermere Bay – Kyauk Phyu Harbour – Gadechy Harbour — General 21/17
145 information; arrival information; limiting conditions; directions; berths and basins
159 Burma -- Gulf of Martaban -- Yadana Gas Field — Restricted area 03/18
159 Burma -- Baragua Point to Yangon River — Directions; dangerous wreck 08/16
161 Burma – Yangon River – Approach to Yangon River — Directions; Western channel 45/16
161 Burma -- Yangon River — Directions; light buoys 03/17
161 Burma -- Yangon River and Approaches — Buoyed passage 49/17
161 Burma -- Yangon River and Approaches — Directions; light buoy 06/16
161 Burma – Yangon River – Sin Min Point to Port of Yangon — Directions; caution; 45/16
route
161, 162 Burma – Yangon River – Port of Yangon — Limiting conditions; controlling depth; 45/16
vertical clearance
162 Burma – Yangon River – Port of Yangon — Arrival information; prohibited 45/16
anchorages
162, 162--163 Burma – Yangon River – Port of Yangon — Directions for entering harbour; D’Silva 45/16
Shoal to Hastings Sand; Hastings Sand to Thanlyetsoon Point Channel
163 Burma – Yangon River – Port of Yangon — Berths; anchorages and moorings; 45/16
alongside berths
171 Burma -- Gulf of Mataban -- HeinzÏ Islands — Restricted area 03/18
177 Burma -- Myauk Taw Win Island to Chong Pak Phra — Directions; shoal 32/16
185, 188 Burma -- Inshore route--North Part -- Dawei Point to Myeik — General information; 32/16
charts
189, 190 Burma -- Inshore route--North Part -- Fell Passage — General information; charts; 32/16
directions
190 Burma -- Inshore route--North Part -- Mermaid Passage to Pinbwa Island — General 32/16
information; charts
221 Andaman Islands – Long Island – Raman Point — Berth 16/17
222 Andaman Islands – Diligent Strait – Charka Juru — Depths; distances 16/17
229 India -- Andaman Islands -- South Andaman Island -- Port Blair — Directions; floating 36/18
dock
22 Bay of Biscay 13th Edition (2016) 43/16
54 Spain -- Pasaia (Pasajes) -- Directions — Other aids to navigation; AIS 01/17
67 France -- L’Odet river -- Bénodet — Fairway; directions; depth 20/17
69 France -- Pointe de Trévignon — Directions; wreck 34/17
82 France – Approaches to Lorient -- Les Coureaux de Groix — anchorages 11/17
133 France -- La Loire – Chenal du Sud — Pilotage 47/18
133 France -- La Loire Approaches and Estuary -- Chenal du Sud, Chenal de 02/17
Bonne--Anse and Grande Rade de Saint--Nazaire — Directions; AIS
137 France -- Saint--Nazaire -- Passage du Ronfle — Prohibited anchorage 43/17
143 France – Saint--Nazaire — General information; vertical clearance 05/17
144 France – West coast – Loire River estuary – Montoir — Berths 43/16
174 France -- West coast -- La Rochelle--Pallice — Arrival information; Prohibited areas 43/18
201 France -- The Garonne -- Bordeaux — Wreck; buoy 52/17
214 France -- Bayonne — Outer anchorage 49/16
214 France -- Bayonne — Traffic regulations 49/16
214 France -- Bayonne — Traffic regulations 30/17
224 Spain -- Pasaia (Pasajes) -- Directions — Other aids to navigation; AIS 01/17
242 Spain -- Bilbao -- El Abra — Wreck 41/17
276 Spain -- Avilés — Directions; light 21/18
4.23 Wk01/19
IV

Edition
23 Bering Sea and Strait 8th Edition (2013) 07/14
137, 149, 155, 163 United States of America – Aleutian Islands — General information; areas to be 49/15
avoided
165 United States of America -- Alaska -- Pavlof Islands — Rock awash 39/17
172 United States of America -- Aleutian Islands -- Ikatan Peninsula -- Pankof Breaker — 32/18
Depth
178, 179, 190, 206, 212, United States of America – Aleutian Islands — General information; areas to be 49/15
219, 244, 251, 260, 267 avoided
283 United States of America – Kushkokwim Bay — General information; Pilotage 09/16
284 United States of America – Goodnews Bay — Pilotage 09/16
299 United States of America – Nome — Arrival information; Pilotage 09/16
301 United States of America – Port Clarence — Arrival information; Pilotage 09/16
303 United States of America – E part of Chukchi Sea — General information; Pilotage 09/16
305 United States of America – Kotzebue Sound — Pilotage 09/16
311 United States of America – Barrow — Pilotage 09/16
339 Russia -- Bering Sea -- Poluostrov Kamchatka -- Mys Afrika — Directions; light 52/17
24 Black Sea and Sea of 5th Edition (2017) 07/17
Azov
90 Turkey -- YiÔitler Geçidi -- Büyükliman Burnu — Directions; light buoy 24/17
103 Turkey -- Ambarli LimanÝ — Arrival information; pilotage 09/17
105 Turkey -- ™zmit Körfezi -- Osmangazi Bridge — Vertical clearance 15/17
108 Turkey -- YarÝmca—Tütünçiftlik industrial complex — Berths; depths; light 08/18
110 Turkey -- Marmara Denizi -- Approaches to Istanbul BoÔazÝ — Traffic regulations; 24/17
restricted area
111 Turkey -- Marmara Denizi -- Fenerbahçe BankÝ — Prohibited entry 29/18
111 Turkey -- Istanbul -- Kumkapi — Directions; light 18/18
114 Turkey – Tuzla Koyu — Pilotage 03/18
114 Turkey -- Marmara Denizi -- AydÝnlÝ Koyu — Shoal 40/18
118 Turkey -- Istanbul BoÔazÝ (Bosporus) — Bridges 16/18
118 Turkey – Istanbul — Overhead power cables; air draught limit 11/17
120 Turkey – Istanbul BoÔazÝ (Bosporus) — Directions; AIS 11/17
120 Turkey -- Istanbul BoÔazÝ (Bosporus) — Bridges 16/18
130 Turkey -- EreÔli -- Kuzey Mendirek — Regulations; restricted areas 24/18
131 Turkey -- EreÔli — Berths; depths 09/17
140 Turkey -- Black Sea -- Gerze — Anchorages; wreck 36/18
143 Turkey -- Ünye Körfezi — Anchorages 31/17
145 Turkey -- Giresun — Prohibited anchorage 45/17
146 Turkey – Giresun to Kale Burnu -- Tirebolu — Directions; light 24/17
147 Turkey -- Black Sea -- Karadeniz LPG Terminal — Waiting anchorage 50/18
147 Turkey – Giresun to Kale Burnu -- Tirebolu — Directions; light 24/17
153,154 Georgia -- Turkish border – Sarp — Restricted area; vessel activity 19/17
158 Georgia -- P’ot’i — Maximum draught 06/18
158 Georgia -- Black Sea -- P’ot’i — Regulated areas 38/18
162 Turkey -- Black Sea -- West of Istanbul — Port installation 49/18
162 Turkey -- Dalyan Burnu — Wrecks 43/17
162 Turkey -- Karataî Burnu — Anchorage 43/17
163 Turkey -- Black Sea -- KÝyÝköy — Prohibited anchorage 34/18
203 Ukraine -- Lymans’kyi Kanal -- Dnistrovs’ko--Tsarehrads’ke Hyrlo — Light 44/17
205 Ukraine -- Lymans’kyi Kanal -- Dnistrovs’ko--Tsarehrads’ke Hyrlo — Light 44/17
Wk01/19 4.24
IV

Edition
213 Ukraine -- Approaches to Port Yuzhnyy — Outer anchorage; change of designation 05/18
216 Ukraine -- Port Yuzhnyy — Anchorages 50/17
216 Ukraine -- Black Sea -- Odes’ka Banka — Obstruction 07/18
227 Ukraine -- Black Sea -- Mykolaiv — Speed restriction 01/18
227 Ukraine -- Mykolaiv — Anchorages 50/17
232 Ukraine -- Approaches to Kherson -- West of Ostrov Malyi Pot’omkin — Submarine 52/17
cable
251 Approaches to Yalta -- Hurzuf -- Mys Ayudah — Prohibited area 35/18
252 Approaches to Yalta -- Hurzuf -- Mys Ayudah — Prohibited area 35/18
264 Russia -- Black Sea -- Novorossiysk — Caution; unexploded ordnance 52/17
277 Georgia – Kulevi Terminal — Limiting conditions; depth and width 24/17
277--278 Georgia – Kulevi Terminal — Directions for entering harbour; buoyed channel 24/17
282 Black Sea – Kerch Strait — Pilotage 46/18
284 Russia -- Black Sea -- Port Taman’ — Speed limit 01/18
284 Russia -- Black Sea -- Port Taman’ — Pilotage; tugs 01/18
284 Russia -- Black Sea -- Port Taman’ — Berths 01/18
285 Black Sea -- Kerch Strait — Pilotage 47/18
285 Black Sea -- Kerch Strait — Anchorages 19/17
285 Russia -- Sea of Azov -- Kerch Strait — Wrecks; fouls; anchorage 44/17
285 Russia – Kerch Strait — Anchorages 41/18
293 Ukraine -- Sea of Azov -- Berdyans’k — Depths 47/18
295 Ukraine – Port Mariupol’ — Limiting conditions maximum draught; maximum size of 41/18
vessel
295 Ukraine – Port Mariupol’ — Arrival information; vessel traffic service 41/18
296 Ukraine – Port Mariupol’ — Arrival information; anchorages 41/18
296 Ukraine – Port Mariupol’ — Arrival information; regulations 41/18
314 Appendix 3 -- Hurzuf -- Mys Ayudah — Prohibited area 35/18
25 British Columbia 1 16th Edition (2017) 04/17
8 United States of America -- West coast -- Washington — ATBA 50/18
75 Canada -- Esquimalt Harbour — Anchorage 18/18
79 Canada -- Vancouver Island -- Mayor Channel — Directions; buoy 19/17
83 United States of America – Juan de Fuca Strait – Minor Island — Directions; light 20/17
104 United States of America -- Seattle -- Lake Union — Seaplane area 39/18
104 United States of America -- Seattle -- Lake Washington — Bridge clearance 25/18
104 United States of America -- Seattle -- Lake Washington — Bridge clearance 42/18
191 Canada -- Strait of Georgia -- Roberts Bank — Under--keel clearance 25/17
195 Canada -- Fraser River — Under--keel clearance; pilotage 25/17
200 Canada -- Vancouver — Under--keel clearance 25/17
202 Canada -- Vancouver — Under--keel clearance; depths; regulations 25/17
202 Canada -- Vancouver -- Deadman Island — Prohibited anchorage 47/18
202 Canada -- Vancouver — Under--keel clearance; depths; regulations 25/17
207 Canada -- Vancouver -- Burrard Inlet — Under--keel clearance; depths; regulations 25/17
208 Canada -- Vancouver -- Second Narrows — Navigable width; horizontal clearance 25/17
210 Canada – Port Moody — Berths; anchorage 04/17
248 Canada -- Sechelt Inlet — Directions; depth 47/17
268 Canada -- Vancouver Island -- Thurlow Islands -- Mayne Passage — Offshore 40/17
platform
363 Canada -- Clayoquot Sound -- Calmus Passage — Buoy 46/17
4.25 Wk01/19
IV

Edition
26 British Columbia 2 11th Edition (2017) 11/17
112 Douglas Channel -- Gertrude Point — Directions; light 22/17
158 Queen Charlotte Sound – Calvert Island — General information; traffic regulations 22/17
176 Hecate Sound – Price Island — General information; traffic regulations 22/17
180 Hecate Strait – Bonilla Island — General information; traffic regulations 22/17
188 British Columbia -- Pitt Island -- Otter Channel — Light 44/17
190 British Columbia -- Pitt Island -- Otter Channel — Lights 44/17
197 Canada -- Hecate Strait -- Browning Entrance to Dundas Island — Directions; shoal; 23/17
buoyage
213 British Columbia -- Moresby Island -- Juan Perez Sound -- Matheson Inlet — Depth 30/18
242 British Columbia -- West coast of Graham Island — Caution; depths 30/18
27 Channel 12th Edition (2018) 45/18
iii Preface page 45/18
255 France -- Avant--Goulet de Brest -- Waiting area to Brest — Buoyage 45/18
265 France -- West coast -- Douarnenez — Pilotage 45/18
375 Channel Islands -- Jersey -- Saint Catherine’s Bay — Anchorage 51/18
Last page Last page 45/18
28 Dover Strait 12th Edition (2017) 34/17
60 England -- Dover Strait -- North--west of Sandettié Bank — Unexploded ordinance 28/18
61 Belgium -- Westhinder — Obstructions 49/17
66 England -- Dover Strait -- North--west of Sandettié Bank — Directions; unexploded 28/18
ordinance
73 England – Littlehampton — Directions; caution 45/18
83 England -- South Coast -- Beachy Head — Directions; light 37/18
86 England -- South Coast -- Beachy Head — Directions; light 37/18
94 England -- South--east coast -- Dover — Regulations 14/18
139 France -- Calais — Basins and berths; depths 47/17
161--162 Belgium -- Thornton Bank — Buoyage 35/17
162 Belgium -- North Sea -- Thornton Bank and Lodewijbank — Wind farms 17/18
162 Belgium -- North Sea -- North west of Oostende — Pilotage 23/18
162 Netherlands -- North Sea -- Schouwenbank Junction -- Steenbank — Pilot station 46/17
163 The Netherlands -- Westerschelde -- Westkapelle — Pilotage 45/18
166 Belgium -- Thornton Bank — Buoyage 35/17
167 Belgium -- Approaches to Zeebrugge — LNG tanker regulations 23/18
176 Netherlands -- North Hinder Junction — Directions; buoyage 35/17
195 Belgium -- Antwerp — Overhead power cables 51/18
195--196 Belgium -- Antwerp -- Kieldrechtsluis — Lock dimensions 13/18
203 Netherlands -- Schouwendiep — Directions; buoyage 47/17
243 England -- Thames Estuary — Pilotage 35/17
244 England -- Thames Estuary — Pilotage 35/17
244 England -- Thames Estuary — Draught, pilotage 45/18
273 England -- Felixstowe -- Sledway — Anchorage 42/18
294 England -- River Colne -- Brightlingsea — Directions; buoy 22/18
307 River Thames -- Sea Reach -- Canvey Island — Berths 32/18
309 England -- River Thames -- Tilbury — Chimney 43/17
310 England -- River Thames -- Tilbury Power Station — Depths 47/17
315 England -- River Thames -- Long Reach Esso Terminal — Depths 47/17
327 England -- River Medway -- Isle of Grain — Berths 42/17
335 England -- The Swale -- Kingsferry Bridge — Vertical clearance 47/17
Wk01/19 4.26
IV

Edition
30 China Sea 1 11th Edition (2018) 29/18
6 China -- Approaches to Hong Kong — Traffic Separation Scheme 44/18
7 Malaysia — Regulations; National Heritage Zones 29/18
96 Malaysia -- East coast -- Kuantan Port — Anchorages; pilotage 49/18
103 Malaysia -- East coast -- Pulau Bidung Laut — Directions; National Heritage Zone 29/18
105 Malaysia -- Pulau Redang — Marine park 29/18
159 Vietnam -- South coast -- Can Tho — Depths 49/18
161 Vietnam – Song Sai Gon -- Cua Soirap — Depths 29/18
166 Vietnam -- Song Cai Mep — Berth; depth 29/18
186 Vietnam – Quy--Nhon — Depths 29/18
207 Vietnam – Haiphong — Depth 29/18
207 Vietnam -- Haiphong -- Luong Hai Phong — Vertical clearance 37/18
207 Vietnam -- Haiphong — Vertical clearance 31/18
210 Vietnam -- Haiphong -- Luong Hai Phong — Anchorages 34/18
210 Vietnam -- Outer Approaches to Haiphong -- Cat Hai — Directions; development 37/18
212 Vietnam -- Gulf of Tonkin -- Approaches to Quang Ninh — Directions; wreck 38/18
213 Vietnam -- Gulf of Tonkin -- Quang Ninh — Depth 34/18
213 Vietnam – Quang Ninh Port — Berths 47/18
216 Vietnam -- Gulf of Tonkin -- Archipel des Fai Tsi Long — Directions; light 49/18
218 Vietnam -- Gulf of Tonkin -- Archipel des Fai Tsi Long — Directions; light 49/18
219 China -- Gulf of Tonkin -- Fangcheng Gang — Anchorages; wreck 29/18
229 China – Gulf of Tonkin – Tieshan Gang — Anchorage 35/18
235 China -- Hainan Dao -- Macun Gang — Pilotage 45/18
241 China -- Yulin Jiao -- Basuo Gang and approaches — Directions; wreck 29/18
246 China -- South coast -- Yangpu to Lingao Ji`o — Directions; wreck 29/18
248 China -- Gulf of Tonkin -- Hainan Dao -- Sanya Wan — Anchorage 41/18
248--249 China – Hainan Dao – Sanya — Directions; lights 29/18
249 China -- Hainan Dao -- Lingshui Jiao — Directions; platform 42/18
266 China -- Huangmao Hai -- T’an Chiang -- Yamen Daqiao Bridge — Vertical clearance; 41/18
anchorages
275 China – Jiuzhou Gang — Controlling depths; vertical clearance; horizontal clearance 35/18
284 China -- Approaches to Hong Kong — Directions; Traffic Separation Scheme 44/18
285--286 China -- Approaches to Hong Kong — Directions; Traffic Separation Scheme 44/18
292 China – Hong Kong – East Lamma Channel — Traffic regulations 29/18
31 China Sea 2 13th Edition (2018) 07/18
81 South China Sea -- Scarborough Reef — Caution 20/18
97 Malaysia -- Sarawak -- Kuala Santubong — Directions; wreck; light 28/18
105 Malaysia -- Sarawak -- Kuala Rajang — Buoy 28/18
106 Malaysia -- Sarawak -- Kuala Rajang — Directions; wreck; buoy 28/18
106 Malaysia -- Sarawak -- Batang Rajang — Directions; depths 52/18
118 Malaysia -- Sarawak -- Kuala Similajau to Tanjung Similajau — Development; tidal 10/18
streams; port
156 Philippines – Palawan – North--west coast – Malampaya Gas Field — Pilotage 48/18
186 Philippines – Luzon – Manila — Directions; buoyage 07/18
192 Philippines -- Luzon -- Subic Bay — Speed limit 22/18
4.27 Wk01/19
IV

Edition
193 Philippines -- Luzon -- West coast -- Subic Bay — Traffic Separation Scheme 31/18
194--195 Philippines -- Luzon -- West coast -- Port Olongapo — Directions; buoyage 31/18
195 Philippines -- Luzon -- Subic Bay — Speed limit 22/18
206 Philippines -- Luzon -- West coast -- San Fernando — Nature reserve 40/18
32A China Sea 3 1st Edition (2018) 01/18
63 China -- Taiwan Strait -- North--west of Taiwan Banks — Directions; wreck 18/18
63 Taiwan Strait -- Dongxiang Dao — Directions; obstruction; depth 11/18
66 Taiwan -- Kao--Hsiung — Controlling depths 08/18
68 Taiwan -- Kao--Hsiung — Harbour development 01/18
70 Taiwan -- West Coast -- Kao--Hsiung -- Second Entrance — Directions; light 34/18
75 Taiwan -- West coast -- An--p’ing Kang — Berths 01/18
82 Taiwan -- West coast -- T’ai--Chung Kang — Outer anchorages; foul ground; depths 25/18
83 Taiwan – T’ai--chung — Pilotage 01/18
91 Taiwan -- Approaches to T’aipei — Obstructions 41/18
127 China -- South coast -- Yuedong LNG Terminal — Pilotage; directions 26/18
128 China -- South--east coast -- Guang’ao Wan — Development 05/18
129 China -- South--east coast -- Guang’ao Wan — Directions 05/18
130 China -- Shantou -- East--north--east of Biao Jiao — Pilot boarding position 11/18
130 China – Shantou Gang — Arrival information; pilotage 49/18
133 China -- Taiwan Strait -- Xiongdi Yu — Directions; wreck 34/18
143 China -- Approaches to Xiamen Gang -- Qingyu Shuidao — Directions; depth 21/18
151 China -- Taiwan Strait -- Jinmen Dao -- Jinmen Gang — Bridge 18/18
154 China -- South east coast -- Quanzhou Wan — Restricted area 09/18
156 China -- South--east coast -- Quanzhou Gang — Directions; buoyage 09/18
156 China -- East coast – Quanzhou Wan — Directions; shoal 01/18
156--157 China -- South--east coast -- Quanzhou Gang — Directions; buoyage 09/18
157 China -- South east coast -- Quanzhou Wan — Anchorages 09/18
158 China -- Meizhou Wan — Limiting conditions; Controlling depths 43/18
158 China -- Meizhou Wan — Arrival information; Outer anchorages 43/18
159 China -- Meizhou Wan — Arrival information; Traffic regulations 43/18
162 China -- Taiwan Strait -- Xinghua Wan Approaches — Wind Farm 15/18
163 China -- Taiwan Strait -- Xinghua Wan Approaches — Directions; Wind Farm 15/18
163 China -- Taiwan Strait -- Shitang Yang to Dala Jiao — Directions; inshore route 10/18
165 China -- Taiwan Strait -- Xinghua Wan Approaches — Directions; Wind Farm 15/18
168 China -- Niushan Dao to Dongquan Dao — Directions; offshore route 06/18
168 China -- Dala Jiao to Dongquan Dao — Directions; alternative routes 10/18
175 China -- Donquan Dao to Dongyin Dao — Directions 06/18
176 China -- Donquan Dao to Dongyin Dao — Directions; offshore route 06/18
176 China -- East China Sea -- Dongyin Dao — Directions; route 05/18
176 China -- Donquan Dao to Dongyin Dao — Directions; offshore route 06/18
176 China -- Dongquan Dao to Kuishan Dao — Directions; alternative routes 10/18
179 China -- East China Sea -- Sansha Wan — Vessel Traffic Service 34/18
181 China -- East China Sea -- Luoyuan Wan — Outer anchorages; pilotage 22/18
181 China -- East China Sea -- Luoyuan Wan — Anchorage 22/18
181 China -- East China Sea -- Luoyuan Wan -- Gang Yu — Anchorages 25/18
184 China -- East coast – Sacheng Gang — Directions; light 01/18
184 China -- Dongyin Dao — Directions; offshore route 06/18
184 China -- Kuishan Dao to Qixing Dao — Directions; alternative routes 10/18
Wk01/19 4.28
IV

Edition
186 China -- East coast – Sacheng Gang — Directions; light 01/18
192 China -- Approaches to Wenzhou Wan — Directions; buoyed channel 41/18
200 China -- Wenzhou Wan to Sheshan Dao — Directions; wreck 16/18
201 China -- Wenzhou Wan to Sheshan Dao -- Inshore route — Directions; rock 31/18
203 China -- East coast -- Xuanmen Wan — Wreck 01/18
217 China – Zhoushan Qundao -- North of Hai Jiao — Directions; wrecks 21/18
223 China -- East coast -- Southern approaches to Zhoushan and Ningbo — Outer 35/18
anchorages
227 China -- Zhoushan Qundao -- Shuangyu Men -- Liuheng Dao NW side — Directions; 08/18
wreck
227 China -- East coast -- Zhitou Yang -- Fodu Shuidao — Directions; buoy 33/18
229 China -- Ningbo Gang — Restricted area 10/18
230 China -- Xima’anshan Dao to Yuxingnao Dao — Directions; wreck 29/18
233 China -- East coast -- Daxie Dao -- Chuanshangang Xikou — Vertical clearances 39/18
233 China -- East coast -- Ningbo — Anchorages 01/18
237 China -- East Coast -- Ningbo -- Chuanshan Gangqu — Alongside berths 27/18
238 China -- East coast -- Damao Dao to Waizhi Dao — Overhead power cable; vertical 39/18
clearance
241 China -- East coast -- Zhoushan Dao — Directions; depth 47/18
246 China – East China Sea – Zhoushan Qundao — Side channels 01/18
246 China – East China Sea – Zhoushan Qundao — Anchorages 01/18
253 China -- Yangshan — Container terminal 06/18
254 China -- Yangshan — Container terminal; alongside berths 06/18
256 China -- Xima’anshan Dao to Caojing LANBY — Directions; wreck 29/18
258 China -- Hangzhou Wan -- Jinshan — Anchorage; depth 01/18
258 China -- Hangzhou Wan -- Jinshan — Anchorages 01/18
259 China -- Hangzhou Wan -- Hangzhou Bay Bridge — Restricted area 01/18
259 China -- Hangzhou Wan -- Zhapu — Anchorages 01/18
259 China -- Hangzhou Wan -- Dushan Gangqu — Directions; fairway 01/18
260 China – Hangzhou Wan – Zhapu — Outer anchorages 01/18
260 China -- Hangzhou Wan -- Zhapu — Depth 01/18
268 China -- Shanghai -- Changjiang Kou — Obstruction 20/18
272 China -- Outer approaches to Shanghai -- Nancao Shuidao — Directions; wreck 33/18
272 China -- Outer approaches to Shanghai -- Nancao Shuidao — Directions; obstruction 09/18
272 China -- Shanghai -- Nanzhi Hangdao — Directions; obstruction 16/18
272 China -- Shanghai -- Nangang Shuidao — Directions; wreck 14/18
273 China -- Approaches to Shanghai -- Beicao Shuidao — Anchorages 31/18
273 China -- Approaches to Shanghai -- Beicao Shuidao — Anchorages 39/18
273 China -- Shanghai — Anchorage; obstruction 01/18
273 China -- Chang Jiang -- Inner approaches to Shanghai — Anchorages 35/18
273 China -- Chang Jiang -- Inner approaches to Shanghai — Anchorages 51/18
273 China -- Approaches to Shanghai -- Xinqiao Shuidao — Anchorages 31/18
273 China -- Shanghai -- Chuansha — Obstruction 22/18
273 China -- Approaches to Shanghai -- Chuansha — Anchorages 31/18
278 China -- Shanghai -- South--south--west of Nan Pu Bridge — Directions; wreck 45/18
32B China Sea 4 1st Edition (2018) 01/18
54 China -- Yellow Sea -- Dafeng Gang — Light 08/18
55 China -- Yellow Sea -- Dafeng Gang — Light 08/18
56 China -- North--east coast -- Dafeng Gang — Directions 05/18
4.29 Wk01/19
IV

Edition
56 China -- Yellow Sea -- Dafeng Gang — Obstruction 01/18
57 China -- North--east coast -- Lianyungang — Anchorage 05/18
57 China -- Northeast coast -- Lianyungang — Anchorage; wreck 22/18
57 China – Lianyungang — Pilotage 21/18
57 China – Lianyungang — Pilotage 39/18
60 China -- Yellow Sea -- Lianyungang -- Laogangqu Hangdao — Directions; leading 27/18
beacons
61 China -- Yellow Sea -- Qingdao Gang — Prohibited area 42/18
62 China -- Yellow Sea -- Qingdao — Directions; wreck 43/18
63 China -- Yellow Sea -- Lanshan — Pilotage 01/18
65 China -- Yellow Sea -- Rizhao Gang — Pilotage 01/18
65 China -- Yellow Sea -- Rizhao Gang — Directions; Berths 40/18
65 China -- Yellow Sea -- Rizhao Gang — Berths; depths 01/18
65 China -- Yellow Sea -- Rizhao Gang — Directions; Berths 40/18
66 China -- Yellow Sea -- Dongjiakou — Pilotage 01/18
66 China -- Yellow Sea -- Dongjiakou — Berths; depths 01/18
66 China – Yellow Sea – Dongjiakou — Berths 01/18
71 China -- Qingdao Gang -- Huangdao Qianwan — Directions; light buoy 41/18
76 China -- Yellow Sea -- Haiyang Gangqu — Pilotage 01/18
96 China -- Yantai Gang -- Zhifu Wan — Pilotage 01/18
97 China -- Bohai Haixa -- Yantai — Directions; buoyage; basins 18/18
97 China -- Yantai — Leading lights 10/18
99 China -- Yantai Gang Xigangqu — Pilotage 01/18
105 China -- Yellow Sea -- Approaches to Dalian Gang — Outer anchorages; wreck 19/18
113 China -- Changshan Qundao -- Dahama Jiao — Directions; depths 05/18
122 China -- Bohai Wan — Directions; racon 20/18
123 China -- Bo Hai -- Bohai Wan Oilfield — Directions; wrecks; obstructions 51/18
125 China -- Laizhou Wan -- Longkou -- Shengli Matou — Depth 01/18
126 China -- Bo Hai -- Longkou — Directions; obstruction 01/18
129 China -- Bo Hai -- Laizhou Wan — Directions; platform 08/18
129 China – Bo Hai — Directions; platform; wreck 01/18
129 China -- Bo Hai -- Laizhou Wan — Port 01/18
129 China -- Bo Hai -- Laizhou Wan — Anchorage 49/18
130 China -- Bohai Wan -- Dongying Gang — Pilotage positions 01/18
130 China -- Bo Hai -- Dongying Gang -- South Basin — Directions; buoys 41/18
130 China -- Bo Hai -- Dongying Gang — Directions; channels 46/18
130 China -- Bohai Wan -- Dagang Gangqu — Berths; depths 22/18
130 China -- Bohai Wan -- Dagang Gangqu — Depth; bouyage 30/18
131 China -- Huanghua Gang — Anchorage; obstruction 10/18
138 China -- Bohai Wan — Directions; SPM 20/18
138 China -- Caofeidian to Jingtang — Directions; wreck 29/18
138 China -- Bo Hai -- Approaches to Jingtang — Directions; wreck 05/18
139 China -- Bo Hai -- Caofeidian — Anchorages; obstruction 01/18
139 China -- Bo Hai -- Caofeidian — Wrecks 20/18
142 China -- Bo Hai -- Jintang approaches — Direction; wreck 23/18
144 China -- Qinhuangdao Gang — Limiting conditions; depths 19/18
144 China -- Bo Hai -- Qinhuangdao — Channel depths 34/18
Wk01/19 4.30
IV

Edition
144 China -- Bo Hai -- Qinhuangdao — Outer anchorages 01/18
145 China -- Approaches to Qinhuangdao Gang — Directions 19/18
146 China -- Qinhuangdao — Leading light 19/18
148 China -- Liaodong Wan -- Daolong Zui — Directions; wreck 01/18
149 China – Bo Hai – Shanhaiguan — Depth 01/18
150 China -- Liaodong Wan -- Huludao Gang — Pilotage 01/18
152 China -- Bo Hai -- Liaodong Wan -- Baisha Wan — Restricted area 35/18
153 China -- Liaodong Wan -- Changxing Dao — Directions; obstructions 43/18
156 China -- Bo Hai -- Liaodong Wan — Directions; wreck 19/18
157 China -- Bo Hai -- Jinzhou Gang — Berths; depths 01/18
157 China -- Bo Hai -- Liaodong Wan -- Bayuquan — Controlling depth 35/18
157 China -- Yingkou Gang -- Bayuquan — Outer anchorages; obstructions 18/18
158 China -- Liaodong Wan -- West--north--west of Taiping Jiao — Directions; wreck 19/18
161 China -- Liaodong Wan -- Yingkou Gangqu — Pilotage 10/18
165 Korea -- West coast -- Jikdo Island — Restricted area 01/18
166 South Korea -- Maemul Sudo -- Maemulto — Depths 51/18
174 South Korea – Toch’o Sudo — Bridge 01/18
175 Korea -- West coast -- Maro Hae — Directions; fisheries 50/18
183 South Korea -- Myändo Sudo — Directions; obstructions; wreck 01/18
184 South Korea -- Mokpo -- Vertical clearances 01/18
184 South Korea -- Mokpo — Anchorages 01/18
186 South Korea -- Mokpo — Directions; anchorage; shoal 01/18
190 South Korea – Inshore approach to Gunsan — Restricted area 46/18
199 South Korea – Boryeong — Directions; lights 13/18
211 South Korea -- West coast -- Pyeongtaek Hang — Anchorage 33/18
216 South Korea -- Incheon Hang — Directions; light 04/18
217 South Korea -- Incheon Hang — Directions; light 04/18
218 South Korea -- Incheon Hang — Obstructions 01/18
33 Philippine Islands 6th Edition (2017) 49/17
2 Philippines -- Sulu Archipelago — Regulations 02/18
61 Philippines — Regulations 19/18
63 Philippines -- Sulu Sea -- Pangutaran Group Bank — Directions; route 19/18
63 Philippines -- Mindanao -- Teinga Island — Directions; RTC 19/18
64 Philippines -- Sulu Sea -- Tubbataha Reef — Regulations 04/18
141 Philippines -- Sulu Archipelago — Regulations 02/18
143 Philippines -- Sulu Archipelago — Directions 02/18
153 Philippines -- Sulu Archipelago— Directions 02/18
169 Philippines -- Mindanao — Regulations 02/18
170 Philippines -- Mindanao — Directions 02/18
199 Philippines -- Mindanao -- Pakiputan Strait — Directions; shoal 18/18
268 Philippines -- Luzon -- Tayabas Bay -- Castañas — Anchorages and harbours; berths 33/18
284 Luzon -- San Bernardino Strait -- Santa Magdalena — Directions; light 52/17
4.31 Wk01/19
IV

Edition
290 Luzon -- San Bernardino Strait -- San Bernardino Island — Directions; light 52/17
321 Philippines -- Mindanao — Regulations 02/18
332 Philippines -- Negros -- Tañon Strait west side -- San Carlos City — Pipeline 36/18
375 Philippines -- Mindanao -- Butuan Bay -- Nasipit Harbour — Pilotage 27/18
379 Luzon -- Luzon Plateau -- Benham Bank — Marine Protected Area 26/18
34 Indonesia 2 8th Edition (2017) 12/17
3 Malaysia -- Celebes and Sulu Seas — Regulations 40/17
93 Indonesia -- Jawa -- North coast -- Tuban — Trans--Pacific Indotama Port Terminal 24/18
94, 95, 96, 96--97 Jawa North Coast -- Selat Surabaya and approaches — Port information 16/17
97 Indonesia -- Selat Madura — Production platform 52/17
100 Indonesia – Jawa – Tanjungperak — Wreck 14/17
102 Indonesia -- Selat Madura — Prohibited anchorage 52/17
103 Indonesia -- Selat Madura — Traffic regulations; restricted and prohibited areas 52/17
107 Indonesia -- Madura south--east coast -- Kailanget — Directions; wrecks 39/18
108 Indonesia -- Madura south--east coast -- Kailanget — Directions; wrecks 39/18
114 Indonesia -- Bali -- Bukitbadung — Directions; light 11/18
119 Indonesia -- Bali -- Celukanbawang — Directions; light 18/18
119 Indonesia -- Bali -- Celukanbawang — Berth 18/18
125 Indonesia -- Bali -- Pelabuhan Benoa — Directions; buoyage 47/18
126 Indonesia -- Bali -- Pelabuhan Benoa — Directions; buoyage 47/18
161 Indonesia -- Selat Linta -- Labuan Bajo — Directions; reefs; buoyage 25/17
177 Flores Island -- Teluk Aimere — Directions; light 30/17
180 Flores Island -- Teluk Aimere — Light 30/17
202 Selat Boling -- Teluk Leba--Leba — Directions; light 30/17
237 Indonesia -- Kalimantan -- Selat Laut -- Tarjun — Depth 33/18
238 Indonesia -- Kalimantan -- Pulau Laut — Directions; rock 16/18
242 Indonesia -- Kalimantan -- Selat Makassar — Directions; restricted area 36/18
245 Borneo -- Kalimantan -- Balikpapan — Directions; light 22/18
246 Indonesia -- Kalimantan – Balikpapan — Anchorages; pilotage 32/18
247 Indonesia -- Kalimantan – Balikpapan — Anchorages 32/18
247 Indonesia -- Kalimantan – Balikpapan — Offshore supply base 32/18
247 Indonesia -- Kalimantan – Balikpapan — Container terminal 32/18
247 Indonesia -- Kalimantan – Balikpapan — Terminal 32/18
249 Indonesia -- Borneo -- Kalimantan -- Muara Pegah — Directions; leading lights 19/17
267 Indonesia -- South--west coast of South Sulawesi -- Teluk Liakang — Directions; 10/18
major light
274 Indonesia – Sulawesi – Makassar — Directions; LPG terminal; wrecks; anchorage; 14/17
depths
275 Sulawesi -- Makassar — Outer anchorages 30/17
275 South Sulawesi -- South--west coast -- Makassar — Wreck 25/18
276 Indonesia – Sulawesi – Makassar — Directions; LPG terminal; wrecks; anchorage; 14/17
depths
290 Malaysia -- Celebes Sea — Directions; Regulations; routes 40/17
291 Indonesia -- Celebes Sea — Offshore routes 40/17
338 Indonesia -- Sulawesi -- Pulau Buton -- Baubau Oil Terminal — Pilotage; anchorage 30/18
Wk01/19 4.32
IV

Edition
339 Indonesia -- Sulawesi -- Pulau Buton -- Baubau Oil Terminal — UKC; berths; port 30/18
services
360 Indonesia -- Sulawesi -- Selat Peleng — Route 35/17
360--361 Indonesia -- Sulawesi -- Selat Peleng — Directions; track 35/17
389 Indonesia -- Sulawesi -- Pulau Lembeh — Lights 45/17
391 Indonesia -- Sulawesi -- Selat Lembeh — Pilotage 45/17
391 Indonesia -- Sulawesi -- Selat Lembeh — Depths 45/17
391 Indonesia -- Sulawesi -- Selat Lembeh -- Bitung — Pilotage 45/17
391 Indonesia -- Sulawesi -- Palau Lembeh — Lights 45/17
392 Indonesia -- Sulawesi -- Selat Lembeh — Directions; caution 45/17
393 Indonesia -- Sulawesi -- Bitung -- Selat Lembeh — Outer anchorage 45/17
393 Sulawesi -- Bitung -- Selat Lembeh — Anchorages 49/17
393 Indonesia -- Sulawesi -- Bitung -- Selat Lembeh — Anchorage 45/17
393 Indonesia -- Sulawesi -- Bitung -- Selat Lembeh — Anchorages 45/17
127 Indonesia -- Banda Sea -- Pulau--Pulau Tanimbar -- Selat Egron — Directions; wreck 33/18
128 Indonesia -- Banda Sea -- Pulau--Pulau Tanimbar -- Saumlaki approaches — 33/18
Directions; wreck
316 Indonesia -- Halmahera -- Tobelo — Directions for entering harbour; light beacon 02/18
53 Jawa -- Selat Sunda -- Pulau Sangiang — Restricted area 06/18
53 Indonesia -- Jawa -- Selat Sunda — Restricted area; nature reserves 28/18
56 Jawa -- Selat Sunda -- Pulau Sangiang — Anchorage 06/18
57 Indonesia -- Jawa -- Pulau Panaitan — Anchorages 28/18
58 Jawa -- Cigading -- Anyer Terminal — Pilot boarding positions 47/17
63 Jawa -- Selat Sunda -- Suralaya — Anchorage; wreck 47/17
64--65 Jawa -- Selat Sunda -- Pulau Sangiang — Restricted area 06/18
87 Jawa -- North Coast -- Guna Nusa — Wrecks 16/18
89 Jawa North Coast – Tanjungpriok approaches — Directions; wreck; light beacons 26/17
91 Indonesia -- North coast of Jawa -- Pelabuhan Tanjungpriok — Limiting conditions 19/18
92 Jawa – Pelabuhan Tanjungpriok — Arrival information; outer anchorages 24/17
91--92 Jawa -- Pelabuhan Tanjungpriok — Anchorages 38/17
91--92 Indonesia -- North coast of Jawa -- Pelabuhan Tanjungpriok — Arrival information 19/18
98 Jawa -- North Coast -- Pulau--pulau Karimunjawa — Restricted areas; historic wrecks 29/18
98 Jawa -- North Coast -- Karang Rakit Utara to Karang Kapal — Directions; wrecks 29/18
99 Jawa -- North Coast -- Pulau Mandalika to Pulau Bawean — Directions; platforms; 29/18
wrecks
99 Jawa -- North Coast -- Pulau--pulau Karimunjawa — Restricted areas; historic wrecks 29/18
104 Indonesia -- Jawa North Coast -- Cirebon — Depths 20/18
105 Indonesia -- Jawa North Coast -- Cirebon — Wreck 20/18
118 Sumatera -- Selat Bangka -- Karang Haji — Directions; storage tanker 23/18
119 Sumatera -- Selat Bangka -- Karang Haji — Offshore Terminal 23/18
122 Sumatera -- Palembang -- Sungaigerong — Wreck 43/17
133 Pulau Belitung -- Selat Baur -- Karang Selatan — Directions; Light buoy 48/17
133 Pulau Belitung -- Selat Baur -- Karang Balan — Directions; Light buoy 48/17
134 Indonesia -- Selat Gelasa -- Pulau Belitung -- Tanjungpandan — Directions; wrecks 26/18
135 Indonesia – Selat Gelasa -- Selat Leplia — Directions; dangers 02/18
4.33 Wk01/19
IV

Edition
138 Indonesia -- Selat Gelasa -- Pulau Bangka — Directions; wreck 26/18
146 Selat Karimata — Depths; light 37/17
149 Kalimantan -- Tangjung Puting to Tanjung Sambar — Directions; light 24/17
202 Indonesia -- Batam -- Selat Bulan -- Tanjung Uncang — Directions 50/17
202 Indonesia -- Pulau Batam -- Teluk Senimba — Anchorage 51/17
37 West Coasts of 20th Edition (2017) 26/17
England and Wales
8 United Kingdom — Distress and rescue; coastguard stations 29/17
94 Wales – Swansea Bay — Directions; buoy 27/17
97 Wales -- Port of Neath — Depths 24/18
98 Wales -- Port of Neath — Training wall 51/18
103 Wales -- Porthcawl -- Tusker Rock — Directions; obstruction 24/18
116 Wales -- Cardiff -- Lavernock Point — Directions; obstructions 24/18
126 England -- Bristol Channel -- Bridgwater Bay — Light buoy 29/18
126 England -- Bristol Channel -- Bridgwater Bay — Directions; light buoy; shoal 29/18
126 England -- Bridgwater Bay -- Burnham--on--Sea — Leading lights 48/17
140 England -- River Severn -- Chepstow — Vessels handled 28/17
142 England -- River Severn -- Sharpness Dock — Pilotage 28/17
154 Wales -- Milford Haven — Depths 28/18
164 Wales -- Milford Haven -- Milford Docks — Depth 22/18
206 Wales – Menai Strait to South Stack — General information; traffic regulations 25/18
207 Wales – Menai Strait to South Stack — Directions 25/18
231 England -- Liverpool Bay — Wind farm 30/17
236 England -- River Dee -- Hilbre Island — Directions; wreck 23/18
237 River Dee -- Mostyn Channel — Directions; light; channels 19/18
237 Wales -- Mostyn Docks — Directions; directional light 19/18
237 Wales -- Mostyn Docks — Directions; buoys; light sector 23/18
239 England -- Liverpool Bay — Wind farm extension 30/17
244 England -- Liverpool — Berths 28/17
248 England -- Liverpool Bay — Directions; wind farm extension 30/17
272--273 England – Port of Lancaster – Glasson Dock — Times 16/17
300 Scotland -- Kirkcudbright Bay — Outer anchorages 40/17
38 West Coast of India 18th Edition (2016) 39/16
6 India -- Approaches to Mumbai — Traffic Separation Scheme 25/18
78 Maldives -- Addoo Atoll -- Kuda Kandu — Depths 13/18
80 Maldives -- Huvadhoo Atoll — Depths 13/18
125 Sri Lanka -- East Coast -- Sangamankanda Point — Directions; wreck 23/18
148 Sri Lanka -- Colombo Harbour and Approaches — Pilotage 16/17
149 Sri Lanka -- Colombo Harbour — Development 48/16
150 Sri Lanka – Colombo — Directions; light 17/17
155 India -- Gulf of Mannºr -- Pºmban Island -- Kundugºl Channel — Directions; beacons 26/18
156 India -- South coast -- Pºmban Pass — Directions; light 46/18
157 India -- West coast -- Cape Comorin — Directions; obstruction 31/18
158, 159 India – Tuticorin — Arrival information; anchorage; pilotage 07/17
176 India -- Port of Kochi -- Entrance Channel — Light alignment; buoy 07/18
179 India -- West--north--west of Kochi — Passage; wrecks 31/17
181 India -- Badagara — Directions; wreck 04/18
181 India -- Badagara — Anchorage; dangerous wreck 04/18
183 India -- Badagara — Directions; dangerous wreck 04/18
189 India -- West coast -- Mangalore — Directions; depth 01/18
Wk01/19 4.34
IV

Edition
188--189 India -- West coast -- Mangalore — Directions; wrecks 24/18
191 India -- West coast -- New Mangalore — Berths 14/18
193 India -- West coast -- Malpe — Anchorage 50/17
193 India -- West coast -- Malpe — Anchorage 31/18
197 India -- Honºvar -- Basavarajadurg Island — Directions; shoal 35/18
199 India -- Bhatkal to Karwar -- Karwar Naval Harbour — Directions; depths 50/16
215 India -- Vengurla -- Vengurla Roads — Anchorage 51/17
215 India -- Mºlvan Bay — Light sector 07/18
222 India – West coast -- JSW Jaigarth Port — Anchorages 21/17
222 India – West coast – JSW Jaigarh Port — Arrival information; pilotage 43/16
223 India -- Mirya Head to Mumbai (Bombay) -- Port Dºbhol — Pilotage 26/17
224 India -- Mirya Head to Mumbai (Bombay) -- Port Dºbhol — Anchorage 26/17
229, 230 India – Approaches to Mumbai — General information; depths; TSS 27/17
231 India – Approaches to Mumbai — Directions; approach 27/17
232 India – Mumbai Harbour — Arrival information; traffic regulations 27/17
234 India – Mumbai Harbour — Anchorages; general information; deep water anchorage; 27/17
emergency anchorage
235 India -- West Coast -- Mumbai (Bombay) Harbour -- Basins and berths — depths 19/18
237 India – Jawahar Lal Nehru Port — Anchorage 22/17
242 India -- Outer approach to Gulf of Khambºt -- Malacca Banks — Directions; TSS 27/18
256 India -- Gulf of Khambhºt — Shoal 51/17
257 India -- Gulf of Khambºt -- Dahej — Anchorage; berths; exclusion zone 27/18
267 India – Porbandar to Kachchigadh — Harbours 05/17
277 India – Gulf of Kachchh – Salºya Harbour — Pilotage 17/18
280 India -- West coast -- Mundra Port — Anchorages 31/18
281, 282 India -- Gulf of Kachchh -- Tekra — Directions; buoyage; anchorage 18/17
282 India -- West coast -- Kandla — Directions; wreck 47/18
283 India -- Gulf of Kachchh -- Pathfinder Inlet — Directions; wreck 38/17
283 India -- Gulf of Kachchh -- Pathfinder Inlet -- VºdØnºr Offshore Oil Terminal — Wreck 07/18
283 India -- Gulf of Kachchh -- Pathfinder Inlet — Directions; wreck 38/17
287 India -- Gulf of Kachchh -- Tekra — Directions; buoyage; anchorage 18/17
288, 289, 290 India -- Gulf of Kachchh -- Approaches to Kandla — Anchorage; Pilotage; Directions 18/17
291 India – Gulf of Kachchh – Hansthal Creek — Directions 22/17
292 India -- Gulf of Kachchh — Wreck 28/17
293 India -- Gulf of Kachchh — Wrecks 28/17
293 India -- Jakhºu -- Godia Creek — Directions; lidar platform 10/18
302 Pakistan -- Karachi harbour — Directions; light buoy 30/17
4.35 Wk01/19
IV

Edition
303 Pakistan -- Karachi Harbour — Depths 05/18
304 Pakistan -- Karachi harbour — Pilotage 30/17
304 Pakistan -- Karachi Harbour — Pilot boarding position; harbour layout 05/18
305 Pakistan -- Karachi harbour — Directions; light buoy 30/17
305 Pakistan -- Karachi Harbour -- Oyster Islands — Directions; leading lights; breakwater 05/18
306 Pakistan -- Karachi Harbour -- Oyster Islands — PDWCP 05/18
39 South Indian Ocean 15th Edition (2017) 14/17
6 France -- Indian Ocean -- Île Amsterdam and Île Saint--Paul — Nature reserves; 02/18
EEZs
87 Comores – Ndzuani – Mouillage d’Ouani — Leading beacons 25/17
87 Comores -- Ndzuani -- Mouillage d’Ouani — Berths; mooring buoys 48/17
95 Comores Archipelago – Mayotte – Port de Longoni — Port information 28/17
131 Madagascar -- Approaches to Mahajanga -- Banc du Cavalier — Depths 11/18
133 Madagascar -- Mahajanga -- Chenal du Nord--Ouest — Directions; depths; lights; 11/18
outfall
171 Madagascar -- Cap Andavaka — Directions; depth 11/18
214 Madagascar -- Port De La Nièvre -- Port de Commerce and Port Militaire — Berths 47/17
263 Île de La Réunion -- Saint--Pierre — Directions; leading lights 19/17
280 Rodriguez Island -- Port Mathurin -- Western Pass — Directions; light 50/17
281 Rodriguez Island -- Port Mathurin -- Inner entrance — Directions; light 50/17
289 British Indian Ocean Territory — General information; traffic regulations 26/17
301 France -- Indian Ocean -- Île Amsterdam and Île Saint--Paul — Nature reserves; 02/18
EEZs
40 Irish Coast 20th Edition (2016) 36/16
8 United Kingdom — Distress and rescue 30/17
9 United Kingdom — Distress and rescue; SAR in Northern Ireland 30/17
10 United Kingdom — Distress and rescue; SAR in Northern Ireland 30/17
70 Ireland -- South--west Coast -- Bantry Bay — Pilotage 29/18
71 Ireland -- Bantry Bay -- Bear Island — Light buoy 28/17
74 Ireland -- South Coast -- Bantry Bay Oil Terminal — Restricted area 47/16
76 Ireland -- South--west coast -- Bearhaven and Castletownbere Harbour — 37/18
Development
82 Ireland -- South--west Coast -- Sheep’s Head — Light sector 29/18
102--103 Ireland -- South Coast -- Glandore Harbour — Directions; light 46/16
117 Ireland -- Cork -- Cobh Road to abreast Ringaskiddy — Directions; leading line 41/18
135 Ireland -- South Coast -- Kilmokea Point — Berth; depth 46/16
136 Ireland – South coast – Dunmore East Harbour — Depths 36/18
171 Ireland – Dun Laoghaire Harbour — Berths 32/17
173 Dublin Bay -- Port of Dublin — Development 46/17
175 Dublin Bay -- Port of Dublin — Directions; buoyage 31/18
191 Ireland -- East Coast -- Dundalk Bay — Directions; leading marks; landfall mark 42/18
205 Northern Ireland -- East Coast -- Strangford Narrows — Underwater turbine 16/18
216 Northern Ireland -- East coast -- North Channel — Directions; wrecks 32/17
218, 220 Northern Island -- Burr Point to Belfast Lough -- East--south--east of Ballywater — 18/17
Directions; buoy
221, 224 Belfast Lough – Donaghadee Sound — Directions; buoy 14/17
226 Northern Ireland -- Belfast Lough -- Kilroot Salt Jetty — Buoyage 52/17
229 Northern Ireland -- East Coast -- Port of Belfast — Regulations 34/18
235 Northern Ireland – Port of Larne — Depth 33/17
235 Northern Ireland -- East coast -- Port of Larne — Controlling depth 33/18
275 Ireland -- West coast -- River Shannon -- Beal Point — Directions; depths 23/18
Wk01/19 4.36
IV

Edition
276 Ireland -- West Coast -- Kilcreduan Head to Scattery Roads -- Carrigaholt Road — 01/17
Anchorage; clearing marks
276 Ireland -- West Coast -- Kilrush — Depth 46/16
284 Ireland -- West Coast -- Foynes Harbour — Berths; depths 01/17
285, 288, 289, 290 Ireland -- west coast -- River Shannon — Directions; depths 08/17
315 Galway Bay -- Spiddle -- Laghtnagliboge Point — Directions; light buoy 52/17
393, 394 Ireland -- Sheep Haven -- Ards Bay — Light beacon; pier; tidal streams; directions; 43/16
building; leading lights; pilotage; berth; anchorage
421 Ireland -- River Bann -- Coleraine — Pilotage 09/18
423 Northern Ireland -- The Skerries — Directions; beacon 18/17
423 Northern Ireland – North Coast – Portrush – Skerries Sound — Directions; beacon 07/17
41 Japan 1 12th Edition (2018) 08/18
91 Japan -- North--west coast -- Hamada Ko — Vertical clearance 27/18
94 Japan -- Honshu -- Tako Hana — Directions; light 25/18
144 Japan -- Niigata — Arrival information; outer anchorages and pilotage 08/18
153 Japan -- Honshu -- Akita Funakawa Ko — Depth caution 52/18
155 Japan -- Honshu -- Akita Ku — Depth caution 52/18
180 Japan -- Honshu -- Kashima Ko — Vertical clearance 22/18
226 Japan -- Hokkaido -- Ishikariwan Ko — Directions; depths 21/18
42A Japan 2 6th Edition (2017) 36/17
62 Shikoku -- South coast -- South of Oki--no--Shima — Directions; superbuoy 20/18
63 Shikoku -- South coast -- South of Oki--no--Shima — Direction; superbuoy 20/18
67 Shikoku -- South Coast -- Tosa Wan — Directions; superbuoys 18/18
68 Shikoku -- South coast -- Tosa Wan and approaches — Directions; superbuoy 20/18
69 Shikoku -- South Coast -- Tosa Wan — Directions; superbuoy 18/18
69 Shikoku -- Susaki Ko -- Daibo Quay — Depth 49/17
109 Ise Wan -- Yokkaichi Ko — Bridge 09/18
150 Sagami Nada -- West and north--west of O Shima — Directions; recommended route 50/17
150 Sagami Nada -- West and north--west of O Shima — Directions; recommended route 17/18
152 Honshu -- South Coast -- Shimoda Ko — Directions; line of bearing 41/18
168 Honshu -- South coast -- Uraga Suido -- Kurihama Wan — Obstructions 52/18
168 Honshu -- South coast -- Uraga Suido -- Kurihama Wan — Obstructions; pilotage 52/18
170 Honshu -- South coast -- Approaches to Uraga Ko — Directions; clearing bearing; 52/18
light
213 South of Honshu -- Nanpo Shoto -- Nishi--no--Shima (Nishino Shima) — Shoal 07/18
42B Japan 3 11th Edition (2016) 10/16
68 Kanmon Ko -- Mutsurejima Ku — Anchorage; obstruction 42/17
88 Suo Nada – Main Route — Directions; racon 48/16
94 Suo Nada – Ube Ko to Tazuno Hana — Directions; racon 48/16
95 Suo Nada – Tazuno Hana to Tokuyama Wan — Directions; racon 48/16
99, 100 Suo Nada – Tokuyama--Kudamatsu — Directions; racon 48/16
103 Suo Nada – Tokuyama Wan to Iwai Shima — Directions; racon 48/16
111 Suo Nada – Nakatsu Ko — Directions; submerged jetty 42/16
115 Bungo Suido -- Seto Naikai — Pilotage 37/17
118 Bungo Suido – Mizunoko Shima — Directions; racon 52/16
118 Kyushu east coast -- Bungo Suido — Depth 46/17
120, 123, 124, 127 Bungo Suido – Mizunoko Shima — Directions; racon 52/16
132 Hozeku Wan to Yawatahama — General information 14/16
148 Iyo Nada – Sada Misaki to Tsurushima Suido — Directions; racon 48/16
152 Iyo Nada – Matsuyama Ko — Directions for entering harbour; racon 48/16
155, 157, 162, 172 Iyo Nada – North side — Directions; racon 48/16
4.37 Wk01/19
IV

Edition
247 Japanese Inland Sea – Channel separating Hoso Shima and In--no--Shima — 28/16
Vertical clearances
255, 257, 261, 264, 266, Hiuchi Nada and Bingo Nada — Directions; aids to navigation; racons 49/16
267, 268
273 Honshu -- Fukuyama Ko -- South Quay — Depths 48/17
273, 275 Hiuchi Nada and Bingo Nada — Directions; aids to navigation; racons 49/16
287, 295, 297, 300, 301, Bisan Seto — Directions; aids to navigation; racons 49/16
307, 325
323 Seto Naikai -- Bisan Seto -- Okayama Suido — Depths 45/18
325 Bisan Seto — Directions; aids to navigation; racons 49/16
330, 332, 333 Harima Nada — Directions; aids to navigation; racons 49/16
346 Honshu -- Himeji Ko -- Hirohata Passage — Depth 20/18
351 Honshu – Harima Nada – Himeji Ko to Higashi--Harima Ko — Directions; sea berth 46/16
368 Tokushima -- Komatsushima Ko -- Arrival information — pilotage 49/16
376 Shikoku -- Kii Suido -- Awazu Ko — Vertical clearance 15/18
398 Honshu -- Osaka Wan -- Kobe Ku — Foul ground 50/18
401 Osaka Wan -- Kobe Ku -- East Passage — Directions; buoyage 07/17
401 Osaka Wan -- Kobe Ku — Directions; light beacon 34/17
403 Osaka Wan -- Amagasaki--Nishinomiya--Ashiya Ku — Directions; buoyage 07/17
42C Japan 4 5th Edition (2015) 18/15
113 Okinawa -- Nakagusuku Shinko — Harbour; development 48/17
192 Kyushu – Kagoshima Ko — Anchorage and pilotage positions 24/15
199, 206, 209, 214 Kyushu -- South--West Coast -- East of Koshikijima Retto -- Koshiki Kaikyo -- Naka Se 10/17
— Other aids to navigation; racon
244 Kyushu -- Yatsushiro Kai -- Yatsushiro Ko — Berths 42/17
246 Yatsushiro Ko — Basins and berths 17/18
257, 259 Shimabara Wan -- Misumi Ko — Bridge; vertical clearance 19/17
288 Japan -- Approaches to Sasebo Ko -- Terashima Suido — Marine farms 21/18
43 South and East Coasts 11th Edition (2018) 02/18
of Korea, East Coast of
Siberia and Sea of
Okhotsk
94 South Korea -- Cheju Do -- Seogwipo Hang — Pilotage 12/18
94 South Korea -- Jejudo -- Seogwipo Hang — Arrival information; VTS 32/18
98 South Korea -- South coast -- Geomundo — Vertical clearance 49/18
104--105 South Korea -- Korea Strait -- Geomundo — Directions; buoy 51/18
111 South Korea – South Coast – Jangjingno — Bridge 02/18
115 South Korea -- South coast -- Geogeum Sudo — Directions; marine farm 34/18
116 South Korea -- South coast -- Geogeum Sudo — Directions; marine farm 34/18
118 South Korea -- South coast -- Naro Yeoldo — Vertical clearances 28/18
120 South Korea -- South Coast -- Yeoja Man — Vertical clearances 28/18
134 South Korea -- South coast -- Gwangyang Hang — Vertical clearance 20/18
135 South Korea -- South coast -- Gwangyang Hang — Directions; fish haven 51/18
136 South Korea -- South coast -- Gwangyang Hang — Berths; anchorage 51/18
140 South Korea – South coast – Samcheonpo Hang — Directions; leading lights 03/18
141 South Korea -- Gwangyang Hang -- Noryang Sudo — Vertical clearance 33/18
143 South Korea -- South coast -- Araetdaehoseom to Nam Man — Directions; wreck; 34/18
rock
143 South Korea -- South coast -- Approaches to Tongyeong Hang — Wreck 38/18
153 South Korea -- South coast -- Geojedo — Vertical clearance 47/18
159 South Korea -- Busan New Port -- Todo — Prohibited area 04/18
165 South Korea -- Jinhae Man -- Hwangdeokdo — Directions; light 05/18
Wk01/19 4.38
IV

Edition
173 South Korea -- Busan Hang — Light 21/18
184 South Korea -- Ulsan Hang — Port authority 22/18
185 South Korea -- Ulsan Hang — Development 22/18
187 South Korea -- Onsan Hang — Berths 22/18
187 South Korea -- Ulsan Hang -- Outer basin berths — Berth information 33/18
187--188 South Korea -- Ulsan Hang -- Inner basin — Alongside depths 33/18
190 South Korea -- East coast -- Mipo Hang — Wreck 47/18
193 South Korea -- Pohang Hang -- Yeongilman Hang — Development 33/18
216 North Korea -- Amyong Kkut -- North--east coast — Directions; major light 18/18
219 North Korea -- North--east Coast -- Baegandan — Directions; major light 18/18
225 North Korea -- North--east Coast -- Ogar Am — Directions; major light 18/18
226 North Korea -- North--east Coast -- Yujindan — Directions; major light 18/18
227 North Korea -- North--east Coast -- Yujindan — Directions; major light 18/18
233 North Korea -- North--east Coast -- Sajindan — Directions; major light 18/18
259 Russia -- Vladivostok -- Bukhta Diomid — Submerged dock; buoy 27/18
259 Russia -- Pacific Coast -- Vladivostock — Berths; obstruction 36/18
268 Russia -- Zaliv Nakhodka — Vessel Traffic Service; speed restrictions; fairways 43/18
271 Russia -- Approaches to Zaliv Nakhodka — Outer anchorages; buoy 43/18
273 Russia -- Pacific Coast -- Zaliv Nakhodka -- Koz’mino — Restricted area 44/18
304 Russia -- Gulf of Tartary -- Zaliv Chikhacheva — Arrival information 42/18
304 Russia -- Gulf of Tartary -- Zaliv Chikhacheva — Pilotage 42/18
328 Russia – Proliv Nevel’skogo — Traffic regulations 04/18
367 Russia -- Sea of Okhotsk -- Udskaya Guba -- Guba Lebyazh’ya — Anchorage; depths 30/18
410 Appendix II – Areas prohibited for anchoring and fishing — Amurskiy Liman 04/18
428 Russia -- Gulf of Tartary -- Zaliv Chikhacheva — Appendix II; STS anchorage 42/18
432--449 East coasts of Korea and Siberia and Sea of Okhotsk — Index 33/18
44 Malacca Strait and 13th Edition (2017) 42/17
West Coast of
Sumatera
74 Sumatera -- Pasir Selatan — Directions; light buoy 17/18
76 Indonesia -- East Coast of Sumatera -- Pulau Rupat — Wreck 42/17
77 Indonesia -- East Coast of Sumatera -- Pulau Rupat — Wreck 42/17
107 Indonesia -- Sumatera -- Pelabuhan Kualatanjung — Anchorages; pilot boarding 52/18
position
154 Malaysia -- Lumut — Anchorage 10/18
159 Malaysia -- Malacca Strait -- Pelabuhan Klang — Anchorage areas 37/18
161 Malaysia -- North approach to Pelabuhan Klang -- Angsa Bank — Obstruction; light 50/17
166 Malaysia -- Malacca Strait -- Tanjung Ru — Light 45/17
176 Malaysia -- Malacca Strait -- South of Tanjung Tohor — Directions; wreck 08/18
193 Singapore -- Singapore Strait -- Middle Channel — Directions 10/18
194 Singapore -- Singapore Strait -- Middle Channel — Directions; wreck 44/18
196 Malaysia -- Johor -- Pengerang Terminal — Directions; jetty; berths 01/18
196 Malaysia -- East Johor Strait -- Pengerang Terminal — Pilotage 40/18
196 Malaysia -- Johor -- Pengerang Terminal — Directions; jetty; berths 01/18
207 Singapore -- South--west of Pulau Pawai — Anchorage 09/18
207 Singapore -- South--west of Pulau Sudong — Anchorage 11/18
207 Singapore -- South--west of Pulau Sudong — Anchorages; depths 14/18
207 Singapore -- South--west of Pulau Sudong — Anchorages; height restriction 16/18
207 Singapore -- South--west of Pulau Sudong — Depths 26/18
213 Singapore -- Jurong Island -- Sinki Fairway — Pilot boarding position 14/18
223 Singapore -- Jurong Island -- Ayer Merbau Basin — Directions 12/18
4.39 Wk01/19
IV

Edition
229 Singapore -- The Sisters — Marine nature reserve 50/17
229 Singapore -- The Sisters — Directions; Marine nature reserve 50/17
235 Singapore -- Jurong Island -- Sakra Basin — Berths 48/17
235 Singapore -- Jurong Island -- Ayer Merbau Basin — Development 12/18
249 Malaysia -- Johor Strait -- Tanjung Pelepas — Pilotage 38/18
255 Singapore -- Johor Strait — Pilotage 40/18
257 Singapore -- Johor Strait — Directions; pilotage 40/18
345 Indonesia -- Sumatera -- Teluk Bayur — Directions; leading lights 50/17
346 Indonesia -- Sumatera -- Teluk Bayur — Berths 50/17
45 Mediterranean 1 16th Edition (2018) 14/18
112 Spain -- Approaches to Cartagena — Approach and entry 31/18
112--113 Spain -- Approaches to Cartagena — Regulations; buoyage 31/18
113 Spain -- Approaches to Cartagena — Directions; buoyage 31/18
165 Spain -- East coast -- Puerto de Blanes — Directions; buoy 23/18
192 Spain -- Isla de Ibiza -- Ibiza -- Isla Grossa — Pilotage 52/18
196 Spain -- South--west coast of Isla de Mallorca -- Freu de Cabrera — Buoy 22/18
224 Spain – Isla de Menorca – East coast — Anchorage 47/18
226 Spain – Isla de Menorca – East coast — Anchorage 47/18
227 Spain – Isla de Menorca – South coast — Anchorage 47/18
239 Morocco -- Al Hoceïma — Pilotage 46/18
239 Morocco -- Al Hoceïma — Directions; leading lights 50/18
264 Algeria -- Golfo d’Arzew to Cap Ténès -- Pointe Rouge — Directions; obstruction 15/18
265 Algeria -- Port de Ténès — Outer anchorage; direction; depths 43/18
287 Algeria – Skikda and Port Méthanier — Anchorages 15/18
287 Algeria -- Golfe de Stora -- Skikda ad Port Méthanier — Anchorages 34/18
288 Algeria -- Golfe de Stora -- Stora — Prohibited anchorage 34/18
291 Algeria -- Annaba — Outer anchorage; controlling depths 43/18
299 Tunisia -- Golfe de Tunis -- Djamour el Kébir — Prohibited area 28/18
312 Tunisia – Cap Bon to Cap Afrique – Sousse — Traffic regulations 35/18
326 Tunisia -- Gulf of Gabès — Directions; wreck 28/18
326 Tunisia -- Gulf of Gabès -- La Skhirra — Directions; light 32/18
406 Sicilia -- North coast -- Porto Di Milazzo — Prohibited area 34/18
408 Sicilia -- North coast -- Porto Di Milazzo — Directions; prohibited area 34/18
460 Italy – Porto di Augusta — Directions; wreck 17/18
491 Italy -- South--east coast -- Golfo di Taranto — Prohibited areas 45/18
492 Italy -- South--east coast -- Golfo di Taranto — Directions; prohibited area; 45/18
obstructions
495 Italy -- Golfo di Taranto -- Capo Spulico — Anchorage; caution 45/18
511 Italy -- Golfo di Taranto -- Gallipoli — Prohibited area 19/18
67 France -- South coast -- Gulf of Lions -- Golfe d’Aigues Mortes — Seaplane operating 49/18
area
71 France -- South coast -- Gulf of Lions -- Golfe de Fos — Seaplane operating area 49/18
119 France -- South coast -- Golfe Juan — Prohibited area; seaplane area 41/18
125 Monaco -- Port de Monaco — Protected area 46/18
127 Monaco -- Port de Monaco — Prohibited area 46/18
141 Italy – Gulf of Genoa -- Arenzano — Restricted area 41/18
148 Italy -- Genova — Regulations; speed limit 45/18
160 Italy – La Spezia — Outer anchorages; wrecks 41/18
187 France – Corse – North--west coast – Port de I’Île--Rousse — Pilotage 41/18
188 France – Corse – North--west coast – Port de Calvi — Pilotage 41/18
Wk01/19 4.40
IV

Edition
241 Italy – Portovecchio di Piombino — Berths; draught restrictions 41/18
241 Italy – Golfo di Follonica -- Torre del Sale — Restricted area 41/18
243 Italy – West Coast -- Promontorio Argentario — Prohibited area 41/18
244 Italy – Porto Santo Stefano — Basins and berths; depth 41/18
270 Italy -- Sardegna -- Capo Teulada — Prohibited area 45/18
270 Italy – Sardegna – South Coast -- Golfo di Teulada -- Porto Zafferano — Directions; 41/18
wreck
299 Italy -- Sardegna -- Golfo Spurlatta — Restricted area 45/18
300 Italy – Sardegna – North--west coast -- Isola Tavolara — Anchorage 41/18
345 Italy – Porto di Procida — Prohibited anchorage 41/18
378 Italy – West Coast -- Marina di Camerota — Anchorage 41/18
6 Greece — Regulations; Historic wrecks 28/18
77 Greece -- West coast -- Pelopónnisos -- Stenó Prótis — Directions; historic wreck 28/18
77 Greece -- West coast -- Pelopónnisos -- Marathópolis — Anchorage 28/18
78 Greece -- West coast -- Pelopónnisos -- Stenó Prótis — Anchorage 28/18
85 Greece -- Nísos Zákynthos -- Órmos Alykés — Wreck 21/18
86 Greece -- West Coast – Kólpos Argostolíou — Restricted area 47/18
108 Greece -- Préveza -- West--south--west of Fort Áktion — Directions; wreck 21/18
113 Greece -- Patraïkós Kólpos — Regulations; historic wrecks 28/18
115 Greece -- West coast -- Patraïkós Kólpos — Seaplane landing area 04/18
118 Greece -- West coast -- Pátrai Harbour — Seaplane operating areas 04/18
150 Albania -- Stenó Kérkyras -- Northern part — Directions; historic wrecks 37/18
263 Croatia -- Splitski Kanal — Anchorage 32/17
264 Croatia -- Split -- Kaðtelanski Zaljev — Prohibited anchorage; modification of area 10/18
264 Croatia -- Split -- Kaðtelanski Zaljev — Prohibited anchorage 40/17
264 Croatia -- Split -- Kaðtelanski Zaljev — Prohibited anchorage; modification of area 10/18
328 Croatia -- SedmovraÆe — Pilotage 26/18
419 Croatia -- Tihi Kanal — Pilotage 26/18
423 Croatia -- Faýanski Kanal — Pilotage 26/18
444 Slovenia -- Gulf of Trieste -- Koper — Anchorages 26/18
450 Italy -- Trieste -- Porto Industriale — Directions; light 14/18
461 Italy -- Otranto — Development 05/18
466 Italy -- Brindisi — Arrival information; regulations concerning entry 35/17
467 Italy -- Brindisi — Directions; light sector 35/17
470 Italy -- Monopoli — Depths; berths 49/17
476 Italy -- East of Bisceglia — Marine farm; restricted area 28/18
487--488 Italy -- Adriatic Sea -- Isola Pianosa — Prohibited areas 45/17
488 Italy -- Adriatic Sea -- Isole Tremiti — Restricted areas; overhead cables 45/17
489 Italy -- South east coast -- South east of Vasto — Restricted area; marine farm 35/18
492 Italy -- South east coast -- Approaches to Ortona — Prohibited entry; directions; 35/18
obstructions
494 Italy – Pescara — Anchorages; pilotage 45/18
498 Italy -- East Coast -- Pescara — Directions; obstruction 16/18
501 Italy -- East coast -- Approaches to Ancona and Falconara — Traffic regulations 41/18
510 Italy -- East Coast -- Falconara Marittima -- API Refinery Pier — Obstruction 32/17
513 Italy -- North Adriatic -- Rimini — Prohibited area 05/18
514 Italy -- East coast -- Approaches to Ravenna — Directions; wrecks 41/18
528 Italy -- Laguna Di Venezia — Vessel traffic service 22/18
533 Italy – Venezia — Depths 45/18
4.41 Wk01/19
IV

Edition
6 Greece -- National regulations — Historic wrecks 28/18
78 Greece -- Nísos Kríti-- Órmos Soúdas — Regulations; historic wrecks 28/18
143 Greece -- Nísos Salamína -- Peiraiás — Wreck 41/18
153 Greece – Stenó Nafstáthmou — Directions; wreck 34/17
213 Greece -- Kykládes Nísoi -- Ermoúpolis — Anchorage 37/17
226 Greece -- Aegean Sea -- Órmos Ágiou Nikoláou -- Órmos Livádi — Anchorage 27/18
227 Greece -- South Aegean -- Órmos Vourkári — Anchorage 21/18
232 Greece — Regulations; historic wrecks 28/18
299 Greece -- East coast -- Stenó Makrónisou — Regulations; historic wrecks 28/18
300 Greece -- East coast -- Stenó Makrónisou — Directions; wrecks 28/18
323 Greece -- East coast -- Vóreios Evvoïkós Kólpos -- Órmos Ágiou Georgíou — Historic 28/18
wreck
360 Greece -- Thermaïkós Kólpos -- Néa Moudaniá — Anchorage 11/18
362 Greece -- Kólpos Thessaloníkis -- Wreck 30/17
397 Turkey -- Çanakkale BoÔazÝ -- Kumkale Burnu — Restricted area 32/18
398 Turkey -- North Aegean -- Karayer AdalarÝ — Directions; major lights 42/17
398 Turkey -- Bozcaada — Directions; light sector 35/17
399 Turkey -- West coast -- Bozcaada — Directions; unexploded ammunition 29/18
408 Turkey -- West coast -- KuîadasÝ — Dolphins 30/18
433 Turkey -- Nemrut LimanÝ — Pilotage 45/17
434 Turkey -- Nemrut LimanÝ — Directions; pilotage 45/17
436 Turkey -- AliaÔa — Anchorages 45/17
436 Turkey -- North Aegean -- AliaÔa — Anchorages 40/18
437 Turkey -- North Aegean -- AliaÔa — Pilotage 42/18
447 Turkey -- Díavlos Lámna/Müsellim Geçidi -- Müsellim KayasÝ — Position 42/17
448 Turkey -- Díavlos Lámna/Müsellim Geçidi — Directions; shoals, depths 42/17
127 Egypt – Port Said — Prohibited anchorage area 23/18
127 Egypt – Port Said — Prohibited anchorage area 38/18
178 Turkey -- Mersin Körfezi — Prohibited area 35/18
183 Turkey -- South--east coast -- ™skenderun Körfezi — Outer anchorages 37/18
186 Turkey -- ™skenderun Körfezi -- ™sdemir — Berths; depths 32/18
187--188 Turkey -- ™skenderun Körfezi -- ™skenderun — Berths; depths 32/18
188 Turkey -- ™skenderun Körfezi -- ™skenderun — Berths; depths 32/18
229 Lebanon -- Sel’ Ata -- Ra’s Kubbº — Shoal 49/18
245 Israel – Ashdod — Pilotage 23/18
50 Newfoundland and 14th Edition (2016) 34/16
Labrador
130 Canada -- Newfoundland -- Placentia Bay — Depths 30/18
145 Canada -- Newfoundland -- South coast -- Placentia Bay -- North Harbour — Fish 35/18
haven
149 France -- Île Saint--Pierre and Miquelon — Directions; depth 47/18
149 Canada – Newfoundland -- Burin Peninsula — Directions; buoy 47/18
152 France -- Île Saint--Pierre and Miquelon – Port de Saint--Pierre — Speed limit 02/18
155 France -- Île Saint--Pierre and Miquelon — Directions; buoy 47/18
155 France -- Newfoundland -- Petite Miquelon — Directions; depth 40/18
156 France -- Île Saint--Pierre and Miquelon — Anchorage 47/18
Wk01/19 4.42
IV

Edition
156 France -- Newfoundland -- Anse de Miquelon — Anchorage 38/18
428 Canada -- Labrador -- East coast -- Lake Melville — Dumping ground 35/18
432 Canada -- Labrador -- East coast -- Goose Bay — Dumping ground 35/18
433 Canada -- Goose Bay Narrows — Directions; buoyage; depths; controlling depths 39/16
433 Canada -- Labrador -- Goose Bay Narrows to Terrington Basin — Directions; shoal 18/17
454 Canada -- Goose Bay Narrows -- Directions; buoyage; depths; controlling depths 39/16
51 New Zealand 19th Edition (2015) 51/15
5 Navigation and regulations – Radio facilities — Radio navigational warnings 27/17
72 North Island -- Cape Maria van Diemen — Directions; light sector 23/18
81 North Island -- West Coast -- Manukau Harbour — Regulations 32/18
82 North Island -- West Coast -- Manukau Harbour — Prohibited anchorage 32/18
82 North Island -- West Coast -- Manukau Harbour — Signal station 32/18
94 North Island – West coast – Port Taranaki — Pilotage 03/18
104 North Island -- Wanganui — Entry; light 39/16
139 South Island – Tory Channel — Pilotage 29/18
140 South Island – Tory Channel — Traffic regulations 29/18
142 South Island -- Queen Charlotte Sound -- Perano Shoal — Directions; buoy; 31/18
anchorage
177 South Island – West Cape to Windsor Point — Directions 39/16
210 North Island – North Cape to Karaui Point — Directions 51/15
211 North Island -- Parengarenga Harbour — Directions 05/17
212 North Island – North Cape to Karaui Point — Directions 51/15
217, 219 North Island – Bay of Islands — Pilotage, anchorages 51/15
230 North Island -- Whangarei Harbour — Anchorages 39/17
243 North Island -- East coast -- Mahurangi Harbour — Restricted area 41/18
245 Hauraki Gulf -- Auckland approaches — Traffic regulations; reporting 46/17
249 Auckland approaches -- Motuihe Channel — Directions 46/17
252 North Island -- Auckland — Wreck 51/16
263 Auckland approaches -- Tamkai Strait — Local knowledge 46/17
263 North Island -- Auckland Approaches -- Tamaki Strait — Directions; wreck 51/18
274, 276 North Island – East Coast – Tauranga approaches — Exclusion zones 25/16
282 North Island – East Coast – Tauranga — Anchorages 03/16
282 North Island -- Bay of Plenty -- Tauranga — Anchorages 47/18
285 North Island – Tauranga – Maunganui Roads and Stella Passage — Directions; 24/17
beacons
285 North Island – Tauranga – Town Reach — Directions; beacons 24/17
286 North Island – Tauranga – Town Reach — Directions; useful marks 24/17
286 North Island – Tauranga – Western Channel — Directions; buoyage 24/17
286 North Island – Tauranga – Otumoetai Channel — Directions; beacons 24/17
290 North Island – East Coast – Tauranga approaches — Exclusion zones 25/16
291 North Island – East Coast – Whakatane River — Description 06/16
298 North Island – East Coast – East Cape to Mahia Peninsula – Gisborne — 02/16
Anchorages
298 North Island – East coast – Gisborne — Anchorages 35/17
300 North Island – East coast – Gisborne — Directions; lights 30/16
303, 304 North Island – Hawke Bay — Directions; pilotage; anchorages 12/17
307 Napier – Breakwater Harbour — Directions; light 16/16
314 South Island -- East Coast – Cape Campbell to Conway Flat — General information; 22/17
depths
315 South Island -- Cook Strait -- Cape Campbell — Directions; rocks 34/18
317, 320 South Island – Lyttelton – Godley Head — Light 10/16
4.43 Wk01/19
IV

Edition
320 South Island – East Coast – Lyttelton Harbour — AIS 07/17
323 East coast of South Island – Banks Peninsula — General information; marine 52/16
reserves; marine mammal sanctuary
324 Akaroa Harbour — Arrival information 22/16
324 South Island -- East Coast -- Akaroa Harbour — Marine reserve 25/16
324 Akaroa Harbour — Arrival information 26/16
325 Akaroa Harbour — Berths; anchorages and moorings 22/16
326 South Island – East Coast – Canterbury Bight — Wreck 25/16
328 South Island -- East coast -- Timaru Harbour — Pilot boarding place 50/17
334 South Island – East coast – Otago Harbour — Arrival information; pilotage 30/16
337 South Island -- East coast -- Otago Harbour -- Port Chalmers — Wharf development 50/17
344 Kermadec Islands — Directions 16/16
344 Raoul Island -- Denham Bay — Directions; obstruction 30/17
344 Kermadec Islands — Directions 16/16
344 Kermadec Islands — Anchorages and landing places 16/16
347 Chatham Island -- Hanson Bay — Restricted area 30/18
349 Chatham Islands -- Port Waitangi — Directions; lights 38/18
350 Chatham Island -- Kaingaroa Harbour — Directions; anchorages; depth 30/18
350--351 Pitt Island -- Motutapu Point — Directions 30/18
353 Auckland Islands — General information; prohibited area 06/17
52 North Coast of 10th Edition (2018) 32/18
Scotland
4 United Kingdom -- North Sea — Statutory safety zones 32/18
267 Faroe Islands -- Tórshavn — Development 36/18
272 Faroe Islands -- SkálafjørÉur -- Runavík — Development 32/18
54 North Sea (West) 11th Edition (2018) 18/18
3 United Kingdom -- North Sea — Statutory safety zones 31/18
3 United Kingdom -- North Sea -- Marine exploitation — OREIs 25/18
61 Scotland -- South--east of Aberdeen — Offshore wind farm 25/18
65 Scotland – Montrose — Pilotage 45/18
85 Scotland -- Methil — Under--keel clearance; navigable width 23/18
89 Scotland -- Leith — Under--keel clearance; navigable width 23/18
90 Scotland -- Leith — Lock width 23/18
92 Scotland -- Burntisland — Under--keel clearance; navigable width 23/18
98 Scotland -- Firth of Forth -- Hound Point Marine Terminal — Under--keel clearance 23/18
100 Scotland -- Rosyth — Under--keel clearance 23/18
104 Scotland -- Grangemouth — Under--keel clearance 23/18
174 England -- River Humber -- Skitter Channel — Light float 49/18
182 England -- East Coast -- River Trent — Vertical clearance 48/18
205 England – East coast – Great Yarmouth approaches — Directions; obstruction 29/18
206 England – East coast – Great Yarmouth and Lowestoft approaches — Depth 29/18
206 England – East coast – Great Yarmouth and Lowestoft approaches — Directions 29/18
209 England – Great Yarmouth — Arrival information; pilotage 43/18
55 North Sea (East) 11th Edition (2018) 37/18
151 Germany -- The Jade — Regulations; extraordinarily large vessels 39/18
302 Denmark -- North Coast -- Hanstholm — Directions; light 47/18
56 Norway 1 17th Edition (2018) 39/18
77 Norway -- Approaches to Åna--Sira — Vertical clearance 45/18
189 Norway -- Oslofjorden -- Horten — Depth 42/18
190--191 Norway -- Oslofjorden -- Horten — Directions; underwater rocks 42/18
225 Norway -- Oslofjorden -- Løperen — Directions; light sector; positions 50/18
Wk01/19 4.44
IV

Edition
225 Norway -- Oslofjorden -- Løperen — Directions; leading lights 52/18
235 Norway -- Oslofjorden -- Svalerødkilen — Anchorage 39/18
57A Norway 2A 12th Edition (2016) 50/16
84 Norway -- Boknafjorden -- Kvitsøy — Directions; lights 26/18
87 Norway – West coast – Skudeneshavn — Anchorage 50/16
108 Gandsfjorden – Sandnes — Basins and berths; depths 26/17
133 Ryfylkefjordene – Finnøyfjorden – Bokn – Tjørnasund — Anchorage 09/17
144 Norway – West coast – Sandfjorden — Vertical clearance; bridge 50/16
154 Haugesund approaches – Karmsundet South part — Directions; light beacon 26/17
154 Haugesund approaches – Karmsundet South part — Directions; light beacon 26/17
155 Norway -- Karmøy -- Tømmervika — Anchorage 23/18
156 Førresfjorden -- Austdjupet -- Directions; light 28/18
222 Hardangerfjorden -- Sørfjorden -- Odda — Underwater rocks 42/18
235 Bømlo West Coast -- Melingsvågen — Directions; Leading Lights 17/18
275 Huftarøy -- Hundvåkosen — Directions; light 50/16
282 Stora Sotra -- Golta -- Goltastraumen — Vertical clearances 13/18
351, 353 Osterfjorden -- Mulsneset — Overhead cable 10/17
367 Fensfjorden -- Mongstad Oil Terminal — Berths; Depths 50/16
371 Norway -- Fensfjorden -- Rossnesvågen — Vertical clearance 52/17
386 Ånnelandssundet -- Sandøyna -- Grytenes — Light 47/17
389 Folefotsundet — Overhead cable 50/16
426 Norway -- Ytre Sula -- Kolgrov — Leading lights; alignment 07/18
433 Norway -- Ospa -- Drivøyosen — Directions; light 31/17
478 Florø -- Håskjerfora — Directions; lights 33/18
513 Fåfjorden and Våsfjorden — Directions; racons; leading lights 13/17
57B Norway 2B 10th Edition (2017) 45/17
9 Navigation and Regulations – Pilotage — Pilotage boarding places 02/18
81 Raudøyholmen -- Ørstafjorden — Directions; light 22/18
95 Norway -- Møre og Romsdal -- Holmefjorden — Sector light 50/18
97 Norway -- Møre og Romsdal -- Holmefjorden — Directions; sector light 50/18
104 Storfjorden -- Velteneset — Overhead power cables 22/18
116 Norway -- Åsefjorden -- Veddevika — Submarine pipeline 35/18
133 West coast -- Ellingsøya -- Taftasundet — Vertical clearance 41/18
152 Norway -- South of Molde -- Tresfjorden — Directions; light 35/18
158 Nogvafjorden -- Flemsøya — Directions; light sector 31/18
241 West coast -- Tustna -- Klakken — Directions; light sector 41/18
331 Halten and Kaura to Vikna – General information — Pilotage 02/18
360 Namsos – Arrival information — Pilotage 02/18
58A Norway 3A 8th Edition (2015) 20/15
73 Gjerdinga – Korsholmen — Light 38/16
91 Bindalsfjorden -- Fiskarosen and Skjelsviksjøen — Anchorages 01/16
96, 99 Melsteinen – Helgelandsflesa — Directions; racon 07/17
129 Ylvingsfjorden -- Rørøya — Anchorage 21/16
140 Mindværfjorden -- Trosundet — Directions; light 23/16
142 Vefsnfjorden -- Bjørga — Overhead cable 29/15
170 Dønna -- Sørøyvågen — Overhead cable 33/16
175 Tomma -- Alsøyvågen — Overhead cable 33/16
194 Ternholmfjorden -- Ternholmen -- Kalsholmen Light — Directions 09/16
201 Træna -- Husøyhamn — Anchorage 14/16
215 Nordfjorden -- Hellarvika — Overhead cable 34/15
4.45 Wk01/19
IV

Edition
219 North part of Kvarøyfjorden and Rødøfjorden to Skarsfjorden – Tjongsfjorden — 15/17
Anchorage
229 Meløyfjorden -- Jektvika — Directions; light; buoyage 27/16
231 Gåsværfjorden -- Gåsvær — Directions; light 48/15
232 Gåsværfjorden -- Gåsvær — Directions; buoy 27/16
234, 235, 238, 241, 242 Ternholmfjorden -- Ternholmen -- Kalsholmen Light — Directions 09/16
248 Støttvær -- Svenningen and Støtt — Light 34/15
249 Fugløyfjorden -- Røssøya — Light 37/15
249 Fugløyfjorden -- Haggeren — Light 34/15
249 Fleinsundet -- Stabben — Light 37/15
250 Fugløyfjorden -- Hestøya and Stongholmgrunnen — Light 37/15
250 Fugløyfjorden -- Hestøya and Stongholmgrunnen — Light 37/15
258 Saltfjorden east part -- Sennvika — Directions; light 48/15
272 Bodø and approaches -- Alternative south--west approach -- Hernesskagleia and 48/16
Røssøyleia — Directions; lights
279 Vågøyan -- Akseløya — Submarine pipeline 34/17
282 Karlsøytfjorden -- Helloya -- Helloyskjær — Directions; light sectors 32/17
297 Vestfjorden -- Grøtøya — Route; light 02/18
298 Måløy Skarholmen and Folda to Flatøya -- Main Inshore Route -- Sildeskjær to 10/17
Vestfjorden by way of Grøtøysundet and Breidsundet — Depths
298 Vestfjorden -- Heligholmen — Depths 02/18
298 Måløy Skarholmen and Folda to Flatøya -- Main Inshore Route -- Sildeskjær to 10/17
Vestfjorden by way of Grøtøysundet and Breidsundet — Directions; caution
298--299 Vestfjorden -- Grøtøysundet — Directions 02/18
299 Vestfjorden -- Grøtøysundet — Anchorage 10/17
299 Grøtøysundet – Nordskot — Anchorage 26/17
327 Tysfjorden -- Kjøpsviksundet — Vertical clearance 49/15
330 Tysfjorden -- Hellmofjorden -- Musken — Anchorage 07/16
331 Tysfjorden -- Grunnfjorden — Directions 39/15
331 Mannfjorden -- Verka — Overhead cable 34/15
331 Tysfjorden -- Hulløysundet -- Hamnvika — Anchorage 09/16
334 Efjorden -- Straumøya and Hellarneset — Overhead cable 34/15
335 Ofotfjorden -- Geiskevika — Anchorage 20/16
340, 341, 343, 344 Narvik -- Vidrek -- Herjangsfjorden — Anchorages 22/15
357 Sørlandsvågen – Røssnesvågen — Directions; leading lights 01/17
357 Værøy -- Sørlandsvågen -- Røssnesvågen — Directions; Leading Lights 48/17
368 Lofoten -- Sørvagen and Moskenes — Beacon 33/15
368 Lofoten -- Moskenesøya -- Sørvågen — Directions; leading line 48/15
368 Lofoten -- Sørvagen and Moskenes — Beacon 33/15
382 Vestfjorden -- Brandsholmsfallan — Directions; Light buoys 34/17
386 Lofoten -- Henningsvær — Directions; light 48/15
394 Lofoten -- Gimsøya -- Kristenskjæran — Buoy 29/18
398, 399 Lofoten -- Henningsvær — Directions; light 48/15
408 Skrova -- Skrova Havn — Overhead cable 27/16
414 North side of Vestfjorden -- Svolvær — Anchorage 01/16
417 Vestfjorden -- Austnesfjorden -- Sildpollen — Anchorage 10/17
419 Vestfjorden -- Raftsundet — Vertical clearance 07/16
420 North side of Vestfjorden -- South approach to Raftsundet — Directions; beacon 48/15
471 Vesterålen -- Langøysundet -- Rå — Anchorage 11/16
Wk01/19 4.46
IV

Edition
481 Vesterålen -- Malnesfjorden -- Hovden — Directions; leading lights 09/16
481 Vesterålen – Langøya – Hovden — Directions; light 44/16
487 Prestfjorden -- Andvæbåan and Brusfluan — Directions; lights 48/15
488 Prestfjorden -- Skjåneset — Directions; light 46/15
488 Prestfjorden -- Andvæbåan and Brusfluan — Directions; lights 48/15
58B Norway 3B 8th Edition (2018) 40/18
87 Grovfjorden -- Grov — Directions; light sector 43/18
91 Vågsfjorden -- Sagfjorden — Directions; light sector 48/18
361 Norway -- Tanafjorden -- Skardholmen — Directions; sector light 50/18
59 Nova Scotia and Bay of 15th Edition (2013) 04/14
Fundy
94 Canada – Sambro Harbour — Directions; light buoys 52/16
95 Canada – Indian Harbour — Overhead cable 52/16
97 Canada -- Halifax — Vertical clearances 12/18
97 Canada – Halifax — Arrival information; pilotage 39/14
126 Canada – Luneburg Harbour — Arrival information; pilotage 44/14
168 Canada – Petit Passage — General information; overhead power cables 39/14
180 Canada -- Bay of Fundy -- Saint John Harbour — Berths; alongside depths 35/18
60 Pacific Islands 1 13th Edition (2018) 04/18
134 Papua New Guinea -- Bougainville Island -- Otua Island — Directions; light 04/18
262 Papua New Guinea -- Huon Gulf — FADs 30/18
262 Papua New Guinea -- Huon Gulf -- North of Cape Roon — Directions; shoals 37/18
262 Papua New Guinea -- Huon Gulf — Directions; FADs; buoys 30/18
262 Papua New Guinea -- Huon Gulf -- North of Cape Roon — Directions; shoals 37/18
263 Papua New Guinea -- Huon Gulf — Directions; FAD; buoy 30/18
282 Papua New Guinea -- New Britain -- Thilenius Harbour — Depth 52/18
367 Papua New Guinea -- Bougainville Island -- Arawa Bay — Directions; light 04/18
368 Papua New Guinea – Bougainville Island -- North--east coast — Directions; light 04/18
369 Papua New Guinea -- Bougainville Island -- Cape Laverdy — Directions; light 04/18
370 Papua New Guinea -- Bougainville Island -- Cape Laverdy — Directions; light 04/18
87 Nouvelle Calédonie -- South coast -- Nouméa — Limiting conditions; depths 32/17
87 Nouvelle--Calédonie -- Nouméa — Outer anchorage 26/18
87 Nouvelle Calédonie – Nouméa — Prohibited anchorages 47/18
88 Nouvelle--Calédonie -- Nouméa -- Grande Rade — Leading Line 11/17
92 Nouvelle--Calédonie – West coast — Marine reserve 01/18
95--96 Nouvelle Calédonie -- Baie de Saint Vincent — Anchorages 43/17
98 Nouvelle--Calédonie – West coast — Marine reserve 01/18
118 Nouvelle Caledonie -- Île Art -- Baie de Waala — Anchorage 27/18
119 Nouvelle Caledonie -- Île Pott -- Anse Ammoian — Anchorage 27/18
125 Nouvelle--Calédonie – East coast – Port Ounia — Anchorage; wreck 12/18
125 Nouvelle--Calédonie – Baie de Ouinné — Anchorage 20/17
130 Nouvelle--Calédonie – Port de Thio — Directions; leading lights 20/17
135 Nouvelle--Calédonie – Baie Laugier — Directions; leading lights 20/17
138 Nouvelle--Calédonie -- Baie de Poro — Leading beacons 48/17
4.47 Wk01/19
IV

Edition
266 Fiji Islands -- Viti Levu -- Approaches to Suva — Anchorage; wreck 28/18
281 Fiji Islands -- Viti Levu Bay — Directions; rocks 40/17
295 Fiji Isands -- Levuka Wharf — Wreck 41/17
300 Fiji -- Viti Levu -- Rewa Roads — Submarine cable 16/18
346 Fiji -- Exploring Isles -- Qilaqila Passage — Leading Beacons 43/17
360 Fiji Islands -- Balmoral Reef — Shoal 42/18
365 Île Futuna -- Ava Leava — Anchorage 16/18
368 Îles Wallis -- Mouilage de Mata Utu — Anchorage 16/18
368 Oceania – Îles Wallis – Mata Utu — Anchorage 47/18
410 Samoa -- Savai’i Island -- Salelologa Harbour — Directions; depths 16/18
410 Samoa -- Upolu Island -- Mulifanua Harbour — Directions; depths 16/18
411 Samoa -- Upolu Island -- Cape Tapaga — Shoal depth 15/17
130 French Polynesia -- Archipel des Tuamotu -- Taenga — Directions; alignment 43/18
134 French Polynesia -- Archipel des Tuamotu -- Fakarava — Anchorages 44/18
150 French Polynesia -- Îles de la Société -- Tahiti -- Mouillage Vairao — Anchorage 11/17
151 French Polynesia -- Îles de la Société -- Tahiti -- Port Phaéton — Directions; depth 11/17
154 French Polynesia -- Tahiti -- Passe Aifa — Depth 35/17
154 French Polynesia -- Tahiti -- Mouillage d’Aifa — Depth 03/17
158 French Polynesia -- Tahiti -- Lagon de Punaauia — Anchorages; wrecks; beacon 31/17
176 French Polynesia -- Moorea — Regulations 31/17
179 French Polynesia -- Moorea -- Baie de Cook — Anchorage berths 31/17
179 French Polynesia -- Moorea -- Baie d’Opunohu — Anchorages 31/17
201 French Polynesia -- Îles Sous le Vent -- Raiatea – Uturoa — Anchorage berths 09/17
204 Îles de la Société -- Raiatea -- Passe Toamaro — Depth 49/17
212 French Polynesia -- Îles de la Société -- Bora--Bora -- Baie de Povai — Anchorages 44/18
224 Cook Islands -- Penrhyn Island Lagoon — Depths 29/18
244 Palmyra Atoll — Explosives dumping ground 49/17
252 French Polynesia -- Îles Marquises -- Hiva--Oa -- Baie Taaoa — Anchorages; depths 11/18
258 French Polynesia -- Îles Marquises -- Nuku--Hiva -- Baie de Taiohae — Anchorage 10/17
312 Hawaiian Islands – Oahu Island – Pearl Harbor — Controlling depth 42/18
323 Hawaii -- Oahu -- Kaneohe Bay — Directions; wreck 26/17
63 Persian Gulf 18th Edition (2018) 27/18
62 Oman -- Strait of Hormuz -- West Bukha Oilfield — Directions; racon 37/18
62 Oman -- Muscaò - JazØrat Muscaò — Directions; position 49/18
89 Oman -- Shinºî — Anchorage 27/18
134 Iran – Bandar--e Pºrs — Anchorages 27/18
147 United Arab Emirates -- Saqr Port — Directions; pilotage; terminal 44/18
148 United Arab Emirates -- Ra’s al Khaymah -- RAK Maritime City -- RAK Khor Port — 27/18
Directions; control tower; buoy; anchorages
149 United Arab Emirates -- Al Jazeera Port — Anchorages; pipeline; buoy 27/18
150 United Arab Emirates – Umm al Quwain — Anchorage 47/18
157 United Arab Emirates -- Dubai — Anchorage 49/18
165 United Arab Emirates – Abu Dhabi — Arrival information; pilotage 27/18
175 United Arab Emirates -- Approaches to Ar Ru’ays (Ruwais) and Jabal Aþ ¹annah — 48/18
Depths
Wk01/19 4.48
IV

Edition
Directions
Directions
187 Qatar – Doha — Arrival information; pilotage 27/18
188 Qatar – Hamad Port — Limiting conditions; UKC 27/18
189 Qatar – Hamad Port — Arrival information; pilotage 27/18
190 Qatar – Mesaieed — General information; approach and entry 27/18
191 Qatar – Mesaieed — Directions; approach and entry 27/18
194 Qatar – Outer approaches to Ra’s Laffºn — Directions; wreck 27/18
195 Qatar – Al Ruwais Port — Port information 27/18
196 Qatar – Ra’s Laffºn — Limiting conditions; local weather 27/18
196 Qatar – Ra’s Laffºn — Outer anchorages 51/18
201 Bahrain -- Bahrain approaches — Directions; wreck 27/18
202 Bahrain -- Port of Bahrain — Anchorages 27/18
204 Bahrain -- Port of Bahrain — Inner anchorages; berths 27/18
204 Bahrain -- Port of Bahrain — Berths 27/18
232 Kuwait -- Al Kuwayt Harbour — Wreck 32/18
233 Kuwait -- KhalØj al Kuwayt — Development 27/18
234 Kuwait – MØnº’ ash Shuwaykh — Directions 27/18
64 Red Sea and Gulf of 19th Edition (2018) 30/18
Aden
127 Egypt -- Red Sea -- Safaga — Directions; lights 37/18
139 Sudan -- Port Sudan — Cautionary area 30/18
140 Sudan -- Port Sudan — Directions; wreck 30/18
310 Oman -- Port Salalah — Anchorages; pilotage 30/18
332 Djibouti -- Djibouti Port — Anchorages 30/18
65 St Lawrence 18th Edition (2016) 03/16
13 Gulf of St Lawrence — Regulations; speed restrictions; protection of wildlife 41/17
13 St Lawrence — Regulations 08/18
13 Gulf of St Lawrence — Regulations; speed restrictions; protection of wildlife 41/17
13 St Lawrence — Regulations 08/18
65 Gulf of St Lawrence — Traffic regulations 41/17
68 Canada -- Saint Lawrence River -- Baie des Anglais -- Baie--Comeau — Anchorage 39/18
73 Gulf of St Lawrence, North Shore – Strait of Belle Isle to Cap Whittle — 21/16
General information; Navigation
77 Quebec – Chenal à la Baleine — Directions; depths 29/18
78 Quebec – Chenal de l’Ouest — Directions; depths 29/18
78 Quebec – Baie de Bonne--Espérance — Directions; depths 29/18
87 Gulf of St Lawrence — Traffic Regulations 08/18
103 Canada -- Sept--Îles — Arrival information; outer anchorages 47/17
104 Sept--Îles -- Pointe aux Basques — Directions; wreck 05/18
105 St Lawrence River -- Sept--Îles — Berths 45/17
106 St Lawrence River -- Sept--Îles -- Pointe Noire — Berths 45/17
111 Canada -- Saint Lawrence River -- Baie des Anglais — Anchorage 39/18
117 Rivière Saguenay and approaches – Saguenay – St. Lawrence Marine Park — 26/16
Whale protection
117 St Lawrence River -- Saguenay -- St. Lawrence Marine Park — Seasonal whale 35/18
protection
119 Pointe Noire to Pointe au Boeuf — Vertical clearance 48/16
4.49 Wk01/19
IV

Edition
131 Gulf of St Lawrence -- Îles de la Madeleine -- Cap--aux--Mueles — Berths 51/17
159 Saint Lawrence River -- Chenal du Nord -- Saint--Siméon — Pier depth 46/17
192 Saint Lawrence River -- Lac Saint Pierre — Directions; lights 21/18
214 Canada -- Cape Breton Island -- Sydney — Pilotage 39/18
217 Canada -- Cape Breton Island -- St Anns Bank — Restricted area 40/17
221 Canada -- Cape Breton Island -- Little Bras d’Or — Pilotage 39/18
243 Nova Scotia -- Canso Lock — General information; vertical clearance 47/17
245 Strait of Canso – Canso Lock to North Canso — General information; vertical 43/16
clearance
268 Prince Edward Island -- Charlottetown -- North River — Depths 51/17
284 Shediac Valley -- Miramichi Bay — Limiting draught 46/17
288 Gulf of St Lawrence -- West shore -- Miramichi Bay to Birch Point — Wreck 51/17
292 Gulf of St Lawrence -- Baie de Lamèque — Directions; lights 19/17
293 Baie des Chaleurs -- Baie de Shippegan -- Shippegan Harbour — Vertical clearance 36/18
297 Gulf of St Lawrence — Belledune — Outer anchorage; pilotage 08/18
304 Gulf of St Lawrence -- West shore -- Havre de Gaspé — Berths 51/17
66A South west coast of 1st Edition (2014) 13/15
Scotland
5 Scotland – West coast — LORAN--C and eLORAN 52/15
8 Regulations — Dangerous substances in harbour areas 47/16
47 Scotland – West coast – Firth of Clyde — Submarine traffic 49/15
53, 53--54, 54 Scotland — Loch Ryan — Directions 27/16
63 Firth of Clyde – Ayr — Pilotage 42/15
63 Firth of Clyde -- Ayr — Pilotage 31/18
64 Scotland – West coast – Ayr — Directions; light buoy 03/16
65 Firth of Clyde -- Troon — Pilotage 31/18
69 Scotland -- West coast -- Ardrossan — Traffic lights 50/18
78 Scotland – Campbeltown — Arrival information; Regulations 47/16
95 Scotland – West coast – Firth of Clyde — Submarine traffic 49/15
98 Scotland – Firth of Clyde – Firth of Clyde Channel — Least depth 31/16
98 Scotland – Firth of Clyde – Firth of Clyde Channel — Least depth 31/16
105 Scotland – Firth of Clyde – Greenock — Controlling depths 31/16
106 Scotland – Firth of Clyde – Greenock — Harbour 31/16
113 Scotland – Firth of Clyde – Loch Long and approaches — Controlling depths 32/16
117 Loch Goil – Directions 08/17
117 Scotland -- Firth of Clyde -- Loch Goil — Directions; depth 30/18
120 Firth of Clyde – Gareloch – Rhu Narrows — Depths 36/15
122--123 Firth of Clyde -- Gareloch and approaches -- Faslane — Traffic signals 13/17
125 Scotland – West coast – River Clyde — Maintained depth 50/15
140 Scotland --Loch Indaal -- Bruichladdich Pier — Light 49/17
190 Firth of Lorn -- Kerrera Sound -- Oban — Traffic Regulations; directions; 20/17
development; anchorages
190 Scotland – Kerrera Sound — Buoyage 15/15
191 Scotland – Kerrera Sound — Buoyage 15/15
191 Firth of Lorn and South--West Approaches -- Kerrera Sound — Directions; buoyage 26/17
191, 192, 193, 194, 195 Firth of Lorn -- Kerrera Sound -- Oban — Traffic Regulations; directions; 20/17
Wk01/19 4.50
IV

Edition
195 Firth of Lorn and South--West Approaches -- Kerrera Sound -- Oban Harbour — 26/17
Anchorage and harbours; buoyage
199 Loch Morvern -- Glensanda Harbour — Pilotage; tidal streams 31/17
202, 203 Scotland – Lynn of Lorn – Loch Creran — Anchorages 19/16
207 Loch Etive — Directions; depth 16/15
214, 215 Loch Linnhe -- Corran Narrows — Directions; light 24/17
215 Loch Linnhe -- Corran Narrows — Directions; light 15/18
222 Scotland – Sound of Mull — Buoyage 15/16
223 Tobermory -- Harbour Association 01/16
224 Isle of Mull — Tobermory Harbour; seaplane operating area 09/17
224 Scotland West coast -- Loch Aline — depths 27/17
225 Loch Aline — Depth 25/15
236 Scotland – Sound of Iona — Buoyage 05/16
66B North west coast of 1st Edition (2014) 13/15
Scotland
5 Scotland – West coast — LORAN--C and eLORAN 52/15
8 Regulations — Dangerous substances in harbour areas 47/16
86 Loch Alsh — Directions; positions; depths 04/18
91 Isle of Skye — Loch na Bèiste; wrecks 51/16
105 Outer Hebrides – South Uist — Lochboisdale 22/16
106 Outer Hebrides – South Uist — Lochboisdale 22/16
112 The Little Minch — Direction 36/18
147 Loch Maddy — Pilotage 43/16
156 Inner Sound -- Ru na Lachan — Beacons 16/18
161, 162, 163--164, 164, Isle of Skye – Inner Sound — Directions; light beacons 15/15
165
166 Inner Sound -- Rona — Light 44/17
193 Loch Broom -- Ullapool — Directions; wreck 26/17
194 Loch Inver approaches -- A’ Chleit — Directions; depth 14/18
196 Enard Bay -- Loch Salainn — Marine farm 14/18
208 Scotland -- Outer Hebrides -- Stornoway Harbour — Anchorages 30/18
208 Outer Hebrides – Stornoway — Pilotage 45/15
227 Deep water route – Whale Rock — Directions; buoy 25/15
67 West Coasts of Spain 13th Edition (2018) 09/18
and Portugal
66 Spain -- Ferrol -- Islas Gabeiras — Directions; shoal 31/18
113 Spain -- West coast -- Puerto de Vigo — Prohibited area; general layout 49/18
250 Arquipélago dos Açores – Canal de São Jorge — Traffic regulations 36/18
251 Arquipélago dos Açores – Canal de São Jorge -- Porto das Velas — Anchorage 36/18
68 East Coast of the 16th Edition (2018) 16/18
United States 1
108 New Hampshire -- Portsmouth — Vertical and horizontal clearances 43/18
118 Massachusetts -- Approaches to Salem Harbour — Depths 29/18
143 Massachusetts -- Nantucket Sound -- Martha’s Vineyard — Wreck 40/18
184 Connecticut -- Long Island Sound -- New Haven Harbor — Bridge clearance 21/18
215 East coast -- New Jersey -- Port Elizabeth — Berths 27/18
4.51 Wk01/19
IV

Edition
69 East Coast of the 14th Edition (2017) 38/17
United States 2
78 Delaware River -- Marcus Hook — Anchorage; obstruction 15/18
82 New Jersey -- Delaware River -- Gloucester City — Obstruction 09/18
88 New Jersey -- Delaware River -- Whitehill Range — Leading lights 45/17
142 Chesapeake Bay -- Choptank River -- Cambridge — Directions; leading lights 51/18
169--170 North Carolina -- East of Pamlico Sound -- Wimble Shoals — Directions; wreck 30/18
182 South Carolina -- Long Bay — Directions; wrecks 26/18
184 North Carolina -- Willmington -- Smith Island — Directions; leading lights 40/18
208 South Carolina -- Port Royal Sound — Limiting conditions; depths 43/18
225 St Marys Entrance — Pilot boarding position 39/17
225 Georgia -- Saint Marys Entrance — Restricted area 45/17
69A East coasts of Central 7th Edition (2015) 22/15
America and Gulf of
Mexico
6 Mexico — National regulations 42/18
78 Costa Rica – Puerto Moín — Directions; buoy 17/16
78 Costa Rica – Puerto Moín — Directions; buoys; lights 51/16
98 Honduras – Puerto Cortés — Arrival information; prohibited anchorage 44/15
128 Mexico -- Bay of Campeche — Anchorages 32/17
129 Mexico -- East coast -- Progreso to Punta Boxcohuo — Directions 50/18
131 Mexico -- Bay of Campeche -- Dos Bocas — Anchorage 32/17
131 Mexico -- East coast -- Dos Bocas Terminal — National regulations 42/18
131 Mexico -- East coast -- Dos Bocas — Directions; light 34/18
132, 133 Mexico – Coatzacoalcos – Tonalá — Directions; major light 52/16
134 Mexico -- Coatzacoalcos — Anchorage; obstruction 09/18
141 Mexico – Approaches to Tuxpan — Directions; landfall buoy 06/17
142 Mexico – Tuxpan — Arrival information; Traffic regulations 37/15
143 Mexico – Tuxpan approaches — General information; Traffic regulations 37/15
144 Mexico -- East coast -- Approaches to Tuxpan — Directions; reef 29/19
149 Mexico – Tampico to Río Grande -- Laguna Madre — Directions; lights 10/17
149 Mexico -- Gulf of Mexico -- East--north--east of Punta Piedra — Prohibited area 44/18
150 Mexico -- Gulf of Mexico -- East--north--east of Punta Piedra — Prohibited area 44/18
150 Mexico -- East coast -- Altamira Industrial Port — Arrival information 29/19
154 Approaches to Aransas Pass — Directions; AIS 52/15
154 United States of America -- Gulf of Mexico -- Port Mansfield Channel — Directions; 34/18
wrecks
155 United States of America -- Gulf of Mexico -- Port Brownsville — Wreck 50/17
155 United States of America -- Gulf of Mexico -- Port Brownsville — Caution; wrecks 34/18
158 Approaches to Corpus Christi — Directions; AIS 52/15
161 United Staes of America -- Corpus Christi -- La Quinta — Directions; leading lights 47/18
164, 167 Approaches to Freeport — Directions; AIS 52/15
170 Approaches to Galveston Bay — Directions; AIS 52/15
171 Galveston Bay — Directions; AIS 52/15
172 United States of America -- Gulf of Mexico -- Galveston — Anchorages 47/18
173 United States of America -- Galveston -- Galveston Channel — Projected depths 24/18
175 United States of America -- Texas -- Bayport — Directions; lights 28/18
177 United States of America -- Houston — Fred Hartman Bridge 23/15
178 United States of America -- Gulf Coast -- Houston — Directions; wreck 51/17
183 United States of America -- Galveston Approaches to Sabine Pass Approaches -- 22/17
Port Arthur — Natural conditions; current
Wk01/19 4.52
IV

Edition
188 United States of America – Lake Charles — Limiting conditions; road bridge vertical 21/16
clearance
194 United States of America -- Gulf of Mexico — Directions; major light 23/15
202 United States of America -- Mississippi River -- New Orleans — Directions; other aids 18/17
to navigation; AIS
202 United States of America -- New Orleans — Wreck 19/18
217, 218 United States of America -- Tampa Bay — Directions; AIS 23/15
218 United States of America -- Tampa Bay — Directions; AIS 01/16
218 United States of America -- Tampa Bay — Directions; AIS 07/16
224 United States of America -- Tampa Bay -- Weedon Island Terminal — 31/17
Directions; lights; buoyage
229 United States of America -- Tampa Bay -- East Tampa -- Big Bend — Depths 37/18
230 United States of America – Big Bend — Berth; obstruction 43/15
238 Cape San Blas to Pensacola — Directions; AIS 52/15
240 Approaches to Panama City — Directions; AIS 52/15
243 United States of America -- Gulf of Mexico -- Pensacola — Development 22/18
246 Pensacola to Mobile Bay — Directions; AIS 52/15
251 United States of America -- Mississippi Sound-- Pascagoula — Restricted area 47/17
70 West Indies 1 7th Edition (2018) 46/18
123 United States of America -- East coast -- Florida -- Port Canaveral — Depths 49/18
124 United States of America -- East coast -- Florida -- Port Canaveral — Traffic 49/18
Regulations
125 United States of America -- East coast -- Florida -- Port Canaveral — General layout; 49/18
directions; basins
256 Jamaica -- South coast -- Portland Bight — Old Harbour LNG Terminal 49/18
257 Jamaica -- South Coast -- Portland Bight — Anchorage 49/18
71 West Indies 2 18th Edition (2017) 18/17
62 Anguilla -- Sombrero Island — Directions; light 16/18
90 Virgin Islands -- The Narrows — Directions; depths 40/17
96 Virgin Islands -- Tortola -- Road Harbour — Alongside berths 18/17
111 Virgin Islands -- Saint Croix -- Hams Bluff — Directions; light 44/17
115 Virgin Islands -- Saint Croix -- Hams Bluff — Light 44/17
181 Anguilla -- Seal Island — Directions; depth 16/18
182 Anguilla -- Crocus Bay — Wreck; depth 16/18
231 Guadeloupe -- Basse--Terre — Marine reserve; prohibited anchorage 44/18
236 Guadeloupe -- Grand Terre -- Le Moule — Outer anchorage; depths; bearings 11/18
236--237 Guadeloupe -- Grand Terre -- Le Moule — Directions; position; bearings 11/18
242 Guadeloupe -- Pointe de Folle Anse — Berths 40/18
244 Guadeloupe -- Pointe--à--Pitre — Alongside berths 52/17
256 Martinique -- Baie de Fort--de--France — Pilotage 34/18
261 Martinique -- Sainte--Luce — Restricted area 30/17
262 Martinique – Culde--de--Sac du Marin — Directions for entering harbour; channels 23/17
262 Martinique -- Sainte--Luce — Anchorage 30/17
276 Saint Lucia -- Laborie Bay — Directions; rock 44/18
277 Saint Lucia -- Laborie Bay — Rock 44/18
299 The Grenadines -- Carriacou and Grenada -- Northen channel — Directions; rock 18/17
299 The Grenadines -- Ronde Island — Directions; rock; depths 45/18
300 The Grenadines -- Carriacou -- Southwest Point — Directions; rock 45/18
302 The Grenadines -- Carriacou -- Hillsborough Bay — Directions; depth 19/18
307 Grenada -- South Coast -- Woburn Bay — Prohibited area 18/18
307 Grenada -- South Coast -- Prickly Bay — Depths 18/18
4.53 Wk01/19
IV

Edition
308 Grenada -- West coast -- Beauséjour Bay — Marine Protected Area 14/18
309 Grenada -- Saint George’s Harbour — Depth 18/18
309 Grenada -- Saint George’s Harbour — Anchorages 13/18
310 Grenada -- Saint George’s Harbour — Pilotage; landmark; light 13/18
310 Grenada -- West Coast -- Grande Anse Bay — Prohibited area 18/18
310 Grenada -- Saint George’s Harbour — Pilotage; landmark; light 13/18
327 -- 328 Barbados -- Bridgetown — Obstruction; depth 44/17
72 Southern Barents Sea 3rd Edition (2014) 38/14
and Beloye More
78 Kol’skiy Zaliv – Murmansk — Pilotage 41/14
85 Murmanskiy Bereg – Guba Belokamennaya — Directions; cargo transhipment area 42/16
86 Murmanskiy Bereg – Port Murmansk — Arrival information; prohibited anchorage 10/15
87 Port Murmansk -- Tri Ruch’ya -- Mys Lagernyy — Leading lights 03/16
91 Motovskiy Zaliv – Guba Kislukha — Useful mark 39/15
91 Motovskiy Zaliv – Guba Titovka — Beacon 39/15
91 Motovskiy Zaliv – Guba Titovka — Useful mark 39/15
108, 112, 115 Barents Sea -- Beloye More Northern Part — Konushinskiy light 07/17
122 Barents Sea -- Beloye More -- Gorlo -- Ostrov Danilov — Directions; wreck 50/17
140 Arkhangel’sk to Mys Gorbolukskiy — Anchorages and harbours; useful mark 49/16
140 Beloye More – Arkhangel’sk to Mys Gorbolukskiy – Unskaya Guba — Unskiy 16/17
Severnyy Leading lights
143 Proliv Vostochnaya Solovetskaya Salma — Directions; light 49/16
148 Proliv Zapadnaya Solovetskya Salma — Ports and anchorages; light; beacons 49/16
148 Proliv Zapadnaya Solovetskaya Salma – Port Belomorsk — Leading lights 16/17
149 Beloye More, Inner Basin – Onezhskiy Zaliv – Approaches to Port Onega — 16/15
Topography; beacon
150 Approaches to Port Onega — Directions; beacon; light 49/16
151 Beloye More – Approaches to Port Onega — Directions; buoyage 44/14
151 Beloye More, Inner Basin – Onezhskiy Zaliv – Approaches to Port Onega — 16/15
Directions; useful mark
160 Kandalakshskiy Zaliv -- Guba Pon’goma —Directions; leading lights; beacon 49/16
163 Kandalakshskiy Zaliv -- Guba Kovda — Directions; leading lights 49/16
168 Beloye More -- Kandalakshskaya Guba -- Port Vitino approaches — Directions; 35/18
leading lights
183 Pechorskaya Guba to Proliv Yugorskiy Shar – Oil and gas offshore fields – 46/14
Prirazlomnaya platform — Safety zone
Wk01/19 4.54
V
UPDATES TO ADMIRALTY LIST OF LIGHTS AND FOG SIGNALS
NP75, Vol B Edition 2018/19. Weekly Edition No. 1, Dated 03 January 2019.
Last Updates: Weekly Edition No. 51, dated 20 December 2018.
IJMUIDEN WEST INNER TSS

B0761·1 - Q10-A 52 29·74 N Mo(U)W 15s .. 15 Platform
4 12·88 E
-- .. Horn Mo(U)
30s
* * * * * * * *
B0859 - Schulpengat. Schilbolsnol 53 00·50 N F WRG 27 W15 Green post G002°-035°(33°), W035°-038°(3°),
NL, HP2, 1496 4 45·70 E R12 21 R038°-051°(13°),
G11 W051°-068·5°(17·5°),
W338°-002°(24°).
Obscured 068·5°-338°(269·5°)
* *
B2240·2 - Skålholmen. Ldg Lts 023°. 59 05·36 N Oc W 6s 13 8·5 Lantern on structure Vis 5° each side of leading line
NO, , 007910 Front 10 58·94 E 8
* * * * *
B2240·3 - Skålholmen. Ldg Lts 023°. 59 05·41 N Oc W 6s 17 8·5 Lantern on tripod Vis 5° each side of leading line
NO, , 007920 Rear 10 58·99 E 4
* * * * *
B2402 - Ildjernsflu 59 51·35 N Oc(3)WRG 10s 8 W4·1 Column W033·5°-046·5°(13°),

NO, , 021300 10 37·86 E R3·1 16 R046·5°-052°(5·5°),
G3·1 G052°-058·5°(6·5°),
W058·5°-066·5°(8°),
R066·5°-076°(9·5°),
G076°-192°(116°), W192°-209°(17°),
R209°-214°(5°),
G214°-033·5°(179·5°).
Floodlit
*
B2406 - Nordre Langøy 59 52·48 N Oc(2)WRG 8s 8 W3·1 Post G060·5°-088°(27·5°),

NO, , 022500 10 43·21 E R2·3 8 W088°-091·5°(3·5°),
G2·3 R091·5°-095°(3·5°), G095°-098°(3°),
W098°-102°(4°), R102°-121°(19°),
G121°-210°(89°), W210°-216°(6°),
R216°-220·5°(4·5°),
G220·5°-223·5°(3°),
W223·5°-243·5°(20°),
R243·5°-248·5°(5°).
Floodlit
*
B3252·3 - Busholmgrunnen. N Point 59 03·34 N Iso G 4s .. .. .. Floodlit. (P) 2018

NO, , 103235 5 27·29 E
* * * * * * * *
B3253 - Sandholmen. S Point 59 02·47 N Iso WRG 2s 6 W3·2 Tripod G202·1°-216·2°(14·1°),

NO, , 104300 5 25·31 E R2·4 6 W216·2°-226·7°(10·5°),
G2·4 R226·7°-291·8°(65·1°),
G291·8°-299·3°(7·5°),
W299·3°-323·1°(23·8°),
R323·1°-076·6°(113·5°),
G076·6°-125·5°(48·9°),
R125·5°-129·1°(3·6°).
Sectors to be amended (P) 2018
* *
5.1 Wk01/19
V
NP75, Vol B Edition 2018/19 continued.
B3264 - Gryda 59 02·94 N Iso WRG 2s 5 W3·2 Tripod R314°-323·1°(9·1°),

NO, , 105600 5 36·49 E R 2 W323·1°-351·1°(28°),
G1·9 G351·1°-057·6°(66·5°),
W057·6°-060·3°(2·7°),
R060·3°-080°(19·7°),
W080°-139°(59°),
G139°-169·8°(30·8°).
*
B3339 - Barkeneset 59 19·55 N Iso WRG 4s 13 W5·4 . . G195·6°-196·6°(1°),

NO, , 113000 6 05·08 E R3·7 R196·6°-216·4°(19·8°),
G3·5 W216·4°-225°(8·6°),
G225°-299·7°(74·7°),
R299·7°-339·9°(40·2°),
W339·9°-348·8°(8·9°),
G348·8°-062·4°(73·6°),
W062·4°-088·8°(26·4°),
R088·8°-096·8°(8°).
*
RYFYLKEFJORDANE. ERFJOREDN
B3340 - Kileneset 59 18·95 N Iso WRG 6s 3 W5·5 . . G341·2°-353·1°(11·9°),
NO, , 113100 6 15·99 E R3·9 R353·1°-085·2°(92·1°),
G3·6 W085·2°-086·8°(1·6°),
G086·8°-137·8°(51°),
W137·8°-145·3°(7·5°),
R145·3°-160·2°(14·9°).
*
B3358 - Toftøy. S Point 59 15·73 N Oc(3)WRG 10s 11 W11 Framework structure G231·8°-235·4°(3·6°),
NO, , 114500 5 40·12 E R8·3 5 W235·4°-246·8°(11·4°),
G7·8 R246·8°-313·2°(66·4°),
W313·2°-343·5°(30·3°),
G343·5°-022·9°(39·4°),
W022·9°-056·9°(34°),
R056·9°-064·5°(7·6°).
*
B3362 - Årviksund. Holmeflu 59 15·92 N Oc WRG 6s 4 W 7 Tripod W084·1°-095·7°(11·6°),

NO, , 114600 5 32·77 E R5·1 R095·7°-217·4°(121·7°),
G4·7 W217·4°-239·4°(22°),
R239·4°-277·8°(38·4°),
W277·8°-301·3°(23·5°),
G301·3°-084·1°(142·8°).
*
B3366 - Lamholmen. Muslandsvåg 59 19·62 N Iso WRG 6s 8 W8·2 . . R143°-154°(11°), W154°-163°(9°),

NO, , 114700 5 45·19 E R 6 3 G163°-283°(120°), W283°-304°(21°),
G5·7 R304°-325°(21°), G325°-004°(39°),
W004°-014·5°(10·5°),
R014·5°-017·5°(3°),
W017·5°-025·5°(8°),
G025·5°-039°(13·5°).
*
B3368 - Nedstrand. Tanganeset 59 20·23 N Iso WRG 4s 5 W 8 .. G251°-257°(6°), W257°-264°(7°),

NO, , 115000 5 52·49 E R 6 R264°-286°(22°),
G 5 W286°-341·5°(55·5°),
R341·5°-348°(6·5°), W348°-354°(6°),
G354°-041°(47°), W041°-052°(11°),
R052°-106°(54°), W106°-118°(12°).
*
5.2 Wk01/19
V
B3370 - Frøvikneset 59 22·88 N Iso WRG 6s 12 W5·5 . . R145·7°-156·5°(10·8°),

NO, , 115100 5 53·81 E R3·9 3 W156·5°-185·1°(28·6°),
G3·6 G185·1°-197·5°(12·4°),
R197·5°-315·3°(117·8°),
W315·3°-353·4°(38·1°),
G353·4°-357·2°(3·8°).
*
B3372 - Kviteholmen 59 22·81 N Iso WRG 2s 12 W5·3 . . R220·2°-233·1°(12·9°),

NO, , 115200 6 02·53 E R3·6 3 W233·1°-236°(2·9°),
G3·4 G236°-018·3°(142·3°),
W018·3°-030·8°(12·5°),
R030·8°-048·6°(17·8°),
G048·6°-058·8°(10·2°),
R058·8°-108·5°(49·7°),
G108·5°-127·2°(18·7°).
*
B3376 - Ottøya. N Point 59 24·25 N Oc WRG 6s 27 W10 Post G023·85°-043·02°(19·17°),

NO, , 115300 6 05·54 E R 7 W043·02°-044·91°(1·89°),
G 7 R044·91°-133·97°(89·06°),
W133·97°-143·73°(9·76°),
G143·73°-273·28°(129·55°),
W273·28°-279·74°(6·46°),
R279·74°-282·89°(3·15°).
*
B3384 - Hamborgneset 59 24·97 N Oc(2)WRG 8s 6 W10 . . G017·5°-027°(9·5°), W027°-029°(2°),

NO, , 115800 6 07·94 E R 9 R029°-230·5°(201·5°),
G 9 W230·5°-231·5°(1°).
To be removed, replaced by light
with floodlight (P) 2018
*
B3384·9 - Hamborgneset 59 24·97 N FG .. .. .. Floodlit. (P) 2018

NO, , 115877 6 07·95 E
* * * * * * * *
B3386 - Nevøya 59 25·69 N Iso WRG 2s 13 W5·3 . . R053·7°-057·5°(3·8°),

NO, , 116200 6 09·99 E R3·6 W057·5°-063°(5·5°),
G3·4 G063°-210·9°(147·9°),
W210·9°-229·4°(18·5°),
R229·4°-232·5°(3·1°).
*
RYFYLKEFJORDANE
B3388 - Eidsneset 59 29·63 N Oc WRG 6s 4 W11 Building G011·9°-025·2°(13·3°),
NO, , 116300 6 14·90 E R8·7 W025·2°-033·9°(8·7°),
G8·3 R033·9°-194·9°(161°),
W194·9°-198·2°(3·3°),
G198·2°-205·6°(7·4°).
*
B3392 - Solandsneset 59 34·57 N Oc(2)WRG 8s 7 W5·9 Tower W181·6°-192°(10·4°),

NO, , 116500 6 18·38 E R4·2 5 R192°-204·9°(12·9°),
G3·9 W204·9°-348°(143·1°),
R348°-022·7°(34·7°),
W022·7°-025°(2·3°),
G025°-027·2°(2·2°).
*
5.3 Wk01/19
V
B3394 - Saudnes 59 38·50 N Oc WRG 6s 5 W5·6 Building with gallery R243·2°-248·6°(5·4°),

NO, , 116700 6 19·81 E R3·9 4 W248·6°-260·8°(12·2°),
G3·6 G260·8°-271·5°(10·7°),
R271·5°-005·8°(94·3°),
W005·8°-060°(54·2°),
G060°-068·8°(8·8°),
W068·8°-072·3°(3·5°),
R072·3°-077·8°(5·5°).
To be removed (P) 2018
*
B3396 - Sønnanåneset 59 28·90 N Iso WRG 2s 7 W5·3 Tower R336·4°-349·7°(13·3°),

NO, , 117500 5 53·12 E R3·6 6 W349·7°-039·6°(49·9°),
G3·4 G039·6°-083·1°(43·5°),
W083·1°-094°(10·9°),
R094°-138·6°(44·6°),
W138·6°-155·1°(16·5°),
G155·1°-162·4°(7·3°),
W162·4°-191·4°(29°).
*
RYFYLKEFJORDANE. KROSSFJORDEN
B3398 - Hettanes 59 27·37 N Iso WRG 4s 6 W5·4 . . R231·1°-256·4°(25·3°),
NO, , 117600 5 50·33 E R3·8 3 W256·4°-270·8°(14·4°),
G3·5 G270·8°-326·2°(55·4°),
W326·2°-337°(10·8°),
R337°-048·7°(71·7°),
W048·7°-056·9°(8·2°),
G056·9°-067·1°(10·2°).
*
B3400 - Dragneset 59 27·23 N Iso WRG 6s 7 W8·2 . . R061·5°-072°(10·5°),

NO, , 117700 5 55·76 E R 6 6 W072°-136°(64°),
G5·7 G136°-237·5°(101·5°),
W237·5°-248°(10·5°),
R248°-258°(10°), W258°-260°(2°),
G260°-276·5°(16·5°).
*
RYFYLKEFJORDANE. VATSFJORDEN
B3402 - Skjervheim 59 28·08 N Oc WRG 6s 2 W6·2 . . G335·4°-347·1°(11·7°),
NO, , 117800 5 44·74 E R3·3 W347·1°-351·3°(4·2°),
G 4 R351·3°-148·3°(157°).
*
B3404 - Hervikefjord. Raudholmen 59 19·47 N Iso WRG 2s 7 W 5 .. R349·7°-001·3°(11·6°),

NO, , 118000 5 37·11 E R3·4 W001·3°-029·7°(28·4°),
G3·2 G029·7°-179·8°(150·1°),
R179·8°-229·8°(50°),
W229·8°-242°(12·2°),
G242°-257·4°(15·4°),
W257·4°-260·7°(3·3°),
R260·7°-268·2°(7·5°).
*
RYFYLKEFJORDANE. SKJOLDAFJORDEN
B3406 - Høneholmen 59 23·43 N Iso WRG 4s 9 W4·8 . . R162·4°-174·8°(12·4°),
NO, , 118100 5 37·59 E R3·3 W174·8°-177·9°(3·1°),
G 3 G177·9°-246·3°(68·4°),
W246·3°-335·2°(88·9°),
G335·2°-009·3°(34·1°),
R009·3°-023·3°(14°).
*
5.4 Wk01/19
V
RYFYLKEFJORDANE. FØRLANDSFJORD
B3407 - Lamholmflua 59 18·51 N Iso W 4s .. .. .. Floodlit. (P) 2018
NO, , 118286 5 27·65 E
* * * * * * * *
B3408 - Urholmbåen 59 18·24 N Iso G 4s .. .. .. Floodlit. (P) 2018

NO, , 118283 5 27·65 E
* * * * * * * *
B3410 - Urdholmen 59 18·18 N Iso WRG 4s 5 W4·8 . . G337·2°-354·1°(16·9°),

NO, , 118200 5 27·68 E R3·3 R354·1°-178·8°(184·7°),
G 3 W178·8°-192·3°(13·5°).
*
B3410·5 - Hamnarholmen 59 17·94 N Iso R 4s .. .. .. Floodlit. (P) 2018

NO, , 118282 5 27·69 E
* * * * * * * *
RYFYLKEFJORDANE
B3411 - Boknaflæet. Raudholmflu 59 16·25 N Oc(3)WRG 10s 3 W 5 Tripod R359·3°-016·1°(16·8°),
NO, , 118500 5 26·86 E R 4 5 W016·1°-025·9°(9·8°),
G 4 G025·9°-071°(45·1°),
R071°-143·5°(72·5°),
G143·5°-194°(50·5°),
W194°-196·7°(2·7°),
R196·7°-214·4°(17·7°),
W214·4°-252·7°(38·3°),
G252·7°-288·7°(36°).
Sectors to be amended, relocated on
post, 160m W (P) 2018
*
BOKNAFJORDEN. BOKNASUND
B3414 - Aksdalsnes 59 12·53 N Oc WRG 6s 7 W6·8 Tripod R301·7°-316·5°(14·8°),
NO, , 119000 5 29·05 E R4·9 W316·5°-007·1°(50·6°),
G4·5 G007·1°-112·2°(105·1°),
W112·5°-132·3°(19·8°),
R132·3°-135·7°(3·4°).
*
B3415·2 - Rovetærne 59 13·44 N Oc(2)WRG 8s 10 W5·9 GRP tower on R127·58°-148·29°(20·71°),

NO, , 119011 5 32·42 E R4·2 concrete column W148·29°-159·01°(10·72°),
G3·9 10 G159·01°-243·15°(84·14°),
W243·15°-263·07°(19·92°),
R263·07°-278°(14·93°),
W278°-290·27°(12·27°),
G290·27°-317·71°(27·44°),
W317·71°-326·04°(8·33°),
R326·04°-357·88°(31·84°),
W357·88°-026·94°(29·06°),
G026·94°-127·58°(100·64°).
*
B3415·5 - Ognaskjæret 59 15·09 N Oc WRG 6s 7 W11 Column W122·8°-131·3°(8·5°),

NO, , 118900 5 28·31 E R8·2 9 R131·3°-248·3°(117°),
G7·8 G248·3°-277·5°(29·2°),
W277·5°-288°(10·5°),
R288°-311·4°(23·4°),
W311·4°-320·3°(8·9°),
G320·3°-122·8°(162·5°).
*
5.5 Wk01/19
V
BOKNAFJORDEN. BOKNASUND
B3416 - Austboen (Austbåen). Pier 59 13·38 N Oc(2)WRG 8s 5 W6·1 Post R309·6°-324·2°(14·6°),
NO, , 119200 5 27·62 E R4·3 5 W324·2°-335·4°(11·2°),
G 4 G335·4°-135·6°(160·2°),
R135·6°-145°(9·4°),
W145°-151·6°(6·6°),
G151·6°-156·6°(5°),
W156·6°-160·9°(4·3°),
R160·9°-168°(7·1°).
* *
B3420 - Drivsund 59 09·73 N Iso WRG 4s 8 W5·9 White post G292°-322·5°(30·5°),

NO, , 119700 5 25·38 E R4·6 9 W322·5°-357·5°(35°),
G4·6 R357·5°-111°(113·5°),
W111°-120°(9°), G120°-136°(16°).
*
B3424 - Boknahovud 59 14·80 N Iso WRG 2s 23 W5·3 Post W036·3°-061·4°(25·1°),

NO, , 120000 5 23·38 E R3·6 3 G061·4°-089·2°(27·8°),
G3·4 W089·2°-090·8°(1·6°),
R090·8°-163·5°(72·7°),
W163·5°-193·4°(29·9°),
R193·4°-251·8°(58·4°),
W251·8°-266·6°(14·8°),
G266·6°-274·8°(8·2°).
*
B3428 - Smørstakk 59 15·13 N Iso WRG 4s 11 W6·7 Column G340·2°-351·5°(11·3°),

NO, , 120400 5 21·03 E R4·8 10 W351·5°-011·3°(19·8°),
G4·5 R011·3°-022°(10·7°),
W022°-144·2°(122·2°),
R144·2°-158·9°(14·7°),
W158·9°-168·8°(9·9°),
G168·8°-173·5°(4·7°).
*
B3430 - Kopervik. Koparnaglen 59 17·37 N Oc(2)WRG 8s 4 W5·9 Cairn G151·7°-190·9°(39·2°),

NO, , 120500 5 19·10 E R4·1 7 R190·9°-201·7°(10·8°),
G3·8 W201·7°-328·8°(127·1°),
R328·8°-003°(34·2°),
G003°-033·7°(30·7°).
*
B3434 - Dua 59 17·95 N Oc WRG 6s 4 W6·2 Building G343·5°-352·7°(9·2°),

NO, , 120800 5 20·09 E R4·4 6 W352·7°-001·9°(9·2°),
G4·1 R001·9°-102·9°(101°),
W102·9°-115·2°(12·3°),
G115·2°-165·7°(50·5°),
W165·7°-174·2°(8·5°),
R174·2°-185°(10·8°).
*
B3438 - Snikspynten 59 20·95 N Oc(2)WRG 8s 5 W5·5 Building R352·1°-356·5°(4·4°),

NO, , 121200 5 18·96 E R3·8 5 W356·5°-357·3°(0·8°),
G3·5 G357·3°-152·5°(155·2°),
W152·5°-154·6°(2·1°),
R154·6°-169·1°(14·5°).
*
5.6 Wk01/19
V
B3440 - Bukkøya. E Point 59 21·21 N Oc WRG 6s 13 W5·6 Building G144·3°-147·8°(3·5°),

NO, , 121300 5 18·59 E R3·9 6 W147·8°-309·4°(161·6°),
G3·6 R309·4°-341·8°(32·4°),
W341·8°-347·6°(5·8°),
G347·6°-359·7°(12·1°).
*
B3442 - Salhus 59 22·54 N Oc RG 6s 6 R3·9 Post G157·6°-190·6°(33°),

NO, , 121400 5 17·65 E G3·6 3 R190·6°-339°(148·4°),
G339°-344·1°(5·1°).
*
B3447·5 - Søre Storesundsflua 59 23·38 N Iso R 4s .. .. .. Floodlit. (P) 2018

NO, , 121672 5 16·78 E
* * * * * * * *
B3447·8 - Rossebønakken 59 23·59 N Iso G 4s .. .. .. Floodlit. (P) 2018

NO, , 121673 5 17·09 E
* * * * * * * *
B3448 - Rossebønakken 59 23·59 N Oc(3)WRG 10s 12 W5·9 Post ec 5, (lt 1, ec 1) x 2, lt 1.

NO, , 121600 5 17·09 E R4·2 3 R319·9°-330·9°(11°),
G3·9 W330·9°-343·2°(12·3°),
G343·2°-024·5°(41·3°),
R024·5°-131·1°(106·6°),
G131·1°-137·2°(6·1°),
W137·2°-140·3°(3·1°),
R140·3°-156·5°(16·2°).
*
B3503 - Vikaholmen. E Side 59 08·52 N Oc WRG 6s 6 W5·6 . . ec 1.

NO, , 125500 5 16·56 E R3·9 4 W127·3°-132·8°(5·5°),
G3·6 G132·8°-299·8°(167°),
W299·8°-323·5°(23·7°),
R323·5°-343·7°(20·2°).
TE 2018
* *
NP76, Vol C Edition 2018/19. Weekly Edition No. 1, Dated 03 January 2019.
C0261·1 - Rørvig. Ferry Port. S Mole. 55 56·64 N Fl R 3s .. 3 .. (P) 2018

DK, , 1111 Head 11 46·14 E
* * * * * * * *
C0261·15 - Rørvig. Ferry Port. N Mole. 55 56·65 N Fl G 3s .. 3 .. (P) 2018

DK, , 1112 Head 11 46·18 E
* * * * * * * *
SJÆLLAND. HESSELØ BUGT. SJÆLLAND ODDE

C1470 - Odden Havn. N Mole. Head 55 58·33 N Oc WRG 5s 10 W 7 Green framework ec 1.
DK, , 1041 11 22·32 E R4·5 tower W147°-270°(123°), R270°-280°(10°),
G4·5 7 G280°-147°(227°).
Fl G 3s 5m 4·5M (P) 2018
*
5.7 Wk01/19
V
NP76, Vol C Edition 2018/19 continued.
GULF OF GDAŃSK. PORT PÓŁNOCNY

C3081·02 - Ldg Lts 253·6°. Front 54 23·80 N Oc Y 5s 18 8 Orange concrete post ec 2
PL, 521, 0172 18 42·21 E
--- .. By day .. 4
* * *
GULF OF GDAŃSK. PORT PÓŁNOCNY

C3081·03 - Ldg Lts 253·6°. Rear. 900m 54 23·66 N Oc Y 5s 45 8 Orange concrete post ec 2
PL, 521, 0172·1 from front 18 41·41 E
---- .. By day .. 4
* * * * * * * *
C4010 Tolbukhin 60 02·55 N LFl W 12s 29 16 White round tower fl 3

RU, 2201, 485 29 32·52 E and building
30
- Reserve light .. LFl W 12s .. 10
*
C6287 Södra Kvarken 60 25·70 N Fl(2)W 6s 17 7 White structure,

19 04·97 E green band, on grey
plinth
17
- .. Racon .. .. .. ALRS Vol 2 Station 62000
*
NP77, Vol D Edition 2018/19. Weekly Edition No. 1, Dated 03 January 2019.
WEST COAST. PERTUIS D'ANTIOCHE. ÎLE D'OLÉRON

D1287·3 - Bridge. Starboard 45 51·40 N Fl G 4s 3 . . White 3-sided fl 1
FR, , 57470 1 11·20 W structure, green
border
* * * * * * * *
D1287·35 - Bridge. Port 45 51·40 N Fl R 4s 3 . . White rectangular fl 1

FR, , 57480 1 11·20 W structure, red border
* * * * * * * *
D5938 - Ben Schoeman Dock. 33 54·33 S FR 11 9 White concrete tower F R Neon vertical strip, over F R
ZA, , Z5774 Entrance. N Side 18 26·33 E horizontal strip, directional along
entrance channel
*
NP78, Vol E Edition 2018/19. Weekly Edition No. 1, Dated 03 January 2019.
E2684 - Rovinj. S Harbour. 45 04·80 N Fl R 3s 7 3 Red tower with fl 0·3

HR, , 101 Breakwater. Head 13 38·01 E column and gallery
6
*
E2824 - Luka Rijeka. Riječki 45 19·63 N Fl(3)G 5s 15 8 Green tower with (fl 0·5, ec 0·5) x 2, fl 0·5, ec 2·5.
HR, , 187 Lukobran. Head 14 25·16 E gallery Range 4M (T) 2018
14
- - - - Reserve light .. .. .. 3
*
5.8 Wk01/19
V
NP78, Vol E Edition 2018/19 continued.
E3579·5 - Sudurad. Shoal 42 42·63 N Fl G 5s 7 3 Green post on fl 0·5, ec 4·5.

HR, , 705·3 17 54·84 E platform G275°-150°(235°)
5
* * * * * * * *
NP79, Vol F Edition 2018/19. Weekly Edition No. 1, Dated 03 January 2019.
F1182·8 Krabi. Ko Ma. Summit 7 36·89 N Fl(2)W 8s 78 10 White framework fl 0·5, ec 1, fl 0·5, ec 6
98 51·87 E tower
6
*
F1376·9 Kuala Tanjung. Lalang 3 23·10 N Fl Y 3s 4 5 Yellow × on yellow

99 27·35 E beacon
* * * * * * * *
F1376·95 Kuala Tanjung. Lalang 3 23·19 N Fl G 3s 7 5 Green % on beacon

99 27·46 E
* * * * * * * *
F1378·7 Tg Tiram. Ldg Lts 172°. 3 14·16 N Fl W 10s 11 12 White lattice beacon
ID, , 511 Front 99 35·50 E
* * * *
F1378·71 Tg Tiram. Ldg Lts 172°. 3 14·03 N Fl(3)W 10s 15 12 White lattice beacon (fl 0·5, ec 1·5) x 2, fl 0·5, ec 5·5
ID, , 511·1 Rear. 243M from front 99 35·54 E
* *
F1733·176 - Tanah Merah. Breakwater. 1 18·66 N Fl Y 2·5s 7 7 Yellow × on yellow

Middle. TMFT-2 103 59·29 E beacon
* * * * * * * *
NP80, Vol G Edition 2018/19. Weekly Edition No. 1, Dated 03 January 2019.
BAÍA SAMBOROMBÓN. RÍO AJÓ

G0902 Remove from list; deleted
BAÍA SAMBOROMBÓN
G0905 Remove from list; deleted
G2133·381 - Container Wharf. Ldg Lts 5 05·04 S Fl G 5s 17 10 Green concrete tower fl 0·5, ec 4·5
PE, 5020, 11040-B 150°. Rear 81 06·26 W
* *
5.9 Wk01/19
V
NP82, Vol J Edition 2018/19. NEW EDITION Weekly Edition No. 1, Dated 03 January 2019.
NOTE: These are the first updates issued for the New Edition.
Cut out the above and paste it in the NEW EDITION First Updates box immediately below the
RECORD OF UPDATES title on page ii of NP82, Vol J Edition 2018/19 New Edition.
J0414 - Nantucket Harbor. Brant 41 17·40 N Oc R 4s 8 9 White round tower,

US, I, 15205 Point 70 05·42 W footbridge to shore
6
--- .. Horn 10s .. .. .. bl 1.
Activated by keying microphone 5
times on VHF Channel 83A
(157·175MHz). Horn sounds for 45
minutes
*
VINEYARD SOUND. CAPE COD

J0456 - Woods Hole Harbor. 41 30·95 N Fl WR 6s 27 W13 White tower W289°-125°(196°),
US, I, 15560 Nobska Point 70 39·31 W R11 12 W195°-263°(68°), R263°-289°(26°)
over Hedge Fence and l'Hommedieu
shoals.
Shown 24 hours
--- .. Horn(2) 30s .. .. .. bl 2, si 2, bl 2, si 24.
times on VHF channel 83A
minutes
*
J0500 - New Bedford Inner Harbor. 41 37·45 N QG 15 8 On pile

US, I, 16897 W Barrier 70 54·37 W
--- .. Horn 10s .. .. .. bl 1.
minutes
* * * * * * * *
J0650 - South East Point. 41 09·17 N Fl G 5s 80 20 Red brick, 8-sided, Shown 24 hours
US, I, 640 Mohegan Bluffs 71 33·07 W pyramidal tower on
dwelling
20
- - - Emergency light .. Fl G 5s .. .. .. Reduced intensity when main light is
extinguished
--- .. Horn 30s .. .. .. bl 3.
minutes
* *
UPPER POTOMAC RIVER

J1931·7 Remove from list; deleted
CHESAPEAKE BAY. CHOPTANK RIVER

J2140 Remove from list; deleted
CHESAPEAKE BAY. CHOPTANK RIVER

J2192·2 - Wye River. No 1W 38 49·97 N Fl G 2·5s 5 4 Green & on pile

US, II, 26110 76 12·63 W
* * * * * * * *
J2541·1 - Big Island Channel. Upper 34 08·68 N Iso G 2s 5 . . Multi-pile structure Intens 1·5° each side of rangeline
US, II, 30796 N Ldg Lts 313·8°. Front 77 57·19 W
---- .. By day Iso G 2s .. .. .. Vis 1·5° each side of rangeline
* *
5.10 Wk01/19
V
NP82, Vol J Edition 2018/19 continued.
J2541·11 - Big Island Channel. Upper 34 08·72 N Iso G 6s 9 . . Framework tower on Intens 1·5° each side of rangeline
US, II, 30797 N Ldg Lts 313·8°. Rear. 92m 77 57·23 W multi-pile structure
from front
----- .. By day Iso G 6s .. .. .. Vis 1·5° each side of rangeline
* * *
J2550·1 - Lower Brunswick North 34 09·90 N Iso W 6s 11 . . Framework tower on Intens 1·5° each side of rangeline
US, II, 30825 Channel. Ldg Lts 332·6°. 77 57·81 W multi-pile structure
Rear. 263m from front
----- .. By day Iso W 10 .. .. Vis 1·5° each side of rangeline
6s
* * * * * * * *
J3371·4 - Entrance A Ldg Lts 052·5°. 30 08·76 N Fl W 2·5s 8 . . Red U, white stripe, Intens on rangeline only.
US, IV, 3340 Front 85 41·57 W on framework tower Shown 24 hours
on piles
* * *
J3371·41 - Entrance Ldg Lts 052·5°. 30 09·46 N Iso W 6s 20 . . Red U, white stripe, Shown 24 hours
US, IV, 3345 Rear. 1·148M from front 85 40·52 W on framework tower
on piles
* *
J3373·41 - B Ldg Lts 251·6°. Front 30 08·05 N Iso W 2s 8 . . Red U, white stripe, Intens 4° each side of rangeline
US, IV, 3400 85 42·92 W on tower on piles
* * * *
J3373·42 - B Ldg Lts 251·6°. Rear. 30 07·86 N Iso W 6s 16 . . Red U, white stripe, Vis 1·5° each side of rangeline
US, IV, 3405 0·6M from front 85 43·58 W on tower on piles
* * * * *
CORPUS CHRISTI CHANNEL. LA QUINTA CHANNEL

CORPUS CHRISTI CHANNEL. LA QUINTA CHANNEL

GULF OF CAMPECHE. TÚXPAN AND APPROACHES. RÍO TUXPÁN

J4259·265 - Darsena de Ciaboga. No 4 20 56·81 N Fl Y 2s 8 5 Yellow round metal Reported 2018
97 21·10 W tower
3
* * * * * * * *
J4823·5 - Zorrita 22 22·39 N Fl W 7s 11 10 Green framework fl 1.

CU, P2101, 9 84 35·60 W tower on piles TE 2018
8
*
GOLFO DE CAZONES
J5102 - Cayo Guano del Este. W 21 39·80 N Fl(2)W 15s 54 19 White round concrete Aeromarine
CU, P2101, 1006 Side 81 02·44 W tower, red bands
45
- - - Reserve light .. Fl(2)W 15s .. 7
* *
NORTH COAST
J5733·8 - Îlet du Gosier. Anse du 16 12·05 N Fl(2)R 6s 5 2 White beacon, red top
FR, LD, 05260 Mont. Spur. E 61 27·37 W
(FR)
* * * * * * * *
5.11 Wk01/19
V
J5733·9 - Îlet du Gosier. Anse du 16 12·06 N Fl(2)G 6s 5 2 White beacon, green

FR, , 05270 Mont. Jetty. W 61 27·39 W top
(FR)
* * * * * * * *
SOUTHEAST COAST
J5841·5 - Crown Point 11 08·89 N Fl(4)W 20s 35 16 Aluminium (fl 0·5, ec 1·5) x 3, fl 0·5, ec 13·5.
60 50·68 W framework tower TE 2018
topmark
26
*
J5841·54 - Store Bay 11 09·36 N Q WRG 7 W 5 .. R073°-083°(10°), W083°-128°(45°),

60 50·39 W R 4 G128°-138°(10°).
G 4 TE 2018
*
NORTH COAST
J5842 - Galera Point 10 50·04 N Oc W 10s 43 16 Red framework mast, ec 4
60 54·57 W white bands, on white
round tower
23
*
J5896 - Pipeline Jetty. Head 10 18·99 N Fl(4)W 10s 30 14 Metal framework (fl 0·5, ec 1) x 3, fl 0·5, ec 5.
61 28·79 W tower TE 2018
*
SOUTH COAST
J5913·4 - Erin. Taparo Point 10 03·46 N Fl(3)W 15s 69 13
61 37·61 W
*
J6094·23 - Peña Blanca Reach. 9 13·38 N FG .. . . White beacon

Northbound. Ldg Lts 299·7°. 79 56·60 W
Front
(PA:PC)
*
J6094·24 - Gatún Reach. Southbound. 9 10·47 N FG .. . . White beacon

Ldg Lts 179·8°. Front 79 55·46 W
(PA:PC)
*
J6094·25 - Bohio Reach. Northbound. 9 10·59 N FG .. . . White beacon

Ldg Lts 253·6°. Front 79 52·85 W
(PA:PC)
*
J6094·26 - Peña Blanca Reach. 9 10·34 N FG .. . . White beacon

Southbound. Ldg Lts 119·8°. 79 51·37 W
Front
(PA:PC)
*
J6094·28 - Bohio Reach. Southbound. 9 11·20 N FG .. . . White beacon

Ldg Lts 073·7°. Front 79 50·55 W
(PA:PC)
*
J6094·29 - Tabernilla Reach. 9 11·30 N FG .. . . White beacon

Northbound. Ldg Lts 349°. 79 49·13 W
Front
(PA:PC)
*
5.12 Wk01/19
V
J6094·31 - Buena Vista Reach. 9 08·77 N FG .. . . White beacon

Southbound. Ldg Lts 130·1°. 79 47·88 W
Front
(PA:PC)
*
J6144·2 - Zarzurro Bay (Sapzurro 8 39·47 N Fl W 3s 11 10 Red tower, white fl 0·3

CO, C, 58 East) 77 21·39 W bands
5
* *
J6229·51 - Dir Lt 122°. E7 11 00·61 N Iso WRG 5s 16 8 Red and white tower R118·5°-121·5°(3°),
CO, C, 217 74 46·01 W 23 W121·5°-122·5°(1°),
G122·5°-125·5°(3°)
* *
J6396 Oostpunt (Punt'i Kayon) 12 02·63 N Fl W 4s 12 8

68 44·26 W
*
ISLA LA ORCHILA
J6425·7 - Farallón 11 48·98 N Fl(2)W 6s 4 5 Black #on black
(VE) 66 12·72 W post, red band
* * * * * * * *
GULF OF PARIA. ISLA COTORRA

J6615 - Punta Barrial 10 03·05 N Fl W 15s 14 11 Orange GRP tower, fl 1
VE, , V5017·1 62 14·27 W white band
12
*
ISLA COROCORO
J6800 - Punta Barima 8 35·10 N Fl W 10s 24 15 Orange GRP tower, fl 1
VE, , V7003 60 24·64 W white band
15
-- .. Racon 24 .. .. ALRS Vol 2 Station 94607
* *
NP84, Vol L Edition 2018/19. Weekly Edition No. 1, Dated 03 January 2019.
ELLINGSØYFJORDEN
L0798 - Brattholmen 62 29·05 N Oc(2)WRG 8s 9 W3·4 Post G069·5°-090°(20·5°),
NO, , 334700 6 13·12 E R2·5 4 W090°-097·5°(7·5°),
G2·5 R097·5°-100°(2·5°),
G100°-263°(163°), W263°-270°(7°),
R270°-276·5°(6·5°),
G276·5°-282·5°(6°),
W282·5°-286·5°(4°),
R286·5°-324°(37·5°)
* * * *
NORDMØREFJORDENE
L1111·5 - Torsetsundet bro. Bridge 63 19·00 N Iso W 2s
Centre 8 36·27 E
* * * * * * * *
NORDMØREFJORDENE
L1111·9 Remove from list; deleted
5.13 Wk01/19
V
NP84, Vol L Edition 2018/19 continued.
TRONDHEIMSFJORDEN
L1293 Remove from list; deleted
NP85, Vol M Edition 2018/19. Weekly Edition No. 1, Dated 03 January 2019.
M8044 - Severo-Kuril'sk. Mys 50 40·64 N FY 43 10 White 8-sided Vis 10° each side of leading line.
RU, 2401, 2535 Opornyy. Ldg Lts 194·6°. 156 08·57 E concrete tower, red TE 2018
Front and white front
8
*
M8044·1 - Severo-Kuril'sk. Mys 50 40·51 N FY 77 10 White 8-sided Vis 10° each side of leading line.
RU, 2401, 2536 Opornyy. Ldg Lts 194·6°. 156 08·52 E concrete tower, red TE 2018
Rear. 224m from front stripe
8
- - - - - - Reserve light .. .. .. 6
*
OSTROV ONEKOTAN
M8047·5 - Mys Lisiy 49 24·08 N Fl W 2·5s 57 9 White 8-sided fl 0·5.
RU, 2401, 2505 154 49·52 E concrete tower TE 2018
8
*
M8516 Remove from list; deleted
NP86, Vol N Edition 2018/19. Weekly Edition No. 1, Dated 03 January 2019.
N4878 - Gelibolu 40 24·58 N Fl W 5s 34 15 White stone tower fl 0·5

TR, , 21660 26 40·90 E and dwelling
9
-- .. Siren(2) 30s .. .. .. bl 2, si 2, bl 2, si 24.
TD 2018
-- .. Racon .. .. .. ALRS Vol 2 Station 71500
* *
N5808·2 Sinop. Gazibey Kayası 42 01·30 N Fl(2)W 5s 20 5 Black # on black fl 0·5, ec 1, fl 0·5, ec 3.
TR, , 10291 35 12·87 E tower with red bands TE 2018
4
*
N5825·5 Zonguldak Limani. 41 26·43 N Fl R 5s 11 5 .. fl 1.

TR, , 10450 Secondary Harbour. N 31 44·68 E TE 2018
Breakwater. Head
*
5.14 Wk01/19
5(
VI
4/# 3$23. #,(1 +38+(23.%1 #(.2(&- +2

6DDJKX$CHSHNM-N C@SDC)@MT@QX
3GD #,(1 +38+HRSNE1@CHN2HFM@KRCH@FQ@LRHMBKTCDCHMSGDO@ODQUDQRHNMNESGDVDDJKX-NSHBDSN,@QHMDQR2DBSHNM

5(@QDOQHMSDCHMAK@BJ@MCVGHSD (EQDPTHQDC@BNKNTQUDQRHNMNESGDRDCH@FQ@LRB@MADCNVMKN@CDCEQNL
VVV @CLHQ@KSX BN TJL@QHSHLDR@EDSXHMENQL@SHNM 3NNAS@HMSGDBNKNTQUDQRHNMRRDKDBS5HDV@MCCNVMKN@C-,RȋRDKDBS
6DDJKXȋRDKDBS8D@QȋRDKDBS6DDJȋFNSN2DKDBSDC6DDJ"NMSDMSȋRDKDBS%HKDENQDW@LOKD
-/ȋ6*ȋȋ/ &$>6DDJ> OCE
5.+4,$-/

/TAKHRGDC6J
+@RS4OC@SDR6DDJKX$CHSHNM-N C@SDC#DBDLADQ
1 # 1!$ ".-2
/ &$414&4 8@ANUD,NMSDUHCDN$MSQ@MBD"G@MMDK+S!TNX*L

(MRDQS
,NMSDUHCDN$MSQ@MBD"G@MMDK
mț̦2mț̦6 ,
+S!TNX*L
4QTFT@X@M-NSHBD12#1
/ &$4-(3$#23 3$2&TKE"N@RS

-NUTR$"!/K@SENQL
#DKDSDDMSQX
-. !TKKDSHMC@SDC12#1
43., 3("(#$-3(%(" 3(.-2823$, (2
/ &$ 1&$-3(- ADKNV!TDMNR HQDR BBDRR"G@MMDK QK@O@((+S!TNX-N*L

(MRDQS
!TDMNR HQDR BBDRR"G@MMDK

mț̦2mț̦6 1D@K
RS@QR@+S!TNX*L
ENQLDQTOC@SD
QFDMSHMD-NSHBD12#1
/ &$ 1&$-3(- ADKNV!TDMNR HQDR BBDRR"G@MMDK!K@BJ8DKKNV!K@BJ+S!TNX*L

(MRDQS
!TDMNR HQDR BBDRR"G@MMDK/NQS

mț̦2mț̦6 1D@K
+S!M*L
mț̦2mț̦6 1D@K
+S!TNX*L
mț̦2mț̦6 1D@K
+S!TNX*L
ENQLDQTOC@SD
QFDMSHMD-NSHBD12#1
/ &$ 1&$-3(- ADKNV!TDMNR HQDR BBDRR"G@MMDK/NQS+S!TNX-N*L

(MRDQS
!TDMNR HQDR BBDRR"G@MMDK2SAC

mț̦2mț̦6 1D@K
+S!TNX*L
ENQLDQTOC@SD
QFDMSHMD-NSHBD12#1
Wk01/19
6.1

VI
VI
PAGE 92, ARGENTINA, below Buenos Aires Access Channel, Speranza Lt Buoy.
Insert:
Buenos Aires South Access

34°37′·03S 58°18′·30W 997011051 Real
Channel Mirasol Lt Buoy
34°37′·68S 58°20′·07W 997011034 Real
Channel Port Lt Buoy Km 0.9
34°37′·60S 58°19′·83W 997011035 Real
34°37′·52S 58°19′·60W 997011038 Real
34°37′·18S 58°18′·88W 997011046 Real
Channel Port Lt Buoy Km 3
34°36′·90S 58°18′·32W 997011054 Real
34°36′·62S 58°17′·75W 997011056 Real
34°37′·63S 58°19′·47W 997011038 Real
Channel Stbd Lt Buoy Km 1.75
34°37′·45S 58°19′·13W 997011041 Real
Channel Stbd Lt Buoy Km 2.4
34°37′·28S 58°18′·80W 997011045 Real
Channel Stbd Lt Buoy Km 3
34°36′·90S 58°18′·23W 997011055 Real
Channel Stbd Lt Buoy Km 4
Argentine Notice 12/195/18 (RSDRA2018000311611) 1/19
PAGE 102, CHINA, below BDD Obstruction.

Insert:
BDWM Wreck 31°11′·60N 122°12′·34E 994136394 Broadcasts every 3 minutes Virtual
(former update 47/18)

Chinese Notice 49/2145/18 (RSDRA2018000309088) 1/19
PAGE 120, CHINA, below Lianhua Shan Lt Float.

Insert:
Liantgaiyu 003 Wreck 26°13′·00N 119°50′·00E 994136383 Broadcasts every 3 minutes Virtual
PAGE 132, CHINA.

Shun Qiang 2 Wreck.
Delete entry

PAGE 136, CHINA.

WQ 10 Wreck.
Delete entry

PAGE 136, CHINA.

XA27 Wreck.
Delete entry

Wk01/19 6.2
6.2
VI
VI
PAGE 146, CHINA.

ZYJ 288 Wreck.
Delete entry

VOLUME 3, NP283(1), 2018/19

Published Wk 49/18
(Last Updates: Weekly Edition No. 52 dated 27 December 2018)
RADIO WEATHER SERVICES AND NAVIGATIONAL WARNINGS
PAGES 127 and 128, GREENLAND.

AASIAAT, Navigational Warnings table.
Delete table and replace by:
Navigational Warnings
A1, B1: 0905 1305 1805
Storm, gale and ice warnings in English, Greenlandic and Danish – winter broadcast schedule.
2305
A2, B2: On receipt then
0035 0335 0635
Navigational Warnings in English and Danish.
0935 1235 1535
1835 2135
A, B: On request Ice reports in English, Greenlandic and Danish.
1 Summer broadcast schedule for this transmission is one hour earlier than times stated.
2 After Traffic Lists until cancelled
NOTE(S): 1. Scheduled warnings will be announced on 2182 kHz and Ch 16, other warnings will be announced on MF DSC in addition to 2182 kHz and Ch 16,
before being read on the working frequencies. Repeated after the silence period more than half an hour from the first transmission.
2. If no new warnings are received or current warnings are still in force at the time of transmission, the message 'No new warnings received' will be
broadcast.
Greenland Telepost correspondence (RSDRA2018000308516) 1/19
ICE REPORTS
PAGES 297 to 300, FINLAND.

Finnish Transport Agency: Ice Breaking Services, contacts section.
Delete section and replace by:
Finnish Transport Infrastucture Agency: Winter Navigation Unit

+358 295 343000 (Switchboard 0800–1615 LT)
+358 50 4714850 (Operations Service H24 during winter)
Tel: 358 295 343322 (Head of Winter Navigation Unit)
+358 295 343328 (Senior Maritime Officer – traffic restrictions)
+358 295 343326 (Senior Maritime Officer – Lake Saimaa Area)
Fax: –
winternavigation@fta.fi
E-mail:
Tuomas.Taivi@fta.fl (Winter Navigation Specialist)
Website: www.liikennevirasto.fi/web/en/merchant-shipping/winter-navigation
Finnish Notices 33/343/18 and 33/344/18 (RSDRA2018000301827) 1/19
6.3 Wk01/19
6.3
VI
VI
VOLUME 3, NP283(2), 2019/20

Published Wk 50/18
RADIO WEATHER SERVICES AND NAVIGATIONAL WARNINGS
PAGES 170 and 171, GREENLAND.

AASIAAT, Navigational Warnings table.
Delete table and replace by:
Navigational Warnings
A1, B1: 0905 1305 1805
Storm, gale and ice warnings in English, Greenlandic and Danish – winter broadcast schedule.
2305
A2, B2: On receipt then
0035 0335 0635
Navigational Warnings in English and Danish.
0935 1235 1535
1835 2135
A, B: On request Ice reports in English, Greenlandic and Danish.
1 Summer broadcast schedule for this transmission is one hour earlier than times stated.
2 After Traffic Lists until cancelled
NOTE(S): 1. Scheduled warnings will be announced on 2182 kHz and Ch 16, other warnings will be announced on MF DSC in addition to 2182 kHz and Ch 16,
before being read on the working frequencies. Repeated after the silence period more than half an hour from the first transmission.
2. If no new warnings are received or current warnings are still in force at the time of transmission, the message 'No new warnings received' will be
broadcast.
Greenland Telepost correspondence (RSDRA2018000308516) 1/19
Wk01/19 6.4
6.4
VI
VI
VOLUME 6, PART 4, NP 286(4), 2018/19

Published Wk 37/18
––––––––––––––––––
PAGE 203, INDONESIA, KUALATANJUNG, Sumatera, Pilots,

PROCEDURE, below section (2).
Insert:
(3) Pilot boards in position 3°30′·57N 99°27′·41E.
Indonesian Notice 49/541/18, (RSDRA2018000301842), 1/19
––––––––––––––––––––––––––––––
VOLUME 6, PART 5, NP 286(5), 2018/19

Published Wk 44/18
––––––––––––––––––
(Last Updates: Weekly Edition No. 44 dated 1 November 2018)
PAGE 23, CANADA (Atlantic Coast), BELLEDUNE, New Brunswick,

Pilots, PROCEDURE, section (3).
Delete and replace by:
(3) Pilot boards in position 47°56′·00N 65°48′·00W (2 n miles NE of the breakwater).
Transport Safety Board of Canada, (RSDRA2018000301700), 1/19
––––––––––––––––––––––––––––––
1
Wk01/19
6.5
VII
UPDATES TO MISCELLANEOUS ADMIRALTY NAUTICAL PUBLICATIONS
In force 3rd January 2019
Weekly
NP no Page(s) Title Edition
100 The Mariner’s (11th Edition 2016) 50/16

Handbook
192 Submarine Pipelines and Cables 16/18
321 Annex C Flags and Ensigns of Maritime Nations 16/18
322 Annex C Flags and Ensigns of Maritime Nations 16/18
136 Ocean Passages for the (1st Edition 2018) 10/18
World Volume 2
231 Connector Routes. Connector to Connector Routes and Waypoints. 50/18
235 Auckland, Brisbane, Buenaventura and Callao. Port to Port Routes and 50/18
Port to Connector Routes.
239 Gladstone, Harbour of Vancouver (Juan de Fuca Strait) and Hay Point. 50/18
Port to Port Routes and Port to Connector Routes.
243 Lazaro Cardenas, Long Beach and Lyttelton. Port to Port Routes, Port to Connector 50/18
Routes and Waypoints.
245 Melbourne, Newcastle, Oakland and Port Botany. Port to Port Routes and Port to 50/18
Connector Routes.
249 Port Kembla, Quintero, San Jose, San Pedrito Port, Tacoma, Tauranga and 50/18
Townsville. Port to Port Routes and Port to Connector Routes.
7.1
Wk01/19
VIII
ADMIRALTY DIGITAL SERVICES
1. ENC / ECDIS and AVCS
a) Safety Notice
For a graphical way to establish that the ECDIS is correctly displaying the new symbols introduced in IHO S-52 Presentation Library
Edition 4.0 the mariner can check ECDIS Chart 1. ECDIS Chart 1 is a legend of the entire set of symbols that may be used within an
ENC and is installed on all type-approved ECDIS systems. See iho.int for further information.
ECDIS operating with Edition 3.4 of the IHO Presentation Library

From 1st September 2017, ECDIS Systems are required to use Presentation Library edition 4.0. Vessels using previous editions must
upgrade as soon as possible to maintain compliance. The IHO Check Dataset is not required for Presentation Library 4.0.
b) ENCs temporarily withdrawn from AVCS

To review a cumulative list of ENCs temporarily withdrawn from AVCS, please visit the ‘Updates’ tab on:
admiralty.co.uk/AVCS
c) ENC Readme.txt file

The README.TXT file located within the ENC_ROOT folder on the latest AVCS discs contains important safety related information
relating to the use of ENCs in ECDIS. The file is also available on the support tab at admiralty.co.uk/avcs.
This file is updated on a regular basis and should be consulted to ensure that all related issues are taken into consideration.
d) Temporary & Preliminary Notices to Mariners (T&P NMs) in ENCs

The use of T&P NM information is considered an essential part of keeping navigational charts up to date.
The latest confirmed status of T&P NM information in the ENCs that are available in ADMIRALTY services is shown in the ENC-
T&P-NM-Status.pdf file in the INFO folder on the service media and at: admiralty.co.uk/ENC-TP-NMs
Important changes to ADMIRALTY Information Overlay (AIO)
From week 35/2018 (30th August), AIO only shows ADMIRALTY paper T&Ps where they are not already included in the ENCs.
Most countries now include temporary information in their ENCs
The new content is available when the AIO disc is loaded into ECDIS in the normal way. Further guidance can be found in the INFO
folder on AIO discs.
2. ADMIRALTY Products Supporting Digital Navigation
i. ADMIRALTY ENC and ECDIS Maintenance Record (NP133C). This publication is designed to hold paper records on ENC
and ECDIS maintenance to assist information management and support inspections. Please note that V2.0 is the current
edition.
ii. ADMIRALTY Guide to ENC Symbols Used in ECDIS (NP5012). A companion to the ADMIRALTY Guide to Symbols and
Abbreviations Used on Paper Charts, NP5011. The 2nd edition of NP5012 includes the changes highlighted in the new S-52
standards and the new presentation library 4.0.
iii. ADMIRALTY Guide to the Practical Use of ENCs (NP231). Supports ECDIS training on the interpretation and use of ENC
data.
iv. ADMIRALTY Guide to ECDIS Implementation, Policy and Procedures (NP232). Provides clear guidance for any individual
or organisation responsible for the introduction of ECDIS, in particular those involved in the development of detailed ECDIS
operating procedures.
8.1
Wk 01/19
VIII
v. ADMIRALTY Port Approach Guides. Information from a range of official ADMIRALTY charts and publications on one
chart, helping bridge crews to plan for particular approaches and to support Master Pilot Exchange. Expanding coverage of
some of the world's most complex approaches, including Antwerp, Rotterdam and the Panama Canal. More information is
available at admiralty.co.uk/port-approach-guides
3. ADMIRALTY Digital Publications (ADP)

ADP V19 will be released on 10 December 2018 and will be available on the ADP Weekly Update DVD from Week 50 onward.
From 1 January 2019 the UKHO will only support ADP V18 and V19. Users of older versions of ADP should upgrade to a
supported version of ADP before this date as ADMIRALTY Total Tide is no longer updated annually. ADP V18 and V19 allow
users to receive tidal updates as they are made available each week.
ADMIRALTY TotalTide (ATT): German Tidal Stations predicted on LAT

The TotalTide application computes predictions for all German tidal stations based on Lowest Astronomical Tide (LAT).
Mariners using charts which refer to Mean Low Water Springs (MLWS) in German waters, must deduct 0.5m from all predicted tidal
heights for these ports before applying them to the depths on those charts to determine the correct predicted depth of water. This advice
will also be contained in the ‘Notes’ tab on the Prediction Windows in TotalTide for each German tidal station.
For information: Ensure that Activation Key Requests and Update Data Requests for ADP are sent to ADPMailGateway@ukho.gov.uk
4. Status of ADMIRALTY Digital Services
Update status table
Product Last issue date/Week Reissue Date/Week

i. ADMIRALTY Vector Chart Service (AVCS) Base CD 06 December 2018 - 49 31 January 2019 - 05
ii. ADMIRALTY Information Overlay (AIO) CD which contains
20 December 2018 - 51
both the base data and the latest updates
iii. ADMIRALTY Raster Chart Service (ARCS) Regional disc 1 19 July 2018 - 29 07 February 2019 - 06
ADMIRALTY Raster Chart Service (ARCS) Regional disc 2 24 May 2018 - 21 24 January 2019 - 04
ADMIRALTY Raster Chart Service (ARCS) Regional disc 3 27 September 2018- 39
ADMIRALTY Raster Chart Service (ARCS) Regional disc 4 28 June 2018 - 26
ADMIRALTY Raster Chart Service (ARCS) Regional disc 5 29 November 2018 - 48
ADMIRALTY Raster Chart Service (ARCS) Regional disc 6 2 August 2018 - 31 21 February 2019 - 08
ADMIRALTY Raster Chart Service (ARCS) Regional disc 7 18 October 2018 - 42
ADMIRALTY Raster Chart Service (ARCS) Regional disc 8 06 September 2018 - 36
ADMIRALTY Raster Chart Service (ARCS) Regional disc 9 13 December 2018 - 50
ADMIRALTY Raster Chart Service (ARCS) Regional disc 10 1 November 2018 - 44
23 August 2018 – 34
ADMIRALTY Raster Chart Service (ARCS) Regional disc 11
Small-scale Planning Charts
ADMIRALTY Vector Chart Service (AVCS) DVDs and ADMIRALTY Information Overlay (AIO) CDs are issued
weekly and contain all base and update data available at the time of issue.
5. Supported ADMIRALTY Software Versions
Product Supported Versions

ADP 17, 18
ADMIRALTY e-Reader 1.3
ADMIRALTY Planning Station 3.4
ADMIRALTY gateway 4.2, 4.4
NavPac and Compact Data 3.4, 4.0
If you are using an older version which is not supported, you should contact your Chart Agent to upgrade to the latest
version as soon as possible.
8.2
Wk 01/19
HYDROGRAPHIC NOTE FOR PORT
H.102A
INFORMATION (V7.0 Jan 2013)
(To accompany Form H.102)
Reporting Port Information affecting ADMIRALTY Products
NAME OF PORT
APPROXIMATE POSITION Latitude Longitude
GENERAL REMARKS
Principal activities and trade.
Latest population figures and date.
Number of ships or tonnage handled per

year.
Maximum size of vessel handled.
Copy of Port Handbook (if available).
ANCHORAGES
Designation, depths, holding ground,
shelter afforded.
PILOTAGE
Authority for requests.
Embark position.
Regulations.
DIRECTIONS
Entry and berthing information.
Tidal streams.
Navigational aids.
TUGS
Number available.
WHARVES
Names, numbers or positions & lengths.
Depths alongside.
CARGO HANDLING
Containers, lighters, Ro-Ro etc.
REPAIRS
Hull, machinery and underwater.
Shipyards.
Docking or slipping facilities.

(Give size of vessels handled or
dimensions)
Divers.
HYDROGRAPHIC NOTE FOR PORT
H.102A
INFORMATION (V7.0 Jan 2013)
RESCUE AND DISTRESS

Salvage, Lifeboat, Coastguard, etc.
SUPPLIES
Fuel.
(with type, quantities and methods of
delivery)
Fresh water.
(with method of delivery and rate of
supply)
Provisions.
SERVICES
Medical.
Ship Sanitation.
Garbage and slops.
Ship chandlery, tank cleaning, compass

adjustment, hull painting.
COMMUNICATIONS
Nearest airport or airfield.
Port radio and information service. (with

frequencies and hours of operating)
PORT AUTHORITY
Designation, address, telephone, e-mail
address and website.
VIEWS
Photographs (where permitted) of the
approaches, leading marks, the entrance
to the harbour etc.
ADDITIONAL DETAILS
NOTES:
1. Form H.I02A lists the information required for ADMIRALTY Sailing Directions and has been designed to help the
sender and the recipient. The sections should be used as an aide-memoir, being used or followed closely,
whenever appropriate. Where there is insufficient space on the form an additional sheet should be used.
2. Reports which cannot be confirmed or are lacking in certain details should not be withheld. Shortcomings
should be stressed and any firm expectation of being able to check the information on a succeeding voyage should
be mentioned.
HYDROGRAPHIC NOTE FOR
GNSS OBSERVATIONS AGAINST CORRESPONDING BRITISH ADMIRALTY H.102B
(V7.0 Jan 2014)
CHART POSITIONS
Chart/ENC in use
(SEE NOTE 3a) Latitude/Longitude of position read Latitude/Longitude of position read from Additional
Time/Date of
Edition Date & from Chart/ECDIS GNSS Receiver (on WGS84) Information/Remarks
Observation Number /
NM / ENC (SEE NOTE 3b) (SEE NOTE 3c) (SEE NOTE 3d)
ENC
update status
HYDROGRAPHIC NOTE FOR
GNSS OBSERVATIONS AGAINST CORRESPONDING BRITISH ADMIRALTY H.102B
(V7.0 Jan 2014)
CHART POSITIONS
NOTES:
1. This form is designed to assist in the reporting of observed differences between WGS84 datum and the geodetic datum of British
ADMIRALTY Charts by mariners, including yachtsmen and should be submitted as an accompaniment to Form H.102 (full instructions
for the rendering of data are on Form H.102). Where there is insufficient space on the form an additional sheet should be used.
2. Objective of GNSS Data Collection
The UK Hydrographic Office would appreciate the reporting of Global Navigation Satellite Systems (GNSS) positions, referenced to WGS84 datum, at
identifiable locations or features on British ADMIRALTY Charts. Such observations could be used to calculate positional shifts between WGS84 datum and the
geodetic datum for those British ADMIRALTY Charts which it has not yet been possible to compute the appropriate shifts. These would be incorporated in future
new editions or new charts and promulgated by Preliminary Notices to Mariners in the interim.
It is unrealistic to expect that a series of reported WGS84 positions relating to a given chart will enable it to be referenced to that datum with the accuracy
required for geodetic purposes. Nevertheless, this provides adequate accuracy for general navigation, considering the practical limits to the precision of 0.2mm
(probably the best possible under ideal conditions – vessel alongside, good light, sharp dividers etc), this represents 10 metres on the ground at a chart scale of
1:50.000.
It is clear that users prefer to have some indication of the magnitude and direction of the positional shift, together with an assessment of its likely accuracy,
rather than be informed that a definitive answer cannot be formulated. Consequently, where a WGS84 version has not yet been produced, many charts now
carry approximate shifts relating WGS84 datum to the geodetic datum of the chart. Further observations may enable these values to be refined with greater
confidence.
3. Details required
a. It is essential that the chart number, edition date and its correctional state (latest NM) are stated. For ENCs, please state the ENC name and latest
update applied.
b. Position (to 2 decimal places of a minute) of observation point, using chart graticule or, if ungraduated, relative position by bearing/distance from
prominent charted features (navigation lights, trig. points, church spires etc.).
c. Position (to 2 decimal places of a minute) of observation point, using GNSS Receiver. Confirm that GNSS positions are referenced to WGS84 datum.
d. Include GNSS receiver model and aerial type (if known). Also of interest: values of PDOP, HDOP or GDOP displayed (indications of theoretical
quality of position fixing depending upon the distribution of satellites overhead) and any other comments.
HYDROGRAPHIC NOTE – H.102 INSTRUCTIONS (V9.0 Dec 2017)
1. Mariners are requested to notify the United Kingdom Hydrographic Office (UKHO) when new or suspected dangers to
navigation are discovered, changes observed in aids to navigation, or corrections to publications are seen to be necessary.
Mariners can also report any ENC display issues experienced. The Mariner's Handbook (NP100) Chapter 4 gives general
instructions. The provisions of international and national laws should be complied with when forwarding such reports.
2. Accurate position or knowledge of positional error is of great importance. Where latitude and longitude have been used to
specifically position the details of a report, a full description of the method used to obtain the position should be given. Where
possible the position should be fixed by GPS or Astronomical Observations. A full description of the method, equipment,
time, estimated error and datum (where applicable) used should be given. Where the position has been recorded from a
smart phone or tablet, this is to be specifically mentioned. When position is defined by sextant angles or bearings (true or
magnetic to be specified), more than two should be used to provide a redundancy check. Where position is derived from
Electronic Position Fixing (e.g. LORAN C) or distances observed by radar, the raw readings of the system in use should be
quoted wherever possible. Where position is derived after the event, from other observations and / or Dead Reckoning, the
methodology of deriving the position should be included.
3. Paper Charts: A cutting from the largest scale chart is often the best medium for forwarding details, the alterations and
additions being shown thereon in red. When requested, a new copy will be sent in replacement of a chart that has been
used to forward information, or when extensive observations have involved defacement of the observer's chart. If it is
preferred to show the amendments on a tracing of the largest scale chart (rather than on the chart itself) these should be in
red as above, but adequate details from the chart must be traced in black ink to enable the amendments to be fitted correctly.
4. ENCs: A screen shot of the largest scale usage band ENC with the alterations and additions being shown thereon in red.
If it is to report an issue with the display of an ENC, a screen shot of the affected ENC should be sent along with details of
the ECDIS make, model or age and version in use at the time.
5. When soundings are obtained The Mariner's Handbook (NP100) should where possible be consulted. It is important to
ensure that full details of the method of collection are included with the report. This should include but not limited to:
(a) Make, model and type of echo sounder used.
(b) Whether the echo sounder is set to register depths below the surface or below the keel; in the latter case the vessel's
draught should be given.
(c) Time, date and time zone should be given in order that corrections for the height of the tide may be made where
necessary, or a statement made as to what corrections for tide have already been made.
(d) Where larger amounts of bathymetric data have been gathered, only those areas where a significant difference to
the current chart or ENC should be specifically mentioned on the H102. The full data set may also be sent in, with
an additional note added to this effect. If no significant differences are noted, the bathymetric data may still be of
use, and sent in accordingly. Where full data sets are included, a note as to the data owner and their willingness for
the data to be incorporated into charts and ENCs included.
6. For Echo Sounders that use electronic ‘range gating’, care should be taken that the correct range scale and
appropriate gate width are in use. Older electro-mechanical echo sounders frequently record signals from echoes
received back after one or more rotations of the stylus have been completed. Thus, with a set whose maximum range is
500m, an echo recorded at 50m may be from depths of 50m, 550m or even 1050m. Soundings recorded beyond the set's
nominal range can usually be recognised by the following:
(a) the trace being weaker than normal for the depth recorded;
(b) the trace passing through the transmission line;
(c) the feathery nature of the trace.
As a check that apparently shoal soundings are not due to echoes received beyond the set's nominal range,
soundings should be continued until reasonable agreement with charted soundings is reached. However,
soundings received after one or more rotations of the stylus can still be useful and should be submitted if they
show significant differences from charted depths.
7. Reports which cannot be confirmed or are lacking in certain details should not be withheld. Shortcomings should
be stressed and any firm expectation of being able to check the information on a succeeding voyage should be mentioned.
8. Reports of shoal soundings, uncharted dangers and aids to navigation out of order should, at the mariner's discretion, also
be made by radio to the nearest coast radio station. The draught of modern tankers is such that any uncharted depth under
30 metres or 15 fathoms may be of sufficient importance to justify a radio message.
9. Changes to Port Information should be forwarded on Form H.102A and any GPS/Chart Datum observations should be
forwarded on Form H.102B together with Form H.102. Where there is insufficient space on the forms additional sheets
should be used.
10. Reports on ocean currents, magnetic variations and other marine observations should be made in accordance with
The Mariner's Handbook (NP100) Chapter 4 with forms also available at admiralty.co.uk/MSI.
Note. - An acknowledgement or receipt will be sent and the information then used to the best advantage which may mean
immediate action or inclusion in a revision in due course; for these purposes, the UKHO may make reproductions of any
material supplied. When a Notice to Mariners is issued, the sender's ship or name is quoted as authority unless (as
sometimes happens) the information is also received from other authorities or the sender states that they do not want to
be named by using the appropriate tick box on the form. An explanation of the use made of contributions from all parts of
the world would be too great a task and a further communication should only be expected when the information is of
outstanding value or has unusual features.
Hydrographic Note – H.102
Reporting information affecting ADMIRALTY Maritime Products & Services
For emergency information affecting safety of life at sea forward to: navwarnings@btconnect.com
Or alternatively contact T: +44 (0)1823 353448 (direct line) F: +44 (0)1823 322352
For new information affecting all ADMIRALTY Charts and Publications forward to: sdr@ukho.gov.uk
This form H.102 and instructions are available online: admiralty.co.uk/msi
Date Ref. number

Name of ship or sender IMO number
Address and general locality
E-mail / Tel / Fax of sender
Subject
Position
Latitude Longitude
(see Instruction 2)
GPS Datum Accuracy
ADMIRALTY Charts affected Edition
Latest Weekly Edition of

Notices to Mariners (NMs) held
Replacement copy of chart number IS / IS NOT required
(see Instruction 3)
ENCs affected
Latest update disk applied Week:
Make, model and or age of ECDIS if

applicable
Publications affected
(e-NP / DP number, edition number)
Date of latest supplement/update,
page & Light List number etc.
Details of anomaly / observation:
Name of observer / reporter
H.102A submitted Yes No H.102B submitted Yes No
Tick box if not willing to be named as source of this information
Alternatively use our H-Note App located here:

admiralty.co.uk/H-note

01wknm19 Week01 2019

Caricato da

Informazioni sul documento

Titolo originale

Copyright

Formati disponibili

Condividi questo documento

Condividi o incorpora il documento

Opzioni di condivisione

Hai trovato utile questo documento?

Questo contenuto è inappropriato?

Copyright:

Formati disponibili

01wknm19 Week01 2019

Caricato da

Copyright:

Formati disponibili

Notices

I Explanatory Notes. Publications List

For UKHO use only 219401

$GREH$FUREDW5HDGHU 9HUVLRQRUODWHU 5HDGHUVRIWZDUHFDQEHREWDLQHGGLUHFWIURPWKH$GREH

ADMIRALTY NOTICES TO MARINERS

Planning for the future

Admiralty Way, Taunton, Somerset

Find out more about our market-leading

and are trademarks of the Secretary of State for Defence

ADMIRALTY Charts International Chart

210 INT 1288

 denotes chart available in the ADMIRALTY Raster Chart Service series.

NEW EDITIONS OF ADMIRALTY CHARTS AND PUBLICATIONS

New Editions of ADMIRALTY Charts 03 January 2019

Includes significant safety-related information as follows: changes to

Note: On publication of this New Edition former Notice 5829(P)/18 is

1912 Morocco, Approaches to Tanger. 1:30,000 20 40, 52

Includes significant safety-related information as follows: changes to

Includes changes to depths, wrecks, obstructions, fouls and maritime

Note: On publication of this New Edition former Notice 5582(P)/18 is

 denotes chart available in the ADMIRALTY Raster Chart Service series.

NEW EDITIONS OF ADMIRALTY CHARTS AND PUBLICATIONS

New Editions of ADMIRALTY Charts 03 January 2019 (continued)

4932 Canada, British Columbia/Colombie-Britannique, Grenville Channel. 1:40,000 91 108

Includes significant safety-related information as follows: changes to

Note: On publication of this New Edition former Notice 5828(P)/18 is

5127 Routeing Chart North Pacific Ocean. 1:20,000,000 - 142

Meteorological data has been updated throughout these routeing charts.

8251 Port Approach Guide Casablanca and Mohammedia. - 20 144

Includes new port developments and channel and changes to restricted

Note: On publication of this New Edition former Notice 465(P)/17,

NP No. Title and other remarks Date Remarks

ISBN Number: 978-0-70-772-3945

 denotes chart available in the ADMIRALTY Raster Chart Service series.

ADMIRALTY CHARTS TO BE PUBLISHED 17 January 2019

New Editions of ADMIRALTY Charts

210 Scotland - East Coast, Newburgh to Montrose. 1:75,000 210 6

Includes significant safety-related information as follows: A new

Includes significant safety-related information as follows: changes

8217 Port Approach Guide Ningbo Gang, Beilun. - 8217 50

Includes changes to coastline and depth areas.

8219 Port Approach Guide Zhoushan. - 8219 50

Includes changes to coastline and depths.

ADMIRALTY CHARTS AND PUBLICATIONS PERMANENTLY WITHDRAWN

1912 Morocco, Approaches to Tanger. 1912

4932 Canada, British Columbia/Colombie-Britannique, Grenville Channel. 4932

5127 Routeing Chart North Pacific Ocean. 5127

8251 Port Approach Guide Casablanca and Mohammadia. 8251

 denotes chart available in the ADMIRALTY Raster Chart Service series.

NP131 - Catalogue of ADMIRALTY Charts (NP131), 2019 Edition

Wärtsilä Voyage Middle East

Wärtsilä Voyage Shanghai Co., Ltd

Wärtsilä Voyage Greece Branch

Wärtsilä Voyage Germany GmbH

 denotes chart available in the ADMIRALTY Raster Chart Service series.

NP131 - Catalogue of ADMIRALTY Charts (NP131), 2019 Edition

Wärtsilä Voyage Mediterranean Sas

Page 7, Distributor Section,

Wärtsilä Voyage Sweden AB

Wärtsilä Software Technologies (AO)

This is an amendment of current listing Transas Marine (Russia)

 denotes chart available in the ADMIRALTY Raster Chart Service series.

ADMIRALTY CHART AGENT / DISTRIBUTOR INFORMATION

$GREH$FUREDW5HDGHU9HUVLRQRUODWHU5HDGHUVRIWZDUHFDQEHREWDLQHGGLUHFWIURPWKH$GREH