Documenti di Didattica
Documenti di Professioni
Documenti di Cultura
1473--1608/19
Current Nautical Publications
Updates to ADMIRALTY Sailing Directions in Force
Cumulative List for ADMIRALTY List of Radio Signals
ADMIRALTY
NOTICES TO MARINERS
Weekly Edition 13
28 March 2019
(Published on the ADMIRALTY website 18 March 2019)
CONTENTS
For information on how to update your ADMIRALTY products using ADMIRALTY Notices to
Mariners, please refer to NP294 How to Keep Your ADMIRALTY Products Up--to--Date.
Mariners are requested to inform the UKHO immediately of the discovery of new or suspected
dangers to navigation, observed changes to navigational aids and of shortcomings in both paper
and digital ADMIRALTY Charts or Publications.
The H--Note App helps you to send H--Notes to the UKHO, using your device’s camera, GPS and
email. It is available for free download on Google Play and on the App Store.
The Hydrographic Note Form (H102) should be used to forward this information and to report any
ENC display issues.
H102A should be used for reporting changes to Port Information.
H102B should be used for reporting GPS/Chart Datum observations.
Copies of these forms can be found at the back of this bulletin and on the UKHO website.
The following communication facilities are available:
NMs on ADMIRALTY website: Web: admiralty.co.uk/msi
Searchable Notices to Mariners: Web: www.ukho.gov.uk/nmwebsearch
Urgent navigational information: e--mail: navwarnings@ukho.gov.uk
Phone: +44(0)1823 353448
Fax: +44(0)1823 322352
H102 forms e--mail: sdr@ukho.gov.uk
(see back pages of this Weekly Edition) Post: UKHO, Admiralty Way, Taunton,
Somerset, TA1 2DN, UK
All other enquiries/information e--mail: customerservices@ukho.gov.uk
Phone: +44(0)1823 484444 (24/7)
Crown Copyright 2019. All rights Reserved. Permission is not required to make analogue or PDF copies
of these Notices, but such copies may not be sold without the permission of the UKHO. For permission to
sell copies of the Notices or to make (non -- PDF) digital copies please email
intellectual.property@ukho.gov.uk
*8,'$1&(127(6)257+(86(2)$'0,5$/7<127,&(6720$5,1(56
217+(8.+2:(%6,7(
7KH:HHNO\1RWLFHVWR0DULQHUV10XSGDWHVIRUSDSHU&KDUWVDQG3XEOLFDWLRQVFDQEHDFFHVVHGYLD
DGPLUDOW\FRXNPVL RU WKH VHDUFKDEOH 10 :HEVLWH ZZZXNKRJRYXNQPZHEVHDUFK 7KH ODWHVW
GLJLWDO 10 :HHNO\ XSGDWH LV DYDLODEOH GD\V SULRU WR WKH SDSHU SXEOLFDWLRQ GDWH WKHUH DUH QR
VXEVFULSWLRQIHHVIRUDFFHVVWRWKH8.+21RWLFHVWR0DULQHUV:HEVLWH
1%7KH10GDWDEDVHLQFOXGHVKLVWRULFDO10GDWDIURP-DQXDU\IRU10VSULRUWRWKH
&XPXODWLYH/LVWRI1RWLFHVWR0DULQHUV13%PXVWEHXVHG
6RIWZDUHUHTXLUHG
)857+(5*8,'$1&(127(6
)RU IXUWKHU GHWDLOV RI WKH RQOLQH 10 IDFLOLWLHV SOHDVH VHH WKH 10 *XLGDQFH 1RWHV RQ WKH ZHEVLWH
DGGLWLRQDOGHWDLOLQFOXGHV
)LOHFRQWHQWDQGGHVFULSWLRQ
3&DQGSULQWHUVSHFLILFDWLRQV
&86720(56(59,&(
,I\RXH[SHULHQFHDQ\GLIILFXOWLHVSOHDVHFRQWDFWWKH8.+2&XVWRPHU6HUYLFHRQ
7HO
HPDLOFXVWRPHUVHUYLFHV#XNKRJRYXN
Wk13/19
,
:KLOHHYHU\HIIRUWLVPDGHWRHQVXUHWKDWWKHGDWDSURYLGHGWKURXJKWKH1RWLFHVWR0DULQHUV
VHUYLFHLVDFFXUDWHWKHXVHUQHHGVWREHDZDUHRIWKHULVNVRIFRUUXSWLRQWRGDWD,WLVLPSRUWDQW
WKDWWKHXVHUVKRXOGRQO\XVHWKHGDWDRQVXLWDEOHHTXLSPHQWDQGWKDWRWKHUDSSOLFDWLRQVVKRXOG
QRW EH UXQQLQJ RQ WKH XVHU¶V PDFKLQH DW WKH VDPH WLPH 8VHUV VKRXOG H[HUFLVH WKHLU
SURIHVVLRQDOMXGJHPHQWLQWKHXVHRIGDWDDQGDOVRFRQVXOWWKH0DULQHUV¶+DQGERRN13
IRUIXUWKHUGHWDLOV
7KH XVHU QHHGV WR EH DZDUH WKDW WKHUH LV D SRVVLELOLW\ WKDW GDWD FRXOG EH FRUUXSWHG GXULQJ
WUDQVPLVVLRQRULQWKHSURFHVVRIGLVSOD\RUSULQWLQJRQWKHXVHU¶VHTXLSPHQWRULIFRQYHUWHG
WR RWKHU VRIWZDUH IRUPDWV DQG LV DFFRUGLQJO\ DGYLVHG WKDW WKH 8.+2 FDQQRW DFFHSW
UHVSRQVLELOLW\ IRU DQ\ VXFK FKDQJH RU DQ\ PRGLILFDWLRQV RU XQDXWKRULVHG FKDQJHV PDGH E\
OLFHQVHHVRURWKHUSDUWLHV
© Crown Copyright 2018. All rights reserved. Correct at the time of publishing.
Wk13/19
,
EXPLANATORY NOTES
Dating
Weekly Notices are dated for the Thursday appropriate to the week that the printed version is despatched from the UKHO.
They are available earlier from the UKHO website.
Section I - Publications List
At the beginning of the Publications List is an index of ADMIRALTY Charts affected by the Publications List. Thereafter
there are a number of standard lists which contain details and announcements concerning charts and publications relevant for
the particular Weekly Notice. Full details of how to use the various lists contained in Section I are available in NP294.
Special Announcements and Errata are occasionally included at the end of this Section.
Section IA - Temporary and Preliminary (T&P) Notices
A list of T&P Notices in force (along with a list of those cancelled during the previous month), is included in the Weekly NM
each month (see below).
Section IB - Current Nautical Publications
Information about Publications including the current edition numbers is included in the Weekly NM at the end of March,
June, September and December.
Section II - Updates to Standard Nautical Charts
The notices in Section II give instructions for the updating of standard nautical charts and selected thematic charts in the
ADMIRALTY series. Geographical positions refer to the horizontal datum of the current edition of each affected chart
which is stated in the notice alongside the appropriate chart number. Positions are normally given in degrees, minutes and
decimals of a minute, but may occasionally quote seconds for convenience when plotting from the graduation of some older-
style charts. Where Leisure Products are referred to different horizontal datums from the standard nautical charts for that
geographical area, positions in the notices cannot be plotted directly on these products. Bearings are true reckoned clockwise
from 000° to 359°; those relating to lights are from seaward. Symbols referred to are those shown in NP5011. Depths and
heights are given in metres or fathoms and/or feet as appropriate for the chart being updated (abbreviated where necessary to
m, fm and ft respectively). Blocks and notes accompanying notices in Section II are placed towards the end of the section.
T&P Notices. These are indicated by (T) or (P) after the notice number and are placed at the end of Section II. They are
printed on one side of the paper in order that they may be cut up and filed. To assist in filing, the year is indicated after the
notice number and an in-force list is published monthly. Information from these notices is not included on charts before
issue; charts should be updated in pencil on receipt. Associated diagrams are reproduced with Blocks at the end of Section II.
Original Information. A star (*) adjacent to the number of a notice indicates that the notice is based on original
information.
Section III - Navigational Warnings
NAVAREA I Navigational Warnings in force at the specified time quoted in the header are reprinted in Section III. It is
recommended that this reprint should be kept in a file or book, followed by subsequent weekly reprints. Only the most
convenient ADMIRALTY Chart is quoted. The full text of all Warnings in force is included in Weeks 1, 13, 26 and 39 each
year.
Section IV - Sailing Directions
Updates to all Sailing Directions are given in Section IV of ADMIRALTY Notices to Mariners. Those in force at the end of
the year are reprinted in NP247(2) Annual Summary of ADMIRALTY Notices to Mariners Part 2. A list of updates in force is
published in Section IV of the Weekly Edition quarterly. Full details of how to keep Sailing Directions up-to-date can be
found in NP294 How to Keep Your ADMIRALTY Products Up-to-Date.
Section V - Lights
Updates to all the List of Lights are given in Section V and may be published in an earlier edition than the chart-updating
notice. The entire entry for each light updated will be printed (including minor changes) and an asterisk (*) will denote which
column contains a change. In the case of a new light, or where a new sequence is added below the main light, an asterisk (*)
will appear under all columns. All Section V entries are intended to be cut out and pasted into the appropriate volume. It is
emphasised that the List of Lights is the primary source of information on lights and that many alterations, especially those of
a temporary but operational nature, are promulgated only as updates to the List of Lights. Light positions should be
regarded as approximate and are intended to indicate the relative positions of lights only. Charts should be consulted for a
more authoritative position. When a light is affected by a separate chart-updating notice, its Light List number is always
included in the relevant text contained in Section II. The range of a light is normally the nominal range, except when the
responsible authority quotes luminous or geographical range - see special remarks for ranges used by each country.
Wk13/19
,
6HFWLRQ9,5DGLR6LJQDOV
8SGDWHVWRDOOWKH5DGLR6LJQDOVDUHJLYHQLQ6HFWLRQ9,:KHQDFKDUWXSGDWLQJQRWLFHLVLVVXHGIRULQIRUPDWLRQWKDWLVDOVR
LQFOXGHG ZLWKLQ WKH 5DGLR 6LJQDOV WKH DSSURSULDWH YROXPH UHIHUHQFH QXPEHU LV TXRWHG IROORZHG LQ SDUHQWKHVHV E\ WKH
QXPEHURIWKH:HHNO\(GLWLRQFRQWDLQLQJLQ6HFWLRQ9,WKHFRUUHVSRQGLQJXSGDWHWRWKHVHUYLFHGHWDLOV7KHXSGDWHVLQ
6HFWLRQ9,VKRXOGEHFXWRXWDQGSDVWHGLQWRWKHDSSURSULDWHYROXPHV
6HFWLRQ9,,0LVFHOODQHRXV3XEOLFDWLRQV
8SGDWHVWRWKHIROORZLQJVHOHFWHGPLVFHOODQHRXV1DXWLFDO3XEOLFDWLRQVDUHFRQWDLQHGLQ6HFWLRQ9,,
13 7KH0DULQHU¶V+DQGERRN
13$ 3DSHU&KDUW0DLQWHQDQFH5HFRUG
13& (1&0DLQWHQDQFH5HFRUG
13 $'0,5$/7<*XLGHWRWKH3UDFWLFDO8VHRI(1&V
13 $'0,5$/7<*XLGHWR,PSOHPHQWDWLRQ3ROLF\DQG3URFHGXUHV
13 +RZWR.HHS\RXU$'0,5$/7<3URGXFWV8SWRGDWH
13 $'0,5$/7<2FHDQ3DVVDJHVIRUWKH:RUOG±$WODQWLF2FHDQ
13 $'0,5$/7<2FHDQ3DVVDJHVIRUWKH:RUOG±,QGLDQDQG3DFLILF2FHDQV
13 $'0,5$/7<'LVWDQFH7DEOHV±$WODQWLF2FHDQ
13 $'0,5$/7<'LVWDQFH7DEOHV±3DFLILF2FHDQ
13 $'0,5$/7<'LVWDQFH7DEOHV±,QGLDQ2FHDQ
13 ,$/$0DULWLPH%XR\DJH6\VWHP
13 6\PEROVDQG$EEUHYLDWLRQVXVHGRQ$'0,5$/7<3DSHU&KDUWV
13 $'0,5$/7<*XLGHWR(1&6\PEROVXVHGLQ(&',6
$OO7LGHV3XEOLFDWLRQV
1DXWLFDO$OPDQDF3XEOLFDWLRQVLQFOXGLQJ6LJKW5HGXFWLRQ7DEOHV
6HFWLRQ9,,,±$'0,5$/7<'LJLWDO6HUYLFHV
,QIRUPDWLRQUHOHYDQWWR$'0,5$/7<'LJLWDO6HUYLFHV
)XUWKHU*XLGDQFH
7KH0DULQHU¶V+DQGERRN13JLYHVDIXOOHUH[SODQDWLRQRIWKHOLPLWDWLRQVRIFKDUWVDQGGHWDLOVRIWKH8.+2SROLF\IRU
WKHSURPXOJDWLRQDQGVHOHFWLRQRIQDYLJDWLRQDOO\VLJQLILFDQWLQIRUPDWLRQIRUFKDUWV'HWDLOVRIFKDUWXSGDWLQJPHWKRGVFDQEH
IRXQG LQ ³+RZ WR .HHS <RXU $'0,5$/7< 3URGXFWV 8SWRGDWH´ 13 $OO XVHUV DUH DGYLVHG WR VWXG\ WKHVH
SXEOLFDWLRQV
&$87,21$5<127(6
8SGDWLQJ
8SGDWLQJ LQIRUPDWLRQ LV SXEOLVKHG E\ :HHNO\ 1RWLFHV WR 0DULQHUV VXSSOHPHQWHG E\ QDYLJDWLRQDO ZDUQLQJV IRU LWHPV RI
LPPHGLDWHLPSRUWDQFH,WVKRXOGEHERUQHLQPLQGWKDWWKH\PD\EHEDVHGRQUHSRUWVZKLFKFDQQRWDOZD\VEHYHULILHGEHIRUH
SURPXOJDWLRQDQGWKDWLWLVVRPHWLPHVQHFHVVDU\WREHVHOHFWLYHDQGSURPXOJDWHRQO\WKHPRUHLPSRUWDQWLWHPVWRDYRLG
RYHUORDGLQJXVHUVWKHUHPDLQGHUEHLQJLQFOXGHGLQUHYLVHGHGLWLRQVRIWKHFKDUWVDQGSXEOLFDWLRQVFRQFHUQHG
/DZVDQG5HJXODWLRQV
:KLOHLQWKHLQWHUHVWVRIWKHVDIHW\RIVKLSSLQJWKH8.+2PDNHVHYHU\HQGHDYRXUWRLQFOXGHLQLWVSXEOLFDWLRQVGHWDLOVRIWKH
ODZVDQGUHJXODWLRQVRIDOOFRXQWULHVDSSHUWDLQLQJWRQDYLJDWLRQLWPXVWEHFOHDUO\XQGHUVWRRG
aWKDWQROLDELOLW\ZKDWVRHYHUFDQEHDFFHSWHGIRUIDLOXUHWRSXEOLVKGHWDLOVRIDQ\SDUWLFXODUODZRUUHJXODWLRQDQG
bWKDWSXEOLFDWLRQRIWKHGHWDLOVRIDODZRUUHJXODWLRQLVVROHO\IRUWKHVDIHW\DQGFRQYHQLHQFHRIVKLSSLQJDQGLPSOLHVQR
UHFRJQLWLRQRIWKHLQWHUQDWLRQDOYDOLGLW\RIWKHODZRUUHJXODWLRQ
5HOLDQFHRQ&KDUWVDQG$VVRFLDWHG3XEOLFDWLRQV
:KLOH HYHU\ HIIRUW LV PDGH WR HQVXUH WKH DFFXUDF\ RI WKH LQIRUPDWLRQ RQ $'0,5$/7< FKDUWV DQG ZLWKLQ QDXWLFDO
SXEOLFDWLRQVLWVKRXOGEHDSSUHFLDWHGWKDWLWPD\QRWDOZD\VEHFRPSOHWHDQGXSWRGDWH7KHPDULQHUPXVWEHWKHILQDOMXGJH
RIWKHUHOLDQFHKHFDQSODFHRQWKHLQIRUPDWLRQJLYHQEHDULQJLQPLQGKLVSDUWLFXODUFLUFXPVWDQFHVORFDOSLORWDJHJXLGDQFH
DQGWKHMXGLFLRXVXVHRIDYDLODEOHDLGVWRQDYLJDWLRQ
&KDUWV
&KDUWVVKRXOGEHXVHGZLWKSUXGHQFH WKHUHDUHDUHDVZKHUH WKHVRXUFHGDWDDUHROG LQFRPSOHWHRURISRRUTXDOLW\7KH
PDULQHUVKRXOGXVHWKHODUJHVWVFDOHDSSURSULDWHIRUKLVSDUWLFXODUSXUSRVHDSDUWIURPEHLQJWKHPRVWGHWDLOHGWKHODUJHU
VFDOHVDUHXVXDOO\XSGDWHGILUVW:KHQH[WHQVLYHQHZLQIRUPDWLRQVXFKDVDQHZK\GURJUDSKLFVXUYH\LVUHFHLYHGVRPH
PRQWKV PD\ HODSVH EHIRUH LW FDQ EH IXOO\ LQFRUSRUDWHG LQ SXEOLVKHG FKDUWV 2Q VPDOO VFDOH FKDUWV RI RFHDQ DUHDV ZKHUH
K\GURJUDSKLFLQIRUPDWLRQLVLQPDQ\FDVHVVWLOOVSDUVHFKDUWHGVKRDOVPD\EHLQHUURUDVUHJDUGVSRVLWLRQOHDVWGHSWKDQG
H[WHQW8QGLVFRYHUHGGDQJHUVPD\H[LVWSDUWLFXODUO\DZD\IURPZHOOHVWDEOLVKHGURXWHV
6DWHOOLWH'HULYHG3RVLWLRQVDQG&KDUW$FFXUDF\
0DULQHUVPXVWQRWDVVXPHWKDWFKDUWVZKLFKDUHUHIHUUHGWR:*6'DWXPRUWKRVHIRUZKLFKVKLIWVWR:*6'DWXPDUH
SURYLGHGKDYHEHHQVXUYH\HGWRPRGHUQVWDQGDUGVRIDFFXUDF\2QVRPHFKDUWVRZLQJWRWKHDJHDQGTXDOLW\RIWKHVRXUFH
LQIRUPDWLRQVRPHRIWKHFKDUWHGGHWDLOPD\QRWEHSRVLWLRQHGDFFXUDWHO\,QVXFKFDVHVPDULQHUVDUHDGYLVHGWRH[HUFLVH
SDUWLFXODUFDXWLRQZKHQQDYLJDWLQJLQWKHYLFLQLW\RIGDQJHUVHYHQZKHQXVLQJDQHOHFWURQLFSRVLWLRQLQJV\VWHPVXFKDV*36
)RUIXUWKHUGHWDLOVVHH7KH0DULQHU¶V+DQGERRN137KLVDSSOLHVWRERWKSDSHUDQGGLJLWDO$'0,5$/7<5DVWHU
&KDUW6HUYLFHDQG(1&YHUVLRQVRIFKDUWV
Wk13/19
I
[13/19]
ADMIRALTY Charts affected by the Publication List
Wk13/19 1.6
I
ADMIRALTY CHARTS AND PUBLICATIONS NOW PUBLISHED AND AVAILABLE
Chart Title, limits and other remarks Scale Folio 2019 Catalogue page
2710 North America - East Coast, Delaware Bay to Straits of Florida. 1:1,500,000 81 122, 126, 130, 132
26° 00´·0 N .— 39° 00´·0 N., 72° 00´·0 W .— 82° 00´·0 W.
Chart Title, limits and other remarks Scale Folio 2019 Catalogue page
817 International Chart Series, Bay of Bengal, Bangladesh and Burma, 1:350,000 43 64
INT 7430 Elephant Point to Manaung (Cheduba) Island.
883 England - West Coast, Isles of Scilly, Saint Mary's and the 1:12,500 1 20
Principal Off-Islands.
1.7 Wk13/19
I
ADMIRALTY CHARTS AND PUBLICATIONS NOW PUBLISHED AND AVAILABLE
Chart Title, limits and other remarks Scale Folio 2019 Catalogue page
2101 International Chart Series, Turkey - South Coast, Mersin Limanı. 1:12,500 30 46
INT 3657
Includes significant safety-related information as follows: changes
to depths, aids to navigation, lights and coastline.
3739 International Chart Series, United Arab Emirates, Jebel Ali (Mīnā' 1:50,000 40 62
INT 7220 Jabal 'Ālī) and Approaches.
Jebel Ali (Mīnā' Jabal 'Ālī). 1:25,000
Wk13/19 1.8
I
ADMIRALTY CHARTS AND PUBLICATIONS NOW PUBLISHED AND AVAILABLE
Chart Title, limits and other remarks Scale Folio 2019 Catalogue page
Chart Title and other remarks Scale Edition 2019 Catalogue page
1.9 Wk13/19
I
ADMIRALTY CHARTS AND PUBLICATIONS NOW PUBLISHED AND AVAILABLE
Chart Title and other remarks Scale Edition 2019 Catalogue page
Chart Published Title and other remarks Scale Folio 2019 Catalogue page
NZ5215 01/02/2019 New Zealand, North Island - East Coast, Whangarei 1:18,000 71 94
Harbour.
Whangarei Harbour, Continuation to Town Basin. 1:18,000
Wk13/19 1.10
I
ADMIRALTY CHARTS AND PUBLICATIONS NOW PUBLISHED AND AVAILABLE
ADMIRALTY Publications
896 Korea - East Coast, Ulsan Hang to Daebyeon Hang. 1:50,000 896 52
1560 Africa - West Coast, Guinea, Approaches to Rio Nunez. 1:100,000 1560 20
1.11 Wk13/19
I
ADMIRALTY CHARTS AND PUBLICATIONS TO BE PUBLISHED
3391 International Chart Series, Korea - South Coast, Approaches to 1:75,000 3391 52
INT 5360 Gwangyang Hang. INT 5360
3990 South China Sea, Gulf of Tonkin (Northern Part). 1:500,000 3990 47
4813 International Chart Series, North Pacific Ocean, Bering Sea, 1:3,500,000 4813 56
INT 813 Southern Part. INT 813
4814 International Chart Series, North Pacific Ocean, Bering Sea, 1:3,500,000 4814 92
INT 814 Northern Part. INT 814
Wk13/19 1.12
I
CHARTS TO BE AVAILABLE 11 APRIL 2019
New Editions
Charts to be
Chart Title, limits and other remarks Scale WITHDRAWN Folio
ADMIRALTY Charts
Chart to be On publication of
WITHDRAWN Main Title New Chart/New Edition
712 International Chart Series, Indian Ocean, La Réunion to Mauritius and Ile 712
INT 7730 Tromelin. INT 7730
817 International Chart Series, Bay of Bengal, Bangladesh and Burma, Elephant 817
INT 7430 Point to Manaung (Cheduba) Island. INT 7430
883 England - West Coast, Isles of Scilly, Saint Mary's and the Principal Off- 883
Islands.
1992 Mediterranean Sea, Porto Vecchio to Arbatax including Bonifacio Strait. 1992
2101 International Chart Series, Turkey - South Coast, Mersin Limanı. 2101
INT 3657 INT 3657
1.13 Wk13/19
I
ADMIRALTY CHARTS AND PUBLICATIONS PERMANENTLY WITHDRAWN
Chart to be On publication of
WITHDRAWN Main Title New Chart/New Edition
2710 North America - East Coast, Delaware Bay to Straits of Florida. 2710
3739 International Chart Series, United Arab Emirates, Jebel Ali (Mīnā' Jabal 'Ālī) 3739
INT 7220 and Approaches. INT 7220
NZ5215 New Zealand, North Island - East Coast, Whangarei Harbour. NZ5215
Wk13/19 1.14
IB
CURRENT NAUTICAL PUBLICATIONS
(ADMIRALTY Sailing Directions, ADMIRALTY List of Lights, ADMIRALTY Lists of Radio Signals,
ADMIRALTY Tidal Publications, ADMIRALTY Reference Publications)
NP No Title Edition
1 Africa Pilot Volume 1 18th (2017)
2 Africa Pilot Volume 2 18th (2017)
3* Africa Pilot Volume 3 17th (2016)
4‡ South-East Alaska Pilot 8th (2015)
5 South America Pilot Volume 1 19th (2017)
6* South America Pilot Volume 2 18th (2011)
7 South America Pilot Volume 3 13th (2018)
7A South America Pilot Volume 4 8th (2018)
8 Pacific Coasts of Central America and United States Pilot 14th (2016)
9 ‡* Antarctic Pilot 8th (2014)
10 Arctic Pilot Volume 1 9th (2016)
11 ‡ Arctic Pilot Volume 2 12th (2018)
12 ‡ Arctic Pilot Volume 3 10th (2018)
13 Australia Pilot Volume 1 5th (2017)
14* Australia Pilot Volume 2 13th (2016)
15 Australia Pilot Volume 3 14th (2018)
18 Baltic Pilot Volume 1 18th (2018)
19 Baltic Pilot Volume 2 17th (2018)
20 Baltic Pilot Volume 3 13th (2016)
21* Bay of Bengal Pilot 12th (2013)
22* Bay of Biscay Pilot 13th (2016)
23 ‡* Bering Sea and Strait Pilot 8th (2013)
24* Black Sea and Sea of Azov Pilot 5th (2017)
25* British Columbia Pilot Volume 1 16th (2017)
26 ‡ British Columbia Pilot Volume 2 11th (2017)
27 Channel Pilot 12th (2018)
28 Dover Strait Pilot 12th (2017)
30 China Sea Pilot Volume 1 11th (2018)
31 China Sea Pilot Volume 2 13th (2018)
32A* China Sea Pilot Volume 3 2nd (2019)
32B* China Sea Pilot Volume 4 2nd (2019)
33 Philippine Islands Pilot 6th (2017)
34 Indonesia Pilot Volume 2 9th (2019)
35 Indonesia Pilot Volume 3 7th (2017)
36 Indonesia Pilot Volume 1 10th (2019)
37 West Coasts of England and Wales Pilot 20th (2017)
38 West Coast of India Pilot 18th (2016)
39 South Indian Ocean Pilot 15th (2017)
40 Irish Coast Pilot 20th (2016)
41 Japan Pilot Volume 1 12th (2018)
42A Japan Pilot Volume 2 6th (2017)
42B* Japan Pilot Volume 3 11th (2016)
42C Japan Pilot Volume 4 5th (2015)
43 South and East Coasts of Korea, East Coast of Siberia and Sea of Okhotsk Pilot 11th (2018)
44* Malacca Strait and West Coast of Sumatera Pilot 13th (2017)
45 Mediterranean Pilot Volume 1 16th (2018)
1B-1
Wk13/19
IB
(1) Current Editions of ADMIRALTY Sailing Directions (continued)
NP No Title Edition
46 Mediterranean Pilot Volume 2 16th (2018)
47 Mediterranean Pilot Volume 3 16th (2017)
48 Mediterranean Pilot Volume 4 17th (2017)
49 Mediterranean Pilot Volume 5 14th (2018)
50 ‡ Newfoundland and Labrador Pilot 14th (2016)
51 ‡ New Zealand Pilot 19th (2015)
52 North Coast of Scotland Pilot 10th (2018)
54 North Sea (West) Pilot 11th (2018)
55 North Sea (East) Pilot 11th (2018)
56 Norway Pilot Volume 1 17th (2018)
57A* Norway Pilot Volume 2A 12th (2016)
57B Norway Pilot Volume 2B 10th (2017)
58A Norway Pilot Volume 3A 8th (2015)
58B Norway Pilot Volume 3B 8th (2018)
59 ‡* Nova Scotia and Bay of Fundy Pilot 15th (2013)
60 Pacific Islands Pilot Volume 1 13th (2018)
61 ‡ Pacific Islands Pilot Volume 2 13th (2017)
62 Pacific Islands Pilot Volume 3 14th (2016)
63 Persian Gulf Pilot 18th (2018)
64 Red Sea and Gulf of Aden Pilot 19th (2018)
65 St Lawrence Pilot 18th (2016)
66A* South West Coast of Scotland Pilot 2nd (2019)
66B* North West Coast of Scotland Pilot 2nd (2019)
67 West Coasts of Spain and Portugal Pilot 13th (2018)
68 East Coast of the United States Pilot Volume 1 16th (2018)
69 East Coast of the United States Pilot Volume 2 14th (2017)
69A East Coasts of Central America and Gulf of Mexico Pilot 7th (2015)
70 West Indies Pilot Volume 1 7th (2018)
71 ‡ West Indies Pilot Volume 2 18th (2017)
72 Southern Barents Sea and Beloye More Pilot 3rd (2014)
‡ Books in Continuous Revision (on an extended cycle). * New or Revised Edition due for publication within one year.
NP No Edition Published
74 Volume A, 2018/19 April 2018
75 Volume B, 2018/19 June 2018
76 Volume C, 2018/19 July 2018
77 Volume D, 2018/19 May 2018
78 Volume E, 2018/19 May 2018
79 Volume F, 2018/19 August 2018
80 Volume G, 2018/19 November 2018
81 Volume H, 2018/19 November 2018
82 Volume J, 2018/19 January 2019
83 Volume K, 2019/20 January 2019
84 Volume L, 2019/20 March 2019
85 Volume M, 2018/19 October 2018
86 Volume N, 2018/19 August 2018
87 Volume P, 2018/19 September 2018
88 Volume Q, 2019/20 February 2019
1B-2
Wk13/19
IB
(3) ADMIRALTY List of Radio Signals
NP No Title Published
281 Volume 1 Maritime Radio Stations:
2018/19 Part 1: Europe, Africa and Asia (excluding the Far East) October 2018
2018/19 Part 2: The Americas, Far East and Oceania November 2018
282 Volume 2 Radio Aids to Navigation, Differential GPS (DGPS), Legal Time,
Radio Time Signals and Electronic Position Fixing System
2019/20 Part 1: Europe, Africa and Asia (excluding the Far East) March 2019
2019/20 Part 2: The Americas, Far East and Oceania March 2019
283 Volume 3 Maritime Safety Information Services:
2018/19 Part 1: Europe, Africa and Asia (excluding the Far East) December 2018
2019/20 Part 2: The Americas, Far East and Oceania December 2018
284 Volume 4, Meteorological Observation Stations January 2019
2018/19
285 Volume 5, Global Maritime Distress and Safety System (GMDSS) July 2018
2018/19
286 Volume 6 Pilot Services, Vessel Traffic Services and Port Operations:
2018/19 Part 1: United Kingdom and Europe (excluding Arctic, Baltic and April 2018
Mediterranean coasts)
2018/19 Part 2: Europe, Arctic and Baltic coasts, including Iceland and Faroe May 2018
Islands
2018/19 Part 3: Mediterranean Sea, Black Sea and Suez Canal June 2018
2018/19 Part 4: Indian Sub-continent, South East Asia and Australasia September 2018
2018/19 Part 5: North America, Canada and Greenland November 2018
2019/20 Part 6: North East Asia and Russia (Pacific Coast) January 2019
2019/20 Part 7: Central and South America and the Caribbean February 2019
2018/19 Part 8: Africa (excluding Mediterranean Coast), Red Sea and the Persian February 2018
Gulf
1B-3
Wk13/19
IB
(4) ADMIRALTY Tidal Publications (continued)
NP No Co-Tidal Atlases
214 Edition 2 Persian Gulf, 1999
215 Edition 1 South-East Asia, 1979
NP No Title Edition
100 The Mariner’s Handbook 11th (2016)
133C ENC and ECDIS Maintenance Record 2nd (2017)
136 Ocean Passages for the World 1st (2018)
231 ADMIRALTY Guide to the Practical Use of ENCs 2nd (2016)
232 ADMIRALTY Guide to ECDIS Implementation, Policy and Procedures. 3rd (2019)
294 How to Keep Your ADMIRALTY Products Up-to-Date. 10th (2017)
735 IALA Maritime Buoyage System. 8th (2018)
5011 Symbols and Abbreviations used on ADMIRALTY Paper Charts 7th (2018)
5012 ADMIRALTY Guide to ENC Symbols used in ECDIS 2nd (2015)
350(1) ‡ ADMIRALTY Distance Tables - Atlantic Ocean 2nd (2011)
350(2) ‡ ADMIRALTY Distance Tables - Indian Ocean 3rd (2008)
350(3) ‡ ADMIRALTY Distance Tables - Pacific Ocean 2nd (2009)
‡ Books in Continuous Revision (on an extended cycle).
1B-4
Wk13/19
II
GEOGRAPHICAL INDEX
2.1
Wk13/19
II
Notice No. Page Admiralty Chart Folio Notice No. Page Admiralty Chart Folio
1473 2.25 66 1532 2.18 45
1474 2.20 55 1533 2.19 47
1475 2.20 55 1534* 2.8 7
1476 2.21 55 1535 2.32 95
1477 2.21 55 1536(T)/19 2.47 47
1478 2.22 55 1537 2.19 52
1479 2.22 55 1538* 2.9 3
1480 2.23 53 1539(T)/19 2.48 52
1481 2.23 54 1540 2.33 88
1482(T)/19 2.47 55 1541(T)/19 2.45 41
1483(T)/19 2.47 53 1542* 2.9 1
1484(T)/19 2.48 53 1543 2.23 52
1485(T)/19 2.48 54 1544(T)/19 2.45 42, 43
1486 2.26 64 1545* 2.17 36
1487(T)/19 2.37 10 1546(T)/19 2.37 6
1488(P)/19 2.46 52 1547 2.20 52
1489(T)/19 2.49 46, 60 1548 2.16 34
1490(T)/19 2.41 27 1549 2.12 9
1491 2.7 41 1550 2.10 10
1492 2.19 50 1551 2.36 81
1493 2.10 11 1552 2.13 25
1494 2.26 63 1553 2.33 83
1495 2.19 50 1554 2.14 25
1496 2.11 9 1555 2.33 83
1497 2.32 88 1556 2.12 16
1498 2.18 46 1557 2.34 87
1499(P)/19 2.42 34 1558 2.17 42
1500(T)/19 2.49 64 1559 2.31 97
1501 2.26 63 1560 2.31 73
1502* 2.33 85 1561 2.23 52
1503(T)/19 2.50 63 1562 2.24 52
1504(T)/19 2.50 63 1563 2.17 43
1505(P)/19 2.50 67 1564 2.14 30
1506(P)/19 2.51 67 1565 2.12 9
1507(T)/19 2.51 63 1566 2.31 92
1508(P)/19 2.38 10 1567(T)/19 2.49 48
1509(T)/19 2.51 63 1568(T)/19 2.41 30
1510 2.19 52 1569 2.13 83
1511 2.27 63 1570(T)/19 2.49 46, 47, 60
1512(T)/19 2.38 10 1571 2.14 24
1513(T)/19 2.38 11 1572 2.35 87
1514 2.29 66, 67, 68 1573(T)/19 2.41 1, 16
1515 2.28 66 1574 2.25 59
1516(P)/19 2.40 9 1575* 2.12 6
1517(T)/19 2.51 66 1576 2.36 87
1518(T)/19 2.52 66 1577 2.9 1
1519(T)/19 2.52 66 1578 2.18 41
1520 2.28 65 1579 2.8 83
1521 2.13 31 1580 2.10 10
1522* 2.8 3 1581 2.12 9
1523* 2.8 5 1582 2.24 52
1524 2.7 10 1583 2.13 17
1525 2.28 65 1584 2.15 28
1526 2.32 95 1585 2.18 46
1527 2.16 41 1586 2.11 11
1528(P)/19 2.46 52 1587(T)/19 2.41 31
1529 2.32 95 1588 2.15 31
1530 2.16 40 1589 2.25 46, 60
1531 2.32 95
2.2
Wk13/19
II
Notice No. Page Admiralty Chart Folio Notice No. Page Admiralty Chart Folio
1590 2.15 25
1591 2.11 10
1592(P)/19 2.42 25
1593* 2.10 1
1594(P)/19 2.48 52
1595(T)/19 2.43 34
1596(T)/19 2.37 2
1597(P)/19 2.44 40
1598(P)/19 2.39 10, 11
1599(T)/19 2.40 9
1600(T)/19 2.45 43
1601(T)/19 2.40 6, 7, 13
1602(P)/19 2.52 88
1603(T)/19 2.47 47
1604(T)/19 2.37 3
1605(P)/19 2.43 34
1606(T)/19 2.49 56
1607 2.15 29, 31
1608* 2.10 6
2.3
Wk13/19
II
2.4
Wk13/19
II
2.5
Wk13/19
II
International
Admiralty Chart No. Notices Admiralty Chart No. Notices
Notices
Chart No.
INT 1159 1598P
INT 1160 1598P
INT 1187 1598P
INT 1190 1598P
INT 1210 1598P
INT 1246 1598P
INT 1247 1598P
INT 1249 1598P
INT 1250 1598P
INT 1251 1598P
INT 1252 1598P
INT 1254 1598P
INT 1300 1524, 1565
INT 1303 1487T
INT 1317 1591
INT 1326 1508P
INT 1332 1580
INT 1333 1580
INT 1334 1580
INT 1353 1487T, 1550
INT 1360 1550
INT 1400 1601T
INT 1417 1581
INT 1461 1549
INT 1462 1549
INT 1466 1516P
INT 1468 1496
INT 1470 1496
INT 1471 1599T
INT 1540 1546T
INT 1554 1534
INT 1563 1593
INT 1564 1593
INT 1600 1608
INT 1649 1596T
INT 1650 1596T
INT 1704 1573T
INT 1705 1573T
INT 1725 1577
INT 1772 1512T
INT 1777 1493
INT 1786 1513T
INT 2088 1548
INT 2809 1548
INT 2873 1595T
INT 2896 1548
INT 2922 1499P, 1605P
INT 3167 1592P
INT 3681 1568T
INT 3758 1607
INT 5254 1582
INT 5360 1594P
INT 7018 1530
INT 7021 1541T, 1578
INT 7022 1541T
INT 7264 1597P
INT 7275 1597P
INT 7278 1530, 1597P
INT 7331 1491, 1578
INT 7334 1541T
INT 7336 1541T
INT 7338 1541T
INT 7340 1491
INT 7387 1558
INT 7428 1563, 1600T
INT 9120 1559
INT 12461 1598P
INT 12511 1598P
2.6
Wk13/19
II
1491 MISCELLANEOUS UPDATES TO CHARTS
Source: UKHO
(SEP: 2019000030890 - 164021).
Source: UKHO
(SEP: 2019000001562 - 162929).
2.7
Wk13/19
II
1579 MISCELLANEOUS UPDATES TO CHARTS
Source: UKHO
(SEP: 2019000034427 - 165664).
Chart 2210 (Panel, Continuation of Upper Loch Torridon) [ previous update 5673/18 ] ETRS89 DATUM
Insert depth, 88, enclosed by 10m contour (a) 57° 32´·84N., 5° 39´·27W.
Delete depth, 198, close N of: (a) above
Insert depth, 58, and extend 10m contour S to enclose (b) 57° 33´·06N., 5° 37´·70W.
Delete depth, 73, close N of: (b) above
2.8
Wk13/19
II
Chart 2021 (Panel A, Beaulieu River) [ previous update 1439/19 ] ETRS89 DATUM
Insert drying height, 01, and extend 0m low water line S to enclose 50° 48´·176N., 1° 25´·225W.
depth, 09 (a) 50° 48´·117N., 1° 25´·288W.
Delete depth, 18, close NE of: (a) above
Insert depth, 2, and extend 2m contour W to enclose (b) 50° 48´·069N., 1° 25´·334W.
Delete depth, 32, close S of: (b) above
Ef (c) above
50° 35´·905N., 2° 26´·500W.
Delete former limit of marine farm, pecked line, joining: (a) above
(d) above
2.9
Wk13/19
II
Chart 889 (INT 1777) (Panel D, Hallstavik) [ previous update 1365/19 ] WGS84 DATUM
Insert the accompanying block, centred on: 60° 03´·8N., 18° 35´·3E.
Chart 902 (INT 1334) (Panel J, Avedøreværket) [ previous update 1055/19 ] WGS84 DATUM
Insert
¶ F.G 55° 35´·927N., 12° 29´·169E.
Chart 902 (INT 1334) (Panel B, Southern Part) [ previous update 1055/19 ] WGS84 DATUM
Insert
¶ F.G 55° 35´·93N., 12° 29´·17E.
2.10
Wk13/19
II
Chart 857 (INT 1317) (Panel B, Göta Älv) [ previous update 666/19 ] WGS84 DATUM
Insert the accompanying block, centred on: 57° 43´·8N., 11° 59´·6E.
2.11
Wk13/19
II
2.12
Wk13/19
II
2.13
Wk13/19
II
2.14
Wk13/19
II
Chart 1515 (Panel D, Sant Carles de la Rapita and Alcanar) [ previous update 1679/18 ] WGS84 DATUM
Insert the accompanying block, centred on: 40° 36´·4N., 0° 36´·2E.
2.15
Wk13/19
II
2.16
Wk13/19
II
Chart 724 (Panel G, Baie Curieuse) [ previous update 3706/17 ] WGS84 DATUM
Insert limit of marine farm, pecked line, joining: (a) 4° 18´·08S., 55° 43´·50E.
(b) 4° 18´·21S., 55° 43´·60E.
(c) 4° 18´·27S., 55° 43´·52E.
(d) 4° 18´·13S., 55° 43´·41E.
2.17
Wk13/19
II
Chart 3471 (Panel, Pelabuhan Pangkalbalam) [ previous update New Edition 24/01/2019 ] WGS84 DATUM
Insert
T¨Fh l.G.8s12m4M 2° 05´·86S., 106° 10´·93E.
T§Fl.R.4s10m5M
j 2° 06´·19S., 106° 11´·00E.
Replace
HZFp l.10s with TkFl.5s10m12M 2° 06´·20S., 106° 12´·68E.
Chart 3471 (Panel, Pelabuhan Pangkalbalam) [ previous update 1498/19 ] WGS84 DATUM
Insert
ThF¨ l.G.3s10m4M 2° 05´·79S., 106° 08´·08E.
2.18
Wk13/19
II
2.19
Wk13/19
II
2.20
Wk13/19
II
2.21
Wk13/19
II
è Y Lt (a) above
(b) above
38° 19´ 08·1"N., 141° 02´ 40·4"E.
2.22
Wk13/19
II
Chart 898 (Panel A, Ulsan and Mipo) [ previous update 1269/19 ] WGS84 DATUM
Delete
GfFl(4)Y.8s
; C
35° 24´·55N., 129° 22´·62E.
G;Fl(4)Y.8s
f D
35° 24´·35N., 129° 22´·59E.
2.23
Wk13/19
II
2.24
Wk13/19
II
Chart 3015 (Panel D, Suwangi Channels) [ previous update 3914/18 ] WGS84 DATUM
Insert the accompanying note, SUBMARINE CABLES within title panel
submarine cable, É, joining: 3° 28´·93S., 116° 00´·88E.
3° 28´·97S., 116° 00´·99E.
3° 30´·00S., 116° 02´·18E.
and
3° 28´·94S., 116° 00´·88E.
3° 29´·00S., 116° 00´·96E.
3° 29´·41S., 116° 01´·35E.
3° 30´·00S., 116° 02´·16E.
Chart 3015 (Panel C, Selat Laut) [ previous update 3914/18 ] WGS84 DATUM
Insert submarine cable, É, joining: 3° 28´·94S., 116° 00´·89E.
3° 29´·37S., 116° 01´·38E.
3° 30´·01S., 116° 02´·19E.
3° 30´·13S., 116° 02´·39E.
2.25
Wk13/19
II
2.26
Wk13/19
II
2.27
Wk13/19
II
2.28
Wk13/19
II
INTENTIONALLY BLANK
2.29
Wk13/19
II
1514 SOUTH PACIFIC OCEAN - Solomon Islands - Lights. Leading lines. Light-beacons.
Source: Australian Notice 4/168/19
Chart SLB 102 (Panel, Port Noro) [ previous update 1183/19 ] WGS84 DATUM
Insert
T§Fl.G.5s10m4M (a) 8° 15´·42S., 157° 11´·35E.
Chart SLB 102 (Panel, Blackett Strait) [ previous update 1183/19 ] WGS84 DATUM
Insert
T§Fl.G.5s10m4M (a) 8° 15´·42S., 157° 11´·35E.
T Fl.G.2·5s9m4M
8° 15´·31S., 157° 11´·37E.
Amend light-beacon to, Fl(2)10s10m10M 8° 08´·30S., 157° 09´·64E.
Chart 4623 (INT 623) [ previous update New Edition 10/08/2017 ] WGS84 DATUM
Amend range of light to, 10M 7° 52´·7S., 156° 29´·2E.
2.30
Wk13/19
II
Chart 1436 (Panel C, Port de Papeete) [ previous update 5041/18 ] IGN 1951-1954 DATUM
Insert depth,12 (a) 17° 32´·166S., 149° 35´·156W.
Delete depth,124, close E of: (a) above
1566 NORTH PACIFIC OCEAN - Area to be avoided. Legends. Precautionary area. Two-way route.
Notes.
Source: IMO
Note: Chart 1231 is to be deleted from the list of charts affected by Notice 3385(P)/18.
Chart 1231 (Panel D, Approaches to Bukhta Provideniya) [ previous update 3640/13 ] UNDETERMINED DATUM
Insert limit of restricted area, Ç, joining: (a) 63° 55´·00N., 171° 49´·37W.
(b) 63° 57´·23N., 171° 30´·00W.
legend, Area to be Avoided (see Note), along: (a)-(b) above
semi-circular limit of precautionary area, radius 4M, pecked
line, centred on 64° 24’·36N , 171° 36’·61W, joining: 64° 21´·59N., 171° 30´·00W.
64° 27´·13N., 171° 30´·00W.
symbol, precautionary area, centred on: 64° 24´·36N., 171° 37´·52W.
limit of routeing measure, pecked line, joining: (c) 64° 28´·35N., 171° 36´·50W.
(d) 64° 32´·59N., 171° 30´·00W.
legend, RECOMMENDED TWO-WAY ROUTE (see Note),
along: (c)-(d) above
the accompanying note, RECOMMENDED TWO-WAY
ROUTE within title panel
the accompanying note, AREA TO BE AVOIDED within title panel
Chart 226 (INT 9120) (Panel, Neptunes Bellows and Approaches) [ previous update 2317/18 ] WGS84 DATUM
Insert depth, 95, and extend 10m contour E to enclose 62° 58´·499S., 60° 30´·721W.
depth, 65, and extend 10m contour E to enclose 62° 58´·794S., 60° 30´·685W.
depth, 197, and extend 20m approximate contour E to enclose 62° 58´·851S., 60° 30´·267W.
depth, 25 62° 58´·954S., 60° 29´·963W.
depth, 98, enclosed by 10m contour 62° 58´·991S., 60° 30´·663W.
depth, 42, enclosed by 5m contour 62° 59´·000S., 60° 30´·736W.
depth, 94, enclosed by 10m contour (a) 62° 59´·170S., 60° 30´·600W.
Delete depth, 143, close SW of: (a) above
Insert depth, 4, enclosed by 5m contour (b) 62° 59´·393S., 60° 32´·668W.
Delete depth, 55, close W of: (b) above
Insert the accompanying block, centred on: 63° 00´·4S., 60° 33´·4W.
2.31
Wk13/19
II
2.32
Wk13/19
II
1502* PANAMA - Caribbean Sea Coast - Buoy. Single Point Mooring. Fog signal.
Source: mt Almi Sky
Chart 3148 (Panel, St Andrew Bay) [ previous update 1419/19 ] NAD83 DATUM
Amend light-beacon to, Iso.6s67ft & Fl.4s11ft 30° 09´·46N., 85° 40´·52W.
light-beacon to, Iso.6s51ft & Fl.4s11ft 30° 07´·86N., 85° 43´·58W.
Chart 3896 (Panel, Port Fourchon) [ previous update 720/19 ] NAD83 DATUM
Amend light to, Q.G.27ft 29° 05´·92N., 90° 13´·39W.
light to, Fl.4s12ft & Iso.G.6s67ft 29° 07´·41N., 90° 13´·06W.
2.33
Wk13/19
II
1557 WEST INDIES - Windward Islands - Note. Anchor berths. Swinging circles. Legends. Recommended
anchorage.
Source: French Notice 8/261/19
2.34
Wk13/19
II
1572 WEST INDIES - Windward Islands - Anchor berths. Legends. NM Blocks. Notes.
Source: French Notice 8/261/19
Chart 494 (Panel C, Cul-de-Sac du Marin) [ previous update 4895/18 ] WGS84 DATUM
Insert
î 9, with swinging circle, radius 275m (0·15M), pecked
line, centred on: 14° 27´·47N., 60° 52´·76W.
Chart 494 (Panel B, Havre du Robert and Approaches) [ previous update 4895/18 ] WGS84 DATUM
Insert the accompanying block, centred on: 14° 40´·1N., 60° 55´·2W.
2.35
Wk13/19
II
2.36
Wk13/19
II
2.37
Wk13/19
II
2.38
Wk13/19
II
and
60° 09´·22N., 24° 57´·43E.
60° 07´·85N., 24° 55´·73E.
60° 08´·72N., 24° 52´·35E.
60° 05´·35N., 24° 47´·50E.
59° 59´·84N., 24° 36´·50E.
59° 56´·56N., 24° 21´·75E.
59° 56´·55N., 24° 15´·49E.
59° 51´·88N., 24° 09´·98E.
59° 51´·45N., 24° 00´·15E.
59° 42´·68N., 23° 22´·76E.
59° 44´·06N., 23° 10´·52E.
59° 45´·93N., 23° 08´·49E.
59° 48´·70N., 22° 57´·27E.
59° 48´·79N., 22° 54´·64E.
and
59° 48´·79N., 22° 54´·64E.
59° 48´·70N., 22° 55´·40E.
59° 48´·14N., 22° 55´·10E.
59° 47´·92N., 22° 50´·07E.
59° 47´·11N., 22° 46´·22E.
59° 49´·10N., 22° 28´·27E.
59° 50´·45N., 22° 22´·63E.
59° 51´·57N., 22° 20´·52E.
59° 52´·64N., 22° 16´·48E.
59° 52´·85N., 22° 09´·57E.
59° 52´·26N., 22° 07´·48E.
59° 52´·29N., 21° 57´·94E.
59° 51´·16N., 21° 40´·40E.
59° 49´·27N., 21° 33´·04E.
59° 47´·79N., 21° 22´·55E.
59° 47´·36N., 21° 21´·35E.
59° 47´·10N., 21° 21´·99E.
and
59° 47´·10N., 21° 21´·99E.
59° 46´·73N., 21° 18´·29E.
59° 44´·62N., 21° 13´·58E.
59° 41´·00N., 21° 10´·00E.
59° 38´·80N., 20° 38´·89E.
59° 36´·05N., 20° 00´·01E.
2.39
Wk13/19
II
1598(P)/19 FINLAND - South Coast - Submarine cables. (continued)
2. Mariners are advised to navigate with caution in the area.
3. Charts will be updated when full details are available.
(WGS84 DATUM)
Charts affected - 2075 (INT 1210) - 2206 (INT 1154) - 2211 (INT 12511) - 2218 (INT 1159) - 2219 (INT 1160) - 2241 -
2248 - 2260 (INT 1155) - 2263 (INT 12461) - 2264 - 3813 (INT 1246) - 3814 (INT 1247) - 3817 (INT 1249) - 3818
(INT 1250) - 3819 (INT 1251) - 3820 (INT 1252) - 3821 - 3823 (INT 1187) - 3826 (INT 1190) - 3832 (INT 1254)
Charts affected - 274 - 291 - 1405 (INT 1400) - 2182C (INT 1041)
2.40
Wk13/19
II
2.41
Wk13/19
II
1499(P)/19 GABON - Port development. Quays. Dredged depths. Mooring buoy. Swinging circle.
Source: French Notice 7/2(P)/19
1. A new port facility, Owendo (NOIP), has been established, joining the following positions:
0° 17´·105N., 9° 30´·294E.
0° 17´·044N., 9° 30´·314E.
0° 17´·037N., 9° 30´·289E.
0° 17´·016N., 9° 30´·296E.
*0° 17´·098N., 9° 30´·553E.
*0° 17´·127N., 9° 30´·532E.
*0° 17´·117N., 9° 30´·502E.
0° 17´·218N., 9° 30´·470E.
2. *A new quay, GSEZ, 500m in length and with a dredged depth of 13m to a width of 50m, is operational, between the
following positions:
0° 17´·098N., 9° 30´·553E.
0° 17´·245N., 9° 30´·634E.
5. A mooring buoy in position 0° 17´·038N., 9° 30´·448E. has been withdrawn.
6. *A swinging area, 200m radius and dredged to 12m, has been established, centred on position 0° 16´·868N., 9° 30´·240E.
A dredged depth of 12m exists between the swinging area and the two quays.
7. Mariners are advised to navigate with caution in the area and consult the local port authorities for the latest information.
2.42
Wk13/19
II
1499(P)/19 GABON - Port development. Quays. Dredged depths. Mooring buoy. Swinging circle. (continued)
8. Charts will be updated when full details are available.
9. Former Notice 838(P)/19 is cancelled.
*Indicates new or revised entry
(WGS84 DATUM)
0° 18´·18N., 9° 29´·55E.
0° 18´·12N., 9° 29´·42E.
0° 18´·16N., 9° 29´·40E.
0° 18´·19N., 9° 29´·36E.
0° 18´·28N., 9° 29´·33E.
0° 18´·32N., 9° 29´·33E.
0° 18´·89N., 9° 29´·11E.
0° 19´·02N., 9° 29´·24E.
2. *A new quay, GSEZ Mineral Port, 170m in length, is operational along part of the area, between positions:
0° 18´·19N., 9° 29´·36E. and 0° 18´·28N., 9° 29´·33E.
3. The following buoys have been established:
2.43
Wk13/19
II
1597(P)/19 KUWAIT - Works. Submarine pipeline. Islet. Harbour limit. Buoyage. Obstructions.
Source: Navarea IX Warning 84/17, Kuwaiti Notices 3/17 and 3/19, MENAS Notices 110/17 and 46/18
1. Reclamation and marine works are in progress within an area bounded by the following positions:
Charts affected - 1223 - 1224 - 2882 (INT 7264) - 2884 (INT 7278) - 3773 - 3774 (INT 7275)
2.44
Wk13/19
II
Charts affected - IN 211 - IN 255 (INT 7334) - IN 292 (INT 7021) - IN 293 (INT 7022) - IN 2016 (INT 7336) - IN 2076
(INT 7338)
Position
22° 14´·55N., 91° 44´·81E.
22° 14´·97N., 91° 46´·45E.
22° 13´·75N., 91° 47´·41E.
22° 12´·84N., 91° 47´·93E.
2. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)
2.45
Wk13/19
II
1528(P)/19 CHINA - Yellow Sea Coast - Breakwaters. Legends. Coastline. Channel limits.
Source: Chinese Chart 11961
1.
2.46
Wk13/19
II
Chart affected - JP 63
2.47
Wk13/19
II
Designation Position
A 35° 07´·56N., 128° 41´·14E.
B 35° 07´·63N., 128° 41´·17E.
3. Mariners are advised to navigate with caution in the area.
4. Former Notice 1292(T)/19 is cancelled.
* Indicates new or revised entry.
(WGS84 DATUM)
2.48
Wk13/19
II
Charts affected - 1066 - 1312 - 2470 - 2872 - 3757 - 4508 (INT 508)
1500(T)/19 AUSTRALIA - Western Australia - Buoy. Virtual aids to navigation. Radar beacon.
Source: Australian Notice 4/192(T)/19
1. The safe water light-buoy, Iso.3s, and associated radar beacon, Racon(G), in position 28° 46´·19S., 114° 31´·72E. , are off
station. A virtual safe water mark, South Fairway Buoy, exists in situ.
2. A virtual port lateral mark exists in position 28° 45´·47S., 114° 33´·93E.
3. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)
2.49
Wk13/19
II
Position Remarks
17° 44´·77S., 118° 58´·77E. 19m below surface
17° 57´·84S., 119° 07´·68E. 18m below surface
18° 00´·22S., 119° 09´·37E. 18m below surface
18° 00´·22S., 119° 09´·37E. 120m below surface
18° 00´·22S., 119° 09´·37E. special spherical light-buoy, Fl.4s
(WGS84 DATUM)
2.50
Wk13/19
II
Charts affected - 4722 (INT 722) - 4723 (INT 723) - Aus 325 - Aus 326 - Aus 327 - Aus 741
2.51
Wk13/19
II
Charts affected - CP 3 - CP 4
2.52
Wk13/19
To accompany Notice to Mariners 1491/2019
On Chart IN 254
On Chart Aus 20
MARINE FARMS
Marine farms, which may be floating or fixed
structures and their associated moorings
should be avoided. The farms are generally
marked by buoys or beacons, which may be lit.
Their charted positions are approximate.
MARINE FARMS
Marine farms, which may be floating or fixed
structures and their associated moorings
should be avoided. The farms are generally
marked by buoys or beacons, which may be lit.
Their charted positions are approximate.
Wk13/19
To accompany Notice to Mariners 1527/19
On Chart IN 207
LESSER DEPTH
Lesser depths reported in the area. Mariners are advised to excersise caution.
On Chart 368
ANCHORAGES
Mandatory anchorage areas for vessels over
50 metres in length.
On Chart 1231
On Chart 1231
AREA TO BE AVOIDED
To avoid the risk of pollution and damage to
the environment, this area has been
designated an Area to be Avoided. All vessels
exceeding 400 GT, should avoid this area.
This area is IMO-adopted.
On Chart 390
On Chart 369
ANCHORAGES
Mandatory anchorages for vessels over 50
metres in length.
Wk13/19
To accompany Notice to Mariners 1572/19
On Chart 494
ANCHORAGES
Mandatory anchorages for vessels over 50
metres in length.
On Chart 3015
SUBMARINE CABLES
Mariners are advised not to anchor or trawl in
the vicinity of submarine cables.
Wk13/19
To accompany Notice to Mariners 1493/19. Image Size (mm) 109.6 by 59.8
Wk13/19
To accompany Notice to Mariners 1495/19. Image Size (mm) 141.1 by 252.3
Wk13/19
To accompany Notice to Mariners 1501/19. Image Size (mm) 87.1 by 145.3
Wk13/19
To accompany Notice to Mariners 1501/19. Image Size (mm) 64.7 by 66
Wk13/19
To accompany Notice to Mariners 1520/19. Image Size (mm) 123 by 139.4
Wk13/19
To accompany Notice to Mariners 1520/19. Image Size (mm) 140.7 by 240
Wk13/19
To accompany Notice to Mariners 1520/19. Image Size (mm) 139.7 by 258.4
Wk13/19
To accompany Notice to Mariners 1525/19. Image Size (mm) 118.8 by 244.1
Wk13/19
To accompany Notice to Mariners 1543/19. Image Size (mm) 59.4 by 123.2
Wk13/19
To accompany Notice to Mariners 1559/19. Image Size (mm) 161.6 by 92.7
Wk13/19
To accompany Notice to Mariners 1572/19. Image Size (mm) 129.1 by 147.6
Wk13/19
To accompany Notice to Mariners 1572/19. Image Size (mm) 60.4 by 87.4
Wk13/19
To accompany Notice to Mariners 1582/19. Image Size (mm) 110.3 by 85.9
Wk13/19
To accompany Notice to Mariners 1590/19. Image Size (mm) 106.4 by 81.8
Wk13/19
To accompany Notice to Mariners 1591/19. Image Size (mm) 65.6 by 64
Wk13/19
III
NAVIGATIONAL WARNINGS
See The Mariner’s Handbook (2016 Edition). It is recommended that the warnings reprinted below should be kept in a file or
book, followed by subsequent weekly reprints. Only the most convenient ADMIRALTY Chart is quoted. All warnings issued
within the previous 42 days are broadcast via SafetyNET and/or NAVTEX.
The complete texts of all in-force NAVAREA I warnings, including those which are no longer being broadcast, are
available from www.admiralty.co.uk/RNW. Additionally, a quarterly cumulative list of the complete text of all in-force
NAVAREA I Warnings is included in Section III of the Weekly NM Bulletin in Weeks 1, 13, 26 and 39 each year.
Alternatively, these may be requested by e-mail from NAVAREA I Co-ordinator at: navwarnings@ukho.gov.uk
The RNW web page also contains a link to the IHO website which allows direct access to all the other NAVAREA
Co-ordinators around the world who have made their NAVAREA warnings available on the web.
----------------------------------------------------------------------------------------------------------------------------------------------------------
Weekly Edition 13, 28 March 2019 (published on the UKHO website 18 March 2019).
----------------------------------------------------------------------------------------------------------------------------------------------------------
Navarea I (NE Atlantic) Weekly Edition 13
The following NAVAREA I warnings were in force at 180500 UTC Mar 19.
026 Cancelled.
027 ENGLAND, EAST COAST. Approaches to the Thames Estuary. Galloper Windfarm. Chart GB 1610 (INT 1511).
1. Perimeter buoyage; three north cardinal light-buoys, two east cardinal light-buoys, four south cardinal light-buoys
and three special light-buoys; permanently discontinued.
2. New light-buoys established as follows:
A) Special mark, 51-54.0N 002-02.0E
B) Special mark, 51-46.9N 002-02.8E.
029 1. Navarea I warnings in force at 151000 UTC Mar 19. 2. Cancel 024/19.
030 SCOTLAND, EAST COAST. Moray Firth. Chart GB 115 (INT 1503).
Light-buoys marking perimeter of Moray East Offshore Windfarm construction site established as follows:
(A) North cardinal, Q, AIS, 58-18.1N 002-41.1W.
(B) East cardinal, VQ(3)5sec, AIS, 58-10.7N 002-32.8W.
(C) South cardinal, VQ(6)+L.Fl.10sec, AIS, 58-04.0N 002-52.1W.
(D) Six special light-buoys, Fl.Y.5sec, 58-16.8N 002-37.9W, 58-15.1N 002-36.0W, 58-07.8N 002-35.3W,
58-06.7N 002-38.3W, 58-05.0N 002-47.2W and 58-08.6N 002-50.6W.
3.1 Wk13/19
III
NOTES:
A. Rigs are protected by a 500 metre safety zone.
B. ACP - Adjacent to Charted Platform; u/c - under construction
C. For Rigs located North of 65N, East of 5W, refer to Navarea XIX Warnings or visit www.navarea-xix.no
2. Cancel 025/19.
Wk13/19 3.2
III
----------------------------------------------------------------------------------------------------------------------------------------------------------
Cumulative list of other NAVAREA I Warnings in-force at 180500 UTC Mar 19
----------------------------------------------------------------------------------------------------------------------------------------------------------
2017 series:
163 SOUTHWESTERN APPROACHES TO THE BRITISH ISLES. Chart GB 2 (INT 160).
ODAS light-buoy K1 reported off station in 48-47.4N 012-24.2W.
2019 series:
011 ENGLAND, EAST COAST. Thames Gas Field. Chart GB 1503 (INT 1509).
The four cardinal light-buoys marking the perimeter of the platform in position 53-05.0N 002-32.7E have been
permanently discontinued.
020 ENGLAND, EAST COAST. Outer Dowsing Shoal northwards. Chart GB 107.
1. The four cardinal light buoys marking the perimeter of the platform in position 53-37.7N 000-56.2E have been
permanently removed.
2. Cancel 008/19.
3.3 Wk13/19
IV
[13/19]
UPDATES TO ADMIRALTY SAILING DIRECTIONS
Morocco -- Laâyoune — Directions; useful marks Peru – North--west coast – Eten Offshore
Terminal — Arrival information; anchorage
175
313
Paragraph 5.254 1 line(s) 5--8 Replace by:
Paragraph 10.170 1 line(s) 3--5 Replace by:
Main Breakwater Light (S cardinal beacon, 14 m in
height) (270537N 132598W). Outer anchorages. A designated anchorage area,
Outer Breakwater Head Light (red mast, 8 m in with depths of around 6 to 9 m, is centred on
height) (270539N 132585W). 65575S 795293W.
Anchorage may also be obtained about 9 cables W of
Spanish Notice 9/72/19 [NP1--No 52--Wk 13/19] Punta Eten (65688S 795202W) in charted depths
of around 12 m.
NP7 South America Pilot Volume 3 (2018 Edition) Peruvian Notice 2/032(2)/19 [NP7--No 27--Wk 13/19]
Wk13/19 4.1
IV
Peru -- North--west coast -- Pimentel -- San José NP30 China Sea Pilot Volume 1 (2018 Edition)
— Anchorages
172
Paragraph 10.183 3 line(s) 1--2 Replace by:
After Paragraph 5.146 1 line(s) 5 Insert:
3 Anchorage may be obtained in a designated area,
centred on 65290S 795610W, in depths of around Clear of a dangerous wreck (101655N
5 to 7 m, coarse sand. It is... 1070810E), thence:
Peruvian Notice 2/030(9)/19 [NP7--No 31--Wk 13/19] 1 Approach. From the pilot boarding position at
11071N 1035437E the track initially leads SE,
passing:
NE of the coastal bank fronting the NE side of Pulau
Sambu (10948N 1035407E), and:
NP19 Baltic Pilot Volume 2 (2018 Edition) NE of a light buoy (10988N 1035467E) (special).
The track then leads SSW, passing:
Clear of a light buoy (10958N 1035491E) (safe
water), thence:
Sweden -- Kalmarsund -- Degerhamn — ESE of the SE end of Pulau Sambu, thence:
Harbour; depths ESE of Pulau Meriam (10901N 1035439E) on
which stands a light beacon (starboard hand),
and:
153 WNW of a drying reef, marked on its N side by a light
beacon (port hand) (10886N 1035471E).
Entry. Thence, from a position in the N end of
Paragraph 4.23 1--2 Replace by: Selat Bulan, about 2 cables SE of the light beacon
(10901N 1035439E) standing on Pulau Meriam,
1 The harbour is approached and entered on the the track leads SE, passing:
alignment of leading lights, through a buoyed channel, SW of the drying reef (10882N 1035472E),
40 m wide with a minimum swept depth of 63 m marked on its N side by a light beacon, thence:
(2018). The harbour is formed by a long W SW of a small unmarked drying reef (10874N
breakwater and a short E mole to give a 55 m wide 1035477E), thence:
SW facing entrance. Clear of a shoal patch (10852N 1035464E), with
Areas of the harbour have depths of 60 m (2018). a least depth of 62 m. A dangerous wreck
Depths may be less than stated due to silting. (10840N 1035470E), lies close S of the shoal
2 The main berths are on the E side and a small patch. Thence:
boat harbour, with lesser depths, lies in the N part of SW of another unmarked drying reef (10865N
the harbour. A short quay for the use of fishing boats 1035488E), thence:
lies in the S of the harbour on the inside of the E SW of a shoal, marked on its NW side by a light
mole. beacon (isolated danger) (10851N
1035496E), thence:
Swedish Notice 745/13830/19 [NP19--No 54--Wk 13/19] Indonesian Notice 10/136/19 [NP36--No 2--Wk 13/19]
4.2 Wk13/19
IV
NP44 Malacca Strait and West Coast of Sumatera 8 Anchorages. There are several designated
Pilot (2017 Edition) anchorages in Teluk Jodoh (7.50), W of Batuampar,
centred on the following positions:
Customs/quarantine 11060N
1035598E
Indonesia -- Batuampar —
Pilotage; directions; anchorages; caution General cargo vessels 11084N
1035705E
Container vessels 11105N
189 1035810E
9 Tanker vessels 11135N
Paragraph 7.54 1--5 and 7.55 1--2 including heading Replace 1035895E
by:
Sea trial area 10949N
1035596E
1 Description. Batuampar (11000N 1040000E), a
small port and town, is situated on the E side of Teluk Waiting area 10949N
Jodoh. It consists of Pertamina Basin, a 1035667E
rectangular--shaped basin, about 300 m in width, with Transhipment 10949N
a jetty extending W from the N quay. McDermott 1035750E
Basin, a second basin, lies 3 cables N. Multipurpose 10949N
Controlling depths. Least charted depths are 1035838E
46 m in Pertamina Basin and 47 m in McDermott
Basin. It is recommended that further information is 10 Caution. The anchorage area W of Batuampar
obtained from port authorities. contains the following dangers to navigation:
2 Tidal levels. Mean maximum range about 20 m; Dangerous wreck (11101N 1035741E), position
mean minimum range about 11 m. See information in approximate.
ADMIRALTY Tide Tables Volume 5. Stranded wreck (10923N 1035563E).
Notice of ETA required 10, 3, and 2 days, and Two offshore platforms (11064N 1035660E) and
24 hours before arrival via the agent. (10930N 1035733E).
3 Pilotage and tugs. Pilot boards at two positions 11 Berths. Within Pertamina Basin, there are quays on
depending on direction of approach: three sides, between about 300 and 1000 m in length,
Approach from W (11071N 1035437E). with charted depths of 25 to 63 m alongside; a ferry
Approach from E (11043N 1035909E). terminal lies at the SE corner of the basin.
Tugs available for the Pertamina berths, and the Supplies: fresh water; limited provisions.
Pilot reportedly boards from a tug.
Spare
4 Racon:
7.55
Batuampar Light (10998N 1040028E).
Directions for Pertamina Basin (Western
Approach). From a position about 6 cables NE of Indonesian Notice 10/136/19 [NP44--No 38--Wk 13/19]
Batu Berhanti Light Beacon (11109N 1035298E)
(7.47), the track leads SE, passing:
5 NE of Pulau Anaksambu (11022N NP45 Mediterranean Pilot Volume 1
1035347E), a small wooded island, thence: (2018 Edition)
NE of a 146 m shoal (11007N 1035469E).
Thence, from a position about 14 miles E of the
N point of Pulau Sambu (10964N 1035386E) Spain -- Approaches to Cartagena —
(7.49), the line of bearing 090 of Batuampar Light Regulations; buoyage
(triangle, point down on white beacon) leads E,
passing: 112
6 N of a stranded wreck (10998N 1035688E),
thence: Paragraph 2.178 1 including existing Section IV Week
N of a light beacon (white) (10965N 1035922E) 31/18 Replace by:
marking the N edge of a separated reef which
dries to 03 m, thence: 1 All vessels over 500 gt must head for the Landfall
Through a channel (10998N 1035950E) marked Point (Punta de Recalada) in position 373200N
by light buoys (lateral), into the basin. 10000W.
7 Directions for Pertamina Basin (Eastern For further details on reporting see ADMIRALTY
Approach). From the vicinity of 11260N 1035986E List of Radio Signals Volume 6(3).
the track leads initially S to the vicinity of 11160N 2 Tankers with a draught of more than 18 m can
1035986E, and thence SSW to a position 5 cables berth during daylight hours only.
NNW of a light beacon (white) (10965N Entry into Dársena de Cartagena is generally
1035922E) marking the N edge of a separated reef limited to vessels of 300 m or less and maximum
which dries 03 m. draught of 1125 m. Larger vessels wishing to enter
The track then leads E through a channel should contact the port authority before arrival.
(10998N 1035950E) marked by light buoys
(lateral) into the basin. Spanish Notice 9/73/19 [NP45--No 42--Wk 13/19]
Wk13/19 4.3
IV
113
89
Paragraph 2.184 1--2 including existing Section IV Week
31/18 Replace by: Paragraph 4.46a 1 line(s) 1--3 existing Section IV Notice
Week 23/18 Replace by:
1 Track. From a position SE of Cabo Tiñoso
(373213N 10651W) (2.129), the track leads NE for 1 An UKC of 10 and 15 m should be maintained in
about 5½ miles, passing: the approach channel, at flood and ebb tide
2 SE of a shoal spit, with a depth of 65 m, respectively. An UKC of 05 m should be maintained
extending 1½ cables SW of Isla de Las at the berths.
Palomas (373424N 10250W), a rocky islet
with a wreck lying 1 cable off its WNW side; a
patch, with a depth of 44 m, lies a similar Correspondence Forth Ports Limited
distance off the SE side of the islet. Thence: [NP54--No 19--Wk 13/19]
4.4 Wk13/19
IV
166
Paragraph 4.386 1 line(s) 3 For (138--164) Read
(138--1615)
202
Paragraph 8.34 1 Replace by:
1 Pilotage is compulsory for all vessels over 250 gt
and available day and night; pilot boards in position
262130N 504621E or 261047N 504437E.
2 Pilotage is co--ordinated through Bahrain Port
Control. Bahrain Pilots handle all vessels for
Mina’ Salmºn (Khawr al Qulay’ah) and the BLNG,
Bahrain Steel (BS), ALBA and BAPCO Terminals.
ASRY pilots handle all vessels bound for the ship
building and repair yard.
For further information, see ADMIRALTY List of
Radio Signals Volume 6(8).
202
After Paragraph 8.35 2 line(s) 7 Insert:
An area in which anchoring is prohibited lies either
side of a submarine cable extending generally NE,
then N, from the Khalifa Bin Salmºn Port breakwater.
Wk13/19 4.5
IV
[13/19]
UPDATES TO ADMIRALTY SAILING DIRECTIONS
In force 14 th March 2019
Weekly
NP no Page(s) Title Edition
1 Africa 1 18th Edition (2017) 47/17
v Africa Pilot Volume 1 — Preface page -- Closure date 47/17
114 Spain -- Islas Canarias -- Isla de la Gomera — Wreck 42/18
121 Arquipélago de Cabo Verde — Regulations; anchorage 18/18
122 Cabo Verde -- Ilha do Sal — Directions; shoal 34/18
130 Arquipélago de Cabo Verde -- Ilha de São Vicente -- Baía de San Pedro — 18/18
Anchorage
132 Arquipélago de Cabo Verde -- Ilha de São Vicente -- Porto Grande — Depths 18/18
133 Arquipélago de Cabo Verde -- Ilha de Santo Antão -- Porto Novo — Anchorage 18/18
137 Arquipélago de Cabo Verde -- Ilha de Santiago -- Baía do Tarrafal — Anchorage 18/18
141 Arquipélago de Cabo Verde -- Ilha Brava -- Porto de Furna — Anchorages 18/18
147 Morocco -- West coast -- Larache — Pilotage 36/18
152 Morocco -- Mohammadia — Directions; oil terminal 36/18
152 Morocco -- West coast -- Mohammedia — Directions; light buoys 06/19
152--153 Morocco -- Mohammadia — Directions; inner port 36/18
153 Morocco -- West coast -- Mohammedia — Directions; light buoys 06/19
153 Morocco -- West coast -- Approaches to Mohammedia — Light buoy 06/19
154 Morocco -- Casablanca — Directions; buoyage 34/18
154 Morocco -- Casablanca — Outer anchorages; wrecks 33/18
154--155 Morocco -- Casablanca — Pilotage 34/18
155 Morocco -- Casablanca — Buoyage 38/18
156 Morocco -- Casablanca — Directions; buoyage 34/18
156 Morocco -- Casablanca — Berths 18/18
156 Morocco -- Casablanca — Berths 01/19
156 Morocco -- West coast -- Casablanca — Depths alongside 06/19
159 Morocco – Jorf Lasfar — Anchorages 12/18
160 Morocco – Jorf Lasfar — Directions; buoyage 02/18
160 Morocco -- Jorf Lasfar — Directions; light 11/19
162 Morocco -- West coast -- Safi — Wreck 06/19
163 Morocco -- Cap Hadid — Major light 52/18
163 Morocco -- Cap Hadid — Directions; major light 52/18
169 Morocco -- South of Agadir -- Oued Sous — Directions 11/19
173 Morocco -- Laâyoune — Directions; major light 13/19
175 Morocco -- West coast -- Laâyoune — Pilotage 47/18
175 Morocco -- West coast -- Laâyoune — Directions; leading marks 47/18
175 Morocco -- Laâyoune — Directions; useful marks 13/19
183 Morocco -- Ad Dakhla — Arrival information; outer anchorages 51/17
189 Mauritania -- Nouadhibou -- Point Central to Pointe de Cansado — Directions 05/18
189 Mauritania -- Nouadhibou -- Baie de Cansado — Directions; wrecks, buoy 05/18
191--92 Mauritania -- Cap Blanc to Port de L’Amitié — Directions; wrecks; depths 07/19
194 Mauritania -- Port de l’Amitié — Anchorage 40/18
194 Mauritania -- Port de l’Amitié — Directions; leading lights 40/18
214 The Gambia -- Banjul — Depth 09/19
215 The Gambia -- Banjul -- Kotu Point — Directions 09/19
216 The Gambia -- Banjul -- Kotu Point — Directions, depth 09/19
223 Senegal -- Rivière Casamance — Directions; wreck 12/19
244 Guinea -- Approaches to Port Kamsar — Anchorage terminal 08/19
4.6 Wk13/19
IV
Weekly
NP no Page(s) Title Edition
296 Africa -- Ivory Coast -- Abidjan — Limiting conditions; depth 50/18
323 Togo -- Port de Lomé — Anchorages 02/19
323 Togo -- Port de Lomé — Regulations 02/19
323 Togo -- Port de Lomé — Directions; wreck 18/18
325 Togo -- Kpémé — Anchorages 02/19
326 Republic of Benin -- Cotonou — Outer anchorages; obstruction 33/18
357 Nigeria -- Bight of Biafra — Offshore terminals 23/18
2 Africa 2 18th Edition (2017) 39/17
6 Republic of South Africa — Regulations; PSSA 28/18
99 Isla de Bioko -- Puerto de Malabo — Berths; depths 07/18
131 Cameroon -- Kribi — Marine terminal 02/19
147 Gabon -- Owendo — Berths 06/19
159 Gabon -- South--south--west of Pointe Tishibobo — Terminal 34/18
171 Angola -- Malongo Terminal — Pilotage 48/17
173 Angola -- Futila Terminal — Directions; buoyage 39/17
185 Angola -- River Congo -- Ponta Kimongoa — Directions; caution 21/18
193 Angola -- Kaombo Field — Restricted areas 01/18
196 Angola -- Palanca Terminal — Pilotage 39/17
226 Namibia -- Walvis Bay — Wreck; barge 11/19
263 Republic of South Africa -- Saldanha Bay — Prohibited area 47/17
263 Republic of South Africa -- Saldanha Bay — MBM; submarine gas pipeline 47/17
3 Africa 3 17th Edition (2016) 16/16
6 South Africa — Regulations; PSSA 28/18
158 Mozambique -- Ponta do Ouro to Baía de Maputo -- Cabo Inhaca — Anchorage 24/17
158, 159 Mozambique – Baía de Maputo — General information; depths; vessel traffic service; 17/17
directions; anchorages
160 Mozambique – Maputo — Port information 17/17
160 Mozambique -- Maputo — Vertical clearances 52/17
160 Mozambique -- Maputo — Vertical clearances 40/18
160 Mozambique -- Maputo — Vertical clearances 43/18
160 Mozambique – Maputo — Port information 17/17
160 Mozambique -- Maputo — Pilotage 12/18
160 Mozambique -- Maputo — Pilotage 16/18
160 Mozambique – Maputo — Port information 17/17
160 Mozambique -- Maputo — Regulations 52/17
160 Mozambique -- Maputo — Regulations 40/18
160 Mozambique -- Maputo — Directions; leading lights 02/17
160, 161, 162 Mozambique – Maputo — Port information 17/17
162 Mozambique -- Maputo — Berths; vertical clearance 52/17
162 Mozambique – Maputo — Port information 17/17
169, 170, 171, 173 Mozambique – Beira approaches — General information; directions; Racon; buoy 37/16
176 Mozambique – Quelimane approaches — Directions; wreck 26/17
189 Mozambique -- Nacala — Alongside berths 25/18
204 Tanzania -- Mtwara — Depth 46/18
205 Tanzania -- Mtwara — Directions; depth 46/18
262 Kenya -- Mombasa — Maritime security zone 28/17
267 Kenya -- Mombasa — Anchorage berths 12/17
267 Kenya -- Mombasa -- Port Reitz — LPG Terminal 08/18
269 Kenya -- Mombasa -- Port Reitz — Berths 26/17
Wk13/19 4.7
IV
Weekly
NP no Page(s) Title Edition
4 South--East Alaska 8th Edition (2015) 16/15
169 Kake -- Security Bay — Patch 41/17
365 Cook Inlet – Approaches to Anchorage — Directions; V--AIS 47/15
5 South America 1 19th Edition (2017) 22/17
6 Brazil — Regulations; Extractive Reserves 24/18
71 Brazil -- South Coast -- Porto de Santos — Marine exploration 48/18
81 Brazil -- Rio Amazonas — Regulations 48/17
88 Brazil -- Porto de Santana — Berths; anchorage 41/17
88 Brazil -- North coast -- East of Ilha Do Oiapoque — Directions 50/17
93 Brazil -- North coast -- Rio Pará -- Ponta Taipu — Directions; light 11/19
93 Brazil -- North coast -- Rio Pará -- Ponta Taipu — Directions; light 11/19
93 Brazil -- North coast -- Rio Pará -- Ilha dos Guarás — Directions; light 31/18
93 Brazil -- Rio Pará -- Canal do Espadarte — Directions; depths 48/17
94 Brazil -- North coast -- Rio Pará -- Salinópolis to Chapéu Virado — Directions 05/18
96 Brazil -- North coast -- Porto de Belém — Directions; wreck 11/19
97 Brazil -- Belém -- Ilha do Mosqueiro — Directions; shoal depth 22/18
99 Brazil -- Rio Pará -- Baía de Marajó — Directions; wreck 01/18
99 Brazil -- North coast -- Rio Pará -- Porto de Vila do Conde — Directions; buoy 05/19
101 Brazil -- Rio Pará -- Porto de Vila do Conde — Directions; wreck 01/18
109 --110 Brazil -- River Amazon -- Ilha das Garças — Directions; depths 48/17
115 Brazil -- Rio Negro -- Porto de Manaus — Vertical clearance 48/17
115 Brazil -- Rio Negro -- Porto de Manaus — Anchorages 48/17
116 Brazil -- Rio Negro -- Porto de Manaus — Bridge 48/17
125 Brazil – North coast – Cabo Gurupi to Ilhas de São João — Directions; wreck 30/18
126 Brazil – North coast – Ilha Mangunça — Directions; light 29/18
127 Brazil -- North coast -- Baía de São Marcos -- Ilha do Medo — Directions; light 07/19
128 Brazil -- North coast -- Baía de São Marcos -- Ilha do Medo — Directions; light 07/19
129 Brazil -- Baía de São Marcos -- Terminal da Ponta da Madeira — Berth 23/17
129 Brazil -- North coast -- Baía de São Marcos -- Ilha do Medo — Directions; light 07/19
130 Brazil -- North coast -- Baía de São Marcos -- Ilha do Medo — Directions; light 07/19
137 Brazil -- Pecém Terminal — Anchorages; berths 50/17
137 Brazil -- North coast -- Porto de Mucuripe — Wreck 07/19
141 Brazil -- North coast -- Approaches to Fortaleza — Directions; wreck 07/19
162 Brazil -- East coast -- South of Recife — Directions; wreck 27/18
171 Brazil -- East Coast -- Aracaju -- Sergipe Terminal — Pilotage 01/19
171 Brazil -- Aracaju -- Sergipe Terminal — Anchorage 39/18
175 Brazil -- East coast -- Salvador — Anchorages; pilotage 36/18
175 Brazil -- East coast -- Porto de Salvador — Anchorages 38/18
188 Brazil -- East coast -- Porto de Ilhéus — Controlling depths 31/18
199 Brazil -- Barra do Riacho — Anchorage 20/18
199 Brazil – Terminal de Barra do Riacho — Prohibited anchorage; harbour 01/18
200 Brazil – Terminal de Barra do Riacho — Berths 01/18
201 Brazil -- Porto de Vitória —Vessel traffic service 01/18
202 Brazil -- Porto de Vitória —Vessel traffic service 01/18
209 Brazil -- East coast -- Guaxindiba — Directions; lights 46/17
210 Brazil -- East coast -- Approaches to Porto do Açu — Danger area 31/18
211 Brazil -- Porto do Açu — Directions; light beacons; buoys 24/18
214 Brazil -- Cabo Búzios -- Enseada de Búzios — Anchorage 46/17
219 Brazil -- East coast -- Baía de Guanabara — Wreck 09/19
227 Brazil -- Porto de Rio de Janerio — Directions 50/17
4.8 Wk13/19
IV
Weekly
NP no Page(s) Title Edition
228 Brazil -- Porto de Rio de Janeiro — Anchorages 01/18
234 Brazil -- East coast -- Ponta de Castelhanos — Directions; Pilot 05/18
236 Brazil -- Baía de Sepetiba -- Porto de Itaguaí — Directions; channels 52/17
236 Brazil -- Baía de Sepetiba -- Porto de Itaguaí — Directions; channels; depths 52/17
237 Brazil -- East coast -- Baía de Sepetiba — Directions; wreck 12/18
236--237 Brazil – Baía de Sepetiba — Directions; wreck 03/19
237 Brazil -- South coast -- Porto de Itaguaí — Depths 25/18
237 Brazil -- Porto de Itaguaí — Anchorages 52/17
254 Brazil -- Approaches to Porto de Santos — Directions; wreck 17/18
256 Brazil -- East coast -- Barra de Icapara — Directions; light 01/18
257 Brazil -- East coast -- Barra de Icapara — Directions; light 01/18
257 Brazil -- East coast -- Ilha do Cardoso — Wreck 09/19
260 Brazil -- East Coast -- Porto de Antonina — Position; limiting conditions; berths 22/18
266 Brazil -- South coast -- Itajaí — Terminals; alongside berths 26/18
273 Brazil -- South coast -- Barra do Rio Grande Approaches — Directions; wrecks 27/18
276 Brazil -- Porto Do Rio Grande — Berths 43/17
290 Uruguay -- Isla de Flores — ESSA 39/18
290 Uruguay – Río de La Plata — Directions; wreck 27/17
294 Uruguay -- Montevideo -- Antepuerto — Depth 11/18
295 Uruguay -- Puerto de Montevideo — Prohibited area 45/17
298 Uruguay -- Montevideo -- Antepuerto — Depth 11/18
298 Uruguay -- Puerto de Montevideo — Alongside berths; Muelle C 23/17
300 Uruguay -- Río de La Plata — Under keel clearance 46/18
303 Argentina – Río de La Plata — Directions; Canal Punta Indio Sudeste 22/17
304 Argentina -- Puerto La Plata — Anchorages 46/18
307 Uruguay -- West--north--west of Montevideo — ESSA 39/18
319 Uruguay – Río de La Plata – Paso de San Juan and Pozos de San Juan — 22/17
Directions; emergency anchorage; passing areas
326 Uruguay -- Río Uruguay -- Puerto de Nueva Palmira — Light; berths 41/17
335 Argentina -- Puerto Bunge Ramallo — Directions; name change; new route 41/17
336 Argentina -- Puerto Bunge Ramallo — Name change 41/17
336 Argentina -- Río Parana -- Puerto San Nicolás — Anchorages 13/18
337 Argentina -- Río Paraná -- Punta Alvear — Terminals 47/18
337 Argentina -- Río Paraná -- Puerto Rosario — Berths 47/18
352 Argentina -- Bahía Blanca -- Puerto Galván — Berths 16/18
353 Argentina -- Bahía Blanca — Anchorages 16/18
6 South America 2 18th Edition (2011) 50/11
108 Falkland Islands -- Choiseul Sound — Pilotage 14/18
113 Falkland Islands -- East Falkland -- Hecate Channel -- East Cove — Buoy 14/18
220--221 Chile -- Canal Beagle – West Part – Canal Thomson — General information; 25/12
directions
221 Chile – Canal Thomson — Directions; AIS 14/14
220--221 Chile -- Canal Beagle – West Part – Canal Thomson — General information; 25/12
directions
235 Chile – Bahía Cook — Pilot boarding position 10/12
235--236 Chile – Bahía Cook – General information — Directions 25/12
235 Chile – Bahía Cook — Directions; AIS 14/14
243, 244, 252 Chile – Canal Cockburn — Directions; light 10/12
273, 275 Chile – Primera Angostura — Directions; AIS 14/14
275--276 Chile – Estrecho de Magallanes – Puerto Sara — General information; directions; 42/12
leading lights
Wk13/19 4.9
IV
Weekly
NP no Page(s) Title Edition
7 South America 3 13th Edition (2018) 49/18
204 Chile -- Puerto San Antonio — Berth draught 49/18
204--205 Chile -- Puerto San Antonio — Prohibited areas; outer anchorage; pilotage 49/18
205--206 Chile -- Puerto San Antonio — Moorings; berths 49/18
258 Chile -- Bahia Chiquinata -- Punta Gruesa — Prohibited area 49/18
260 Chile -- Bahia Chiquinata -- Punta Gruesa — Prohibited area 49/18
279 Peru -- San Juan — Anchorage 09/19
291 Peru -- Callao – Ensenada de Chorrillos — Anchorage 49/18
291--292 Peru -- Callao — Anchorages 49/18
299 Peru – Puerto Chancay — Anchorages 49/18
300 Peru – Puerto Chancay — Berths 49/18
300 Peru -- Puerto Huacho — Outer anchorage 51/18
305 Peru -- Chimbote — Anchorages 05/19
305 Peru – North--west coast – Chimbote — Berths; anchorage 13/19
307 Peru -- Bahía Coishco — Anchorages 05/19
313 Peru – North--west coast – Eten Offshore Terminal — Arrival information; anchorage 13/19
313 Peru – North--west coast – Pimentel — Arrival information; anchorage 13/19
314 Peru – North--west coast – Santa Rosa — Anchorage 13/19
314 Peru -- North--west coast -- Pimentel -- San José — Anchorages 13/19
321 Peru -- North--west coast --Talara — Outer anchorages 13/19
324 Peru -- Puerto Zorritos — Anchorage 09/19
332 Ecuador -- Guayaquil — Vertical clearance 02/19
332 Ecuador -- Guayaquil — Horizontal clearance 02/19
335--336 Ecuador -- Guayaquil — Berths 02/19
341 Ecuador – Manta — Directions; light 51/18
342 Ecuador – Manta — Directions; Light 51/18
342 Ecuador -- Monteverde — Pilotage; anchorages; berths 02/19
343 Ecuador – Manta — Directions; Light 51/18
343 Ecuador – Manta — Directions; Light 51/18
346 Ecuador -- Esmeraldas — Anchorage; pilotage; traffic regulations 08/19
347 Ecuador -- Esmeraldas — Directions; buoy 02/19
347 Ecuador -- Approaches to Esmeraldas — Directions 08/19
7A South America 4 8th Edition (2018) 51/18
90 Guyana -- Waini River — Directions; wreck 01/19
93 Venezuela -- Boca Grande -- South Channel — Light buoy 51/18
94 Venezuela -- Boca Grande -- South Channel — Light buoy 51/18
94 Venezuela -- Boca Grande -- South Channel — Light buoy; precautionary area 51/18
95 Venezuela -- Boca Grande -- South Channel — Controlling depths 51/18
95 Venezuela -- Boca Grande -- South Channel — Directions; wreck; light buoy 51/18
98 Venezuela -- Río Grande -- San Felix — Directions; leading lights 51/18
98 Venezuela -- Río Orinoco — Anchorages 51/18
98 Venezuela -- Río Orinoco -- Punta de Piedra — Anchorage 51/18
98 Venezuela -- Río Orinoco -- Los Castillos — Anchorage 51/18
98 Venezuela -- Río Orinoco -- San Félix — Anchorages 51/18
98 Venezuela -- Río Orinoco -- San Félix — Directions; leading light 51/18
99 Venezuela -- Río Orinoco -- Puerto Matanzas — Anchorage 51/18
116 Trinidad and Tobago -- Gulf of Paria -- Chaguaramas bay — Pilotage 11/19
129 Venezuela -- Gulf of Paria -- Puerto de Guiria — Anchorages 09/19
160 Venezuela -- Bahía de Pozuelos — Directions 09/19
161 Venezuela -- Bahía de Pozuelos -- Los Cocos — Directions 09/19
4.10 Wk13/19
IV
Weekly
NP no Page(s) Title Edition
162 Venezuela -- Bahía de Barcelona -- Puerto Jose — Pilotage 09/19
221 Venezuela – Bahía de Amuay — Anchorage 51/18
252 Colombia -- North coast -- Puerto Barranquilla -- Terminal Maritimo — Directions; 51/18
leading lights
263 Colombia -- North coast -- Golfo de Morrosquillo — Directions; track 03/19
277 Panama – Bahía de San Cristobal to Bahía de Portobelo — Marine reserve 51/18
278 Panama – Bahía de Portobelo — Marine reserve 51/18
291 Panama -- Puerto de Cristóbal — Anchorage 02/19
293 Panama -- Puerto de Cristóbal — Berths 02/19
297 Panama -- Panama Canal -- Gatún Lake — Anchorage 52/18
8 Pacific Coasts of 14th Edition (2016) 46/16
Central America and
United States
6 Mexico — Regulations; protected areas 33/18
6 Mexico — National regulations 42/18
75 Mexico -- Islas Revillagigedo — Regulations 05/18
75 Mexico -- West coast -- Islas Revillagigedo — Protected area 33/18
77 Mexico -- West coast -- Rocas Alijos — Protected area 33/18
77 Mexico -- West coast -- Isla de Guadalupe — Protected area 33/18
85 Panama -- South--west coast -- Isla de Coiba — Traffic regulations 23/18
86 Panama -- Canal de Jicaron — Anchorages 23/18
89 Panama -- South--west coast -- Isla de Coiba — Caution 23/18
96 Costa Rica -- South--west coast -- Golfo Dulce — Traffic regulations 23/18
97 Costa Rica -- Puerto Golfito — Anchorages 23/18
98 Costa Rica – Peninsula de Osa — Traffic regulations; ATBA 01/18
99 Costa Rica -- Isla del Caño — Anchorage 23/18
100 Costa Rica -- Golfo de Nicoya — TSS 27/18
103 Costa Rica -- Puerto Caldera — Berths; depths 27/18
130 El Salvador -- Acajutla — Outer anchorage; wreck 05/18
134 Guatemala -- Puerto Quetzal — Berths; depths 01/18
135 Guatemala -- Puerto Quetzal — Directions; Berths 49/17
141 Mexico -- West coast -- Puerto Chiapas — Depths 52/17
142 Mexico -- West coast-- Puerto Chiapas — Berths 52/17
144 Mexico -- Pacific coast -- Salina Cruz -- Directions; Leading lights 17/17
155 Mexico -- West Coast -- Lázaro Cárdenas — Directions; TSS 38/18
156--157 Mexico -- West Coast -- Lázaro Cárdenas — Anchorage; pilotage; regulations 38/18
158 Mexico -- Lázaro Cárdenas — Harbour; development 48/17
157--158 Mexico -- Lázaro Cárdenas — Port layout 45/18
158 Mexico -- West Coast-- Lázaro Cárdenas — Directions; TSS 38/18
158 Mexico -- Lázaro Cárdenas — Directions; basins and berths 45/18
160 Mexico -- Puerto de Láguna de Cuyutlán — Directions; general information 13/18
165, 166 Mexico -- Bahía de Manzanillo to Cabo Corrientes — Directions; light 46/16
179 Mexico -- West coast -- Golfo de California — General information; Protected areas 33/18
180 Mexico -- West coast -- Golfo de California Southern part -- Offshore route — 33/18
Protected areas
189 Mexico -- West coast -- Golfo de California -- Cabo Falso to Punta Arena — Protected 33/18
areas
190 Mexico -- West coast -- Golfo de California -- Bahía San Lucas — Protected areas 33/18
191 Mexico -- West coast -- Golfo de California -- Bahía Frailes — Protected areas 33/18
191 Mexico -- West coast -- Golfo de California -- Punta Arena to Bahía de la Paz — 33/18
Protected areas
197 Mexico -- West coast -- Golfo de California -- La Paz — Anchorages 33/18
Wk13/19 4.11
IV
Weekly
NP no Page(s) Title Edition
197--198 Mexico -- West coast -- Golfo de California -- Bahía de la Paz to Isla Coronados — 33/18
Protected areas
207 Mexico -- West coast -- Golfo de California -- Isla San Pedro Mátir — Protected areas 33/18
212 Mexico -- West coast -- Golfo de California -- Northern part -- West side — Protected 33/18
areas
215 Mexico -- Golfo de California -- Isla Ángel de la Guarda and Puerto Refugio — 33/18
Restrictions
215 Mexico -- Golfo de California -- Canal Salsipuedes and Canal de Ballenas — 33/18
Protected areas
221 Mexico -- West coast -- Baja California — General Information; protected areas 33/18
242 Mexico -- Bahía de Todos Santos -- Ensenada — Pilotage 15/18
242, 243 Mexico – Bahía De Todos Santos – Ensenada — Development 06/17
245 Mexico -- Energia Costa Azul LNG Terminal — Directions; light alignment 11/18
246 Mexico -- West Coast -- Rosarito — Directions; wreck 37/18
254 United States – San Diego Bay – Entrance channel — Directions; dangerous wreck 10/17
268 USA -- California -- Long Beach Harbor -- Back Channel — Vertical clearance; 31/17
bridges
268 United States of America -- California -- Long Beach Harbor -- Back Channel — 45/18
Vertical clearance; bridges
287 United States -- Port Hueneme — Controlling depths 45/17
287 United States of America -- California -- Channel Islands Harbor — Depths 50/17
287 United States of America -- California -- Channel Islands Harbor — Depths 40/18
331 United States America -- San Francisco Bay -- Yerba Buena Island — Wreck 29/17
335 United States of America – San Francisco Bay – Hunters Point to Coyote Creek — 46/16
Directions; San Bruno Shoal Channel depth and width
342 United States of America -- San Francisco -- San Pablo Bay — Directions; 04/18
submerged piles
346 United States of America – Pacific Coast – Suisun Bay — Anchorages; wrecks 46/16
347 United States -- California -- Suisun Bay -- Antioch — Vertical clearance 47/17
349 United States of America – Port of Sacramento — vertical clearances 51/16
349 United States -- California -- Port of Sacramento -- Sacramento River — Vertical 47/17
clearance
386 United States of America – Coos Bay to Yaquina Bay — Directions; major light 05/17
400 United States of America – Oregon – Columbia River — Pilotage 21/17
403 United States -- Washington -- Columbia River -- Chinook — Controlling depth 49/17
421 United States of America – Washington – Grays Harbor — Berths 21/17
9 Antarctic 8th Edition (2014) 38/14
139 Îles Kerguelen – Baie Norvégienne — Directions; channel 01/18
221 British Antarctic Territory – South Orkney Islands – Signy Island — Directions; light 21/17
229 British Antarctic Territory – South Shetland Islands – Clarence Island to Low Island 01/16
through Bransfield Strait — Directions
289 Antarctica – Hope Bay — Grunden Rock Light 09/15
291 Antarctic -- Trinity Peninsula -- Antarctic Sound to Montravel Rock — Directions; 13/17
shoal
297 Orleans Strait -- Mikkelsen Harbour — Directions; shoal 14/18
310 Antarctic Peninsula -- Gerlache Strait -- North North West of Useful Island — 52/17
Directions; shoal
320 Antarctica – Port Lockroy — Bills Island Light 09/15
335 Antarctic Peninsula -- Lavoisier Island -- Cape Leblond — Directions; position 05/18
336 Antarctic Peninsula -- Biscoe Islands -- Pendleton Strait — Directions; positions 05/18
351 Antarctic Peninsula -- Biscoe Islands -- Pendleton Strait — Directions; positions 05/18
353 Antarctic Peninsula -- Biscoe Islands -- Pendleton Strait — Directions; positions 05/18
355 Antarctic Peninsula -- Biscoe Islands -- Lavoisier Island — Directions; positions 05/18
4.12 Wk13/19
IV
Weekly
NP no Page(s) Title Edition
356 Antarctic Peninsula -- Biscoe Islands -- Pendleton Strait to Matha Strait — Directions; 05/18
positions
357 Antarctic Peninsula -- Crystal Sound — Directions; positions 05/18
358 Antarctic Peninsula -- Crystal Sound — Directions; positions; depth 05/18
359 Antarctic Peninsula -- Crystal Sound — Directions; positions 05/18
360 Antarctic Peninsula -- Crystal Sound -- Bragg Islands — Directions; positions 05/18
361 Antarctic Peninsula -- Crystal Sound -- Bragg Islands — Positions 05/18
371 Antarctic Peninsula W coast – Liard Island — Directions; rock 06/17
424 Ross Sea – Scott Island — Position 11/17
10 Arctic 1 9th Edition (2016) 07/16
8 Navigation and Regulations -- Russian pilotage — Icebreaker pilotage 32/16
86 Russia -- Kara Sea -- Ostrov Belyy — Directions; recommended routes 48/18
275 Obskaya Guba – Mys Belyy to Mys Drovyanov — Directions; anchorages and 52/16
harbours
275 Russia -- Kara Sea -- Mys Belyy to Mys Drovyanoy — Directions; recommended 48/18
route
275, 276 Mys Drovyanov to Mys Shtormovoy — General information; directions 52/16
277 Mys Shtormovoy to Mys Khonarasalya — Directions 52/16
278 Kara Sea -- Obskaya Guba -- Port Sabetta — Development 12/17
278--279 Kara Sea -- Obskaya Guba — Directions; DW route; landmarks; depths 29/17
279--280 Kara Sea -- Obskaya Guba — Directions; DW route; landmarks; depths 29/17
289 Kara Sea – South Part — Aids to navigation; lights 04/17
311 Reka Yenisey – Mouth of river to Igarka — General information; navigation; lights 04/17
319, 322 Kara Sea -- Reka Yenisey -- Mys Krestovskiy to Dudinka — Pilot boarding positions; 16/16
anchorages
322 Kara Sea -- Reka Yenisey -- Dudinka to Igarka — Pilot boarding position 16/16
473, 474 Reka Kolyma – Protoka Kamennaya — Depths; directions 07/16
11 Arctic 2 12th Edition (2018) 34/18
126--127 Iceland -- Akranes — Directions; lights 45/18
247 Svalbard -- Spitsbergen -- Adventfjorden — Anchorage 34/18
322 Greenland -- Kong Christian IX Land -- Kap Gustav Holm — Directions; shoal 49/18
12 Arctic 3 10th Edition (2018) 19/18
181 Greenland -- West coast -- Sarfartoq -- Kangerlussuaq — Berth 42/18
13 Australia 1 5th Edition (2017) 17/17
10 Australian Regulations — Protection of historic features and areas 36/18
97 Queensland -- Gulf of Carpentaria -- Albatross Bay -- Amrun Port — Port 52/18
114 Melville Bay -- Gove Harbour — Outer anchorages 08/18
129 Arnhem Land -- North and north--east of Maningrida — Outlying dangers; wrecks 08/18
130 Northern Territory -- Arafura Sea -- South Goulburn Island — Depths 45/17
146 Western Australia -- Ashmore Reef — Prohibited area 35/18
147 Western Australia -- North Coast -- Browse Island — FLNG Terminal 19/18
156 Northern Territory -- Port Darwin — Regulations; restricted areas 21/18
159 Northern Territory -- Port Darwin -- Wickham Shoal — Wreck 26/18
166 Australia -- North coast -- Cambridge Gulf — Pilotage 08/18
168 Western Australia -- Cambridge Gulf -- Cawston Bay — Directions; depth 01/18
168 Western Australia -- Cambridge Gulf -- Wyndham Wharf — Directions; light buoys 49/18
183 Western Australia -- Brunswick Bay -- Hanover Bay — Anchorage 17/17
213 Western Australia -- Broome — Directions; controlling depth 46/18
221 Western Australia -- Port Hedland — Traffic Regulaltions 38/17
223 Western Australia -- Port Hedland -- Goldsworthy Front — Directions; light 35/18
223 Western Australia -- Port Hedland — Berths 38/17
Wk13/19 4.13
IV
Weekly
NP no Page(s) Title Edition
224 Western Australia -- Port Hedland — Tug haven 48/17
235 Western Australia -- Port Walcott — Pilot boarding place 17/17
236 Port Walcott -- Outer North Channel — Emergency waiting areas 42/17
241 Western Australia -- Dampier -- East Intercourse Island -- Radome 17/17
279 Western Australia -- Shark Bay -- Denham Sound — Directions; wreck 28/18
281 Geelvink Channel -- Shoal Point — Directions; Racon 44/17
284 Geelvink Channel -- Shoal Point — Directions; Racon 44/17
291 Western Australia -- Port Denison — Directions; leading lights 37/17
326 Western Australia -- South Coast -- Albany — Directions; light 12/19
328 Western Australia -- South Coast -- Albany — Directions; light 12/19
332 Western Australia -- South Coast --Albany — Directions; light 12/19
333 South coast of Australia -- Cape Vancouver -- Lookout Point — Wreck 03/19
338 South coast of Australia -- Cape Le Grand -- Pasco Island — Directions; shoal 03/19
347 South Australia -- Great Australian Bight -- Cape Adieu — Environmentally sensitive 37/18
sea area
356 South Australia -- Streaky Bay -- Blanche Port — Directions 11/18
359 South Australia -- Great Australian Bight -- Venus Bay — Directions 11/18
383 South Australia -- Germein Bay — ESSA 40/18
383 South Australia -- Germein Bay -- Port Pirie — ESSA 40/18
398 South Australia -- Kangaroo Island -- Hog Bay — Anchorage 35/17
401 Gulf of Saint Vincent -- Port Stanvac — Port description 08/19
14 Australia 2 13th Edition (2016) 28/16
5 Australia — Regulations; Australian Quarantine and Inspection Service; website 52/17
9 Australian Regulations — Protection of historic features and areas 36/18
10 Distress and Rescue -- Ship reporting systems — MASTREP 08/17
68 Bass Strait — Regulations; restricted area 33/17
87 Chappell Islands -- East side — Directions; Minnie Carmichael 46/16
111--112 Point Grey to Port Phillip Heads — Anchorages and harbours 52/16
115 Victoria -- Approaches to Port Philip -- South--south--west of Point Lonsdale — 14/18
Pilotage
133 Victoria -- Port Philip -- Geelong — Directions for Point Henry Pier; leading beacons 28/16
137 Victoria -- Melbourne -- Port Phillip — Anchorages 26/18
138 Port Phillip -- Werribee River — Directions; leading lights 37/17
150 Victoria -- Philip Island -- Cape Woolamai — Depth 14/18
152 Western Port -- Hastings -- West Head — Pilotage 25/18
156 Western Port -- Hastings to Sandy Point — Directions; under keel clearance; speed 25/18
165 Bass Strait -- Cape Woolamai to Cape Liptrap -- Anderson Inlet — Prohibited 10/17
anchorage
169--170 Bass Strait — Regulations; restricted area 33/17
171 Victoria -- Gabo Island — Racon 14/17
182 Victoria – Port Albert — Directions; buoy 32/18
191 Victoria -- Gabo Island — Racon 14/17
197, 200 North coast of Tasmania -- Circular Head -- Stanley Harbour — Prohibited anchorage 10/17
201 Tasmania -- Port Latta — Anchorage 20/17
205, 206 Tasmania North coast – Burnie — Arrival information; pilotage; directions 17/17
209, 212 Tasmania -- Devonport — Limiting conditions; berths 39/16
215 Tasmania -- North Coast -- Port Dalrymple — Directions; radio masts 42/18
231 Tasmania West coast – Cape Grim — Directions; shoal 30/17
265 Port Arthur — Restricted area; anchorage 27/17
266 Port Arthur — Restricted area; anchorage 27/17
269 Hobart — Arrival information; outer anchorages 27/17
4.14 Wk13/19
IV
Weekly
NP no Page(s) Title Edition
270 Hobart — Arrival information; restricted area 27/17
290 West coast of Tasmania -- Wineglass Bay — Anchorage 27/17
292 Tasmania -- Spring Bay -- Paddys Point — Leading lights 14/17
293 West coast of Tasmania -- Wineglass Bay — Anchorage 27/17
294, 296 Cape Tourville to Eddystone Point — Anchorages and harbours 52/16
301 New South Wales -- Eden — UKC 24/18
301 New South Wales -- Eden — Anchorages 24/18
303 New South Wales -- Eden — Berths; depths 24/18
303 New South Wales -- Eden -- Munganno Point — Caution; obstructions 30/18
303--304 New South Wales -- Eden — Berths; depths 24/18
338 New South Wales – Port Botany — Limiting conditions; controlling depths; berths 01/17
341 New South Wales – Botany Bay — Berths 30/16
341 New South Wales – Port Botany — Limiting conditions; controlling depths; berths 01/17
347 New South Wales – Sydney Harbour — Arrival information; anchorages 01/17
360, 361, 364 New South Wales – Sydney Harbour – Glebe Island – White Bay – Gore Cove — 01/17
Directions; naval berths; commercial basins and berths
366 New South Wales -- Port Jackson — Vertical clearances 44/18
366 Sydney -- Paramatta River — Wreck 41/16
366 New South Wales -- Port Jackson — Directions; vertical clearances 44/18
15 Australia 3 14th Edition (2018) 24/18
112 Australia -- New South Wales -- Newcastle -- Stockton Bight — Pilotage 40/18
124 Australia -- New South Wales -- Perpendicular Point — Directions; ESSA 42/18
129 Australia -- East Coast -- Coffs Harbour to Evans Head — Environmentally Sensitive 41/18
Sea Area
156 Australia -- Queensland -- Moreton Bay -- St Helena Island — Directions; wreck 24/18
178 Australia -- Queensland – Port Bundaberg — Directions; lights 47/18
241 Australia -- East Coast -- Whitsunday Passage — Tidal streams 27/18
251 Australia -- Queensland -- Whitsunday Passage -- Grassy Island — Anchorage 42/18
266--267 Australia -- Queensland – Lucinda — Directions; lights 24/18
266--267 Australia -- East coast -- Lucinda — Directions; shoal 08/19
268 Australia -- East coast -- Queensland -- Hinchinbrook Channel — Directions; leading 52/18
lights
291 Australia -- Queensland -- Cairns — Pilotage 12/19
369 Papua New Guinea – Port Moresby — Directions; lights 24/18
374 Papua New Guinea – Port Moresby — Directions; lights 24/18
375 Papua New Guinea – Port Moresby — Directions; lights 24/18
378 Papua New Guinea – Port Moresby — Directions; lights 24/18
18 Baltic 1 18th Edition (2018) 43/18
110 Sweden -- West coast -- Göteborg -- Marieholmsbron — Regulations 11/19
144 Denmark -- Kattegat -- Sjællands Odde — Directions; light 02/19
144--145 Denmark -- Kattegat -- Sjællands Odde — Directions; light 02/19
189 Sweden -- West coast -- Flintrännan — Controlling depth 09/19
209 Denmark -- København -- Frederiksholmsløbet — Vertical clearance 03/19
216 Sweden -- West coast -- Flintrännan — Controlling depth 09/19
310 Denmark -- Lillebælt -- Sønderborg — Prohibited area 09/19
337 Denmark -- Skælskør -- Stigsnæsværkets Havn — Pilotage; berths 08/19
386 Denmark -- Egernsund -- Egernsundbroen — Vertical clearance 43/18
398 Germany -- Neustädter Bucht -- Hafen von Neustadt — General information; 10/19
prohibited area
Wk13/19 4.15
IV
Weekly
NP no Page(s) Title Edition
19 Baltic 2 17th Edition (2018) 06/18
86 Poland -- Baltic Sea -- North of Rozewie — Submarine pipeline 36/18
92 Denmark -- Bornholm -- Rønne — Directions; Buoy 15/18
92 Denmark -- Bornholm -- Rønne — Prohibited area 10/18
92 Denmark -- Bornholm -- Rønne — Directions; Buoy 15/18
96 Denmark -- Bornholm -- Gudhjem — Pilotage 26/18
97 Denmark -- Bornholm -- Rønne — Prohibited area 23/18
97 Denmark -- Bornholm -- Rønne — Directions; wreck, shoal, pilotage 23/18
97 Denmark -- Bornholm -- Bakkegrund — Directions; dangerous wreck 50/18
105 Sweden -- Gotland -- Visby — Development; pier 19/18
126 Sweden -- Åhus — Photograph 13/18
140 Sweden -- Approaches to Ronneby — Directions; lights; beacons; alignment 31/18
144 Sweden -- Approaches to Karlskrona -- Hasslö -- Hasslöbron — Horizontal clearance; 44/18
lights
153 Sweden -- Kalmarsund -- Degerhamn — Harbour; depths 13/19
155 Sweden -- Kalmarsund -- Kristianopel — Directions; alignment 19/18
167 Sweden -- North Kalmarsund -- Jättersön — Directions; buoys 27/18
205 Sweden -- Approaches to Norrköping — Directions; leading lights 03/19
215 Sweden -- Oxelösund -- Ljungskär — Directions; light sector 05/19
257 Sweden -- Stockholms Skärgård -- Söderarm — Draught 30/18
262 Sweden -- Stockholms Skärgård -- Landsort entrance — Traffic regulations 30/18
265 Sweden -- Nynäshamn -- Furholmen — Restricted area 22/18
274 Sweden -- Stockholms Skärgård -- Approaches to Sandhamn — Traffic regulations 30/18
275 Sweden -- Stockholms Skärgård -- Approaches to Sandhamn — Traffic regulations 30/18
281 Sweden -- Stockholms Skärgård -- Oxdjupet — Directions; wreck 30/18
287 Sweden -- Stockholm -- Karl Johansslussen — Restricted area 31/18
287 Sweden -- Stockholm — Regulations 12/18
288 Sweden -- Stockholm -- Södrahamnen — Development 12/18
289 Sweden -- Stockholm -- Ulvsundasjön — Directions; vertical clearance 06/18
290 Sweden -- Port of Stockholm — Basins and berths; alongside depth 19/18
296 Sweden -- Stockholms Skärgård -- Söderarm entrance — Traffic regulations 30/18
296 Sweden -- Stockholms Skärgård -- Tjärven fairway — Traffic regulations 30/18
299 Sweden -- East Coast -- Kapellskär — Berths 37/18
304 Sweden -- Stockholms Skärgård -- Simpnäs fairway — Traffic regulations 30/18
312 Germany -- Baltic Sea -- Adler Grund — Prohibited area 02/19
323 Germany -- Approaches to Wolgast — Speed limit 42/18
325 Germany -- Wolgast Hafen — Speed limit 42/18
328 Germany -- Baltic South Shore -- Zatoka Pomorska — Prohibited area 51/18
340 Poland -- Szczecin -- Parnica — Berths; depths 36/18
341 Poland -- West and north--north--west of Mrzeÿyno — Directions; wrecks 10/18
345 Poland -- Rowy to Łeba — Nature reserve 24/18
355 Poland -- Gdynia — Pilotage 36/18
355 Poland -- Gdynia — Tugs 36/18
355 Poland -- Gdynia — Restricted area 40/18
357 Poland -- Gdynia — Obstructions 36/18
357 Poland -- Gdynia — Berths; obstructions 40/18
358 Poland -- Gdamsk — Anchorage; wreck 29/18
359 Poland -- Gdamsk — Pilotage 36/18
361 Poland -- PóÞnocny — Pilotage 36/18
361--362 Poland -- Port PóÞnocny -- Basen Paliw PÞynnych — Draughts 13/18
4.16 Wk13/19
IV
Weekly
NP no Page(s) Title Edition
362 Poland -- Gdamsk -- Rzeka WisÞa ©miaÞa — Bridge clearances 07/19
398 Latvia -- SalacgrØva — Controlling depths 36/18
404 Estonia -- Saaremaa -- Suur Katel — Directions; wrecks 31/18
405 Estonia -- Roomassaare — Directions; light sector 01/19
423 Estonia -- Väinameri -- Vormsi -- Sviby — Pilotage 11/19
424 Estonia -- Muhu Väin -- Rohuküla — Pilotage 11/19
425 Estonia -- Muhu Väin -- Hiiumaa -- Heltermaa — Pilotage 11/19
20 Baltic 3 13th Edition (2016) 26/16
101--102 Estonia -- Paldiski — Anchorage; prohibited areas 48/17
102 Estonia -- Väike--Pakri — Obstruction 41/17
109--110 Estonia – Muuga Sadam and Approaches — Arrival information; anchorages 05/17
109--110 Estonia -- Gulf of Finland -- East of Agena saar — Obstruction 46/17
112 Estonia – Muuga Sadam to Letipea Neem — Directions; AIS 05/17
117 Estonia – Narva Bay and Approaches — General information; hazards 05/17
118 Estonia -- Narva Bay -- Directions; buoy 26/18
119 Estonia -- Narva Bay -- Directions; buoy 26/18
126 Russia -- Sankt Peterburg approaches -- North of Krasnava Gorka — Anchorage; 09/18
obstructions
126 Russia -- Sankt Peterburg approaches -- North of Krasnaya Gorka — Anchorage 30/18
128 Russia -- Sankt Peterburg approaches -- Kronshtadtskiy Korabel’nyy Farvater — 30/18
Depth
128 Russia – Sankt Peterburg – Outer Approaches — General information; 07/17
traffic regulations
128 Russia -- Approaches to Sankt Peterburg — Speed restrictions 47/17
131 Russia -- Sankt Peterburg and approaches -- Port Bronka — Depths; directions 28/16
135 Russia -- Sankt Peterburg — Vertical clearance 02/18
143 Finland -- South--west coast -- Nyhamn — Pilotage 02/19
147 Finland -- Hanko approaches — Directions; draught; beacons 33/17
148 Finland -- Hanko approaches — Directions; light 33/17
149 Finland -- Gulf of Finland -- Hanko — Limiting conditions; draught 44/17
152 Finland -- Tammisaari Approaches — Directions; beacon 40/17
153 Finland -- Tammisaari Approaches — Directions; beacon 40/17
153 Finland -- Tammisaari Approaches -- Odensö — Directions; beacons 16/18
156 Finland -- Gulf of Finland -- Julö — Directions; light 50/17
158 Finland -- Porkkalanselkä — Pilotage 16/18
167 Finland -- Helsinki Approaches — Pilotage 16/18
167 Finland -- Helsinki Approaches — Pilotage 20/18
195 Finland -- Loviisa Approaches -- Orrengrund — Pilotage 16/18
202 Finland – Approaches to Kotka — Outer anchorage 47/16
203 Finland – Kotka — Anchorages 47/16
203--204 Finland – Kotka — Anchorages 47/16
204 Finland -- Gulf of Finland -- Kotka — Directions for western harbours; authorised 26/16
draughts
205 Finland -- South coast -- Kotka — Basins and berths; depths and maximum draughts 31/16
208 Finland -- Approaches to Hamina -- Hamina bypass channel — Directions; maximum 19/17
draught
211 Finland – Hamina -- Eastern entrance; Pieni--Musta to Haminanlahti — Directions 47/16
212 Finland – Hamina — Directions; draught restriction; leading lights 09/17
214 Finland -- North of Harvajanniemi -- Klamilanlahti — Directions; draught 13/17
218 Finland -- Malyy Tranzundskiy Reyd -- Banka Yalkamatala to Banka Khallikivi — 07/18
Directions; obstructions
Wk13/19 4.17
IV
Weekly
NP no Page(s) Title Edition
219 Russia -- Malyy Tranzundskiy Reyd -- West of Ostrov Krepysh — Anchorages; 46/17
wrecks and obstruction
225 Russia -- Primorsk Oil Terminal — Arrival information; pilotage 09/19
229 Finland -- South west coast -- Saaristomeri — Pilotage 41/18
229 Finland -- Hanko Approaches — Pilotage 16/18
231 Finland -- Saaristomeri — Directions; other aids to navigation 26/16
239 Finland – Hanko to Salo -- Route East of Kemiö — Bridge clearances 50/16
244 Finland -- Saaristomeri -- Isokari--Lövskär channel — Directions; light 50/17
252 Finland -- Lövskär to Purha — Directions; light 13/17
253 Finland -- Kråkholm to Kyrkfjärden — Directions; link channel; leading beacons 48/17
255 Finland -- South--west coast -- Maarianhamina — Pilotage 25/18
257 Finland – Rödhamnsfjärden — Anchorage 47/16
264 Finland -- Isokari and approaches — Directions; depth 13/17
267 Finland -- South--west -- Laupunen to Rajakari — Directions; light 26/16
272 Finland -- Naantali — Anchorage position 17/18
275 Finland -- Maarianhamina -- Granöklubb — Directions; caution; leading lights 13/18
275 Finland -- Maarianhamina -- Granöklubb — Directions; caution; track; draught 23/18
275 Finland -- Maarianhamina -- Granöklubb — Directions; caution; leading lights 13/18
276 Finland -- Maarianhamina -- Granö to Hackorna Beacon — Directions 13/18
276 Finland -- Maarianhamina Approach -- Stora Skivgrund — Directions; buoys 23/18
278 Finland -- Ahvenanmaa -- Berghamn — Light sector 13/18
278 Finland -- Åland Hav -- Signilskär — Directions; lights; beacons 39/17
279 Finland – Avenanmaa — General information; draught regulations 42/16
280 Finland – Ahvenanmaa – 25 m route to Maarianhamina — Directions 47/16
292 Finland -- Rauma Approaches — Pilotage 16/18
297 Finland -- Rauma to Porin Majakka — Directions; other aids to navigation 27/16
297 Finland -- Rauma to Porin Majakka — Directions; buoys 13/17
299 Finland -- Pori Approaches — Pilotage 16/18
299, 300, 301 Finland -- Pori and Approaches — Directions; other aids to navigation 27/16
302 Finland -- Porin Majakka to Kristiinankaupunki — Directions; other aids to navigation 27/16
303 Finland -- Porin Majakka to Kristiinankaupunki — Directions; rock awash 13/17
303 Finland -- Porin Majakka to Kristiinankaupunki — Directions; shoals 13/17
303 Finland -- Gulf of Bothnia -- Kristiinankaupunki — Directions; buoyage 28/18
303 Finland -- Porin Majakka to Kristiinankaupunki — Directions; other aids to navigation 27/16
303 Finland -- Tahkoluoto — Wind farm 45/17
309 Finland -- Gulf of Bothnia -- Kristiinankaupunki — Directions; buoyage 28/18
309 Finland -- Gulf of Bothnia -- Kristiinankaupunki — Directions; buoyage 28/18
315 Finland -- Gulf of Bothnia -- Norra Kvarken -- Helsingkallan — Directions; Buoys 28/18
316 Finland -- South approaches to Vaasa -- Gåshällan to Bergö — Directions; lights 28/16
322 Finland -- North approaches to Vaasa — Vertical clearance 27/16
322 Finland – North approaches to Vaasa — Vertical clearances 44/16
329 Finland -- Gulf of Bothnia -- Kokkola — Firing practise areas 02/18
331 Finland – Stubben to Raahe – Pietarsaari — Directions; general information; light 39/16
331 Finland -- Stubben to Kokkola Majakka — Other aids to navigation; racon 13/17
331, 331--332 Finland – Stubben to Raahe – Pietarsaari — Directions; general information; light 39/16
335 Finland -- Kokkola — Anchorage 30/17
336 Finland -- Rahja Approaches — Pilotage 16/18
340 Finland -- Raahe and approaches -- Roska Roads to Lapaluote — 13/17
Directions; maximum draught
343 Finland -- Oulu Approaches — Pilotage 16/18
344 Finland -- Gulf of Bothnia -- Hailuoto -- Merikallat — Directions; draught 26/18
4.18 Wk13/19
IV
Weekly
NP no Page(s) Title Edition
346 Finland -- Oulu -- Toppila — Toppilansalmi Leading lights 45/17
346 Finland -- Oulu -- Kuivasmeri — Directions; light 12/19
348 Approaches to Oulu -- Kropsu — Directions; light 26/17
349 Approaches to Oulu -- Kropsu — Directions; light 26/17
363 Sweden – Gulf of Bothnia – Singösund — vertical clearance 48/16
365 Sweden -- East coast -- West of Singö -- Slätön and Medholmen — Nature reserve 06/19
368 Sweden – Väddö Kanal — Bridge clearances 52/16
373 Sweden -- Gulf of Bothnia -- Slada Hamn — Anchorage; shoal 41/18
386 Sweden -- Gulf of Bothnia -- Hudiksvall -- Gretas Klackar — Depths 05/19
412 Sweden -- Gulf of Bothnia -- Ållerviken — Prohibited anchorage 11/19
435 Sweden -- Gulf of Bothnia -- Örnsköldsvik -- Råskärsön — Anchorages 50/18
442 Sweden -- Norra Kvarken -- Hörnefors --Lögaren — Directions; light 26/18
443 Sweden -- Norra Kvarken -- Hörnefors --Lögaren — Directions; light 26/18
444 Sweden -- Norra Kvarken -- Hörnefors --Lögaren — Directions; light 26/18
457 Sweden -- Gulf of Bothnia -- Bjurön — Directions; light position 31/18
459 Sweden -- Gulf of Bothnia -- Lövsele — Directions; leading lights 52/17
460 Sweden -- Gulf of Bothnia -- Bjurön — Light position 31/18
460 Sweden -- Gulf of Bothnia -- Bjurön — Directions; light position 31/18
461 Sweden -- Gulf of Bothnia -- Bjurön — Directions; light position 31/18
461 Sweden -- Gulf of Bothnia -- Bjurön — Light position 31/18
462 Sweden – Gulf of Bothnia – Skelleftehamn — Draught 17/17
463 Sweden -- East approach to Gåsören --Skötgrönnan — Directions; shoals, wreck; 21/18
buoy; depths
463 Sweden -- Gulf of Bothnia -- Bjurön — Directions; light position 31/18
463 Sweden -- East approach to Gåsören --Skötgrönnan — Directions; shoals, wreck; 21/18
buoy; depths
464 Sweden – Skelleftehamn – Gåsören to Sörfjärden — Directions 07/17
465 Sweden – Gulf of Bothnia – Skelleftehamn — Draught 17/17
466--467 Sweden -- Approaches to Kågehamn — Directions; depths 21/18
467 Sweden -- Furuögrund — Directions; depths 21/18
468 Sweden -- Åbyfjärden — Directions; shoal; positions 21/18
468 Sweden -- Kinnbäcksfjärden -- South--west of Rönnskär — Directions; shoal; 21/18
positions
469 Sweden -- Piteå and approaches — Depths 11/17
470 Sweden -- Gulf of Bothnia -- Bondöfjärden — Directions; leading lights 19/17
470 Sweden -- Gulf of Bothnia -- Bondöfjärden — Leading lights; alignment; position; 41/18
distance
470 Sweden -- Gulf of Bothnia -- Bondöfjärden — Directions; leading lights 19/17
470 Sweden -- Gulf of Bothnia -- Bondöfjärden — Leading lights; position; distance; rock 41/18
471 Sweden -- Piteå and approaches — Directions 11/17
471 Sweden -- Piteå and approaches -- Skuthamn to Piteå Södra Hamn — Directions 11/17
472 Sweden -- Piteå and approaches — Berths 11/17
478 Sweden -- Approaches to Luleå -- Sandön — Directions; sector light 49/18
480 Sweden -- Luleå -- Sandöfjärden — Prohibited anchorage 02/19
21 Bay of Bengal 12th Edition (2013) 05/14
73 India – Coromandel Coast — Directions; major light 31/14
73 India – East coast – Coleroon Point to Palºr River — Directions; wreck 42/14
74 India -- East coast -- Cuddalore — Anchorage 10/19
80 India – East coast – Kamarajar (Ennore) Port — Depths; harbour; directions 09/18
80 India -- Ennore Port — Arrival information; fairway buoy 31/16
80 India -- Ennore Port — Arrival information; pilotage 04/17
Wk13/19 4.19
IV
Weekly
NP no Page(s) Title Edition
80 India -- East coast -- Kamarajar (Ennore) Port — Designated waiting area and 10/18
pilotage
80 India – East coast – Kamarajar (Ennore) Port — Depths; harbour; directions 09/18
80 India -- Ennore Port — Directions; fairway buoy 31/16
80 India – East coast – Kamarajar (Ennore) Port — Depths; harbour; directions 09/18
80--81 India – East coast – Kamarajar (Ennore) Port — Directions 09/18
81 India – East coast – Kamarajar (Ennore) Port — Basins and berths 09/18
82 India -- East Coast -- Krishnapatnam — Anchorages 43/17
82 India -- Krishnapatnam Port — Arrival information; pilot station 12/16
85 India -- East coast -- Kºkinºda Port — Controlling depths; pilotage 01/19
86 India -- East coast -- Kºkinºda Port — Directions 01/19
86 India -- East coast -- Kºkinºda Port — Berths 01/19
88 India – East coast – Kºkinºda Bay to Vishºkhapatnam — Directions; wreck; SPM 42/14
88 India – East coast – Kºkinºda Bay to Vishºkhapatnam — Directions; dangerous 04/16
wreck
88 India -- Vishºkhapatnam -- Gangavaram — Anchorages 03/19
90 India -- Vishºkhapatnam — Anchorages 03/19
91 India -- Bay of Bengal -- Vishºkhapatnam -- Leading lights; alignment 41/17
92 India -- Bay of Bengal -- Vishºkhapatnam -- Leading lights; alignment 41/17
98--99 India -- East Coast -- Gopalpur — Port information 47/17
98--99 India -- East Coast -- Gopalpur — Port 14/18
99 India -- East coast -- Gopºlpur Port — Anchorage 27/18
101 India – Bay of Bengal Bengal of Bay -- South of Pºrºdip — Directions; shoal 31/17
101 India -- Bay of Bengal -- Pºrºdip — Depth 40/17
101 India -- East coast -- Pºrºdip — Anchorages 24/18
101,102 India – East coast – Pºrºdip — Berth 43/16
102 India -- Pºrºdip — Directions for entering harbour 06/16
102, 103 India – East coast – Pºrºdip — Berth 43/16
104 India -- Pºrºdip — Directions; wreck 34/17
105 India -- East coast -- Dhºmra Port — Depths 14/18
112, 112--113 India – Hugli River — Directions 23/17
112--113 India -- Sºgar Roads to Haldia Port — Directions 10/18
113 India – Hugli River — Directions 23/17
113 India -- Tigris Sand to Ghorºmºra Island — Directions 10/18
113, 113--114, 114 India – Hugli River — Directions 23/17
115 India – Haldia Port — Directions; landmark 23/17
115 India -- East coast -- Haldia Port — Directions; marks 27/18
116 India -- Hugli River -- Brul Reach — Directions; beacon alignment 29/18
124 India -- East coast -- Matla River — Directions; wreck 11/19
127 Bangladesh -- Pussur River to Sandwip Channel — Directions; stranded wreck 12/16
127 Bangladesh -- Chittagong -- Patenga Point — Directions; light 37/18
128 Bangladesh -- Pussur River to Sandwip Channel — Directions; stranded wreck 01/16
128 Bangladesh -- Pussur River to Sandwip Channel — Directions; stranded wreck 12/16
127--128 Bangladesh -- Pussur River to Sandwip Channel — Directions 07/19
129 Bangladesh -- Meghana River — Directions; light buoy 07/19
129 Bangladesh -- Chittagong Coast — General information; stranded wreck 12/16
130 Bangladesh -- Chittagong Coast -- Maiskhali Island — Directions; restricted areas; 36/18
wreck
130 Bangladesh – Chittagong Coast – Kutubdia Island — Directions; well 25/17
130 Bangladesh -- Chittagong Coast — Directions; stranded wreck 12/16
133 Bangladesh -- Chittagong -- Patenga Point — Directions; light 37/18
4.20 Wk13/19
IV
Weekly
NP no Page(s) Title Edition
133 Bangladesh -- Chittagong — Directions for entering harbour; stranded wreck 12/16
133 Bangladesh -- Chittagong -- Patenga Point — Directions; light 37/18
141 Burma -- Sittwe — Directions; stranded wrecks 39/15
142, 143, 144, 144--145, Burma – Combermere Bay – Kyauk Phyu Harbour – Gadechy Harbour — General 21/17
145 information; arrival information; limiting conditions; directions; berths and basins
159 Burma -- Gulf of Martaban -- Yadana Gas Field — Restricted area 03/18
159 Burma -- Baragua Point to Yangon River — Directions; dangerous wreck 08/16
161 Burma – Yangon River – Approach to Yangon River — Directions; Western channel 45/16
161 Burma -- Yangon River — Directions; light buoys 03/17
161 Burma -- Yangon River and Approaches — Buoyed passage 49/17
161 Burma -- Yangon River and Approaches — Directions; light buoy 06/16
161 Burma – Yangon River – Sin Min Point to Port of Yangon — Directions; caution; 45/16
route
161, 162 Burma – Yangon River – Port of Yangon — Limiting conditions; controlling depth; 45/16
vertical clearance
162 Burma – Yangon River – Port of Yangon — Arrival information; prohibited 45/16
anchorages
162, 162--163 Burma – Yangon River – Port of Yangon — Directions for entering harbour; D’Silva 45/16
Shoal to Hastings Sand; Hastings Sand to Thanlyetsoon Point Channel
163 Burma – Yangon River – Port of Yangon — Berths; anchorages and moorings; 45/16
alongside berths
171 Burma -- Gulf of Mataban -- HeinzÏ Islands — Restricted area 03/18
177 Burma -- Myauk Taw Win Island to Chong Pak Phra — Directions; shoal 32/16
185, 188 Burma -- Inshore route -- North Part -- Dawei Point to Myeik — General information; 32/16
charts
189, 190 Burma -- Inshore route -- North Part -- Fell Passage — General information; charts; 32/16
directions
190 Burma -- Inshore route -- North Part -- Mermaid Passage to Pinbwa Island — General 32/16
information; charts
221 Andaman Islands – Long Island – Raman Point — Berth 16/17
222 Andaman Islands – Diligent Strait – Charka Juru — Depths; distances 16/17
229 India -- Andaman Islands -- South Andaman Island -- Port Blair — Directions; floating 36/18
dock
22 Bay of Biscay 13th Edition (2016) 43/16
54 Spain -- Pasaia (Pasajes) -- Directions — Other aids to navigation; AIS 01/17
67 France -- L’Odet river -- Bénodet — Fairway; directions; depth 20/17
69 France -- Pointe de Trévignon — Directions; wreck 34/17
82 France – Approaches to Lorient -- Les Coureaux de Groix — anchorages 11/17
84 France -- West coast -- Lorient and approaches — Limiting conditions; controlling 10/19
depth
133 France -- La Loire – Chenal du Sud — Pilotage 47/18
133 France -- La Loire Approaches and Estuary -- Chenal du Sud, Chenal de 02/17
Bonne--Anse and Grande Rade de Saint--Nazaire — Directions; AIS
137 France -- Saint--Nazaire -- Passage du Ronfle — Prohibited anchorage 43/17
143 France – Saint--Nazaire — General information; vertical clearance 05/17
144 France – West coast – Loire River estuary – Montoir — Berths 43/16
151 France -- West coast -- Baie de Bourgneuf -- L’Herbaudière approaches — Directions; 11/19
shoal
174 France -- West coast -- La Rochelle--Pallice — Arrival information; Prohibited areas 43/18
201 France -- The Garonne -- Bordeaux — Wreck; buoy 52/17
214 France -- Bayonne — Outer anchorage 49/16
214 France -- Bayonne — Traffic regulations 49/16
214 France -- Bayonne — Traffic regulations 30/17
219 France -- Bay of Biscay -- Saint--Jean--de--Luz — Pilotage 07/19
Wk13/19 4.21
IV
Weekly
NP no Page(s) Title Edition
224 Spain -- Pasaia (Pasajes) -- Directions — Other aids to navigation; AIS 01/17
242 Spain -- Bilbao -- El Abra — Wreck 41/17
276 Spain -- Avilés — Directions; light 21/18
23 Bering Sea and Strait 8th Edition (2013) 07/14
81 Bering Sea — Depths; two--way route; ATBAs 03/19
81 United States of America -- Bering Sea -- Unimak Pass to Norton Sound — 03/19
Directions; two--way route
81 United States of America -- Bering Sea -- Unimak Pass to Bering Strait — Directions; 03/19
two--way routes
81 United States of America -- Chukchi Sea — Directions; two--way routes 03/19
137, 149, 155, 163 United States of America – Aleutian Islands — General information; areas to be 49/15
avoided
165 United States of America -- Alaska -- Pavlof Islands — Rock awash 39/17
172 United States of America -- Aleutian Islands -- Ikatan Peninsula -- Pankof Breaker — 32/18
Depth
178, 179, 190, 206, 212, United States of America – Aleutian Islands — General information; areas to be 49/15
219, 244, 251, 260 avoided
260 United States of America -- Bering Sea — ATBAs 03/19
265 United States of America -- Bering Sea -- Saint Lawrence Island — ATBA 03/19
267 United States of America – Aleutian Islands — General information; areas to be 49/15
avoided
283 United States of America – Kushkokwim Bay — General information; Pilotage 09/16
284 United States of America – Goodnews Bay — Pilotage 09/16
286 United States of America -- Bering Sea -- Nunivak Island — ATBA 03/19
291 United States of America -- Bering Sea -- King Island — ATBA 03/19
292 United States of America -- Bering Sea -- Norton Sound — Recommended route 03/19
299 United States of America -- Bering Sea -- King Island — ATBA 03/19
299 United States of America – Nome — Arrival information; Pilotage 09/16
301 United States of America – Port Clarence — Arrival information; Pilotage 09/16
303 United States of America – E part of Chukchi Sea — General information; Pilotage 09/16
305 United States of America – Kotzebue Sound — Pilotage 09/16
311 United States of America – Barrow — Pilotage 09/16
339 Russia -- Bering Sea -- Poluostrov Kamchatka -- Mys Afrika — Directions; light 52/17
342 Russia -- Bering Sea -- Poluostrov Kamchatka -- Mys Afrika — Directions; light 52/17
350 Russia -- Bering Sea -- Poluostrov Kamchatka -- Mys Afrika — Directions; light 52/17
24 Black Sea and Sea of 5th Edition (2017) 07/17
Azov
74 Turkey -- Turkish Straits — Regulations 09/19
90 Turkey -- YiÔitler Geçidi -- Büyükliman Burnu — Directions; light buoy 24/17
100 Turkey -- Mamara Denizi -- Botaî — Depth 05/19
103 Turkey -- Ambarli LimanÝ — Arrival information; pilotage 09/17
105 Turkey -- ™zmit Körfezi -- Osmangazi Bridge — Vertical clearance 15/17
108 Turkey -- YarÝmca—Tütünçiftlik industrial complex — Berths; depths; light 08/18
110 Turkey -- Marmara Denizi -- Approaches to Istanbul BoÔazÝ — Traffic regulations; 24/17
restricted area
111 Turkey -- Marmara Denizi -- Fenerbahçe BankÝ — Prohibited entry 29/18
111 Turkey -- Istanbul -- Kumkapi — Directions; light 18/18
114 Turkey – Tuzla Koyu — Pilotage 03/18
114 Turkey -- Marmara Denizi -- AydÝnlÝ Koyu — Shoal 40/18
114 Turkey -- Marmara Denizi -- AydÝnlÝ Koyu — Anchorages 12/19
118 Turkey -- Istanbul BoÔazÝ (Bosporus) — Bridges 16/18
118 Turkey – Istanbul — Overhead power cables; air draught limit 11/17
4.22 Wk13/19
IV
Weekly
NP no Page(s) Title Edition
120 Turkey – Istanbul BoÔazÝ (Bosporus) — Directions; AIS 11/17
120 Turkey -- Istanbul BoÔazÝ (Bosporus) — Bridges 16/18
130 Turkey -- EreÔli -- Kuzey Mendirek — Regulations; restricted areas 24/18
130 Turkey – Black Sea -- EreÔli — Arrival information; pilotage 12/19
131 Turkey -- EreÔli — Berths; depths 09/17
140 Turkey -- Black Sea -- Gerze — Anchorages; wreck 36/18
143 Turkey -- Ünye Körfezi — Anchorages 31/17
145 Turkey -- Giresun — Prohibited anchorage 45/17
146 Turkey – Giresun to Kale Burnu -- Tirebolu — Directions; light 24/17
147 Turkey -- Black Sea -- Karadeniz LPG Terminal — Waiting anchorage 50/18
147 Turkey – Giresun to Kale Burnu -- Tirebolu — Directions; light 24/17
153,154 Georgia -- Turkish border – Sarp — Restricted area; vessel activity 19/17
158 Georgia -- P’ot’i — Maximum draught 06/18
158 Georgia -- Black Sea -- P’ot’i — Regulated areas 38/18
162 Turkey -- Black Sea -- West of Istanbul — Port installation 49/18
162 Turkey -- Dalyan Burnu — Wrecks 43/17
162 Turkey -- Karataî Burnu — Anchorage 43/17
163 Turkey -- Black Sea -- KÝyÝköy — Prohibited anchorage 34/18
175 Bulgaria -- Black Sea -- Balchik — Prohibited area 03/19
203 Ukraine -- Lymans’kyi Kanal -- Dnistrovs’ko--Tsarehrads’ke Hyrlo — Light 44/17
205 Ukraine -- Lymans’kyi Kanal -- Dnistrovs’ko--Tsarehrads’ke Hyrlo — Light 44/17
213 Ukraine -- Approaches to Port Yuzhnyy — Outer anchorage; change of designation 05/18
216 Ukraine -- Port Yuzhnyy — Anchorages 50/17
216 Ukraine -- Black Sea -- Odes’ka Banka — Obstruction 07/18
227 Ukraine -- Black Sea -- Mykolaiv — Speed restriction 01/18
227 Ukraine -- Mykolaiv — Anchorages 50/17
232 Ukraine -- Approaches to Kherson -- West of Ostrov Malyi Pot’omkin — Submarine 52/17
cable
247 Black Sea -- Balaklava — Anchorage; pilotage 07/19
251 Approaches to Yalta -- Hurzuf -- Mys Ayudah — Prohibited area 35/18
252 Approaches to Yalta -- Hurzuf -- Mys Ayudah — Prohibited area 35/18
264 Russia -- Black Sea -- Novorossiysk — Caution; unexploded ordnance 52/17
277 Georgia – Kulevi Terminal — Limiting conditions; depth and width 24/17
277--278 Georgia – Kulevi Terminal — Directions for entering harbour; buoyed channel 24/17
278 Georgia -- Anaklia — Port development 12/19
282 Black Sea – Kerch Strait — Pilotage 46/18
284 Russia -- Black Sea -- Port Taman’ — Speed limit 01/18
284 Russia -- Black Sea -- Port Taman’ — Pilotage; tugs 01/18
284 Russia -- Black Sea -- Port Taman’ — Berths 01/18
285 Black Sea -- Kerch Strait — Pilotage 47/18
285 Black Sea -- Kerch Strait — Anchorages 19/17
285 Russia -- Sea of Azov -- Kerch Strait — Wrecks; fouls; anchorage 44/17
285 Russia – Kerch Strait — Anchorages 41/18
286 Black Sea -- Kerch Strait — Pilotage 47/18
289 Black Sea -- Kerch Strait — Pilotage 47/18
293 Ukraine -- Sea of Azov -- Berdyans’k — Depths 47/18
295 Ukraine – Port Mariupol’ — Limiting conditions maximum draught; maximum size of 41/18
vessel
295 Ukraine – Port Mariupol’ — Arrival information; vessel traffic service 41/18
296 Ukraine – Port Mariupol’ — Arrival information; anchorages 41/18
296 Ukraine – Port Mariupol’ — Arrival information; regulations 41/18
Wk13/19 4.23
IV
Weekly
NP no Page(s) Title Edition
307 Russia -- Sea of Azov -- Taganrog — Depth 07/19
314 Appendix 3 -- Hurzuf -- Mys Ayudah — Prohibited area 35/18
25 British Columbia 1 16th Edition (2017) 04/17
8 United States of America -- West coast -- Washington — ATBA 50/18
75 Canada -- Esquimalt Harbour — Anchorage 18/18
77 Canada -- Vancouver Island -- Victoria -- Upper Harbour — Piles 11/19
79 Canada -- Vancouver Island -- Mayor Channel — Directions; buoy 19/17
83 United States of America – Juan de Fuca Strait – Minor Island — Directions; light 20/17
99 United States of America -- West coast -- Port of Seattle — Vertical clearances 10/19
104 United States of America -- Seattle -- Lake Union — Seaplane area 39/18
104 United States of America -- Seattle -- Lake Washington — Bridge clearance 25/18
104 United States of America -- Seattle -- Lake Washington — Bridge clearance 42/18
191 Canada -- Strait of Georgia -- Roberts Bank — Under--keel clearance 25/17
195 Canada -- Fraser River — Under--keel clearance; pilotage 25/17
200 Canada -- Vancouver — Under--keel clearance 25/17
202 Canada -- Vancouver — Under--keel clearance; depths; regulations 25/17
202 Canada -- Vancouver -- Deadman Island — Prohibited anchorage 47/18
202 Canada -- Vancouver — Under--keel clearance; depths; regulations 25/17
207 Canada -- Vancouver -- Burrard Inlet — Under--keel clearance; depths; regulations 25/17
208 Canada -- Vancouver -- Second Narrows — Navigable width; horizontal clearance 25/17
210 Canada – Port Moody — Berths; anchorage 04/17
248 Canada -- Sechelt Inlet — Directions; depth 47/17
268 Canada -- Vancouver Island -- Thurlow Islands -- Mayne Passage — Offshore 40/17
platform
363 Canada -- Clayoquot Sound -- Calmus Passage — Buoy 46/17
26 British Columbia 2 11th Edition (2017) 11/17
112 Douglas Channel -- Gertrude Point — Directions; light 22/17
158 Queen Charlotte Sound – Calvert Island — General information; traffic regulations 22/17
176 Hecate Sound – Price Island — General information; traffic regulations 22/17
180 Hecate Strait – Bonilla Island — General information; traffic regulations 22/17
188 British Columbia -- Pitt Island -- Otter Channel — Light 44/17
190 British Columbia -- Pitt Island -- Otter Channel — Lights 44/17
197 Canada -- Hecate Strait -- Browning Entrance to Dundas Island — Directions; shoal; 23/17
buoyage
213 British Columbia -- Moresby Island -- Juan Perez Sound -- Matheson Inlet — Depth 30/18
242 British Columbia -- West coast of Graham Island — Caution; depths 30/18
27 Channel 12th Edition (2018) 45/18
iii Preface page 45/18
4 United Kingdom -- Channel Islands — Fishery limits 11/19
255 France -- Avant--Goulet de Brest -- Waiting area to Brest — Buoyage 45/18
265 France -- West coast -- Douarnenez — Pilotage 45/18
342 Channel Islands -- Guernsey — Anchorages 03/19
375 Channel Islands -- Jersey -- Saint Catherine’s Bay — Anchorage 51/18
390 France -- Approaches to Cherbourg — Pilotage 11/19
393 France -- Approaches to Cherbourg — Terminal 11/19
394 France -- Approaches to Cherbourg — Terminal 11/19
398 France -- North coast -- Baie de Seine -- Pointe du Hoc — Traffic regulations 10/19
Last page Last page 45/18
28 Dover Strait 12th Edition (2017) 34/17
60 England -- Dover Strait -- North--west of Sandettié Bank — Unexploded ordinance 28/18
61 Belgium -- Westhinder — Obstructions 49/17
4.24 Wk13/19
IV
Weekly
NP no Page(s) Title Edition
66 England -- Dover Strait -- North--west of Sandettié Bank — Directions; unexploded 28/18
ordinance
73 England – Littlehampton — Directions; caution 45/18
83 England -- South Coast -- Beachy Head — Directions; light 37/18
86 England -- South Coast -- Beachy Head — Directions; light 37/18
94 England -- South--east coast -- Dover — Regulations 14/18
94 England -- Dover Harbour — Traffic regulations; speed 04/18
114 France -- North coast -- Approaches to Fécamp — Directions; wrecks 07/19
139 France -- Calais — Basins and berths; depths 47/17
161--162 Belgium -- Thornton Bank — Buoyage 35/17
162 Belgium -- North Sea -- Thornton Bank and Lodewijbank — Wind farms 17/18
162 Belgium -- North Sea -- North west of Oostende — Pilotage 23/18
162 Netherlands -- North Sea -- Schouwenbank Junction -- Steenbank — Pilot station 46/17
163 The Netherlands -- Westerschelde -- Westkapelle — Pilotage 45/18
166 Belgium -- Thornton Bank — Buoyage 35/17
167 Belgium -- Approaches to Zeebrugge — LNG tanker regulations 23/18
168 Belgium -- Approaches to Westerschelde — Directions; light buoys 02/19
176 Netherlands -- North Hinder Junction — Directions; buoyage 35/17
195 Belgium -- Antwerp — Overhead power cables 51/18
195--196 Belgium -- Antwerp -- Kieldrechtsluis — Lock dimensions 13/18
203 Netherlands -- Schouwendiep — Directions; buoyage 47/17
243 England -- Thames Estuary — Pilotage 35/17
244 England -- Thames Estuary — Pilotage 35/17
244 England -- Thames Estuary — Draught, pilotage 45/18
273 England -- Felixstowe -- Sledway — Anchorage 42/18
294 England -- River Colne -- Brightlingsea — Directions; buoy 22/18
307 River Thames -- Sea Reach -- Canvey Island — Berths 32/18
309 England -- River Thames -- Tilbury — Chimney 43/17
310 England -- River Thames -- Tilbury Power Station — Depths 47/17
315 England -- River Thames -- Long Reach Esso Terminal — Depths 47/17
327 England -- River Medway -- Isle of Grain — Berths 42/17
335 England -- The Swale -- Kingsferry Bridge — Vertical clearance 47/17
30 China Sea 1 11th Edition (2018) 29/18
6 China -- Approaches to Hong Kong — Traffic Separation Scheme 44/18
6 China — National regulations 05/19
7 Malaysia — Regulations; National Heritage Zones 29/18
88 Malaysia -- East coast -- Pulau Tioman — Marine nature reserves 07/19
96 Malaysia -- East coast -- Kuantan Port — Anchorages; pilotage 49/18
96 Malaysia -- East coast -- Kuantan — Controlling depths 06/19
96 Malaysia -- East coast -- Kuantan — Prohibited anchoring 06/19
97 Malaysia -- East coast -- Kuantan — Directions; breakwaters 06/19
97 Malaysia -- East coast -- Kuantan — Directions; deepwater terminal 06/19
103 Malaysia -- East coast -- Pulau Bidung Laut — Directions; National Heritage Zone 29/18
105 Malaysia -- Pulau Redang — Marine park 29/18
159 Vietnam -- South coast -- Can Tho — Depths 49/18
161 Vietnam – Song Sai Gon -- Cua Soirap — Depths 29/18
166 Vietnam -- Song Cai Mep — Berth; depth 29/18
172 Vietnam – South--east coast – Mui Vung Tau — Directions; wreck 13/19
186 Vietnam – Quy--Nhon — Depths 29/18
190 Vietnam -- South central coast -- Dung Quat — Directions 03/19
Wk13/19 4.25
IV
Weekly
NP no Page(s) Title Edition
207 Vietnam – Haiphong — Depth 29/18
207 Vietnam -- Haiphong -- Luong Hai Phong — Vertical clearance 37/18
207 Vietnam -- Haiphong — Vertical clearance 31/18
207 Vietnam -- North--east coast -- Haiphong — Anchorage 07/19
210 Vietnam -- Haiphong -- Luong Hai Phong — Anchorages 34/18
210 Vietnam -- Outer Approaches to Haiphong -- Cat Hai — Directions; development 37/18
212 Vietnam -- Gulf of Tonkin -- Approaches to Quang Ninh — Directions; wreck 38/18
213 Vietnam -- Gulf of Tonkin -- Quang Ninh — Depth 34/18
213 Vietnam – Quang Ninh Port — Berths 47/18
216 Vietnam -- Gulf of Tonkin -- Archipel des Fai Tsi Long — Directions; light 49/18
218 Vietnam -- Gulf of Tonkin -- Archipel des Fai Tsi Long — Directions; light 49/18
219 China -- Gulf of Tonkin -- Fangcheng Gang — Anchorages; wreck 29/18
229 China – Gulf of Tonkin – Tieshan Gang — Anchorage 35/18
235 China -- Hainan Dao -- Macun Gang — Pilotage 45/18
235 China -- Qiongzhou Haixia -- Chengmai Wan -- Macun Gangqu — Directions 09/19
241 China -- Yulin Jiao -- Basuo Gang and approaches — Directions; wreck 29/18
246 China -- South coast -- Yangpu to Lingao Ji`o — Directions; wreck 29/18
248 China -- Gulf of Tonkin -- Hainan Dao -- Sanya Wan — Anchorage 41/18
248--249 China – Hainan Dao – Sanya — Directions; lights 29/18
249 China -- Hainan Dao -- Lingshui Jiao — Directions; platform 42/18
265 China -- South coast -- Taidian — Depth 03/19
266 China -- Huangmao Hai -- T’an Chiang -- Yamen Daqiao Bridge — Vertical clearance; 41/18
anchorages
272 China -- South China Sea -- Zhujiang Kou -- Guishan Dao — Pilotage 05/19
275 China – Jiuzhou Gang — Controlling depths; vertical clearance; horizontal clearance 35/18
281 China -- Approaches to Hong Kong — Traffic Separation Scheme 44/18
284 China -- Approaches to Hong Kong — Directions; Traffic Separation Scheme 44/18
285 China -- Approaches to Hong Kong — Traffic Separation Scheme 44/18
285--286 China -- Approaches to Hong Kong — Directions; Traffic Separation Scheme 44/18
292 China – Hong Kong – East Lamma Channel — Traffic regulations 29/18
309 China -- Hong Kong – Lantau Island Anchorage — Wreck 12/19
323 China -- Approaches to Hong Kong — Traffic Separation Scheme 44/18
324 China -- Approaches to Hong Kong — Traffic Separation Scheme 44/18
334 Hong Kong -- Yantian Harbour -- West of Crooked Island — Directions 02/19
31 China Sea 2 13th Edition (2018) 07/18
81 South China Sea -- Scarborough Reef — Caution 20/18
97 Malaysia -- Sarawak -- Kuala Santubong — Directions; wreck; light 28/18
102 Malaysia -- Sarawak -- Sungai Sarawak — Anchorage 05/19
105 Malaysia -- Sarawak -- Kuala Rajang — Buoy 28/18
106 Malaysia -- Sarawak -- Kuala Rajang — Directions; wreck; buoy 28/18
106 Malaysia -- Sarawak -- Rajang — Anchorages 05/19
106 Malaysia -- Sarawak -- Batang Rajang — Directions; depths 52/18
110 Malaysia -- Sarawak -- Sibu — Anchorages 05/19
111 Malaysia -- Sarawak -- North of Kuala Oya — Directions; fish haven; obstruction; 08/19
wrecks
118 Malaysia -- Sarawak -- Kuala Similajau to Tanjung Similajau — Development; tidal 10/18
streams; port
156 Philippines – Palawan – North--west coast – Malampaya Gas Field — Pilotage 48/18
186 Philippines – Luzon – Manila — Directions; buoyage 07/18
186 Philippines – Luzon – Manila — Directions; buoyage 07/18
187 Philippines – Luzon – Manila — Directions; buoyage 07/18
4.26 Wk13/19
IV
Weekly
NP no Page(s) Title Edition
187 Philippines -- Luzon -- Manila -- South Harbour — Obstruction 05/19
192 Philippines -- Luzon -- Subic Bay — Speed limit 22/18
193 Philippines -- Luzon -- West coast -- Subic Bay — Traffic Separation Scheme 31/18
194--195 Philippines -- Luzon -- West coast -- Port Olongapo — Directions; buoyage 31/18
195 Philippines -- Luzon -- Subic Bay — Speed limit 22/18
206 Philippines -- Luzon -- West coast -- San Fernando — Nature reserve 40/18
206 Philippines -- Luzon -- West coast -- San Fernando — Directions; depth 05/19
32A China Sea 3 1st Edition (2019) 06/19
6--7 China — National regulations 06/19
76 Taiwan -- Mai--liao to T’ai--chung Kang — Directions; wreck 09/19
124 China -- Taiwan Strait -- Shantou Gang — Anchorage 06/19
124 China -- Taiwan Strait -- Shantou Gang — Pilotage 06/19
140 China -- Xiamen Gang — Directions; buoy 08/19
141 China -- Xiamen Gang — Directions; buoys 08/19
142 China -- Xiamen Gang — Directions; buoy 08/19
148 China -- Taiwan Strait -- Weitou Wan — VTS 06/19
149 China -- Taiwan Strait -- Shenhu Wan — VTS 06/19
149 China -- Taiwan Strait -- Jinshang — VTS 06/19
150 China -- Taiwan Strait -- Quanzhou Wan — VTS 06/19
159 China -- Taiwan Strait -- Xinghua Wan — Quarantine anchorage 06/19
163 China -- Taiwan Strait -- Haitan Dao -- Dongxiang — Directions; wreck 10/19
164 China – Xinghua Wan — Arrival information; pilotage; quarantine anchorage 03/19
192 China -- East China Sea -- Wenzhou — Anchorage 06/19
215 China -- East China Sea -- Zhoushan Qundao — Directions; wreck 06/19
220 China -- East China Sea -- Zhoushan Qundao — Directions; wreck 06/19
237 China -- East China Sea -- Zhoushan Qundao — Directions; depth 06/19
241 China -- East China Sea -- Zhoushan Qundao -- Qushan Dao — Anchorage; caution 11/19
266 China -- Shanghai -- Nangang Shuidao — Anchorages; wreck 06/19
32B China Sea 4 2nd Edition (2019) 01/18
7 China — National regulations 08/19
53 China – Yellow Sea – Dafeng Gang approaches — Directions; wrecks 08/19
55 China -- East coast -- Outer approaches to Dafeng Gang — Directions; wreck 02/19
76 China -- Yellow Sea -- South--east of Moye Dao — Directions; wreck 10/19
77 China -- Yellow Sea -- East--south--east of Chengshan Jiao — Directions; wreck 10/19
99 China – Changshan Shuidao -- Penglai — Arrival information; outer anchorages 12/19
114 China -- Yellow Sea -- Dadong Gangqu approaches — Wreck 09/19
120 China – Bohai Wan— Directions; wrecks; obstructions 08/19
121 China – Bohai Wan— Directions; obstructions 08/19
123 China – Bo Hai – Laizhou Wan -- Longkou — Anchorages 08/19
126 China – Bo Hai -- Laizhou Wan — Directions; wreck 08/19
127 China – Bo Hai -- Weifang Gang — Anchorages 08/19
129 China -- Bo Hai -- Laizhou Wan — Directions; wreck 02/19
130 China – Bohai Wan – Huanghua Gang — Pilotage 08/19
131 China -- Bohai Wan -- Dagusha Hangdao — Distances 09/19
132 China -- Bohai Wan -- Dagusha Hangdao — Depths 09/19
135 China -- Bohai Wan -- Dagusha Hangdao — Distances 09/19
142 China – Bo Hai -- Qinhuangdao — Limiting conditions; controlling depths 12/19
154 China -- Liaodong Wan – Jinzhou — Directions; wreck 08/19
166 South Korea – West coast -- Maemul Sudo — Depths 08/19
167 South Korea -- West coast -- Maemul Sudo – Naju Kundo — Directions; light 08/19
Wk13/19 4.27
IV
Weekly
NP no Page(s) Title Edition
172 South Korea -- West coast -- Maemul Sudo – Naju Kundo — Directions; light 08/19
175 South Korea – South coast -- Maro Hae — Directions; marine farms 08/19
182 South Korea – West coast -- Saok Sudo — Depth 08/19
188 South Korea – West coast -- Gunsan Hang — Directions; anchorage 08/19
191 South Korea – West coast -- Gunsan Hang — Anchorages 08/19
195 South Korea -- West coast -- Oeyeon Yeoldo — Directions; light 08/19
195 South Korea -- West coast -- Oeyeon Yeoldo — Directions; light 08/19
197 South Korea -- West coast -- Oeyeon Yeoldo — Directions; light 08/19
197 South Korea -- West coast -- Oeyeon Yeoldo — Directions; light 08/19
198 South Korea -- West coast -- Oeyeon Yeoldo — Directions; light 08/19
199 South Korea -- West coast -- Oeyeon Yeoldo — Directions; light 08/19
200 South Korea – West coast -- Approaches to Daesan — Directions; wreck 08/19
204 South Korea – West coast -- Approaches to Daesan — Directions; wreck 08/19
205 South Korea – Gadaeam to Janganseo — Directions; wrecks 12/19
207 South Korea – Pyeongtaek Hang — Arrival information; outer anchorages 12/19
210 South Korea – Janganseo to Palmido — Anchorages 12/19
221 North Korea – Haeju Hang — Directions; shoal 08/19
224 North Korea -- Korean Bay — Prohibited areas 08/19
33 Philippine Islands 6th Edition (2017) 49/17
2 Philippines -- Sulu Archipelago — Regulations 02/18
61 Philippines — Regulations 19/18
63 Philippines -- Sulu Sea -- Pangutaran Group Bank — Directions; route 19/18
63 Philippines -- Mindanao -- Teinga Island — Directions; RTC 19/18
64 Philippines -- Sulu Sea -- Tubbataha Reef — Regulations 04/18
141 Philippines -- Sulu Archipelago — Regulations 02/18
143 Philippines -- Sulu Archipelago — Directions 02/18
144 Philippines -- Sulu Archipelago — Directions 02/18
152 Philippines -- Sulu Archipelago — Directions 02/18
153 Philippines -- Sulu Archipelago — Directions 02/18
153 Philippines -- Sulu Archipelago — Directions 02/18
153 Philippines -- Sulu Archipelago— Directions 02/18
157 Philippines -- Sulu Archipelago — Directions 02/18
158 Philippines -- Sulu Archipelago — Directions 02/18
159 Philippines -- Sulu Archipelago — Directions 02/18
164 Philippines -- Sulu Archipelago — Directions 02/18
169 Philippines -- Mindanao — Regulations 02/18
170 Philippines -- Mindanao — Directions 02/18
199 Philippines -- Mindanao -- Pakiputan Strait — Directions; shoal 18/18
268 Philippines -- Luzon -- Tayabas Bay -- Castañas — Anchorages and harbours; berths 33/18
268 Philippines -- Luzon -- Tayabas Bay -- Sariaya — Jetties 02/19
284 Luzon -- San Bernardino Strait -- Santa Magdalena — Directions; light 52/17
290 Luzon -- San Bernardino Strait -- Santa Magdalena — Directions; light 52/17
290 Luzon -- San Bernardino Strait -- San Bernardino Island — Directions; light 52/17
300 Luzon -- San Bernardino Strait -- Santa Magdalena — Directions; light 52/17
321 Philippines -- Mindanao — Regulations 02/18
322 Philippines -- Mindanao — Directions 02/18
323 Philippines -- Mindanao — Directions 02/18
324 Philippines -- Mindanao — Directions 02/18
332 Philippines -- Negros -- Tañon Strait west side -- San Carlos City — Pipeline 36/18
4.28 Wk13/19
IV
Weekly
NP no Page(s) Title Edition
375 Philippines -- Mindanao -- Butuan Bay -- Nasipit Harbour — Pilotage 27/18
379 Luzon -- Luzon Plateau -- Benham Bank — Marine Protected Area 26/18
34 Indonesia 2 9th Edition (2019) 10/19
95 Indonesia -- Jawa -- Approaches to Surabaya -- Gresik — Directions; shoal; light buoy 10/19
405 Indonesia -- Sulawesi -- Anggrek -- Teluk Kwandang — Directions; wreck 10/19
406 Indonesia -- Teluk Kwandang -- Anggrek — Directions; wreck 04/19
35 Indonesia 3 7th Edition (2017) 43/17
127 Indonesia -- Banda Sea -- Pulau--Pulau Tanimbar -- Selat Egron — Directions; wreck 33/18
128 Indonesia -- Banda Sea -- Pulau--Pulau Tanimbar -- Saumlaki approaches — 33/18
Directions; wreck
316 Indonesia -- Halmahera -- Tobelo — Directions for entering harbour; light beacon 02/18
36 Indonesia 1 10th Edition (2019) 09/19
141 Indonesia -- Kalimantan -- Selat Karimata — Directions; wreck 11/19
199 Indonesia -- Selat Bulan -- Approaches to Sekupang — Pilotage; directions 13/19
37 West Coasts of 20th Edition (2017) 26/17
England and Wales
8 United Kingdom — Distress and rescue; coastguard stations 29/17
94 Wales – Swansea Bay — Directions; buoy 27/17
94 Wales -- Swansea — Depth 08/19
96 Wales -- Swansea Bay -- Mumbles Head — Approaches 05/19
97 Wales -- Port of Neath — Depths 24/18
97 Wales -- Port of Neath — Vertical clearances 08/19
98 Wales -- Port of Neath — Training wall 51/18
103 Wales -- Porthcawl -- Tusker Rock — Directions; obstruction 24/18
116 Wales -- Cardiff -- Lavernock Point — Directions; obstructions 24/18
120 Wales -- Bristol Channel -- Newport — Directions; light sector 10/19
126 England -- Bristol Channel -- Bridgwater Bay — Light buoy 29/18
126 England -- Bristol Channel -- Bridgwater Bay — Directions; light buoy; shoal 29/18
126 England -- Bridgwater Bay -- Burnham--on--Sea — Leading lights 48/17
140 England -- River Severn -- Chepstow — Vessels handled 28/17
142 England -- River Severn -- Sharpness Dock — Pilotage 28/17
154 Wales -- Milford Haven — Depths 28/18
164 Wales -- Milford Haven -- Milford Docks — Depth 22/18
206 Wales – Menai Strait to South Stack — General information; traffic regulations 25/18
207 Wales – Menai Strait to South Stack — Directions 25/18
231 England -- Liverpool Bay — Wind farm 30/17
236 England -- River Dee -- Hilbre Island — Directions; wreck 23/18
237 River Dee -- Mostyn Channel — Directions; light; channels 19/18
237 Wales -- Mostyn Docks — Directions; directional light 19/18
237 Wales -- Mostyn Docks — Directions; buoys; light sector 23/18
239 England -- Liverpool Bay — Wind farm extension 30/17
244 England -- Liverpool — Berths 28/17
248 England -- Liverpool Bay — Directions; wind farm extension 30/17
251 England -- River Mersey -- Runcorn Sands — Vertical clearance 02/19
272--273 England – Port of Lancaster – Glasson Dock — Times 16/17
300 Scotland -- Kirkcudbright Bay — Outer anchorages 40/17
38 West Coast of India 18th Edition (2016) 39/16
6 India -- Approaches to Mumbai — Traffic Separation Scheme 25/18
78 Maldives -- Addoo Atoll -- Kuda Kandu — Depths 13/18
80 Maldives -- Huvadhoo Atoll — Depths 13/18
125 Sri Lanka -- East Coast -- Sangamankanda Point — Directions; wreck 23/18
Wk13/19 4.29
IV
Weekly
NP no Page(s) Title Edition
136 Sri Lanka -- Pedro Channel -- Kankesanturai — Directions; wreck 04/19
148 Sri Lanka -- Colombo Harbour and Approaches — Pilotage 16/17
149 Sri Lanka -- Colombo Harbour — Development 48/16
150 Sri Lanka – Colombo — Directions; light 17/17
155 India -- Gulf of Mannºr -- Pºmban Island -- Kundugºl Channel — Directions; beacons 26/18
156 India -- South coast -- Pºmban Pass — Directions; light 46/18
157 India -- West coast -- Cape Comorin — Directions; obstruction 31/18
158, 159 India – Tuticorin — Arrival information; anchorage; pilotage 07/17
173 India -- West coast -- Port of Kochi — Depth 06/19
176 India -- Port of Kochi -- Entrance Channel — Light alignment; buoy 07/18
179 India -- West--north--west of Kochi — Passage; wrecks 31/17
181 India -- Badagara — Directions; wreck 04/18
181 India -- Badagara — Anchorage; dangerous wreck 04/18
183 India -- Badagara — Directions; dangerous wreck 04/18
189 India -- West coast -- Mangalore — Directions; depth 01/18
188--189 India -- West coast -- Mangalore — Directions; wrecks 24/18
191 India -- West coast -- New Mangalore — Berths 14/18
193 India -- West coast -- Malpe — Anchorage 50/17
193 India -- West coast -- Malpe — Anchorage 31/18
197 India -- Honºvar -- Basavarajadurg Island — Directions; shoal 35/18
199 India -- Bhatkal to Karwar -- Karwar Naval Harbour — Directions; depths 50/16
211 India -- Approaches to Mumbai — Traffic Separation Scheme 25/18
215 India -- Vengurla -- Vengurla Roads — Anchorage 51/17
215 India -- Mºlvan Bay — Light sector 07/18
218 India -- Approaches to Mumbai — Traffic Separation Scheme 25/18
220 India -- Approaches to Mumbai — Traffic Separation Scheme 25/18
221 India -- Approaches to Mumbai — Traffic Separation Scheme 25/18
222 India – West coast -- JSW Jaigarth Port — Anchorages 21/17
222 India – West coast – JSW Jaigarh Port — Arrival information; pilotage 43/16
223 India -- Mirya Head to Mumbai (Bombay) -- Port Dºbhol — Pilotage 26/17
224 India -- Mirya Head to Mumbai (Bombay) -- Port Dºbhol — Anchorage 26/17
224 India -- Approaches to Mumbai — Traffic Separation Scheme 25/18
225 India -- Approaches to Mumbai — Traffic Separation Scheme 25/18
226 India -- Approaches to Mumbai — Traffic Separation Scheme 25/18
227 India -- Approaches to Mumbai — Traffic Separation Scheme 25/18
229 India -- Approaches to Mumbai — Traffic Separation Scheme 25/18
229, 230 India – Approaches to Mumbai — General information; depths; TSS 27/17
230 India -- Approaches to Mumbai — Traffic Separation Scheme 25/18
231 India – Approaches to Mumbai — Directions; approach 27/17
231 India -- Approaches to Mumbai — Traffic Separation Scheme 25/18
232 India – Mumbai Harbour — Arrival information; traffic regulations 27/17
234 India – Mumbai Harbour — Anchorages; general information; deep water anchorage; 27/17
emergency anchorage
235 India -- West Coast -- Mumbai (Bombay) Harbour -- Basins and berths — depths 19/18
237 India – Jawahar Lal Nehru Port — Anchorage 22/17
239 India -- Approaches to Mumbai — Traffic Separation Scheme 25/18
240 India -- Approaches to Mumbai — Traffic Separation Scheme 25/18
242 India -- Outer approach to Gulf of Khambºt -- Malacca Banks — Directions; TSS 27/18
252 India -- Gulf of Khambºt -- Narmada Bank — Depths 11/19
256 India -- Gulf of Khambhºt — Shoal 51/17
4.30 Wk13/19
IV
Weekly
NP no Page(s) Title Edition
257 India -- Gulf of Khambºt -- Dahej — Anchorage; berths; exclusion zone 27/18
259 India -- Gulf of Khambºt -- Bhºvnagar Port — Obstructions; wreck 11/19
267 India – Porbandar to Kachchigadh — Harbours 05/17
277 India – Gulf of Kachchh – Salºya Harbour — Pilotage 17/18
280 India -- West coast -- Mundra Port — Anchorages 31/18
281, 282 India -- Gulf of Kachchh -- Tekra — Directions; buoyage; anchorage 18/17
282 India -- West coast -- Kandla — Directions; wreck 47/18
283 India -- Gulf of Kachchh -- Pathfinder Inlet — Directions; wreck 38/17
283 India -- Gulf of Kachchh -- Pathfinder Inlet -- VºdØnºr Offshore Oil Terminal — Wreck 07/18
283 India -- Gulf of Kachchh -- Pathfinder Inlet — Directions; wreck 38/17
287 India -- Gulf of Kachchh -- Tekra — Directions; buoyage; anchorage 18/17
288, 289, 290 India -- Gulf of Kachchh -- Approaches to Kandla — Anchorage; Pilotage; Directions 18/17
291 India – Gulf of Kachchh – Hansthal Creek — Directions 22/17
292 India -- Gulf of Kachchh — Wreck 28/17
293 India -- Gulf of Kachchh — Wrecks 28/17
293 India -- Jakhºu -- Godia Creek — Directions; lidar platform 10/18
302 Pakistan -- Karachi harbour — Directions; light buoy 30/17
303 Pakistan -- Karachi Harbour — Depths 05/18
304 Pakistan -- Karachi harbour — Pilotage 30/17
304 Pakistan -- Karachi Harbour — Pilot boarding position; harbour layout 05/18
305 Pakistan -- Karachi harbour — Directions; light buoy 30/17
305 Pakistan -- Karachi Harbour -- Oyster Islands — Directions; leading lights; breakwater 05/18
306 Pakistan -- Karachi Harbour -- Oyster Islands — PDWCP 05/18
39 South Indian Ocean 15th Edition (2017) 14/17
6 France -- Indian Ocean -- Île Amsterdam and Île Saint--Paul — Nature reserves; 02/18
EEZs
87 Comores – Ndzuani – Mouillage d’Ouani — Leading beacons 25/17
87 Comores -- Ndzuani -- Mouillage d’Ouani — Berths; mooring buoys 48/17
95 Comores Archipelago – Mayotte – Port de Longoni — Port information 28/17
131 Madagascar -- Approaches to Mahajanga -- Banc du Cavalier — Depths 11/18
133 Madagascar -- Mahajanga -- Chenal du Nord--Ouest — Directions; depths; lights; 11/18
outfall
133 Madagascar -- North--west coast -- Mahajanga — Directions; buoy 01/19
134 Madagascar -- North--west coast -- Mahajanga — Directions; gas terminal 01/19
171 Madagascar -- Cap Andavaka — Directions; depth 11/18
210 Île de La Réunion – Saint--Pierre — Directions; Leading line 12/19
214 Madagascar -- Port De La Nièvre -- Port de Commerce and Port Militaire — Berths 47/17
263 Île de La Réunion -- Saint--Pierre — Directions; leading line 12/19
263 Île de La Réunion -- Saint--Pierre — Directions; leading lights 19/17
280 Rodriguez Island -- Port Mathurin -- Western Pass — Directions; light 50/17
281 Rodriguez Island -- Port Mathurin -- Inner entrance — Directions; light 50/17
289 British Indian Ocean Territory — General information; traffic regulations 26/17
301 France -- Indian Ocean -- Île Amsterdam and Île Saint--Paul — Nature reserves; 02/18
EEZs
40 Irish Coast 20th Edition (2016) 36/16
8 United Kingdom — Distress and rescue 30/17
9 United Kingdom — Distress and rescue; SAR in Northern Ireland 30/17
10 United Kingdom — Distress and rescue; SAR in Northern Ireland 30/17
70 Ireland -- South--west Coast -- Bantry Bay — Pilotage 29/18
71 Ireland -- Bantry Bay -- Bear Island — Light buoy 28/17
74 Ireland -- South Coast -- Bantry Bay Oil Terminal — Restricted area 47/16
Wk13/19 4.31
IV
Weekly
NP no Page(s) Title Edition
76 Ireland -- South--west coast -- Bearhaven and Castletownbere Harbour — 37/18
Development
82 Ireland -- South--west Coast -- Sheep’s Head — Light sector 29/18
102--103 Ireland -- South Coast -- Glandore Harbour — Directions; light 46/16
117 Ireland -- Cork -- Cobh Road to abreast Ringaskiddy — Directions; leading line 41/18
135 Ireland -- South Coast -- Kilmokea Point — Berth; depth 46/16
136 Ireland – South coast – Dunmore East Harbour — Depths 36/18
171 Ireland – Dun Laoghaire Harbour — Berths 32/17
173 Dublin Bay -- Port of Dublin — Development 46/17
175 Dublin Bay -- Port of Dublin — Directions; buoyage 31/18
191 Ireland -- East Coast -- Dundalk Bay — Directions; leading marks; landfall mark 42/18
205 Northern Ireland -- East Coast -- Strangford Narrows — Underwater turbine 16/18
216 Northern Ireland -- East coast -- North Channel — Directions; wrecks 32/17
218, 220 Northern Island -- Burr Point to Belfast Lough -- East--south--east of Ballywater — 18/17
Directions; buoy
221, 224 Belfast Lough – Donaghadee Sound — Directions; buoy 14/17
226 Northern Ireland -- Belfast Lough -- Kilroot Salt Jetty — Buoyage 52/17
229 Northern Ireland -- East Coast -- Port of Belfast — Regulations 34/18
235 Northern Ireland – Port of Larne — Depth 33/17
235 Northern Ireland -- East coast -- Port of Larne — Controlling depth 33/18
275 Ireland -- West coast -- River Shannon -- Beal Point — Directions; depths 23/18
276 Ireland -- West Coast -- Kilcreduan Head to Scattery Roads -- Carrigaholt Road — 01/17
Anchorage; clearing marks
276 Ireland -- West Coast -- Kilrush — Depth 46/16
284 Ireland -- West Coast -- Foynes Harbour — Berths; depths 01/17
285, 288, 289, 290 Ireland -- west coast -- River Shannon — Directions; depths 08/17
315 Galway Bay -- Spiddle -- Laghtnagliboge Point — Directions; light buoy 52/17
393, 394 Ireland -- Sheep Haven -- Ards Bay — Light beacon; pier; tidal streams; directions; 43/16
building; leading lights; pilotage; berth; anchorage
421 Ireland -- River Bann -- Coleraine — Pilotage 09/18
423 Northern Ireland -- The Skerries — Directions; beacon 18/17
423 Northern Ireland – North Coast – Portrush – Skerries Sound — Directions; beacon 07/17
41 Japan 1 12th Edition (2018) 08/18
91 Japan -- North--west coast -- Hamada Ko — Vertical clearance 27/18
94 Japan -- Honshu -- Tako Hana — Directions; light 25/18
144 Japan -- Niigata — Arrival information; outer anchorages and pilotage 08/18
153 Japan -- Honshu -- Akita Funakawa Ko — Depth caution 52/18
155 Japan -- Honshu -- Akita Ku — Depth caution 52/18
180 Japan -- Honshu -- Kashima Ko — Vertical clearance 22/18
226 Japan -- Hokkaido -- Ishikariwan Ko — Directions; depths 21/18
280 Russia -- Ostrov Shikotan -- Bukhta Malokuril’skaya — Submarine cable 06/19
288 Russia -- Sea of Okhotsk -- Ostrov Iturup -- Kuril’skiy Zaliv — Anchorage 07/19
42A Japan 2 6th Edition (2017) 36/17
62 Shikoku -- South coast -- South of Oki--no--Shima — Directions; superbuoy 20/18
63 Shikoku -- South coast -- South of Oki--no--Shima — Direction; superbuoy 20/18
67 Shikoku -- South Coast -- Tosa Wan — Directions; superbuoys 18/18
68 Shikoku -- South coast -- Tosa Wan and approaches — Directions; superbuoy 20/18
69 Shikoku -- South Coast -- Tosa Wan — Directions; superbuoy 18/18
69 Shikoku -- Susaki Ko -- Daibo Quay — Depth 49/17
109 Ise Wan -- Yokkaichi Ko — Bridge 09/18
150 Sagami Nada -- West and north--west of O Shima — Directions; recommended route 50/17
4.32 Wk13/19
IV
Weekly
NP no Page(s) Title Edition
150 Sagami Nada -- West and north--west of O Shima — Directions; recommended route 17/18
152 Honshu -- South Coast -- Shimoda Ko — Directions; line of bearing 41/18
168 Honshu -- South coast -- Uraga Suido -- Kurihama Wan — Obstructions 52/18
168 Honshu -- South coast -- Uraga Suido -- Kurihama Wan — Obstructions; pilotage 52/18
170 Honshu -- South coast -- Approaches to Uraga Ko — Directions; clearing bearing; 52/18
light
193 Japan -- Tokyo Wan -- Tokyo--Ku — Traffic regulations; Prohibited area 03/19
213 South of Honshu -- Nanpo Shoto -- Nishi--no--Shima (Nishino Shima) — Shoal 07/18
42B Japan 3 11th Edition (2016) 10/16
68 Kanmon Ko -- Mutsurejima Ku — Anchorage; obstruction 42/17
88 Suo Nada – Main Route — Directions; racon 48/16
94 Suo Nada – Ube Ko to Tazuno Hana — Directions; racon 48/16
95 Suo Nada – Tazuno Hana to Tokuyama Wan — Directions; racon 48/16
99, 100 Suo Nada – Tokuyama--Kudamatsu — Directions; racon 48/16
103 Suo Nada – Tokuyama Wan to Iwai Shima — Directions; racon 48/16
111 Suo Nada – Nakatsu Ko — Directions; submerged jetty 42/16
115 Bungo Suido -- Seto Naikai — Pilotage 37/17
118 Bungo Suido – Mizunoko Shima — Directions; racon 52/16
118 Kyushu east coast -- Bungo Suido — Depth 46/17
120, 123, 124, 127 Bungo Suido – Mizunoko Shima — Directions; racon 52/16
132 Hozeku Wan to Yawatahama — General information 14/16
148 Iyo Nada – Sada Misaki to Tsurushima Suido — Directions; racon 48/16
152 Iyo Nada – Matsuyama Ko — Directions for entering harbour; racon 48/16
155, 157, 162, 172 Iyo Nada – North side — Directions; racon 48/16
247 Japanese Inland Sea – Channel separating Hoso Shima and In--no--Shima — 28/16
Vertical clearances
255, 257, 261, 264, 266, Hiuchi Nada and Bingo Nada — Directions; aids to navigation; racons 49/16
267, 268
273 Honshu -- Fukuyama Ko -- South Quay — Depths 48/17
273, 275 Hiuchi Nada and Bingo Nada — Directions; aids to navigation; racons 49/16
287, 295, 297, 300, 301, Bisan Seto — Directions; aids to navigation; racons 49/16
307, 325
323 Seto Naikai -- Bisan Seto -- Okayama Suido — Depths 45/18
325 Bisan Seto — Directions; aids to navigation; racons 49/16
330, 332, 333 Harima Nada — Directions; aids to navigation; racons 49/16
346 Honshu -- Himeji Ko -- Hirohata Passage — Depth 20/18
351 Honshu – Harima Nada – Himeji Ko to Higashi--Harima Ko — Directions; sea berth 46/16
368 Tokushima -- Komatsushima Ko -- Arrival information — pilotage 49/16
376 Shikoku -- Kii Suido -- Awazu Ko — Vertical clearance 15/18
389 Kii Suido – East side – Wakayama--Shimotsu Ko — Harbour; development 01/19
398 Honshu -- Osaka Wan -- Kobe Ku — Foul ground 50/18
401 Osaka Wan -- Kobe Ku -- East Passage — Directions; buoyage 07/17
401 Osaka Wan -- Kobe Ku — Directions; light beacon 34/17
403 Osaka Wan -- Amagasaki--Nishinomiya--Ashiya Ku — Directions; buoyage 07/17
42C Japan 4 5th Edition (2015) 18/15
113 Okinawa -- Nakagusuku Shinko — Harbour; development 48/17
192 Kyushu – Kagoshima Ko — Anchorage and pilotage positions 24/15
199, 206, 209, 214 Kyushu -- South--West Coast -- East of Koshikijima Retto -- Koshiki Kaikyo -- Naka Se 10/17
— Other aids to navigation; racon
244 Kyushu -- Yatsushiro Kai -- Yatsushiro Ko — Berths 42/17
246 Yatsushiro Ko — Basins and berths 17/18
Wk13/19 4.33
IV
Weekly
NP no Page(s) Title Edition
257, 259 Shimabara Wan -- Misumi Ko — Bridge; vertical clearance 19/17
288 Japan -- Approaches to Sasebo Ko -- Terashima Suido — Marine farms 21/18
43 South and East Coasts 11th Edition (2018) 02/18
of Korea, East Coast of
Siberia and Sea of
Okhotsk
94 South Korea -- Cheju Do -- Seogwipo Hang — Pilotage 12/18
94 South Korea -- Jejudo -- Seogwipo Hang — Arrival information; VTS 32/18
98 South Korea -- South coast -- Geomundo — Vertical clearance 49/18
104--105 South Korea -- Korea Strait -- Geomundo — Directions; buoy 51/18
111 South Korea – South Coast – Jangjingno — Bridge 02/18
115 South Korea -- South coast -- Geogeum Sudo — Directions; marine farm 34/18
116 South Korea -- South coast -- Geogeum Sudo — Directions; marine farm 34/18
118 South Korea -- South coast -- Naro Yeoldo — Vertical clearances 28/18
120 South Korea -- South Coast -- Yeoja Man — Vertical clearances 28/18
127 South Korea – Yeosu Haeman — General information; VTS 12/19
129 South Korea – Yeosu Haeman — General information; pilotage 12/19
134 South Korea – Gwangyang Hang — Limiting conditions; depths 03/19
134 South Korea -- South coast -- Gwangyang Hang — Vertical clearance 20/18
135 South Korea -- South coast -- Gwangyang Hang — Directions; fish haven 51/18
136 South Korea -- South coast -- Gwangyang Hang — Berths; anchorage 51/18
140 South Korea – South coast – Samcheonpo Hang — Directions; leading lights 03/18
141 South Korea -- Jinju Man -- Namhaedo — Vertical clearance 04/19
141 South Korea – South Coast – Jinju Man – Noryang Sudo — Vertical clearances 12/19
141 South Korea -- Gwangyang Hang -- Noryang Sudo — Vertical clearance 33/18
143 South Korea -- South coast -- Araetdaehoseom to Nam Man — Directions; wreck; 34/18
rock
143 South Korea -- South coast -- Approaches to Tongyeong Hang — Wreck 38/18
149 South Korea -- South coast -- Gyeonnaeryang Haehyeop — Vertical clearance 12/19
153 South Korea -- South coast -- Geojedo — Vertical clearance 47/18
159 South Korea -- Busan New Port -- Todo — Prohibited area 04/18
165 South Korea -- Jinhae Man -- Hwangdeokdo — Directions; light 05/18
173 South Korea -- Busan Hang — Light 21/18
184 South Korea -- Ulsan Hang — Port authority 22/18
185 South Korea -- Ulsan Hang — Development 22/18
186 South Korea -- East coast -- Ulsan Sin Hang — Directions; fairway 09/19
186 South Korea -- East coast -- Approaches to Ulsan Hang — Directions; SBM 04/19
187 South Korea -- Onsan Hang — Berths 22/18
187 South Korea -- Ulsan Hang -- Outer basin berths — Berth information 33/18
187--188 South Korea -- Ulsan Hang -- Inner basin — Alongside depths 33/18
190 South Korea -- East coast -- Mipo Hang — Wreck 47/18
193 South Korea -- Pohang Hang -- Yeongilman Hang — Development 33/18
216 North Korea -- Amyong Kkut -- North--east coast — Directions; major light 18/18
219 North Korea -- North--east Coast -- Baegandan — Directions; major light 18/18
225 North Korea -- North--east Coast -- Ogar Am — Directions; major light 18/18
226 North Korea -- North--east Coast -- Yujindan — Directions; major light 18/18
227 North Korea -- North--east Coast -- Yujindan — Directions; major light 18/18
233 North Korea -- North--east Coast -- Sajindan — Directions; major light 18/18
259 Russia -- Vladivostok -- Bukhta Diomid — Submerged dock; buoy 27/18
259 Russia -- Pacific Coast -- Vladivostock — Berths; obstruction 36/18
268 Russia -- Zaliv Nakhodka — Vessel Traffic Service; speed restrictions; fairways 43/18
4.34 Wk13/19
IV
Weekly
NP no Page(s) Title Edition
271 Russia -- Approaches to Zaliv Nakhodka — Outer anchorages; buoy 43/18
273 Russia -- Pacific Coast -- Zaliv Nakhodka -- Koz’mino — Restricted area 44/18
304 Russia -- Gulf of Tartary -- Zaliv Chikhacheva — Arrival information 42/18
304 Russia -- Gulf of Tartary -- Zaliv Chikhacheva — Pilotage 42/18
328 Russia – Proliv Nevel’skogo — Traffic regulations 04/18
333 Russia -- Amurskiy Liman -- Mys Khussi — Directions; wreck 06/19
367 Russia -- Sea of Okhotsk -- Udskaya Guba -- Guba Lebyazh’ya — Anchorage; depths 30/18
410 Appendix II – Areas prohibited for anchoring and fishing — Amurskiy Liman 04/18
428 Russia -- Gulf of Tartary -- Zaliv Chikhacheva — Appendix II; STS anchorage 42/18
432--449 East coasts of Korea and Siberia and Sea of Okhotsk — Index 33/18
44 Malacca Strait and 13th Edition (2017) 42/17
West Coast of
Sumatera
74 Sumatera -- Pasir Selatan — Directions; light buoy 17/18
76 Indonesia -- East Coast of Sumatera -- Pulau Rupat — Wreck 42/17
77 Indonesia -- East Coast of Sumatera -- Pulau Rupat — Wreck 42/17
107 Indonesia -- Sumatera -- Pelabuhan Kualatanjung — Anchorages; pilot boarding 52/18
position
111 Sumatera -- Pulau Rupat -- Morong — Pilot boarding position 01/19
113 Sumatera -- Selat Rupat -- Approaches to Dumai — Directions; wreck 01/19
114 Sumatera -- Pulau Rupat -- Morong — Pilot boarding position 01/19
154 Malaysia -- Lumut — Anchorage 10/18
156 Malaysia -- Sungai Manjung (Sungai Dinding) -- Lumut — Depths 11/19
159 Malaysia -- Malacca Strait -- Pelabuhan Klang — Anchorage areas 37/18
161 Malaysia -- North approach to Pelabuhan Klang -- Angsa Bank — Obstruction; light 50/17
166 Malaysia -- Malacca Strait -- Tanjung Ru — Light 45/17
176 Malaysia -- Malacca Strait -- South of Tanjung Tohor — Directions; wreck 08/18
189 Indonesia -- Batuampar — Pilotage; directions; anchorages; caution 13/19
193 Singapore -- Singapore Strait -- Middle Channel — Directions 10/18
194 Singapore -- Singapore Strait -- Middle Channel — Directions; wreck 44/18
194--195 Malaysia -- Singapore Strait -- North Channel -- East of Tanjung Punggai — 06/19
Directions; depths; wreck
196 Malaysia -- Johor -- Pengerang Terminal — Directions; jetty; berths 01/18
196 Malaysia -- East Johor Strait -- Pengerang Terminal — Pilotage 40/18
196 Malaysia -- Johor -- Pengerang Terminal — Directions; jetty; berths 01/18
201 Singapore -- Singapore Strait -- South--west of Jurong Island — Directions; wrecks 01/19
207 Singapore -- South--west of Pulau Pawai — Anchorage 09/18
207 Singapore -- South--west of Pulau Sudong — Anchorage 11/18
207 Singapore -- South--west of Pulau Sudong — Anchorages; depths 14/18
207 Singapore -- South--west of Pulau Sudong — Anchorages; height restriction 16/18
207 Singapore -- South--west of Pulau Sudong — Depths 26/18
210 Singapore -- Changi — Anchorage 12/19
213 Singapore -- Jurong Island -- Sinki Fairway — Pilot boarding position 14/18
223 Singapore -- Jurong Island -- Ayer Merbau Basin — Directions 12/18
229 Singapore -- The Sisters — Marine nature reserve 50/17
229 Singapore -- The Sisters — Directions; Marine nature reserve 50/17
235 Singapore -- Jurong Island -- Sakra Basin — Berths 48/17
235 Singapore -- Jurong Island -- Ayer Merbau Basin — Development 12/18
249 Malaysia -- Johor Strait -- Tanjung Pelepas — Pilotage 38/18
251 Singapore Island -- West Johor Strait — Directions; caution 04/19
255 Singapore -- Johor Strait — Pilotage 40/18
Wk13/19 4.35
IV
Weekly
NP no Page(s) Title Edition
257 Singapore -- Johor Strait — Directions; pilotage 40/18
345 Indonesia -- Sumatera -- Teluk Bayur — Directions; leading lights 50/17
346 Indonesia -- Sumatera -- Teluk Bayur — Berths 50/17
45 Mediterranean 1 16th Edition (2018) 14/18
112 Spain -- Approaches to Cartagena — Approach and entry 31/18
112--113 Spain -- Approaches to Cartagena — Regulations; buoyage 31/18
112 Spain -- Approaches to Cartagena — Regulations; buoyage 13/19
113 Spain -- Approaches to Cartagena — Directions; buoyage 31/18
113 Spain -- Approaches to Cartagena — Directions; buoyage 13/19
165 Spain -- East coast -- Puerto de Blanes — Directions; buoy 23/18
179--180 Spain -- Islas Baleares -- Ibiza and Formentera — Marine reserve 08/19
185 Spain -- Islas Baleares -- Ibiza — Marine reserve 08/19
189 Spain -- Islas Baleares -- Ibiza — Marine reserve 08/19
192 Spain -- Isla de Ibiza -- Ibiza -- Isla Grossa — Pilotage 52/18
192 Spain -- Isla de Ibiza -- Puerto de Ibiza — Regulations 02/19
196 Spain -- South--west coast of Isla de Mallorca -- Freu de Cabrera — Buoy 22/18
199 Spain -- Islas Baleares -- Mallorca -- Ensenada de Santa Ponça — Anchorage 08/19
224 Spain – Isla de Menorca – East coast — Anchorage 47/18
226 Spain – Isla de Menorca – East coast — Anchorage 47/18
227 Spain – Isla de Menorca – South coast — Anchorage 47/18
239 Morocco -- Al Hoceïma — Pilotage 46/18
239 Morocco -- Al Hoceïma — Directions; leading lights 50/18
264 Algeria -- Golfo d’Arzew to Cap Ténès -- Pointe Rouge — Directions; obstruction 15/18
265 Algeria -- Port de Ténès — Outer anchorage; direction; depths 43/18
266 Algeria -- Alger — Directions; light 04/19
271 Algeria -- Alger — Directions; light 04/19
272 Algeria -- Alger — Light 04/19
273 Algeria -- Alger — Directions; light 04/19
279 Algeria -- Cap Carbon to Cap Bougaroun -- Djen-- Djen — Directions; major lights 08/19
279 Algeria -- Cap Carbon to Cap Bougaroun -- Djen-- Djen — Directions; major light 12/19
287 Algeria – Skikda and Port Méthanier — Anchorages 15/18
287 Algeria -- Golfe de Stora -- Skikda ad Port Méthanier — Anchorages 34/18
288 Algeria -- Golfe de Stora -- Stora — Prohibited anchorage 34/18
291 Algeria -- Annaba — Outer anchorage; controlling depths 43/18
299 Tunisia -- Golfe de Tunis -- Djamour el Kébir — Prohibited area 28/18
312 Tunisia – Cap Bon to Cap Afrique – Sousse — Traffic regulations 35/18
326 Tunisia -- Gulf of Gabès — Directions; wreck 28/18
326 Tunisia -- Gulf of Gabès -- La Skhirra — Directions; light 32/18
335 Italy -- Sicilian Channel – Isola di Pantelleria – Porto di Pantelleria — Arrival 13/19
information; prohibited anchorage and fishing area
406 Sicilia -- North coast -- Porto Di Milazzo — Prohibited area 34/18
408 Sicilia -- North coast -- Porto Di Milazzo — Directions; prohibited area 34/18
460 Italy – Porto di Augusta — Directions; wreck 17/18
465 Italy -- Sicilia – South--east Coast – Santa Panagia Oil Terminal — Prohibited areas; 13/19
pipeline
491 Italy -- South--east coast -- Golfo di Taranto — Prohibited areas 45/18
492 Italy -- South--east coast -- Golfo di Taranto — Directions; prohibited area; 45/18
obstructions
495 Italy -- Golfo di Taranto -- Capo Spulico — Anchorage; caution 45/18
511 Italy -- Golfo di Taranto -- Gallipoli — Prohibited area 19/18
4.36 Wk13/19
IV
Weekly
NP no Page(s) Title Edition
46 Mediterranean 2 16th Edition (2018) 41/18
67 France -- South coast -- Gulf of Lions -- Golfe d’Aigues Mortes — Seaplane operating 49/18
area
71 France -- South coast -- Gulf of Lions -- Golfe de Fos — Seaplane operating area 49/18
102 France -- South coast -- Rade D’Hyères — Prohibited anchorages 02/19
102 France -- Toulon -- Îles d’Hyères — Regulations 06/19
119 France -- South coast -- Golfe Juan — Prohibited area; seaplane area 41/18
125 Monaco -- Port de Monaco — Protected area 46/18
127 Monaco -- Port de Monaco — Prohibited area 46/18
134 Italy -- Gulf of Genoa -- Imperia — Wrecks 07/19
141 Italy – Gulf of Genoa -- Arenzano — Restricted area 41/18
148 Italy -- Genova — Regulations; speed limit 45/18
150 Italy -- Genova —Directions; wreck 09/19
160 Italy – La Spezia — Outer anchorages; wrecks 41/18
187 France – Corse – North--west coast – Port de I’Île--Rousse — Pilotage 41/18
188 France – Corse – North--west coast – Port de Calvi — Pilotage 41/18
205 Italy -- Sardegna -- Bonifacio Strait — Marine reserve 07/19
229 Italy -- West coast -- Corsican Channel TSS to Isola Giannutri — Routes 04/19
230 Italy -- West coast -- Isola del Giglio — Directions; light 04/19
230 Italy -- West coast -- Corsican Channel TSS to Isola del Giglio — Directions 04/19
230 Italy -- West coast -- Isola del Giglio to Isola di Giannutri — Directions; useful marks 04/19
231 Italy -- West coast -- Isola del Giglio — Light 04/19
232 Italy -- West coast -- Corsican Channel TSS to Isola d’Elba — Light 04/19
241 Italy – Portovecchio di Piombino — Berths; draught restrictions 41/18
241 Italy – Golfo di Follonica -- Torre del Sale — Restricted area 41/18
243 Italy – West Coast -- Promontorio Argentario — Prohibited area 41/18
243 Italy -- West coast -- Isola del Giglio — Directions; light 04/19
244 Italy – Porto Santo Stefano — Basins and berths; depth 41/18
270 Italy -- Sardegna -- Capo Teulada — Prohibited area 45/18
270 Italy – Sardegna – South Coast -- Golfo di Teulada -- Porto Zafferano — Directions; 41/18
wreck
299 Italy -- Sardegna -- Golfo Spurlatta — Restricted area 45/18
300 Italy – Sardegna – North--west coast -- Isola Tavolara — Anchorage 41/18
305 Sardegna -- East coast -- Capo San Lorenzo — Prohibited area 06/19
345 Italy – Porto di Procida — Prohibited anchorage 41/18
378 Italy – West Coast -- Marina di Camerota — Anchorage 41/18
47 Mediterranean 3 16th Edition (2017) 32/17
6 Greece — Regulations; Historic wrecks 28/18
77 Greece -- West coast -- Pelopónnisos -- Stenó Prótis — Directions; historic wreck 28/18
77 Greece -- West coast -- Pelopónnisos -- Marathópolis — Anchorage 28/18
78 Greece -- West coast -- Pelopónnisos -- Stenó Prótis — Anchorage 28/18
85 Greece -- Nísos Zákynthos -- Órmos Alykés — Wreck 21/18
86 Greece -- West Coast – Kólpos Argostolíou — Restricted area 47/18
108 Greece -- Préveza -- West--south--west of Fort Áktion — Directions; wreck 21/18
113 Greece -- Patraïkós Kólpos — Regulations; historic wrecks 28/18
115 Greece -- West coast -- Patraïkós Kólpos — Seaplane landing area 04/18
118 Greece -- West coast -- Pátrai Harbour — Seaplane operating areas 04/18
150 Albania -- Stenó Kérkyras -- Northern part — Directions; historic wrecks 37/18
188 Montenegro -- Kotor — Directions; pilotage 11/19
263 Croatia -- Splitski Kanal — Anchorage 32/17
264 Croatia -- Split -- Kaðtelanski Zaljev — Prohibited anchorage; modification of area 10/18
Wk13/19 4.37
IV
Weekly
NP no Page(s) Title Edition
264 Croatia -- Split -- Kaðtelanski Zaljev — Prohibited anchorage 40/17
264 Croatia -- Split -- Kaðtelanski Zaljev — Prohibited anchorage; modification of area 10/18
328 Croatia -- SedmovraÆe — Pilotage 26/18
419 Croatia -- Tihi Kanal — Pilotage 26/18
423 Croatia -- Faýanski Kanal — Pilotage 26/18
444 Slovenia -- Gulf of Trieste -- Koper — Anchorages 26/18
450 Italy -- Trieste -- Porto Industriale — Directions; light 14/18
461 Italy -- Otranto — Development 05/18
466 Italy -- Brindisi — Arrival information; regulations concerning entry 35/17
467 Italy -- Brindisi — Directions; light sector 35/17
470 Italy -- Monopoli — Depths; berths 49/17
476 Italy -- East of Bisceglia — Marine farm; restricted area 28/18
487--488 Italy -- Adriatic Sea -- Isola Pianosa — Prohibited areas 45/17
488 Italy -- Adriatic Sea -- Isole Tremiti — Restricted areas; overhead cables 45/17
489 Italy -- South east coast -- South east of Vasto — Restricted area; marine farm 35/18
492 Italy -- South east coast -- Approaches to Ortona — Prohibited entry; directions; 35/18
obstructions
494 Italy -- Pescara — Anchorages; pilotage 45/18
498 Italy -- East coast -- Pescara to Pedaso — Restricted area 11/19
498 Italy -- East Coast -- Pescara — Directions; obstruction 16/18
501 Italy -- East coast -- Approaches to Ancona and Falconara — Traffic regulations 41/18
510 Italy -- East Coast -- Falconara Marittima -- API Refinery Pier — Obstruction 32/17
513 Italy -- North Adriatic -- Rimini — Prohibited area 05/18
514 Italy -- East coast -- Approaches to Ravenna — Directions; wrecks 41/18
528 Italy -- Laguna Di Venezia — Vessel traffic service 22/18
533 Italy -- Venezia — Depths 45/18
533 Italy -- Venezia — Depths 09/19
536 Italy -- Venezia -- Canale Vittorio Emanuele — Depths 09/19
48 Mediterranean 4 17th Edition (2017) 30/17
6 Greece -- National regulations — Historic wrecks 28/18
78 Greece -- Nísos Kríti-- Órmos Soúdas — Regulations; historic wrecks 28/18
143 Greece -- Nísos Salamína -- Peiraiás — Wreck 41/18
153 Greece – Stenó Nafstáthmou — Directions; wreck 34/17
213 Greece -- Kykládes Nísoi -- Ermoúpolis — Anchorage 37/17
226 Greece -- Aegean Sea -- Órmos Ágiou Nikoláou -- Órmos Livádi — Anchorage 27/18
227 Greece -- South Aegean -- Órmos Vourkári — Anchorage 21/18
232 Greece — Regulations; historic wrecks 28/18
299 Greece -- East coast -- Stenó Makrónisou — Regulations; historic wrecks 28/18
300 Greece -- East coast -- Stenó Makrónisou — Directions; wrecks 28/18
323 Greece -- East coast -- Vóreios Evvoïkós Kólpos -- Órmos Ágiou Georgíou — Historic 28/18
wreck
360 Greece -- Thermaïkós Kólpos -- Néa Moudaniá — Anchorage 11/18
362 Greece -- Kólpos Thessaloníkis -- Wreck 30/17
397 Turkey -- Çanakkale BoÔazÝ -- Kumkale Burnu — Restricted area 32/18
398 Turkey -- North Aegean -- Karayer AdalarÝ — Directions; major lights 42/17
398 Turkey -- Bozcaada — Directions; light sector 35/17
399 Turkey -- North Aegean -- Karayer AdalarÝ — Directions; major lights 42/17
399 Turkey -- West coast -- Bozcaada — Directions; unexploded ammunition 29/18
400 Turkey -- North Aegean -- Karayer AdalarÝ — Directions; major lights 42/17
403 Turkey -- North Aegean -- Karayer AdalarÝ — Directions; major lights 42/17
408 Turkey -- West coast -- KuîadasÝ — Dolphins 30/18
4.38 Wk13/19
IV
Weekly
NP no Page(s) Title Edition
433 Turkey -- Nemrut LimanÝ — Pilotage 45/17
434 Turkey -- Nemrut LimanÝ — Directions; pilotage 45/17
436 Turkey -- AliaÔa — Anchorages 45/17
436 Turkey -- North Aegean -- AliaÔa — Anchorages 40/18
437 Turkey -- North Aegean -- AliaÔa — Pilotage 42/18
437 Turkey -- ÇandarlÝ Körfezi -- AliaÔa LNG Terminal — Arrival information; Restricted 02/19
area
447 Turkey -- Díavlos Lámna/Müsellim Geçidi -- Müsellim KayasÝ — Position 42/17
448 Turkey -- Díavlos Lámna/Müsellim Geçidi — Directions; shoals, depths 42/17
49 Mediterranean 5 14th Edition (2018) 23/18
67 Libya -- ®arºbulus — Pilotage 04/19
115 Egypt -- MØnº’ Al IskandarØyah — Directions; wreck; buoys 11/19
115 Egypt -- MØnº’ Al IskandarØyah — Directions; buoy 11/19
127 Egypt – Port Said — Prohibited anchorage area 23/18
127 Egypt – Port Said — Prohibited anchorage area 38/18
175 Turkey -- South coast -- Approaches to Taîucu Körfezi — Directions; marine farm 09/19
176 Turkey -- Mediterranean Sea -- OvacÝk Körfezi — Alongside berths; useful mark 08/19
178 Turkey -- Mersin Körfezi — Prohibited area 35/18
183 Turkey -- South--east coast -- ™skenderun Körfezi — Outer anchorages 37/18
184 Turkey -- ™skenderun Körfezi -- Botaî (Dörtyol) Oil Terminal — General information 09/19
186 Turkey -- ™skenderun Körfezi -- ™sdemir — Berths; depths 32/18
187--188 Turkey -- ™skenderun Körfezi -- ™skenderun — Berths; depths 32/18
188 Turkey -- ™skenderun Körfezi -- ™skenderun — Berths; depths 32/18
229 Lebanon -- Sel’ Ata -- Ra’s Kubbº — Shoal 49/18
245 Israel – Ashdod — Pilotage 23/18
50 Newfoundland and 14th Edition (2016) 34/16
Labrador
130 Canada -- Newfoundland -- Placentia Bay — Depths 30/18
145 Canada -- Newfoundland -- South coast -- Placentia Bay -- North Harbour — Fish 35/18
haven
149 France -- Île Saint--Pierre and Miquelon — Directions; depth 47/18
149 Canada – Newfoundland -- Burin Peninsula — Directions; buoy 47/18
152 France -- Île Saint--Pierre and Miquelon – Port de Saint--Pierre — Speed limit 02/18
155 France -- Île Saint--Pierre and Miquelon — Directions; buoy 47/18
155 France -- Newfoundland -- Petite Miquelon — Directions; depth 40/18
156 France -- Île Saint--Pierre and Miquelon — Anchorage 47/18
156 France -- Newfoundland -- Anse de Miquelon — Anchorage 38/18
158 Canada -- Newfoundland -- South coast -- Fortune Harbour — Anchorage 38/18
375 Labrador -- Strait of Belle Isle Approaches — Caution; ODAS 01/19
428 Canada -- Labrador -- East coast -- Lake Melville — Dumping ground 35/18
432 Canada -- Labrador -- East coast -- Goose Bay — Dumping ground 35/18
433 Canada -- Goose Bay Narrows — Directions; buoyage; depths; controlling depths 39/16
433 Canada -- Labrador -- Goose Bay Narrows to Terrington Basin — Directions; shoal 18/17
454 Canada -- Goose Bay Narrows -- Directions; buoyage; depths; controlling depths 39/16
51 New Zealand 19th Edition (2015) 51/15
5 Navigation and regulations – Radio facilities — Radio navigational warnings 27/17
72 North Island -- Cape Maria van Diemen — Directions; light sector 23/18
81 North Island -- West Coast -- Manukau Harbour — Regulations 32/18
82 North Island -- West Coast -- Manukau Harbour — Prohibited anchorage 32/18
82 North Island -- West Coast -- Manukau Harbour — Signal station 32/18
94 North Island – West coast – Port Taranaki — Pilotage 03/18
Wk13/19 4.39
IV
Weekly
NP no Page(s) Title Edition
104 North Island -- Wanganui — Entry; light 39/16
139 South Island – Tory Channel — Pilotage 29/18
140 South Island – Tory Channel — Traffic regulations 29/18
142 South Island -- Queen Charlotte Sound -- Perano Shoal — Directions; buoy; 31/18
anchorage
177 South Island – West Cape to Windsor Point — Directions 39/16
210 North Island – North Cape to Karaui Point — Directions 51/15
211 North Island -- Parengarenga Harbour — Directions 05/17
212 North Island – North Cape to Karaui Point — Directions 51/15
217, 219 North Island – Bay of Islands — Pilotage, anchorages 51/15
230 North Island -- Whangarei Harbour — Anchorages 39/17
243 North Island -- East coast -- Mahurangi Harbour — Restricted area 41/18
245 Hauraki Gulf -- Auckland approaches — Traffic regulations; reporting 46/17
249 Auckland approaches -- Motuihe Channel — Directions 46/17
252 North Island -- Auckland — Wreck 51/16
263 Auckland approaches -- Tamkai Strait — Local knowledge 46/17
263 North Island -- Auckland Approaches -- Tamaki Strait — Directions; wreck 51/18
274, 276 North Island – East Coast – Tauranga approaches — Exclusion zones 25/16
282 North Island – East Coast – Tauranga — Anchorages 03/16
282 North Island -- Bay of Plenty -- Tauranga — Anchorages 47/18
285 North Island – Tauranga – Maunganui Roads and Stella Passage — Directions; 24/17
beacons
285 North Island – Tauranga – Town Reach — Directions; beacons 24/17
286 North Island – Tauranga – Town Reach — Directions; useful marks 24/17
286 North Island – Tauranga – Western Channel — Directions; buoyage 24/17
286 North Island – Tauranga – Otumoetai Channel — Directions; beacons 24/17
290 North Island – East Coast – Tauranga approaches — Exclusion zones 25/16
291 North Island – East Coast – Whakatane River — Description 06/16
298 North Island – East Coast – East Cape to Mahia Peninsula – Gisborne — 02/16
Anchorages
298 North Island – East coast – Gisborne — Anchorages 35/17
300 North Island – East coast – Gisborne — Directions; lights 30/16
303, 304 North Island – Hawke Bay — Directions; pilotage; anchorages 12/17
307 Napier – Breakwater Harbour — Directions; light 16/16
314 South Island -- East Coast – Cape Campbell to Conway Flat — General information; 22/17
depths
315 South Island -- Cook Strait -- Cape Campbell — Directions; rocks 34/18
317 South Island – Lyttelton – Godley Head — Light 10/16
319 South Island -- Lyttelton Harbour — Depth 02/19
319 South Island -- Lyttelton Harbour — Anchorage 02/19
320 South Island -- Lyttelton Harbour — Pilotage 02/19
320 South Island – Lyttelton – Godley Head — Light 10/16
320 South Island – East Coast – Lyttelton Harbour — AIS 07/17
323 East coast of South Island – Banks Peninsula — General information; marine 52/16
reserves; marine mammal sanctuary
324 Akaroa Harbour — Arrival information 22/16
324 South Island -- East Coast -- Akaroa Harbour — Marine reserve 25/16
324 Akaroa Harbour — Arrival information 26/16
325 Akaroa Harbour — Berths; anchorages and moorings 22/16
326 South Island – East Coast – Canterbury Bight — Wreck 25/16
328 South Island -- East coast -- Timaru Harbour — Pilot boarding place 50/17
4.40 Wk13/19
IV
Weekly
NP no Page(s) Title Edition
334 South Island – East coast – Otago Harbour — Arrival information; pilotage 30/16
337 South Island -- East coast -- Otago Harbour -- Port Chalmers — Wharf development 50/17
344 Kermadec Islands — Directions 16/16
344 Raoul Island -- Denham Bay — Directions; obstruction 30/17
344 Kermadec Islands — Directions 16/16
344 Kermadec Islands — Anchorages and landing places 16/16
347 Chatham Island -- Hanson Bay — Restricted area 30/18
349 Chatham Islands -- Port Waitangi — Directions; lights 38/18
350 Chatham Island -- Kaingaroa Harbour — Directions; anchorages; depth 30/18
350--351 Pitt Island -- Motutapu Point — Directions 30/18
353 Auckland Islands — General information; prohibited area 06/17
52 North Coast of 10th Edition (2018) 32/18
Scotland
4 United Kingdom -- North Sea — Statutory safety zones 32/18
85 Scotland -- North--east coast -- Wick — Directions; clearing marks 08/19
213 The Shetland Islands -- North Approach to Lerwick -- Cat Firth -- Directions; depth 04/19
219 Shetland Isles -- Stepping Stones -- Muckle Fladdicap — Directions; depth 08/19
267 Faroe Islands -- Tórshavn — Development 36/18
272 Faroe Islands -- SkálafjørÉur -- Runavík — Development 32/18
54 North Sea (West) 11th Edition (2018) 18/18
3 United Kingdom -- North Sea — Statutory safety zones 31/18
3 United Kingdom -- North Sea -- Marine exploitation — OREIs 25/18
61 Scotland -- South--east of Aberdeen — Offshore wind farm 25/18
65 Scotland – Montrose — Pilotage 45/18
85 Scotland -- Methil — Under--keel clearance; navigable width 23/18
87 Scotland -- East coast -- Firth of Forth -- Kirkcaldy — Limiting conditions 13/19
89 Scotland -- Leith — Under--keel clearance; navigable width 23/18
89 Scotland -- East coast -- Firth of Forth -- Leith — Under--keel clearance 13/19
90 Scotland -- Leith — Lock width 23/18
92 Scotland -- Burntisland — Under--keel clearance; navigable width 23/18
98 Scotland -- Firth of Forth -- Hound Point Marine Terminal — Under--keel clearance 23/18
98 Scotland -- East coast -- Firth of Forth -- Hound Point Marine Terminal — Under--keel 13/19
clearance
100 Scotland -- Rosyth — Under--keel clearance 23/18
100 Scotland -- East coast -- Firth of Forth -- Rosyth — Under--keel clearance 13/19
104 Scotland -- Grangemouth — Under--keel clearance 23/18
174 England -- River Humber -- Skitter Channel — Light float 49/18
182 England -- East Coast -- River Trent — Vertical clearance 48/18
205 England – East coast – Great Yarmouth approaches — Directions; obstruction 29/18
206 England – East coast – Great Yarmouth and Lowestoft approaches — Depth 29/18
206 England – East coast – Great Yarmouth and Lowestoft approaches — Directions 29/18
209 England – Great Yarmouth — Arrival information; pilotage 43/18
55 North Sea (East) 11th Edition (2018) 37/18
89 Netherlands -- Zeegat van Texel — Lighthouse 07/19
90 Netherlands -- Zeegat van Texel — Directions; lighthouse 07/19
93 Netherlands -- Zeegat van Texel — Directions; lighthouse 07/19
98 Netherlands -- Zeegat van Texel — Directions; lighthouse 07/19
151 Germany -- The Jade — Regulations; extraordinarily large vessels 39/18
243 Germany -- The Eider -- Eiderstedt — Directions; light 10/19
302 Denmark -- North Coast -- Hanstholm — Directions; light 47/18
Wk13/19 4.41
IV
Weekly
NP no Page(s) Title Edition
56 Norway 1 17th Edition (2018) 39/18
72 Norway -- South--west coast -- Egersund — Berths 07/19
77 Norway -- Approaches to Åna--Sira — Vertical clearance 45/18
120 Norway -- Kristiansand -- Topdalsfjorden — Directions; lights 09/19
189 Norway -- Oslofjorden -- Horten — Depth 42/18
190--191 Norway -- Oslofjorden -- Horten — Directions; underwater rocks 42/18
199 Norway -- Oslofjorden -- Fagerstrand — Depths 13/19
225 Norway -- Oslofjorden -- Løperen — Directions; light sector; positions 50/18
225 Norway -- Oslofjorden -- Løperen — Directions; leading lights 52/18
225 Norway -- Oslofjorden -- Asmaløy — Directions; lights 09/19
235 Norway -- Oslofjorden -- Svalerødkilen — Anchorage 39/18
277 Sweden -- Skagerrak -- Hakefjord -- Mitholmarna — Directions; light 12/19
277 Sweden -- Skagerrak -- Hakefjord -- Mitholmarna — Directions; light 12/19
277 Sweden -- Skagerrak -- Hakefjord -- Mitholmarna — Directions; light 12/19
57A Norway 2A 12th Edition (2016) 50/16
84 Norway -- Boknafjorden -- Kvitsøy — Directions; lights 26/18
87 Norway – West coast – Skudeneshavn — Anchorage 50/16
108 Gandsfjorden – Sandnes — Basins and berths; depths 26/17
133 Ryfylkefjordene – Finnøyfjorden – Bokn – Tjørnasund — Anchorage 09/17
144 Norway – West coast – Sandfjorden — Vertical clearance; bridge 50/16
154 Haugesund approaches – Karmsundet South part — Directions; light beacon 26/17
154 Haugesund approaches – Karmsundet South part — Directions; light beacon 26/17
155 Norway -- Karmøy -- Tømmervika — Anchorage 23/18
156 Førresfjorden -- Austdjupet -- Directions; light 28/18
222 Hardangerfjorden -- Sørfjorden -- Odda — Underwater rocks 42/18
222 Norway -- West coast -- Sørfjorden -- Odda — Directions; light 06/19
235 Bømlo West Coast -- Melingsvågen — Directions; Leading Lights 17/18
275 Huftarøy -- Hundvåkosen — Directions; light 50/16
282 Stora Sotra -- Golta -- Goltastraumen — Vertical clearances 13/18
338 Norway -- West coast -- Fedjefjorden -- Fedje — Anchorages 03/19
351, 353 Osterfjorden -- Mulsneset — Overhead cable 10/17
367 Fensfjorden -- Mongstad Oil Terminal — Berths; Depths 50/16
371 Norway -- Fensfjorden -- Rossnesvågen — Vertical clearance 52/17
386 Ånnelandssundet -- Sandøyna -- Grytenes — Light 47/17
389 Folefotsundet — Overhead cable 50/16
426 Norway -- Ytre Sula -- Kolgrov — Leading lights; alignment 07/18
433 Norway -- Ospa -- Drivøyosen — Directions; light 31/17
478 Florø -- Håskjerfora — Directions; lights 33/18
513 Fåfjorden and Våsfjorden — Directions; racons; leading lights 13/17
57B Norway 2B 10th Edition (2017) 45/17
9 Navigation and Regulations – Pilotage — Pilotage boarding places 02/18
81 Raudøyholmen -- Ørstafjorden — Directions; light 22/18
95 Norway -- Møre og Romsdal -- Holmefjorden — Sector light 50/18
97 Norway -- Møre og Romsdal -- Holmefjorden — Directions; sector light 50/18
104 Storfjorden -- Velteneset — Overhead power cables 22/18
116 Norway -- Åsefjorden -- Veddevika — Submarine pipeline 35/18
133 West coast -- Ellingsøya -- Taftasundet — Vertical clearance 41/18
152 Norway -- South of Molde -- Tresfjorden — Directions; light 35/18
158 Nogvafjorden -- Flemsøya — Directions; light sector 31/18
166 Approaches to Budadjupet -- Bjørnsund — Directions; light 13/19
4.42 Wk13/19
IV
Weekly
NP no Page(s) Title Edition
241 West coast -- Tustna -- Klakken — Directions; light sector 41/18
331 Halten and Kaura to Vikna – General information — Pilotage 02/18
360 Namsos – Arrival information — Pilotage 02/18
58A Norway 3A 8th Edition (2015) 20/15
73 Gjerdinga – Korsholmen — Light 38/16
91 Bindalsfjorden -- Fiskarosen and Skjelsviksjøen — Anchorages 01/16
96, 99 Melsteinen – Helgelandsflesa — Directions; racon 07/17
129 Ylvingsfjorden -- Rørøya — Anchorage 21/16
140 Mindværfjorden -- Trosundet — Directions; light 23/16
142 Vefsnfjorden -- Bjørga — Overhead cable 29/15
170 Dønna -- Sørøyvågen — Overhead cable 33/16
175 Tomma -- Alsøyvågen — Overhead cable 33/16
194 Ternholmfjorden -- Ternholmen -- Kalsholmen Light — Directions 09/16
201 Træna -- Husøyhamn — Anchorage 14/16
215 Nordfjorden -- Hellarvika — Overhead cable 34/15
219 North part of Kvarøyfjorden and Rødøfjorden to Skarsfjorden – Tjongsfjorden — 15/17
Anchorage
224 Ternholmfjorden -- Ternholmen -- Kalsholmen Light — Directions 09/16
229 Meløyfjorden -- Jektvika — Directions; light; buoyage 27/16
231 Ternholmfjorden -- Ternholmen -- Kalsholmen Light — Directions 09/16
231,232 Gåsværfjorden -- Gåsvær — Directions; light 48/15
232 Gåsværfjorden -- Gåsvær — Directions; buoy 27/16
234, 235, 238, 241, 242 Ternholmfjorden -- Ternholmen -- Kalsholmen Light — Directions 09/16
248 Støttvær -- Svenningen and Støtt — Light 34/15
249 Fugløyfjorden -- Røssøya — Light 37/15
249 Fugløyfjorden -- Haggeren — Light 34/15
249 Fleinsundet -- Stabben — Light 37/15
250 Fugløyfjorden -- Hestøya and Stongholmgrunnen — Light 37/15
250 Fugløyfjorden -- Hestøya and Stongholmgrunnen — Light 37/15
258 Saltfjorden east part -- Sennvika — Directions; light 48/15
272 Bodø and approaches -- Alternative south--west approach -- Hernesskagleia and 48/16
Røssøyleia — Directions; lights
272 Bodø -- Nyholmsundet — Directions; light sectors 05/19
276 Bodø -- Nyholmsundet — Directions; light sector 05/19
279 Vågøyan -- Akseløya — Submarine pipeline 34/17
282 Karlsøytfjorden -- Helloya -- Helloyskjær — Directions; light sectors 32/17
297 Vestfjorden -- Grøtøya — Route; light 02/18
298 Måløy Skarholmen and Folda to Flatøya -- Main Inshore Route -- Sildeskjær to 10/17
Vestfjorden by way of Grøtøysundet and Breidsundet — Depths
298 Vestfjorden -- Heligholmen — Depths 02/18
298 Måløy Skarholmen and Folda to Flatøya -- Main Inshore Route -- Sildeskjær to 10/17
Vestfjorden by way of Grøtøysundet and Breidsundet — Directions; caution
298--299 Vestfjorden -- Grøtøysundet — Directions 02/18
299 Vestfjorden -- Grøtøysundet — Anchorage 10/17
299 Grøtøysundet – Nordskot — Anchorage 26/17
302 Skjettenfjorden -- Husøyvær -- Bolsøygalten — Directions; light sector 05/19
304 Skjettenfjorden -- Husøyvær -- Bolsøygalten — Directions; light sector 05/19
305 Skjettenfjorden -- Husøyvær -- Bolsøygalten — Directions; light sector 05/19
327 Tysfjorden -- Kjøpsviksundet — Vertical clearance 49/15
330 Tysfjorden -- Hellmofjorden -- Musken — Anchorage 07/16
331 Tysfjorden -- Grunnfjorden — Directions 39/15
Wk13/19 4.43
IV
Weekly
NP no Page(s) Title Edition
331 Mannfjorden -- Verka — Overhead cable 34/15
331 Tysfjorden -- Hulløysundet -- Hamnvika — Anchorage 09/16
334 Efjorden -- Straumøya and Hellarneset — Overhead cable 34/15
335 Ofotfjorden -- Geiskevika — Anchorage 20/16
340, 341, 343, 344 Narvik -- Vidrek -- Herjangsfjorden — Anchorages 22/15
345 Ofotfjorden -- Rombaken — Vertical clearances 07/19
357 Sørlandsvågen – Røssnesvågen — Directions; leading lights 01/17
357 Værøy -- Sørlandsvågen -- Røssnesvågen — Directions; Leading Lights 48/17
368 Lofoten -- Sørvagen and Moskenes — Beacon 33/15
368 Lofoten -- Moskenesøya -- Sørvågen — Directions; leading line 48/15
368 Lofoten -- Sørvagen and Moskenes — Beacon 33/15
382 Vestfjorden -- Brandsholmsfallan — Directions; Light buoys 34/17
386 Lofoten -- Henningsvær — Directions; light 48/15
394 Lofoten -- Gimsøya -- Kristenskjæran — Buoy 29/18
398, 399 Lofoten -- Henningsvær — Directions; light 48/15
408 Skrova -- Skrova Havn — Overhead cable 27/16
414 North side of Vestfjorden -- Svolvær — Anchorage 01/16
417 Vestfjorden -- Austnesfjorden -- Sildpollen — Anchorage 10/17
419 Vestfjorden -- Raftsundet — Vertical clearance 07/16
420 North side of Vestfjorden -- South approach to Raftsundet — Directions; beacon 48/15
471 Vesterålen -- Langøysundet -- Rå — Anchorage 11/16
481 Vesterålen -- Malnesfjorden -- Hovden — Directions; leading lights 09/16
481 Vesterålen – Langøya – Hovden — Directions; light 44/16
487 Prestfjorden -- Andvæbåan and Brusfluan — Directions; lights 48/15
488 Prestfjorden -- Skjåneset — Directions; light 46/15
488 Prestfjorden -- Andvæbåan and Brusfluan — Directions; lights 48/15
58B Norway 3B 8th Edition (2018) 40/18
82 Norway -- Vågsfjorden -- Sandssundet — Directions; buoys 09/19
87 Grovfjorden -- Grov — Directions; light sector 43/18
91 Vågsfjorden -- Sagfjorden — Directions; light sector 48/18
311 North coast -- Entrance to inshore waters between Ingøya and Hjelmsøya — 11/19
Directions; light
361 Norway -- Tanafjorden -- Skardholmen — Directions; sector light 50/18
366 Norway -- Berlevåg -- Kjølnes — Directions; light 09/19
59 Nova Scotia and Bay of 15th Edition (2013) 04/14
Fundy
94 Canada – Sambro Harbour — Directions; light buoys 52/16
95 Canada – Indian Harbour — Overhead cable 52/16
97 Canada -- Halifax — Vertical clearances 12/18
97 Canada – Halifax — Arrival information; pilotage 39/14
126 Canada – Luneburg Harbour — Arrival information; pilotage 44/14
167 Nova Scotia -- Approaches to Bay of Fundy -- Brier Island -- Grand Passage — 12/19
Directions
168 Canada – Petit Passage — General information; overhead power cables 39/14
180 Canada -- Bay of Fundy -- Saint John Harbour — Berths; alongside depths 35/18
60 Pacific Islands 1 13th Edition (2018) 04/18
134 Papua New Guinea -- Bougainville Island -- Otua Island — Directions; light 04/18
155 Papua New Guinea -- Bougainville Island -- Otua Island — Directions; light 04/18
156 Papua New Guinea -- Bougainville Island -- Otua Island — Directions; light 04/18
157 Papua New Guinea -- Bougainville Island -- Otua Island — Directions; light 04/18
262 Papua New Guinea -- Huon Gulf — FADs 30/18
4.44 Wk13/19
IV
Weekly
NP no Page(s) Title Edition
262 Papua New Guinea -- Huon Gulf -- North of Cape Roon — Directions; shoals 37/18
262 Papua New Guinea -- Huon Gulf — Directions; FADs; buoys 30/18
262 Papua New Guinea -- Huon Gulf -- North of Cape Roon — Directions; shoals 37/18
263 Papua New Guinea -- Huon Gulf — Directions; FAD; buoy 30/18
282 Papua New Guinea -- New Britain -- Thilenius Harbour — Depth 52/18
331 Papua New Guinea -- Vitu Islands -- Mundua Islands — General Information; depth 08/19
357 Papua New Guinea -- Bougainville Island -- Otua Island — Directions; light 04/18
364 Papua New Guinea -- Bougainville Island -- Otua Island — Directions; light 04/18
367 Papua New Guinea -- Bougainville Island -- Arawa Bay — Directions; light 04/18
368 Papua New Guinea – Bougainville Island -- North--east coast — Directions; light 04/18
369 Papua New Guinea -- Bougainville Island -- Cape Laverdy — Directions; light 04/18
370 Papua New Guinea -- Bougainville Island -- Cape Laverdy — Directions; light 04/18
61 Pacific Islands 2 13th Edition (2017) 10/17
87 Nouvelle Calédonie -- South coast -- Nouméa — Limiting conditions; depths 32/17
87 Nouvelle--Calédonie -- Nouméa — Outer anchorage 26/18
87 Nouvelle Calédonie – Nouméa — Prohibited anchorages 47/18
88 Nouvelle--Calédonie -- Nouméa -- Grande Rade — Leading Line 11/17
92 Nouvelle--Calédonie – West coast — Marine reserve 01/18
95--96 Nouvelle Calédonie -- Baie de Saint Vincent — Anchorages 43/17
98 Nouvelle--Calédonie – West coast — Marine reserve 01/18
118 Nouvelle Caledonie -- Île Art -- Baie de Waala — Anchorage 27/18
119 Nouvelle Caledonie -- Île Pott -- Anse Ammoian — Anchorage 27/18
125 Nouvelle--Calédonie – East coast – Port Ounia — Anchorage; wreck 12/18
125 Nouvelle--Calédonie – Baie de Ouinné — Anchorage 20/17
130 Nouvelle--Calédonie – Port de Thio — Directions; leading lights 20/17
135 Nouvelle--Calédonie – Baie Laugier — Directions; leading lights 20/17
138 Nouvelle--Calédonie -- Baie de Poro — Leading beacons 48/17
266 Fiji Islands -- Viti Levu -- Approaches to Suva — Anchorage; wreck 28/18
281 Fiji Islands -- Viti Levu Bay — Directions; rocks 40/17
295 Fiji Isands -- Levuka Wharf — Wreck 41/17
300 Fiji -- Viti Levu -- Rewa Roads — Submarine cable 16/18
346 Fiji -- Exploring Isles -- Qilaqila Passage — Leading Beacons 43/17
360 Fiji Islands -- Balmoral Reef — Shoal 42/18
365 Île Futuna -- Ava Leava — Anchorage 16/18
368 Îles Wallis -- Mouilage de Mata Utu — Anchorage 16/18
368 Oceania – Îles Wallis – Mata Utu — Anchorage 47/18
394 Tonga -- Ha’apai Group -- Ava Vahaa Fonua — Directions; rock 02/19
410 Samoa -- Savai’i Island -- Salelologa Harbour — Directions; depths 16/18
410 Samoa -- Upolu Island -- Mulifanua Harbour — Directions; depths 16/18
411 Samoa -- Upolu Island -- Cape Tapaga — Shoal depth 15/17
62 Pacific Islands 3 14th Edition (2016) 51/16
130 French Polynesia -- Archipel des Tuamotu -- Taenga — Directions; alignment 43/18
134 French Polynesia -- Archipel des Tuamotu -- Fakarava — Anchorages 44/18
150 French Polynesia -- Îles de la Société -- Tahiti -- Mouillage Vairao — Anchorage 11/17
151 French Polynesia -- Îles de la Société -- Tahiti -- Port Phaéton — Directions; depth 11/17
154 French Polynesia -- Tahiti -- Passe Aifa — Depth 35/17
154 French Polynesia -- Tahiti -- Mouillage d’Aifa — Depth 03/17
158 French Polynesia -- Tahiti -- Lagon de Punaauia — Anchorages; wrecks; beacon 31/17
176 French Polynesia -- Moorea — Regulations 31/17
179 French Polynesia -- Moorea -- Baie de Cook — Anchorage berths 31/17
Wk13/19 4.45
IV
Weekly
NP no Page(s) Title Edition
179 French Polynesia -- Moorea -- Baie d’Opunohu — Anchorages 31/17
201 French Polynesia -- Îles Sous le Vent -- Raiatea – Uturoa — Anchorage berths 09/17
204 Îles de la Société -- Raiatea -- Passe Toamaro — Depth 49/17
212 French Polynesia -- Îles de la Société -- Bora--Bora -- Baie de Povai — Anchorages 44/18
224 Cook Islands -- Penrhyn Island Lagoon — Depths 29/18
244 Palmyra Atoll — Explosives dumping ground 49/17
252 French Polynesia -- Îles Marquises -- Hiva--Oa -- Baie Taaoa — Anchorages; depths 11/18
258 French Polynesia -- Îles Marquises -- Nuku--Hiva -- Baie de Taiohae — Anchorage 10/17
312 Hawaiian Islands – Oahu Island – Pearl Harbor — Controlling depth 42/18
323 Hawaii -- Oahu -- Kaneohe Bay — Directions; wreck 26/17
63 Persian Gulf 18th Edition (2018) 27/18
61 Western approaches to the Strait of Hormuz -- JazØreh--ye Tonb--e Bozorg — Name 11/19
61 Western approaches to the Strait of Hormuz -- JazØreh--ye Tonb--e Bozorg — Name 11/19
62 Western approaches to the Strait of Hormuz -- JazØreh--ye Tonb--e Bozorg — 11/19
Directions; name
62 Oman -- Strait of Hormuz -- West Bukha Oilfield — Directions; racon 37/18
62 Western approaches to the Strait of Hormuz -- JazØreh--ye Tonb--e Bozorg — 11/19
Directions; name
62 Oman -- Muscaò - JazØrat Muscaò — Directions; position 49/18
63 Western approaches to the Strait of Hormuz -- JazØreh--ye Tonb--e Bozorg — 11/19
Directions; names
64 Western approaches to the Strait of Hormuz -- JazØreh--ye Tonb--e Bozorg — 11/19
Directions; names
64 Western approaches to the Strait of Hormuz -- JazØreh--ye Tonb--e Bozorg — Name 11/19
64 Western approaches to the Strait of Hormuz -- JazØreh--ye Tonb--e Køchek — Name 11/19
77 Oman -- Muscaò - JazØrat Muscaò — Directions; position 49/18
79 Oman -- Muscaò - JazØrat Muscaò — Directions; position 49/18
82 Oman -- Muscaò - JazØrat Muscaò — Directions; position 49/18
89 Oman -- Shinºî — Anchorage 27/18
102 Oman -- Strait of Hormuz -- West Bukha Oilfield — Directions; racon 37/18
122 Oman -- Strait of Hormuz -- West Bukha Oilfield — Directions; racon 37/18
134 Iran – Bandar--e Pºrs — Anchorages 27/18
147 United Arab Emirates -- Saqr Port — Directions; pilotage; terminal 44/18
148 United Arab Emirates -- Ra’s al Khaymah -- RAK Maritime City -- RAK Khor Port — 27/18
Directions; control tower; buoy; anchorages
149 United Arab Emirates -- Al Jazeera Port — Anchorages; pipeline; buoy 27/18
150 United Arab Emirates – Umm al Quwain — Anchorage 47/18
153 Western approaches to the Strait of Hormuz -- Abø Møsá — Name 11/19
157 United Arab Emirates -- Dubai — Anchorage 49/18
162 United Arab Emirates -- Jebel Ali to Khalifa Port — Hassyan Clean Coal Power Plant 11/19
165 United Arab Emirates – Abu Dhabi — Arrival information; pilotage 27/18
172 United Arab Emirates -- Zirku Oil Loading Terminal — Vessel traffic information 05/19
service
174 United Arab Emirates -- –ºlat al Mubarraz Oil Loading Terminal — Vessel traffic 05/19
information service
175 United Arab Emirates -- Approaches to Ar Ru’ays (Ruwais) and Jabal Aþ ¹annah — 48/18
Depths
176 United Arab Emirates -- Jabal Aþ ¹annah — Vessel traffic information service 05/19
177 United Arab Emirates – Arzanah Oilfield — Directions; platforms 02/19
177 United Arab Emirates -- Approaches to Ar Ru’ays (Ruwais) and Jabal Aþ ¹annah — 48/18
Directions
178 United Arab Emirates -- Approaches to Ar Ru’ays (Ruwais) and Jabal Aþ ¹annah — 48/18
Directions
4.46 Wk13/19
IV
Weekly
NP no Page(s) Title Edition
187 Qatar – Doha — Arrival information; pilotage 27/18
188 Qatar – Hamad Port — Limiting conditions; UKC 27/18
189 Qatar – Hamad Port — Arrival information; pilotage 27/18
190 Qatar – Mesaieed — General information; approach and entry 27/18
191 Qatar – Mesaieed — Directions; approach and entry 27/18
194 Qatar – Outer approaches to Ra’s Laffºn — Directions; wreck 27/18
195 Qatar – Al Ruwais Port — Port information 27/18
196 Qatar – Ra’s Laffºn — Limiting conditions; local weather 27/18
196 Qatar – Ra’s Laffºn — Outer anchorages 51/18
201 Bahrain -- Bahrain approaches — Directions; wreck 27/18
202 Bahrain -- Port of Bahrain — Anchorages 27/18
202 Bahrain -- Port of Bahrain — Pilotage; obstruction 13/19
202 Bahrain -- Port of Bahrain — Restricted areas; submarine cable 13/19
204 Bahrain -- Port of Bahrain — Inner anchorages; berths 27/18
204 Mina’ Salman -- Khawr al Qulay’ah — Anchorage; wreck and buoy 11/19
204 Bahrain -- Port of Bahrain — Berths 27/18
211 Saudi Arabia -- Ad Dammºm — Anchorages 02/19
232 Kuwait -- Al Kuwayt Harbour — Wreck 32/18
233 Kuwait -- KhalØj al Kuwayt — Development 27/18
234 Kuwait – MØnº’ ash Shuwaykh — Directions 27/18
243 Iraq -- Approaches to Khawr ‘Abd Allºh — Security zones 10/19
245 Iraq -- Approaches to Khawr ‘Abd Allºh — Security zones 10/19
245 Iraq -- Approaches to Khawr ‘Abd Allºh — Security zones 10/19
247 Iraq -- Approaches to Khawr ‘Abd Allºh — Security zones 10/19
247 Iraq -- Approaches to Khawr ‘Abd Allºh — Directions; security zones 10/19
64 Red Sea and Gulf of 19th Edition (2018) 30/18
Aden
124--125 Egypt -- Red Sea -- BarnØs — Directions; buoyage; recommended route 02/19
127 Egypt -- Red Sea -- Safaga — Directions; lights 37/18
139 Sudan -- Port Sudan — Cautionary area 30/18
140 Sudan -- Port Sudan — Directions; wreck 30/18
310 Oman -- Port Salalah — Anchorages; pilotage 30/18
332 Djibouti -- Djibouti Port — Anchorages 30/18
65 St Lawrence 18th Edition (2016) 03/16
13 Gulf of St Lawrence — Regulations; speed restrictions; protection of wildlife 41/17
13 St Lawrence — Regulations 08/18
13 Gulf of St Lawrence — Regulations; speed restrictions; protection of wildlife 41/17
13 St Lawrence — Regulations 08/18
65 Gulf of St Lawrence — Traffic regulations 41/17
68 Canada -- Saint Lawrence River -- Baie des Anglais -- Baie--Comeau — Anchorage 39/18
73 Gulf of St Lawrence, North Shore – Strait of Belle Isle to Cap Whittle — 21/16
General information; Navigation
77 Quebec – Chenal à la Baleine — Directions; depths 29/18
78 Quebec – Chenal de l’Ouest — Directions; depths 29/18
78 Quebec – Baie de Bonne--Espérance — Directions; depths 29/18
87 Gulf of St Lawrence — Traffic regulations 41/17
87 Gulf of St Lawrence — Traffic Regulations 08/18
103 Canada -- Sept--Îles — Arrival information; outer anchorages 47/17
104 Sept--Îles -- Pointe aux Basques — Directions; wreck 05/18
105 St Lawrence River -- Sept--Îles — Berths 45/17
106 St Lawrence River -- Sept--Îles -- Pointe Noire — Berths 45/17
Wk13/19 4.47
IV
Weekly
NP no Page(s) Title Edition
111 Canada -- Saint Lawrence River -- Baie des Anglais — Anchorage 39/18
117 Rivière Saguenay and approaches – Saguenay – St. Lawrence Marine Park — 26/16
Whale protection
117 St Lawrence River -- Saguenay -- St. Lawrence Marine Park — Seasonal whale 35/18
protection
119 Pointe Noire to Pointe au Boeuf — Vertical clearance 48/16
125 Gulf of St Lawrence — Traffic regulations 41/17
131 Gulf of St Lawrence -- Îles de la Madeleine -- Cap--aux--Mueles — Berths 51/17
152 Québec -- St Lawrence River -- Rimouski Harbour — Berths 12/19
159 Saint Lawrence River -- Chenal du Nord -- Saint--Siméon — Pier depth 46/17
192 Saint Lawrence River -- Lac Saint Pierre — Directions; lights 21/18
214 Canada -- Cape Breton Island -- Sydney — Pilotage 39/18
217 Canada -- Cape Breton Island -- St Anns Bank — Restricted area 40/17
221 Canada -- Cape Breton Island -- Little Bras d’Or — Pilotage 39/18
243 Nova Scotia -- Canso Lock — General information; vertical clearance 47/17
245 Strait of Canso – Canso Lock to North Canso — General information; vertical 43/16
clearance
268 Prince Edward Island -- Charlottetown -- North River — Depths 51/17
283 Gulf of St Lawrence — Traffic regulations 41/17
284 Shediac Valley -- Miramichi Bay — Limiting draught 46/17
288 Gulf of St Lawrence -- West shore -- Miramichi Bay to Birch Point — Wreck 51/17
292 Gulf of St Lawrence -- Baie de Lamèque — Directions; lights 19/17
292 New Brunswick -- Baie de Lamèque — Depths 10/19
292 Gulf of St Lawrence -- Baie de Lamèque — Directions; lights 19/17
292 New Brunswick -- Baie de Lamèque — Directions; directions 10/19
293 Baie des Chaleurs -- Baie de Shippegan -- Shippegan Harbour — Vertical clearance 36/18
296 New Brunswick -- Bathhurst -- Carron Point — Lights 10/19
296 New Brunswick -- Approaches to Bathhurst harbour — Directions 10/19
297 Gulf of St Lawrence — Belledune — Outer anchorage; pilotage 08/18
304 Gulf of St Lawrence -- West shore -- Havre de Gaspé — Berths 51/17
66A South west coast of 2nd Edition (2019) 03/19
Scotland
64 Scotland -- West coast -- Ardrossan — Traffic lights 03/19
174 Oban Harbour — Anchorages 11/19
66B North west coast of 2nd Edition (2019) 02/19
Scotland
133 South Harris -- Leverburgh — Directions; light 07/19
150 Inner Sound -- Loch Kishorn — Berths 07/19
198 Isle of Lewis -- Breivig — Directional light 07/19
67 West Coasts of Spain 13th Edition (2018) 09/18
and Portugal
66 Spain -- Ferrol -- Islas Gabeiras — Directions; shoal 31/18
112 Spain -- West coast -- Vigo — Restricted area 06/19
113 Spain -- West coast -- Puerto de Vigo — Prohibited area; general layout 49/18
113 Spain -- West coast -- Vigo — Prohibited area 06/19
113 Spain -- West coast -- Puerto de Vigo — Prohibited area; general layout 49/18
115 Spain -- West coast -- Vigo — Directions; light buoy 06/19
250 Portugal -- Arquipélago dos Açores -- Ilha de São Jorge — Directions; major light 03/19
250 Arquipélago dos Açores – Canal de São Jorge — Traffic regulations 36/18
251 Portugal -- Arquipélago dos Açores -- Ilha de São Jorge — Directions; major light 03/19
251 Arquipélago dos Açores – Canal de São Jorge -- Porto das Velas — Anchorage 36/18
4.48 Wk13/19
IV
Weekly
NP no Page(s) Title Edition
68 East Coast of the 16th Edition (2018) 16/18
United States 1
60 Maine – Frenchman Bay – Bar Harbor — Wreck 12/19
108 New Hampshire -- Portsmouth — Vertical and horizontal clearances 43/18
118 Massachusetts -- Approaches to Salem Harbour — Depths 29/18
143 Massachusetts -- Nantucket Sound -- Martha’s Vineyard — Wreck 40/18
184 Connecticut -- Long Island Sound -- New Haven Harbor — Bridge clearance 21/18
208 New York -- Ambrose Channel -- Gravesend Bay — Anchorage; wrecks 10/19
210 New York -- Upper Bay -- Anchorage Channel — Anchorages; obstructions 10/19
215 East coast -- New Jersey -- Port Elizabeth — Berths 27/18
69 East Coast of the 14th Edition (2017) 38/17
United States 2
78 Delaware River -- Marcus Hook — Anchorage; obstruction 15/18
82 New Jersey -- Delaware River -- Gloucester City — Obstruction 09/18
88 New Jersey -- Delaware River -- Whitehill Range — Leading lights 45/17
91 Chesapeake Bay entrance -- Cape Charles — Lighthouse 10/19
93 Chesapeake Bay entrance -- Cape Charles — Lighthouse 10/19
95 Chesapeake Bay entrance -- Cape Charles — Lighthouse 10/19
96 Chesapeake Bay entrance -- Cape Charles — Lighthouse 10/19
97 Chesapeake Bay entrance -- Cape Charles — Lighthouse 10/19
98 Chesapeake Bay entrance -- Cape Charles — Lighthouse 10/19
100 Chesapeake Bay entrance -- Cape Charles — Lighthouse 10/19
114 Chesapeake Bay entrance -- Cape Charles — Lighthouse 10/19
116 Chesapeake Bay entrance -- Cape Charles — Lighthouse 10/19
142 Chesapeake Bay -- Choptank River -- Cambridge — Directions; leading lights 51/18
169 Chesapeake Bay entrance -- Cape Charles — Lighthouse 10/19
169--170 North Carolina -- East of Pamlico Sound -- Wimble Shoals — Directions; wreck 30/18
182 South Carolina -- Long Bay — Directions; wrecks 26/18
184 North Carolina -- Willmington -- Smith Island — Directions; leading lights 40/18
208 South Carolina -- Port Royal Sound — Limiting conditions; depths 43/18
225 St Marys Entrance — Pilot boarding position 39/17
225 Georgia -- Saint Marys Entrance — Restricted area 45/17
69A East coasts of Central 7th Edition (2015) 22/15
America and Gulf of
Mexico
6 Mexico — National regulations 42/18
78 Costa Rica – Puerto Moín — Directions; buoy 17/16
78 Costa Rica – Puerto Moín — Directions; buoys; lights 51/16
98 Honduras – Puerto Cortés — Arrival information; prohibited anchorage 44/15
128 Mexico -- Bay of Campeche — Anchorages 32/17
129 Mexico -- East coast -- Progreso to Punta Boxcohuo — Directions 50/18
131 Mexico -- Bay of Campeche -- Dos Bocas — Anchorage 32/17
131 Mexico -- East coast -- Dos Bocas Terminal — National regulations 42/18
131 Mexico -- East coast -- Dos Bocas — Directions; light 34/18
132, 133 Mexico – Coatzacoalcos – Tonalá — Directions; major light 52/16
134 Mexico -- Coatzacoalcos — Anchorage; obstruction 09/18
141 Mexico – Approaches to Tuxpan — Directions; landfall buoy 06/17
142 Mexico – Tuxpan — Arrival information; Traffic regulations 37/15
143 Mexico – Tuxpan approaches — General information; Traffic regulations 37/15
144 Mexico -- East coast -- Approaches to Tuxpan — Directions; reef 29/19
149 Mexico – Tampico to Río Grande -- Laguna Madre — Directions; lights 10/17
Wk13/19 4.49
IV
Weekly
NP no Page(s) Title Edition
149 Mexico -- Gulf of Mexico -- East--north--east of Punta Piedra — Prohibited area 44/18
150 Mexico -- Gulf of Mexico -- East--north--east of Punta Piedra — Prohibited area 44/18
150 Mexico -- East coast -- Altamira Industrial Port — Arrival information 29/19
154 Approaches to Aransas Pass — Directions; AIS 52/15
154 United States of America -- Gulf of Mexico -- Port Mansfield Channel — Directions; 34/18
wrecks
155 United States of America -- Gulf of Mexico -- Port Brownsville — Wreck 50/17
155 United States of America -- Gulf of Mexico -- Port Brownsville — Caution; wrecks 34/18
158 Approaches to Corpus Christi — Directions; AIS 52/15
161 United Staes of America -- Corpus Christi -- La Quinta — Directions; leading lights 47/18
161 United States of America -- Corpus Christi -- La Quinta — Directions; lights 01/19
164, 167 Approaches to Freeport — Directions; AIS 52/15
170 Approaches to Galveston Bay — Directions; AIS 52/15
171 Galveston Bay — Directions; AIS 52/15
172 United States of America -- Gulf of Mexico -- Galveston — Anchorages 47/18
173 United States of America -- Galveston -- Galveston Channel — Projected depths 24/18
175 United States of America -- Texas -- Bayport — Directions; lights 28/18
177 United States of America -- Houston — Fred Hartman Bridge 23/15
178 United States of America -- Gulf Coast -- Houston — Directions; wreck 51/17
183 United States of America -- Galveston Approaches to Sabine Pass Approaches -- 22/17
Port Arthur — Natural conditions; current
188 United States of America – Lake Charles — Limiting conditions; road bridge vertical 21/16
clearance
194 United States of America -- Gulf of Mexico — Directions; major light 23/15
202 United States of America -- Mississippi River -- New Orleans — Directions; other aids 18/17
to navigation; AIS
202 United States of America -- New Orleans — Wreck 19/18
217, 218 United States of America -- Tampa Bay — Directions; AIS 23/15
218 United States of America -- Tampa Bay — Directions; AIS 01/16
218 United States of America -- Tampa Bay — Directions; AIS 07/16
224 United States of America -- Tampa Bay -- Weedon Island Terminal — 31/17
Directions; lights; buoyage
229 United States of America -- Tampa Bay -- East Tampa -- Big Bend — Depths 37/18
230 United States of America – Big Bend — Berth; obstruction 43/15
238 Cape San Blas to Pensacola — Directions; AIS 52/15
240 Approaches to Panama City — Directions; AIS 52/15
243 United States of America -- Gulf of Mexico -- Pensacola — Development 22/18
246 Pensacola to Mobile Bay — Directions; AIS 52/15
251 United States of America -- Mississippi Sound-- Pascagoula — Restricted area 47/17
70 West Indies 1 7th Edition (2018) 46/18
6 Dominican Republic — Marine reserve 09/19
79 Dominican Republic — Marine reserve 09/19
119 United States of America -- Straits of Florida -- Through route — Data collecting buoy 09/19
123 United States of America -- East coast -- Florida -- Port Canaveral — Depths 49/18
124 United States of America -- East coast -- Florida -- Port Canaveral — Traffic 49/18
Regulations
125 United States of America -- East coast -- Florida -- Port Canaveral — General layout; 49/18
directions; basins
125 United States -- East coast -- Florida -- Port Canaveral — Basins and berths 06/19
125--126 United States -- East coast -- Florida -- Port Canaveral — Basins and berths 06/19
147 Dominican Republic — Marine reserve 09/19
148 Dominican Republic — Marine reserve 09/19
4.50 Wk13/19
IV
Weekly
NP no Page(s) Title Edition
149 Dominican Republic — Marine reserve 09/19
150 Dominican Republic — Marine reservec 09/19
155 Dominican Republic — Marine reserve 09/19
185 Dominican Republic — Marine reserve 09/19
187 Dominican Republic — Marine reserve 09/19
188 Dominican Republic — Marine reserve 09/19
189 Dominican Republic — Marine reserve 09/19
196 Dominican Republic — Marine reserve 09/19
197 Dominican Republic — Marine reserve 09/19
199 Dominican Republic — Marine reserve 09/19
255 Jamaica -- Portland Bight -- Approaches to Port Esquivel — Directions 12/19
256 Jamaica -- South coast -- Portland Bight — Old Harbour LNG Terminal 49/18
256 Jamaica -- Portland Bight; Approaches to Port Esquivel — Terminal name 12/19
257 Jamaica -- South Coast -- Portland Bight — Anchorage 49/18
261 Cayman Islands — Restricted marine areas and marine parks 03/19
71 West Indies 2 18th Edition (2017) 18/17
7 Dominican Republic — Marine reserve 09/19
62 Anguilla -- Sombrero Island — Directions; light 16/18
68 Dominican Republic -- South coast -- Punta Palmillas to Bayahibe — Anchorage; 09/19
marine reserve
90 Virgin Islands -- The Narrows — Directions; depths 40/17
96 Virgin Islands -- Tortola -- Road Harbour — Alongside berths 18/17
111 Virgin Islands -- Saint Croix -- Hams Bluff — Directions; light 44/17
115 Virgin Islands -- Saint Croix -- Hams Bluff — Light 44/17
139 Puerto Rico -- West coast -- Bahía de Mayagüez — Directions; obstruction 09/19
179 Saint Barthélémy -- Baie de Saint--Jean — Restricted area 11/19
181 Anguilla -- Seal Island — Directions; depth 16/18
182 Anguilla -- Crocus Bay — Wreck; depth 16/18
231 Guadeloupe -- Basse--Terre — Marine reserve; prohibited anchorage 44/18
236 Guadeloupe -- Grand Terre -- Le Moule — Outer anchorage; depths; bearings 11/18
236--237 Guadeloupe -- Grand Terre -- Le Moule — Directions; position; bearings 11/18
242 Guadeloupe -- Pointe de Folle Anse — Berths 40/18
244 Guadeloupe -- Pointe--à--Pitre — Alongside berths 52/17
253 Martinique — Regulations 01/19
255 Martinique -- Rade de Saint--Pierre — Prohibited area; anchorages 01/19
256 Martinique -- Baie de Fort--de--France — Outer anchorages 01/19
256 Martinique -- Baie de Fort--de--France — Pilotage 34/18
258 Martinique -- Pointe du Bout — Anchorages 01/19
259 Martinique -- Mouillage des Trois Îlets — Anchorage 01/19
261 Martinique -- Sainte--Luce — Restricted area 30/17
262 Martinique – Culde--de--Sac du Marin — Directions for entering harbour; channels 23/17
262 Martinique -- Cul--de--Sac du Marin and Anse d’Arlets — Anchorages 01/19
262 Martinique -- Sainte--Luce — Anchorage 30/17
265 Martinique -- Havre de la Trinité — Anchorages 01/19
266 Martinique -- Havre du Robert — Anchorages 01/19
267 Martinique -- Îlet Long — Anchorages 01/19
268 Martinique -- Baie du Vauclin — Directions; anchorages 01/19
276 Saint Lucia -- Laborie Bay — Directions; rock 44/18
277 Saint Lucia -- Laborie Bay — Rock 44/18
299 The Grenadines -- Carriacou and Grenada -- Northen channel — Directions; rock 18/17
Wk13/19 4.51
IV
Weekly
NP no Page(s) Title Edition
299 The Grenadines -- Ronde Island — Directions; rock; depths 45/18
300 The Grenadines -- Carriacou -- Southwest Point — Directions; rock 45/18
302 The Grenadines -- Carriacou -- Hillsborough Bay — Directions; depth 19/18
307 Grenada -- South Coast -- Woburn Bay — Prohibited area 18/18
307 Grenada -- South Coast -- Prickly Bay — Depths 18/18
308 Grenada -- West coast -- Beauséjour Bay — Marine Protected Area 14/18
309 Grenada -- Saint George’s Harbour — Depth 18/18
309 Grenada -- Saint George’s Harbour — Anchorages 13/18
310 Grenada -- Saint George’s Harbour — Pilotage; landmark; light 13/18
310 Grenada -- West Coast -- Grande Anse Bay — Prohibited area 18/18
310 Grenada -- Saint George’s Harbour — Pilotage; landmark; light 13/18
327 -- 328 Barbados -- Bridgetown — Obstruction; depth 44/17
368 Appendix IX 01/19
72 Southern Barents Sea 3rd Edition (2014) 38/14
and Beloye More
78 Kol’skiy Zaliv – Murmansk — Pilotage 41/14
85 Murmanskiy Bereg – Guba Belokamennaya — Directions; cargo transhipment area 42/16
86 Murmanskiy Bereg – Port Murmansk — Arrival information; prohibited anchorage 10/15
87 Port Murmansk -- Tri Ruch’ya -- Mys Lagernyy — Leading lights 03/16
91 Motovskiy Zaliv – Guba Kislukha — Useful mark 39/15
91 Motovskiy Zaliv – Guba Titovka — Beacon 39/15
91 Motovskiy Zaliv – Guba Titovka — Useful mark 39/15
108,112 Barents Sea -- Beloye More Northern Part — Konushinskiy light 07/17
112 Beloye More -- Mys Bol’shoy Gorodetskiy to Mys Ostraya Ludka — Directions; 06/19
wrecks
114 Beloye More -- Proliv Orlovskaya Salma — Directions; wreck 06/19
115 Barents Sea -- Beloye More Northern Part — Konushinskiy light 07/17
122 Barents Sea -- Beloye More -- Gorlo -- Ostrov Danilov — Directions; wreck 50/17
140 Arkhangel’sk to Mys Gorbolukskiy — Anchorages and harbours; useful mark 49/16
140 Beloye More – Arkhangel’sk to Mys Gorbolukskiy – Unskaya Guba — Unskiy 16/17
Severnyy Leading lights
143 Proliv Vostochnaya Solovetskaya Salma — Directions; light 49/16
148 Proliv Zapadnaya Solovetskya Salma — Ports and anchorages; light; beacons 49/16
148 Proliv Zapadnaya Solovetskaya Salma – Port Belomorsk — Leading lights 16/17
149 Beloye More, Inner Basin – Onezhskiy Zaliv – Approaches to Port Onega — 16/15
Topography; beacon
150 Approaches to Port Onega — Directions; beacon; light 49/16
151 Beloye More – Approaches to Port Onega — Directions; buoyage 44/14
151 Beloye More, Inner Basin – Onezhskiy Zaliv – Approaches to Port Onega — 16/15
Directions; useful mark
160 Kandalakshskiy Zaliv -- Guba Pon’goma —Directions; leading lights; beacon 49/16
163 Kandalakshskiy Zaliv -- Guba Kovda — Directions; leading lights 49/16
168 Beloye More -- Kandalakshskaya Guba -- Port Vitino approaches — Directions; 35/18
leading lights
183 Pechorskaya Guba to Proliv Yugorskiy Shar – Oil and gas offshore fields – 46/14
Prirazlomnaya platform — Safety zone
4.52 Wk13/19
V
NP74, Vol A Edition 2018/19. Weekly Edition No. 13, Dated 28 March 2019.
Last Updates: Weekly Edition No. 12, dated 21 March 2019.
A3980·5 - River Creed Estuary 58 12·00 N Iso WRG 10s 24 5 Metal post G277°-282°(5°), W282°-290°(8°),
6 23·54 W R290°-295°(5°).
TE; replaced by Fl(2)R 10s 2M (T)
2019
*
A5850 - Wicklow Head 52 57·93 N Fl(3)W 15s 37 18 White tower (fl 0·1, ec 2·4) x 2, fl 0·1, ec 9·9
(IE:CIL) 5 59·93 W 14
-- .. AIS .. .. .. MMSI No 992501031
*
NP75, Vol B Edition 2018/19. Weekly Edition No. 13, Dated 28 March 2019.
Last Updates: Weekly Edition No. 12, dated 21 March 2019.
B1049·4 - NW. BW 01 54 05·25 N Oc(3)Y 16s .. 5 Wind turbine Other wind turbines exist in this area,
6 24·94 E some marked by lights and fog signals
--- .. AIS .. .. .. MMSI No 992111911
* * * * * * * *
B2397·4 - Høvikodden. Ldg Lts 59 53·29 N Iso W 2s 8 0·5 Post Private. Seasonal
NO, , 021170 012·2°. Front 10 33·06 E 7
*
5.1 Wk13/19
V
B2397·41 - Høvikodden. Ldg Lts 59 53·31 N Iso W 2s 10 0·5 Post Private. Seasonal
NO, , 021190 012·2°. Rear 10 33·07 E 2
*
5.2 Wk13/19
V
B2802 - Merdøy. W Point. Ldg Lts 58 25·42 N Oc WRG 6s 2 W6·1 Post R315·5°-347·2°(31·7°),
NO, , 061600 340·7°. Front 8 47·48 E R4·3 3 G347·2°-033·5°(46·3°),
G 4 W033·5°-034·9°(1·4°),
R034·9°-151·6°(116·7°),
G151·6°-177°(25·4°)
* * * *
RYFYLKEFJORDANE. FØRLANDSFJORD
B3407 - Lamholmflua 59 18·51 N Iso W 4s 4 3·3 Post Floodlit
NO, , 118286 5 27·65 E 9
* * * *
RYFYLKEFJORDANE. FØRLANDSFJORD
B3410 Remove from list; deleted
5.3 Wk13/19
V
NP76, Vol C Edition 2018/19. Weekly Edition No. 13, Dated 28 March 2019.
Last Updates: Weekly Edition No. 12, dated 21 March 2019.
C4164 - Rapankari. Dir Lt 353·2° 65 06·08 N Dir Q W 5 5·8 White U, red stripe
FI, , 8999 25 21·41 E
* * *
NP77, Vol D Edition 2018/19. Weekly Edition No. 13, Dated 28 March 2019.
Last Updates: Weekly Edition No. 12, dated 21 March 2019.
NP78, Vol E Edition 2018/19. Weekly Edition No. 13, Dated 28 March 2019.
Last Updates: Weekly Edition No. 12, dated 21 March 2019.
5.4 Wk13/19
V
E0164 Costa Blanca. Yacht Club 38 21·66 N Fl(3)G 9s 6 3 Green and white (fl 0·5, ec 1·5) x 2, fl 0·5, ec 4·5
ES, II, 24680 (Albufereta). Breakwater. 0 26·42 W round column on
Head green base
3
* * *
E0164·2 Costa Blanca. Yacht Club 38 21·67 N Fl(3)R 9s 5 1 Red and white round (fl 0·5, ec 1·5) x 2, fl 0·5, ec 4·5
ES, II, 24682 (Albufereta). Outer 0 26·42 W column on red base
Breakwater. Head 4
* * *
E0168 Puerto de Villajoyosa. E 38 30·34 N Fl(3)G 9s 14 5 Green 4-sided tower (fl 0·5, ec 1·5) x 2, fl 0·5, ec 4·5
ES, II, 24750 Breakwater. Head 0 13·22 W 7
* * *
E0168·5 Puerto de Villajoyosa. 38 30·41 N Fl(3)R 9s 8 3 Red 4-sided tower (fl 0·5, ec 1·5) x 2, fl 0·5, ec 4·5
ES, II, 24745 Breakwater. Head 0 13·29 W 7
* * *
E0169 Puerto de Villajoyosa. W 38 30·45 N Fl(4)R 11s 7 1 Red & on red 8-sided (fl 0·5, ec 1·5) x 3, fl 0·5, ec 4·5
ES, II, 24760 Breakwater. Head 0 13·17 W tower
6
* * *
E0231·6 Cabo de Irta 40 15·63 N Fl(4)W 18s 33 14 White square tower (fl 0·2, ec 2·3) x 3, fl 0·2, ec 10·3.
ES, II, 27140 0 18·13 E 28 W195°-057°(222°).
Range 10M (T) 2019
*
ZALIV TRAŠTE
E3683·8 - Lustica Marina. N 42 23·09 N Fl(2)G 3s 12 6 Green % on green
Breakwater 18 39·84 E mast
* * * * * * * *
5.5 Wk13/19
V
* * * * *
ÎLE DE LA GALITE
E6464 - Galiton de l'Ouest 37 29·89 N Fl(4)W 20s 168 24 Black tower, cupola, (fl 0·4, ec 2·9) x 3, fl 0·4, ec 9·7.
TN, , 0100 8 52·52 E on grey building Obscured 227°-250°(23°) by Île de la
TN, , 0110 14 Galite.
May appear as Fl(2)W 20s at a
distance. F W (T) 2019
- - Auxiliary light .. FR 160 22 . . R064°-069°(5°) over Les Sorelles
*
NP79, Vol F Edition 2018/19. Weekly Edition No. 13, Dated 28 March 2019.
Last Updates: Weekly Edition No. 12, dated 21 March 2019.
NP80, Vol G Edition 2018/19. Weekly Edition No. 13, Dated 28 March 2019.
Last Updates: Weekly Edition No. 12, dated 21 March 2019.
5.6 Wk13/19
V
NP82, Vol J Edition 2018/19. Weekly Edition No. 13, Dated 28 March 2019.
Last Updates: Weekly Edition No. 12, dated 21 March 2019.
NECHES RIVER
J4025·35 Remove from list; replaced by 2 light-buoys
5.7 Wk13/19
V
DEMERARA RIVER
J6841 - Georgetown. Lighthouse 6 49·42 N Fl WR 60s 31 16 White 16-sided W040°-189°(149°),
GY, , C23 58 09·86 W tower, red stripes R275°-040°(125°), W200°-275°(75°).
30 Obscured by buildings 189°-200°(11°)
*
DEMERARA RIVER
J6847 Remove from list; deleted
DEMERARA RIVER
J6847·1 Remove from list; deleted
5.8 Wk13/19
V
NP83, Vol K Edition 2019/20. Weekly Edition No. 13, Dated 28 March 2019.
Last Updates: Weekly Edition No. 12, dated 21 March 2019.
ATOLL DE TIKEHAU
K4997 - Passe Tuheiava. Ldg Lts 15 01·60 S Iso R 4s 8 6 Red and white
FR, LC, 55000 127·5°. Front 148 15·26 W column
(FR) 9
* *
K4997·1 - Passe Tuheiava. Ldg Lts 15 01·63 S Iso R 4s 14 6 Red and white
FR, LC, 55001 127·5°. Rear. 75m from front 148 15·23 W column
(FR) 14
* *
NP84, Vol L Edition 2019/20. Weekly Edition No. 13, Dated 28 March 2019.
Last Updates: Weekly Edition No. 12, dated 21 March 2019.
GRUNNEFJORDEN
L0907·8 - Matlausdjupet. Kvitskjær 62 47·74 N Oc(2)WRG 8s 6 W5·4 Column R203°-219°(16°),
NO, , 352200 6 43·40 E R3·7 6 G219°-250·5°(31·5°),
G3·4 W250·5°-256·5°(6°),
R256·5°-342·5°(86°),
G342·5°-033°(50·5°),
W033°-054°(21°),
R054°-073·5°(19·5°),
G073·5°-108·5°(35°),
W108·5°-126·5°(18°),
R126·5°-157°(30·5°)
*
ONA
L0913 - Rugskjeret 62 50·83 N Iso WRG 6s 8 W3·4 Column R065°-104°(39°),
NO, , 353100 6 32·43 E R2·2 9 G104°-234·5°(130·5°),
G 2 W234·5°-245·5°(11°),
R245·5°-325·5°(80°),
G325·5°-012°(46·5°),
W012°-023°(11°), R023°-038°(15°),
G038°-055·5°(17·5°),
W055·5°-065°(9·5°)
*
L0915·1 - Ldg Lts 319°. Rear. 62 51·99 N Oc WRG 6s 11 W5·9 Cairn G072·5°-099·5°(27°),
NO, , 353600 Tvinitla 6 32·92 E R4·1 6 W099·5°-102·5°(3°),
G3·8 R102·5°-130°(27·5°),
G130°-243·5°(113·5°),
W243·5°-249°(5·5°),
R249°-259·5°(10·5°),
G259·5°-289°(29·5°),
W289°-291·5°(2·5°),
R291·5°-319·5°(28°),
G319·5°-337°(17·5°)
*
L0918 - Moøy. E Side. Bjørnsund 62 53·74 N Oc(2)WRG 8s 26 W12 Tower G052°-062°(10°), W062°-069°(7°),
NO, , 355000 6 48·95 E R9·1 9 R069°-099°(30°), G099°-138°(39°),
G8·6 W138°-161·5°(23·5°),
R161·5°-164·5°(3°),
G164·5°-176·5°(12°),
W176·5°-191°(14·5°),
R191°-200°(9°), G200°-212°(12°),
R212°-241°(29°), G241°-265°(24°)
---- .. Racon .. .. .. ALRS Vol 2 Station 65415
*
5.9 Wk13/19
V
ROMSDALSFJORD
L0970 - Helgestøneset 62 36·45 N Oc WRG 6s 6 W 9 Pile G110°-113°(3°), W113°-127°(14°),
NO, , 364500 7 21·57 E R 7 3 R127°-195°(68°), W195°-212°(17°),
G 7 G212°-310°(98°), W310°-328°(18°),
R328°-336°(8°).
Sectors to be amended (P) 2019
*
5.10 Wk13/19
V
L1076 - Halsafjorden. Saksnes 63 01·72 N Oc(3)WRG 12s 5 W7·4 Post G304°-313°(9°), W313°-320°(7°),
NO, , 384600 8 13·18 E R5·4 3 R320°-331°(11°), G331°-121°(150°),
G5·1 R121°-147·5°(26·5°),
W147·5°-157°(9·5°), G157°-161°(4°),
R161°-163°(2°).
Sectors to be amended (P) 2019
*
NORDMØREFJORDENE
L1086 - Stangvikfjord. Røkkem 62 52·68 N Oc(3)WRG 10s 4 W5·2 Post G129°-133°(4°), W133°-151°(18°),
NO, , 386200 8 29·44 E R3·6 3 R151°-155°(4°), G155°-246°(91°),
G3·3 W246°-254°(8°), R254°-271°(17°),
W271°-281°(10°), G281°-309°(28°).
Sectors to be amended (P) 2019
*
ALTAFJORD
L3911 Remove from list; deleted
NP85, Vol M Edition 2018/19. Weekly Edition No. 13, Dated 28 March 2019.
Last Updates: Weekly Edition No. 12, dated 21 March 2019.
M4180·2 - Araseohae. Lock. W End. S 37 33·60 N Fl Y 4s 6 3 Yellow round metal Entrance to locks controlled by F RG
KR, 410, 3805 Lock. C, D 126 36·10 E tower lights. Arabaetgil channel E marked
KR, 410, 3806 3 by Fl G 4s and Fl R 4s lights
*
5.11 Wk13/19
V
M4206·6 - Sangwangdeungdo. Summit 35 39·73 N Fl W 5s 175 12 White round concrete Range 10M (T) 2019
KR, 410, 3148 126 06·42 E tower
KR, 410, 4601·4 4
--- .. AIS .. .. .. MMSI No 994403654
*
AMAKUSA-SHIMO SHIMA
M5108 - Ushibuka Ko. Bora Yama. 32 11·48 N Fl(2)W 7s 84 7 White round concrete 2 fl in 3s
JP, 411, 6480 Summit 130 01·17 E tower
10
* *
5.12 Wk13/19
V
M7489 - Mys Maksimova 43 08·06 N Iso W 6s 37 9 White 4-sided stone Range 6M (T) 2019
RU, 2401, 337 132 19·60 E tower, red band
8
*
M7490·1 - Bukhta Bol'shoy Kamen. 43 06·41 N FR 107 10 White 8-sided Vis 60° each side of leading line.
RU, 2401, 341·1 Ldg Lts 124°54′. Rear. 132 21·78 E masonry tower, black TE 2019
0·65M from front stripe
13
- - - - - Reserve light .. .. .. 7 .. Vis 3·25° each side of leading line
*
M7492·1 - Bukhta Bol'shoy Kamen. S 43 07·57 N Fl G 5s 9 1 Green round metal Fl(2)G 5s 1M (T) 2019
RU, 2401, 341·4 Breakwater. Head 132 19·40 E tower, white band,
with platform
8
*
PORT NEVEL'SK
M7776 - N Breakwater. S End 46 40·07 N Fl R 3s 5 3 Red metal framework TE 2019
RU, 2401, 1150 141 50·90 E pyramid
2
*
NP86, Vol N Edition 2018/19. Weekly Edition No. 13, Dated 28 March 2019.
Last Updates: Weekly Edition No. 12, dated 21 March 2019.
NP88, Vol Q Edition 2019/20. Weekly Edition No. 13, Dated 28 March 2019.
Last Updates: Weekly Edition No. 12, dated 21 March 2019.
5.13 Wk13/19
VI
5(
UPDATES TO ADMIRALTY
4/# 3$23. LIST OF RADIO
#,(1 +38+(23.%1 SIGNALS
#(.2(&- +2
Weekly Edition No. 13 dated 28 March 2019
6DDJKX$CHSHNM-N
C@SDC,@QBG
The ADMIRALTY
3GD List of Radio Signals diagrams included in the paper version of the weekly Notice to Mariners (Section
#,(1 +38+HRSNE1@CHN2HFM@KRCH@FQ@LRHMBKTCDCHMSGDO@ODQUDQRHNMNESGDVDDJKX-NSHBDSN,@QHMDQR2DBSHNM
VI) @QDOQHMSDCHMAK@BJ@MCVGHSD
(EQDPTHQDC@BNKNTQUDQRHNMNESGDRDCH@FQ@LRB@MADCNVMKN@CDCEQNL
5( are printed in black and white. If required, a colour version of these diagrams can be downloaded from
www.admiralty.co.uk/maritime-safety-information. To obtain the colour versions select View and download NMs – select
VVV
@CLHQ@KSX
BN
TJL@QHSHLDR@EDSXHMENQL@SHNM
3NNAS@HMSGDBNKNTQUDQRHNMRRDKDBS5HDV@MCCNVMKN@C-,RȋRDKDBS
Weekly – select Year – select Week – go to Selected Week Content – select File (for example:
6DDJKXȋRDKDBS8D@QȋRDKDBS6DDJȋFNSN2DKDBSDC6DDJ"NMSDMSȋRDKDBS%HKDENQDW@LOKD
NP286(3)–WK01–14–PAGE149_Week01_2018.pdf)
-/ȋ6*ȋȋ/ &$>6DDJ>
OCE
MARITIME RADIO
, 1(3(,$1 STATIONS
#(.23 3(.-2
OOSTENDE (OSU)
Control Centre: 51°14′·03N 2°55′·75E MMSI 002050480 DSC VHF MF OBS Diagram page 49
Telephone: +32 59 342493 Fax: +32 59 342467
Call: Oostende Radio Email: rmd@mil.be
NOTE(S): 1. DSC VHF Ch 70 operates from remote locations at Middelkerke, Zeebrugge and Antwerpen.
2. When traffic is on hand, the ship will be called on DSC.
ANTI-PIRACY
Wk13/19
6.1
6.1
(MRDQS
2@HMS*HKC@
ANTI-PIRACY Contact Table (Part 1)
Wk13/19
This Table will be amended
ANTI-PIRACY Contact by Notices to Mariners
when necessary Table (Part 1)
This Table will be amended when necessary by Notices to Mariners
UK Maritime Trade The IMB Anti-Piracy NCAGS Detachment
Authority EU NAVFOR (MSC-HOA) NATO Shipping Centre
Operations (MTO) Reporting Centre Bahrain
UK Maritime Trade The IMB Anti-Piracy NCAGS Detachment
Authority Maritime Trade Information Centre EU NAVFOR
European (MSC-HOA)
Union Naval Force ICC International Maritime Bureau NATO
Atlantic Shipping Centre
Building Naval Cooperation and
Operations (MTO) Reporting Centre Bahrain
UKMTO Operation Atalanta Piracy Reporting Centre Northwood Headquarters Guidance for Shipping (NCAGS)
MCSU, PtP
Maritime Trade Information Centre EU OHQ Union Naval Force
European P.O.Box
ICC International
12559 Maritime Bureau Sandy Lane
Atlantic Building CTF-55
Naval Cooperation
NCAGS and
QenetiQ
UKMTO Site Rota
Operation Station
NavalAtalanta 50782 Kuala Lumpur
Piracy Reporting Centre Middlesex,
Northwood HA63HP
Headquarters PSC 851 Box
Guidance 190
for Shipping (NCAGS)
Southwick
MCSU, PtPHill Road Rota
EU OHQ Malaysia
P.O.Box 12559 United Kingdom
Sandy Lane FPO
CTF-55 09834
AENCAGS
Address Portsmouth
QenetiQ Site Cádiz, 11530
Rota Naval Station 50782 Kuala Lumpur Middlesex, HA63HP PSC 851 Box 190
PO9
Southwick
3RU Hill Road Spain
Rota Malaysia United Kingdom FPO AE 09834
Address UKMTO Dubai
Portsmouth Cádiz, 11530
PO9 Embassy
British3RU Spain
mț̦-mț̦6
Dubai
UKMTO Dubai
65
PO BoxEmbassy
British
Red
DubaiSea & Gulf of Aden Red Sea & Gulf of Aden Worldwide Red Sea & Gulf of Aden US Navy
-NQSGDQM+HFGSGNTRD!N@QCBNQQDRONMCDMBD12#1
Region Arabian
PO Box Sea
65 & Somali Basin Arabian Sea & Somalia Basin Arabian Sea & Somali Basin Fifth Fleet Area of Responsibility
Covered of Oman Gulf of Oman
ANTI-PIRACY
Gulf Sea
Red & Gulf of Aden Red Sea & Gulf of Aden Worldwide Red Sea & Gulf of Aden US Navy
5(
VI
6.2
Region Persian
Arabian Gulf
Sea & Somali Basin Arabian Sea & Somalia Basin Arabian Sea & Somali Basin Fifth Fleet Area of Responsibility
Covered
Tel: of +44
Gulf Oman2392 222060 Tel: +33 298 220220 (MSC-HOA) Tel: +603 2031 0014 (H24) Tel: +44
Gulf of 1923 956574
Oman Tel: +973 1785 8240
ANTI-PIRACY
Persian+44
Gulf971 50 552 3215 +33 298 220170 (MSC-HOA) (Watchkeepers)
/TAKHRGDC6J
Emergency Tel: Officer
+44 in Charge
2392 222060 (OiC) Tel: +34 956470533
+33 298 220220(EU NAVFOR)
(MSC-HOA) Tel: +603 2031 0014 (H24) Tel: +44 1923 956574 Tel: +973 1785 8240
%HQRSTOC@SDRHM6J
Reporting +44
+971971
50 50 3983
559552 3215 +33 298 220170 (MSC-HOA) (Watchkeepers)
UKMTO
Officer inDubai
Charge (OiC) +34 956470533 (EU NAVFOR)
Emergency +971
Reporting +971 50
50 552
559 6007
3983
Deputy (OiC)
UKMTO Dubai
1D@K
imbkl@icc-ccs.org cusnc.bwc@me.navy.mil
dcancan@fn.mde.es (EU NAVFOR)
dcanovasc@gmail.com (EU NAVFOR) Tel: +603 2078 5763 Tel: +973 1785 1023
Helplines
e--mail: imbsecurity@icc--ccs.org
www.mschoa.org (MSC-HOA) Tel: +603 2078 5763 Tel: +973 1785 1023
Website
Helplines www.ukmto.org www.icc-ccs.org www.shipping.nato.int
www.eunavfor.eu (EU NAVFOR) e--mail: imbsecurity@icc--ccs.org
ANTI-PIRACY
6.3
6.3 Wk13/19
(MRDQS
2@HMS*HKC@
ANTI-PIRACY Contact Table (Part 1)
Wk13/19
This Table will be amended
ANTI-PIRACY Contact by Notices to Mariners
when necessary Table (Part 1)
This Table will be amended when necessary by Notices to Mariners
UK Maritime Trade The IMB Anti-Piracy NCAGS Detachment
Authority EU NAVFOR (MSC-HOA) NATO Shipping Centre
Operations (MTO) Reporting Centre Bahrain
UK Maritime Trade The IMB Anti-Piracy NCAGS Detachment
Authority Maritime Trade Information Centre EU NAVFOR
European (MSC-HOA)
Union Naval Force ICC International Maritime Bureau NATO
Atlantic Shipping Centre
Building Naval Cooperation and
Operations (MTO) Reporting Centre Bahrain
UKMTO Operation Atalanta Piracy Reporting Centre Northwood Headquarters Guidance for Shipping (NCAGS)
MCSU, PtP
Maritime Trade Information Centre EU OHQ Union Naval Force
European P.O.Box
ICC International
12559 Maritime Bureau Sandy Lane
Atlantic Building CTF-55
Naval Cooperation
NCAGS and
QenetiQ
UKMTO Site Rota
Operation Station
NavalAtalanta 50782 Kuala Lumpur
Piracy Reporting Centre Middlesex,
Northwood HA63HP
Headquarters PSC 851 Box
Guidance 190
for Shipping (NCAGS)
Southwick
MCSU, PtPHill Road Rota
EU OHQ Malaysia
P.O.Box 12559 United Kingdom
Sandy Lane FPO
CTF-55 09834
AENCAGS
Address Portsmouth
QenetiQ Site Cádiz, 11530
Rota Naval Station 50782 Kuala Lumpur Middlesex, HA63HP PSC 851 Box 190
PO9
Southwick
3RU Hill Road Spain
Rota Malaysia United Kingdom FPO AE 09834
Address UKMTO Dubai
Portsmouth Cádiz, 11530
PO9 Embassy
British3RU Spain
mț̦-mț̦6
Dubai
UKMTO Dubai
65
PO BoxEmbassy
British
Red
DubaiSea & Gulf of Aden Red Sea & Gulf of Aden Worldwide Red Sea & Gulf of Aden US Navy
-NQSGDQM+HFGSGNTRD!N@QCBNQQDRONMCDMBD12#1
Region Arabian
PO Box Sea
65 & Somali Basin Arabian Sea & Somalia Basin Arabian Sea & Somali Basin Fifth Fleet Area of Responsibility
Covered of Oman Gulf of Oman
ANTI-PIRACY
Gulf Sea
Red & Gulf of Aden Red Sea & Gulf of Aden Worldwide Red Sea & Gulf of Aden US Navy
5(
VI
6.4
Region Persian
Arabian Gulf
Sea & Somali Basin Arabian Sea & Somalia Basin Arabian Sea & Somali Basin Fifth Fleet Area of Responsibility
Covered
Tel: of +44
Gulf Oman2392 222060 Tel: +33 298 220220 (MSC-HOA) Tel: +603 2031 0014 (H24) Tel: +44
Gulf of 1923 956574
Oman Tel: +973 1785 8240
ANTI-PIRACY
Persian+44
Gulf971 50 552 3215 +33 298 220170 (MSC-HOA) (Watchkeepers)
/TAKHRGDC6J
Emergency Tel: Officer
+44 in Charge
2392 222060 (OiC) Tel: +34 956470533
+33 298 220220(EU NAVFOR)
(MSC-HOA) Tel: +603 2031 0014 (H24) Tel: +44 1923 956574 Tel: +973 1785 8240
%HQRSTOC@SDRHM6J
Reporting +44
+971971
50 50 3983
559552 3215 +33 298 220170 (MSC-HOA) (Watchkeepers)
UKMTO
Officer inDubai
Charge (OiC) +34 956470533 (EU NAVFOR)
Emergency +971
Reporting +971 50
50 552
559 6007
3983
Deputy (OiC)
UKMTO Dubai
1D@K
imbkl@icc-ccs.org cusnc.bwc@me.navy.mil
dcancan@fn.mde.es (EU NAVFOR)
dcanovasc@gmail.com (EU NAVFOR) Tel: +603 2078 5763 Tel: +973 1785 1023
Helplines
e--mail: imbsecurity@icc--ccs.org
www.mschoa.org (MSC-HOA) Tel: +603 2078 5763 Tel: +973 1785 1023
Website
Helplines www.ukmto.org www.icc-ccs.org www.shipping.nato.int
www.eunavfor.eu (EU NAVFOR) e--mail: imbsecurity@icc--ccs.org
RECORD OF UPDATES
UKHO 13/19
RADAR BEACONS
PAGE 46, ANGOLA, below 73140 Saxi-Batuque Oilfield FPSO, Kizomba C Terminal.
Insert:
6.5
6.5 Wk13/19
Insert:
PAGE 90, GERMANY (North Sea Coast), below Alpha Ventus Platform.
Insert:
Bard Offshore Windfarm N 4-1 54°25′·32N 6°01′·09E 992111811 Real Continued on next page
PAGE 90, GERMANY (North Sea Coast), below DolWin Beta Platform.
Insert:
PAGE 92, GERMANY (North Sea Coast), below Meerwind M80 Windfarm.
Insert:
Wk13/19
6.7
Merkur Offshore Windfarm MO 01 54°00′·45N 6°30′·26E 992111947 Real
Continued on next page
Gow Windfarm Platform 01-ZO1 54°01′·47N 7°00′·53E 992111980 Real
PAGE 92, GERMANY (North Sea Coast), below Meerwind M80 Windfarm.
Insert: VI
Merkur Offshore Windfarm MO 04 54°01′·83N 6°30′·24E 992111948 Real Continued on next page
PAGE 92, GERMANY (North Sea Coast), below Nordegründe Wind Farm Platform NG 18.
Insert:
PAGE 122, SAUDI ARABIA (Red Sea Coast), below King Abdullah Port Pilot.
Insert:
PAGE 146, TURKEY (Marmara Denizi), below Büyük Limani Starboard Lt Buoy.
Insert:
Kepez Harbour
Neist Point Lt Lt Buoy 40°06′·49N
57°25′·39N 26°22′·86E
6°47′·33W 992711396
992351301 Real
Real 21
Turkish
NorthernNotice
Northern 4/17/19
Lighthouse
Lighthouse (RSDRA2019000034694)
Board
Board correspondence 13/19
correspondence (RSDRA2019000017589)
(RSDRA2019000017589) 13/19
13/19 VI
PAGE
PAGE 166,
166, UNITED
UNITED KINGDOM.
KINGDOM.
Neist
RubháPoint
Réidh Lt.Lt.
Delete
Delete entry
entry and
and replace
replace by:
by:
RubháPoint
Neist RéidhLtLt 57°51′·53N 6°47′·33W
57°25′·39N 5°48′·71W 992351302
992351301 Real 21
Northern
5(
Northern Lighthouse
Lighthouse Board
Board correspondence
correspondence (RSDRA2019000017589)
(RSDRA2019000017589) 13/19
13/19 6.9
Rubhá Réidh Lt
2@HMS*HKC@ 57°51′·53N 5°48′·71W
mț̦-mț̦6 992351302
Real
1D@K
-NQSGDQM+HFGSGNTRD!N@QCBNQQDRONMCDMBD12#1
Northern Lighthouse Board correspondence (RSDRA2019000017589) 13/19
6.9
1$".1#.%4/# 3$2
3GHRDCHSHNMV@ROTAKHRGDCHM6J
%HQRSTOC@SDRHRRTDCHM6J
4*'.
1 # 1!$ ".-2
"GHMDRe-NSHBD12#1
/ &$) / -
4Q@F@2THCN3Q@EEHB1NTSD+S!TNX-N
#DKDSDDMSQX
)@O@MDRD'XCQNFQ@OGHB.EEHBDBNQQDRONMCDMBD12#1
"GHMDRD-NSHBD12#1
"GHMDRD-NSHBD12#1
Wk13/19
6.10
/ &$) / -ADKNV'HAHJH2GHMJN*T%KN@SHMF6HMC3TQAHMD
(MRDQS
7HMF@MF%@MF!NCH$@RS+S!M mț̦-mț̦$ !QN@CB@RSRDUDQXLHMTSDR 1D@K
"GHMDRD-NSHBD12#1 VI
6.11
PAGE 172, KOREA, SOUTH.
Gwangyang Hang Lt Buoy No 71.
Delete entry
*NQD@M-NSHBD12#1
6.12
/ &$*.1$ 2.43'
2NQNJCN+S!M
#DKDSDDMSQX
*NQD@M-NSHBD12#1
*NQD@M-NSHBD12#1
*NQD@M-NSHBD12#1
*NQD@M-NSHBD12#1
1 #(.3(,$2(&- +2
Wk13/19
6.13
/ &$*.1$ 2.43'
4KR@M2HM'@MF2NTSG!QD@JV@SDQ-NQSG$MC+S
#DKDSDDMSQX
*NQD@M-NSHBD12#1 VI
1 #(.3(,$2(&- +2
60m 00s
59m 55s 5s
50s
10s
45s 15s
40s 20s
35s 25s
30s
Chinese Nautical Almanac B103 (RSDRA2019000022773) 13/19
30s
Chinese Nautical Almanac B103 (RSDRA2019000022773) 13/19
VI
RADIO DJIIDO
Control Centre: 22°15′·52S 166°26′·77E
Bélep 19°42′·00S 163°39′·00E
96 MHz
Bouloupari 21°51′·89S 166°03′·80E
103 MHz Bourail 21°36′·00S 165°29′·00E
Canala 21°29′·34S 165°52′·36E
102 MHz Dumbéa 22°09′·00S 166°27′·00E
Hienghène 20°42′·21S 164°57′·75E
103 MHz Houaїlou 21°16′·37S 165°36′·89E
97 MHz Île des Pins 22°35′·77S 167°27′·07E
96 MHz Kaala-Gormen 20°39′·99S 164°23′·82E
102 MHz Koné 21°03′·00S 164°52′·00E
93·7 MHz Kouaoua 21°23′·70S 165°49′·50E
103 MHz Koumac 20°32′·61S 164°15′·57E
98·5 MHz FM Lifou 21°06′·00S 167°24′·00E
97·5 MHz Maré 21°33′·00S 167°53′·00E
96 MHz Mont-Dore 22°16′·50S 166°35′·00E
97·4 MHz Nouméa 22°17′·00S 166°27′·00E
96·5 MHz Ouvéa 20°39′·00S 166°33′·00E
91·7 MHz Poindimié 20°56′·50S 165°20′·50E
Ponérihouen 21°04′·30S 165°24′·20E
97 MHz
Pouébo 20°24′·11S 164°31′·48E
102 MHz Poum 20°16′·00S 164°02′·00E
95·2 MHz VI Poya 21°21′·42S 165°10′·01E
103 MHz Thio 21°37′·00S 166°13′·00E
96 MHz Touho 20°47′·85S 165°13′·73E
NEW CALEDONIA (France)
102 MHz Yaté 22°10′·67S 166°56′·31E
RADIO DJIIDO (Continued) Diagram page 199
Weather Bulletins Continued on next page
On receipt Cyclone warnings, in French and Kanak.
0515 LT (Mon–Fri) Marine weather bulletin, in French and Kanak.
0815 LT Weather forecast, in French and Kanak. 6.15
RADIO NRJ
Control Centre: 22°16′·69S 166°26′·80E
93·5 MHz FM
Diagram page 199
Weather Bulletins
0550 1230 LT1 Meteorological bulletin “du lagon”, in French.
0630 0830 1230 LT2 Meteorological bulletin “du lagon”, in French.
0620 0720 LT1 Meteorological bulletin “général”, in French.
1710 LT1 Meteorological bulletin “général”, in Kayafou.
0720 0810 1110 LT2
Wk13/19 Meteorological bulletin “général”, in French.
1
6.16
Mon–Fri
2 Sat–Sun
PAGE 201, NEW CALEDONIA (France).
RADIO NOUVELLE-CALÉDONIE (RADIO FRANCE OUTREMER).
Delete entry
RADIO NRJ
Control Centre: 22°16′·69S 166°26′·80E
93·5 MHz FM
Diagram page 199
Weather Bulletins
0550 1230 LT1 Meteorological bulletin “du lagon”, in French.
0630 0830 1230 LT2 Meteorological bulletin “du lagon”, in French.
0620 0720 LT1 Meteorological bulletin “général”, in French.
1710 LT1 Meteorological bulletin “général”, in Kayafou.
0720 0810 1110 LT2 Meteorological bulletin “général”, in French.
1 Mon–Fri
2 Sat–Sun
RADIO OCÉANE
Control Centre: 22°16′·69S 166°26′·80E
95 MHz FM
Diagram page 199
Weather Bulletins
0605 0805 1005 1140 1615
Meteorological bulletin “général”, in French.
LT1
0835 LT1 Meteorological bulletin “du lagon”, in French.
1 Mon–Fri
6.16
Wk13/19
6.17
1 Meteorological bulletin “général”, in French.
LT
0630 0830 1230 LT2 Meteorological bulletin “du lagon”, in French.
0835 1
0620 LT
0720 LT1 Meteorological
Meteorological bulletin
bulletin “du lagon”,ininFrench.
“général”, French.
1 Mon–Fri
1710 LT1 Meteorological bulletin “général”, in Kayafou.
0720 0810 1110 LT2 Meteorological bulletin “général”, in French.
French Notice 9/2.4.3/19 (RSDRA2019000046810) 13/19
1 Mon–Fri VI
2 Sat–Sun
PAGE 201, NEW CALEDONIA (France).
RADIO
French RYTHME
Notice BLEU.
9/2.4.3/19 (RSDRA2019000046810) 13/19
Delete entry and replace by:
VI
PAGE 201, NEW CALEDONIA (France).
RADIO RYTHME
RADIO OCÉANE. BLEU (RRB)
Delete entry and replace
Control Centre: 22°16′·46S by:
166°26′·63E
NEW CALEDONIA (France)
99 MHz Bélep 19°42′·00S 163°39′·00E
RADIO OCÉANE FM
100 MHz RADIO RYTHME 21°51′·89S
Bouloupari BLEU (RRB) (Continued)
166°03′·80E
Control Centre: 22°16′·69S 166°26′·80E
99 MHz Bourail 21°36′·00S
Continued165°29′·00E
on next page
95 MHz FM
98 MHz Canala 21°29′·34S 165°52′·36E
Diagram page 199
98 MHz
Weather Bulletins Dumbéa 22°09′·00S 166°27′·00E
100·4 MHz
0605 0805 1005 1140 1615
6.16
Meteorological bulletin “général”, in French. Farino 21°40′·00S 165°46′·00E
LT1 100 MHz
0835 LT1 Meteorological bulletin “du lagon”, in French. Goro 22°17′·17S 167°00′·75E
1 Mon–Fri Hienghène 20°42′·21S 164°57′·75E
99 MHz
Houaїlou 21°16′·37S 165°36′·89E
French Notice 9/2.4.3/19 (RSDRA2019000046810) 13/19
101 MHz Île des Pins 22°35′·77S 167°27′·07E
99 MHz Kaala-Gormen 20°39′·99S 164°23′·82E
PAGE 201, NEW CALEDONIA (France).
RADIO RYTHME BLEU. 98 MHz Koné 21°03′·00S 164°52′·00E
Delete entry and replace by:
Kouaoua 21°23′·70S 165°49′·50E
99 MHz
RADIO RYTHME BLEU (RRB) Koumac 20°32′·61S 164°15′·57E
100 MHz La Foa 21°42′·50S 165°49′·50E
Control Centre: 22°16′·46S 166°26′·63E
102·5 MHz Lifou 21°05′·12S 167°12′·21E
99 MHz Bélep 19°42′·00S 163°39′·00E
101·5 MHz FM Maré 21°32′·45S 167°53′·43E
100 MHz Bouloupari 21°51′·89S 166°03′·80E
100 MHz Moindou 21°41′·50S 165°40′·50E
Continued on next page
FM
Mont-Dore 22°16′·50S 166°35′·00E
100·4 MHz
Nouméa 22°17′·00S 166°27′·00E
99 MHz Ouégoa 20°21′·00S 164°26′·00E
6.16
103·5 MHz Ouvéa 20°39′·12S 166°32′·09E
100·4 MHz Païta 22°08′·08S 166°22′·37E
100 MHz Poindimié 20°56′·50S 165°20′·50E
99 MHz Ponérihouen 21°04′·30S 165°24′·20E
100 MHz Pouébo 20°24′·11S 164°31′·48E
98 MHz Pouembout 21°07′·30S 164°54′·00E
99 MHz Poum 20°16′·00S 164°02′·00E
101 MHz Poya 21°21′·42S 165°10′·01E
100 MHz Sarraméa 21°38′·50S 165°50′·50E
99 MHz Thio 21°37′·00S 166°13′·00E
Tontouta 22°00′·03S 166°11′·20E
100 MHz
Touho 20°47′·85S 165°13′·73E
Voh 20°57′·18S 164°41′·60E
98 MHz
Yaté 22°10′·67S 166°56′·31E
Diagram page 199
Weather Bulletins
0630 1130 1745 LT1 Meteorological bulletin “général”, in French.
0700 1200 1745 LT2 Meteorological bulletin “général”, in French.
1 Mon–Fri
2 Sat–Sun
Wk13/19
6.18
Denmark +45 72850370 mas@sok.dk
Denmark +45 72850370 mas@sok.dk
vagts@dma.dk
vagts@dma.dk
https://www.dma.dk/sikkerhedtilsoes/sejladsinformation/nautisk_information/sider/n
https://www.dma.dk/sikkerhedtilsoes/sejladsinformation/nautisk_information/sider/n
VI
VI
autisk_information.aspx
autisk_information.aspx
Estonia
Estonia
+372 6205665
+372 6205665
VI navinfo@vta.ee
navinfo@vta.ee
www.vta.ee/notices-to-mariners
www.vta.ee/notices-to-mariners
Finland
Finland
+358 204 486400
+358 204 486400 VOLUME
VOLUME 5,
5, NP285, 2018/19
turku.radio@fta.fi
NP285, 2018/19
turku.radio@fta.fi
Published Wk 29/18
https://extranet.liikennevirasto.fi/pooki_www/merivaroitukset/list_en.html
Published
(Last Updates: Weekly Edition Wk 29/18
https://extranet.liikennevirasto.fi/pooki_www/merivaroitukset/list_en.html
No. 10 dated 07 March 2019)
Germany (Last Updates: Weekly Edition No.
+49 4927 1877283 10 dated 07 March 2019)
seewarndienst.wsa-emd@t-online.de
Germany +49 4927 1877283 seewarndienst.wsa-emd@t-online.de
http://www.bsh.de/aktdat/nwn/nwn-ost.pdf
MARITIME
MARITIME SAFETY INFORMATION (MSI)
(MSI) UNDER UNDER THE
http://www.bsh.de/aktdat/nwn/nwn-ost.pdf
THE GMDSS
Latvia +371 67323103 SAFETY INFORMATION navarea@lhd.lv GMDSS
Latvia +371 67323103 navarea@lhd.lv
sar@mrcc.lv
PAGE 220, NAVAREA (Baltic Sea Sub-Area Coordinator), National sar@mrcc.lvCoordinators table, Lithuania.
PAGE
Delete 220,
row andNAVAREA
replace (Baltic
by: Sea Sub-Area Coordinator), National Coordinators table, Lithuania.
www.navtex.lv
Delete row and replace by: www.navtex.lv
www.lhd.lv
www.lhd.lv
Lithuania +370 61812591 mardep@ltsa.lrv.lt
Lithuania +370 61812591 mardep@ltsa.lrv.lt
https://ltsa.lrv.lt/lt/veiklos-sritys/hidrografine-veikla/pranesimai-jurininkams-notices-
https://ltsa.lrv.lt/lt/veiklos-sritys/hidrografine-veikla/pranesimai-jurininkams-notices-
to-mariners
to-mariners
Poland +48 261 266208 bhmw@bhmw.gov.pl
Polandupdate 29/18)
(former +48 261 266208 bhmw@bhmw.gov.pl
(former update 29/18)
Lithuanian Bulletin 2/19 (RSDRA2019000053473) 13/19 www.hopn.mw.mil.pl/index.php?akcja=on
Lithuanian Bulletin 2/19 (RSDRA2019000053473) 13/19 www.hopn.mw.mil.pl/index.php?akcja=on
Russian Federation +7 812 7175900 unio_navarea@mil.ru
Russian Federation +7 812 7175900 unio_navarea@mil.ru
Sweden +46 771 630685 NAVTEX
NAVTEX swedentraffic@sjofartsverket.se
Sweden279, NAVAREA
PAGE +46
I, 771 630685
BELGIUM. swedentraffic@sjofartsverket.se
PAGE
OOSTENDE.279, NAVAREA I, BELGIUM. http://www.sjofartsverket.se/baltico
OOSTENDE. http://www.sjofartsverket.se/baltico
PAGE entry
Delete 279, NAVAREA
and replaceI, BELGIUM.
by:
PAGE
Delete
OOSTENDE,279, NAVAREA
entry and replaceI,by:
TELEPHONE BELGIUM.
and FAX.
OOSTENDE,
(former
Delete
(former and
update TELEPHONE
update 29/18)
replace
29/18) by: and FAX.
Delete and
Lithuanian replace
Bulletin
Oostende Bulletin
Lithuanian by:
2/19 (RSDRA2019000053473)
[T] [V] [B]
[%NMWeek]
51°04′·44N 3°20′·08E
2/19 (RSDRA2019000053473) [%NMWeek]
Oostende [T] [V] [B] 51°04′·44N 3°20′·08E
TELEPHONE: +32 59 342493 X2
TELEPHONE: +32 59 342493 X2
FAX: +32 59 342467 55 n miles
FAX: +32 59 342467 55 n miles
E-MAIL: rmd@mil.be
E-MAIL: Radio rmd@mil.be
Oostende correspondence (RSDRA2019000053715) 13/19
MMSI: Radio 002050480
Oostende correspondence (RSDRA2019000053715) 13/19
MMSI: 002050480
NAVTEX [T]
NAVTEX [T] DISTRESS, SEARCH
DISTRESS,
NAVIGATIONAL SEARCH
ICE WARNINGS AND
AND
AND RESCUE
RESCUE
TIME UT(GMT) WEATHER BULLETINS NAVIGATIONAL
WARNINGS ICE WARNINGS
REPORTS AND
TIME UT(GMT) WEATHER BULLETINS WARNINGS REPORTS
PAGE0310
343, NAVAREA I.
0310
●
●
●
●
PAGE
/ 343, NAVAREA
&$S
LITHUANIA. & 344- 5 I. 1$ (
0710
LITHUANIA.
+(3'4 ●
-(
and replace ● ●
Delete0710
entry ● by: ● ●
#DKDSDDMSQX@MCQDOK@BDAX
Delete1110
entry and replace by: ● ●
1110 ● ●
LITHUANIA
1510
LITHUANIA
1510
●
●
●
●
See
See diagram
diagram R2
R2
1910 ● ● ●
National
1910SAR Agency:●MRCC Klaipėda ● ●
National SAR Agency: MRCC Klaipėda
2310 J. Janonio St. 24, LT 92251 Klaipėda,
Address: ● Lithuania ●
2310 J. Janonio St. 24, LT 92251 Klaipėda,
Address: ● Lithuania ●
Telephone:
NAVTEX +370
[V] Range 46
is 150 391257
n391257
miles
Telephone:
NAVTEX [V] Range +370 46
is 150
+370 46n391258
miles
TIME UT(GMT) +370 46 391258 NAVIGATIONAL WARNINGS
Fax:
TIME+370 46 391259
UT(GMT) NAVIGATIONAL WARNINGS
Fax: +370 46 391259
email:0330
mrcc@mil.lt ●
email:0330
mrcc@mil.lt ●
MRCC 0730
Klaipėda is responsible for ●
coordinating Search and Rescue operations within the Lithuanian SRR. MRCC Klaipėda maintains a
0730
MRCC Klaipėda is responsible for coordinating ● Search and Rescue operations within the Lithuanian SRR. MRCC Klaipėda maintains a
continuous
1130 watch on 2182 kHz, VHF Ch 16 and also
watch on 2182 kHz, VHF Ch 16
● and has DSC facilities on VHF Ch 70 and 2187·5 kHz.
continuous
1130 ● also has DSC facilities on VHF Ch 70 and 2187·5 kHz.
TeleMedical
1530 Assistance Service: Klaipeda ● Seamen's Hospital Maritime Medical Centre provide assistance. Contact via Klaipeda
TeleMedical
1530 Assistance Service: Klaipeda ● Seamen's Hospital Maritime Medical Centre provide assistance. Contact via Klaipeda
MRCC.
MRCC. 1930 ●
1930 ●
Possible consultation languages: Lithuanian, ● Russian and English.
2330consultation languages: Lithuanian,
Possible
2330 ● Russian and English.
Telephone +370 Fax +370 Others/Ship Earth Stations (SES)
NAVTEX [B] Range is 55 n miles Telephone +370 Fax +370 Others/Ship Earth Stations (SES)
NAVTEX [B]
Frequency:
ARCC VILNIUSRange
490 kHz is 55 n miles
Language:
(Cospas-Sarsat Dutch and sometimes in English
Frequency:
ARCC 490
VILNIUSkHz Language:
(Cospas-Sarsat Dutch and 70694587
sometimes in English 70694589 AFTN: EYVCYCYX
SPOC) 70694587 70694589 AFTN: EYVCYCYX
SPOC)
TIME UT(GMT) WEATHER BULLETINS 70694590
NAVIGATIONAL WARNINGS email: arcc@ans.it
TIME UT(GMT) WEATHER BULLETINS 70694590
NAVIGATIONAL WARNINGS email: arcc@ans.it
MRCC KLAIPĖDA
0010 46 391257 ● 46 391259 Mobile: +370 69818275
MRCC KLAIPĖDA
0010 46 391257 ● 46 391259 Mobile: +370 69818275
0410 46 391258 ● Inmarsat C: 427799011
0410 46 391258 ● Inmarsat C: 427799011
email: mrcc@mil.lt
0810 ● ● email: mrcc@mil.lt
0810 ● ● MMSI: 002770330
MMSI: 002770330
1210 ● ●
1210 ● ●
1610Bulletin 2/19 (RSDRA2019000053473)
Lithuanian ● 13/19 ●
1610Bulletin 2/19 (RSDRA2019000053473)
Lithuanian ● 13/19 ●
2010 ● ●
2010 ● ●
6.18
6.19
6.18
Wk13/19
VI
VI
––––––––––––––––––
(Last Updates: Weekly Edition No. 12 dated 21 March 2019)
––––––––––––––––––––––––––––––
1
Wk13/19
6.20
VI
6.1 Wk13/19
6.21
VI
CHILE 2019 2 NAVAREA IV - CANADA (Arctic Coast, Atlantic Coast and Saint Lawrence
COLOMBIA (Caribbean Coast) 50 River) 29
COLOMBIA (Pacific Coast) 50 NAVAREA IV - COLOMBIA (Caribbean Coast) 44
GREENLAND 2019 1 NAVAREA VIII - INDIA 29
GUAM (USA) 52 NAVAREA IX - IRAQ 52
NEW CALEDONIA (France) 2019 13 NAVAREA XI - GUAM (USA) 52
NEW ZEALAND 50 NAVAREA XII - CANADA (Pacific Coast) 29
UNITED STATES 2019 8 NAVAREA XII - COLOMBIA (Pacific Coast) 44
UNITED STATES (Gulf Coast) 2019 10 NAVAREA XVI - PERU 40
UNITED STATES (Hawaii) 2019 8 NAVAREA XIX - NORWAY 2019 9
URUGUAY 2019 11
DISTRESS, SEARCH AND RESCUE
SAFETYNET
NAVAREA I - LITHUANIA 2019 13
Page 20 EGC SAFETYNET SYSTEM 2019 7 NAVAREA I - POLAND 30
NAVAREA II - LIBERIA 30
DIAGRAMS NAVAREA II - PORTUGAL 30
NAVAREA III - CYPRUS 36, 51
Page 42 50 NAVAREA III - ITALY 29
Page 43 50 NAVAREA III - LIBYA 30
NAVAREA III - TURKEY 2019 7
NAVAREA IV - BAHAMAS, THE 48
VOLUME 5, NP285, 2018/19 NAVAREA IV - CANADA 29
Published Wk 29/18 NAVAREA IV - GUATEMALA 29
NAVAREA IV - SAINT-PIERRE AND MIQUELON (France) 34
NAVAREA V - BRAZIL 48
VHF DSC, LIST OF COAST STATIONS FOR SEA AREA A1
NAVAREA XI - CHINA 2019 5
NAVAREA XI - JAPAN 32
NAVAREA II - PORTUGAL 30
NAVAREA XI - KOREA, NORTH 37
NAVAREA III - SPAIN (Mediterranean Coast) 49
NAVAREA XI - KOREA, SOUTH 51
NAVAREA XI - VIETNAM 2019 10
NAVAREA XII - CANADA 29
MF DSC, LIST OF COAST STATIONS FOR SEA AREA A2 NAVAREA XII - GUATEMALA 29
Page 220 NAVAREA (Baltic Sea Sub-Area Coordinator) 29, 2019 13 PILOT SERVICES, VESSEL TRAFFIC SERVICES
AND PORT OPERATIONS
Page 220 NAVAREA I 2019 7
Page 221 NAVAREA II 29
ENGLISH CHANNEL AND NORTH SEA, including Skagerrak - DEEP SEA
Page 224 NAVAREA IV 34 PILOTS 51
Page 227 NAVAREA VII 35 FRANCE (Atlantic and English Channel Coasts) 17, 29, 49, 50, 2019 6
Page 229 NAVAREA XI 44 GIBRALTAR (UK) 20
Page 247 NAVAREA XV 2019 7 NETHERLANDS 22
UNITED KINGDOM 17, 19, 20, 25, 29, 30, 31, 34, 35, 45, 2019 9, 12
NAVTEX
DIAGRAMS
NAVAREA I - ESTONIA 29
NAVAREA I - BELGIUM 2019 13 Page 154 22
NAVAREA I - NORWAY 2019 9 Page 417 25
NAVAREA I - SWEDEN 29
NAVAREA I - UNITED KINGDOM 38
NAVAREA III - UKRAINE 29
Wk13/19 6.2
6.22
5.+4,$/ 13-/ VI
#( &1 ,2
/TAKHRGDC6J
5.+4,$/ 13-/ /@FD
#( &1 ,2
/TAKHRGDC6J %%("2$15("$2
/(+.32$15("$25$22$+31 /@FD
-#/.13./$1 3(.-2 /@FD
/@FD
/(+.32$15("$25$22$+31 %%("2$15("$2 /@FD
/@FD
! +3("2$
-#/.13./$1 3(.-2 /@FD
/@FD
#$-, 1*
$-&+(2'"' --$+ -#-.13'2$ HMBKTCHMF2J@FDQQ@J#$$/2$ /@FD
! +3("2$
/(+.32 /@FD
#$-, 1*
$23.-( 5.+4,$/ 13-/
$-&+(2'"' --$+ -#-.13'2$ HMBKTCHMF2J@FDQQ@J#$$/2$
%(-+ -#
/(+.32 /TAKHRGDC6J
-.16
$23.-( 8
5.+4,$/ 13-/
/.+
%(-+ -#
-# /TAKHRGDC6J %%("2$15("$2
/(+.32$15("$25$22$+31
1422( !@KSHB"N@RS
-.16 8 -#/.13./$1 3(.-2
26$#$-
/.+ -#
" - # /(+.32$15("$25$22$+31
SK@MSHB"N@RS %%("2$15("$2
1422( !@KSHB"N@RS -#/.13./$1 3(.-2
26$#$-
5.+4,$/ 13-/ " - # SK@MSHB"N@RS
/TAKHRGDC6J 5.+4,$/ 13-/
5.+4,$/ 13-/ /TAKHRGDC6J
/TAKHRGDC6J %%("2$15("$2
/(+.32$15("$25$22$+31 5.+4,$/ 13-/
-#/.13./$1 3(.-2 /TAKHRGDC6J %%("2$15("$2
/(+.32$15("$25$22$+31
-#/.13./$1 3(.-2
"1. 3( /(+.32$15("$25$22$+31
%%("2$15("$2
-#/.13./$1 3(.-2 /(+.32$15("$25$22$+31 %%("2$15("$2
%1 -"$,DCHSDQQ@MD@M"N@RS "'(-
-#/.13./$1 3(.-2
&1$$"$ *.1$ 2.43'
"1. 3(
(21 $+,DCHSDQQ@MD@M"N@RS
%1 -"$,DCHSDQQ@MD@M"N@RS "'(-
(3 +8 *.1$ 2.43' #( &1 ,2
&1$$"$
+(!8 $+,DCHSDQQ@MD@M"N@RS
(21
,.-3$-$&1. /@FD
(3 +8 #( &1 ,2
,.1."".
+(!8
1422( !K@BJ2D@"N@RS
,.-3$-$&1. /@FD
2'(/1$/.13(-&2823$,2
,.1."".
5.+4,$/ 13-/
2/ (-,DCHSDQQ@MD@M"N@RS /TAKHRGDC6J
1422( !K@BJ2D@"N@RS
341*$8
2'(/1$/.13(-&2823$,2 5.+4,$/ 13-/
4*1(-,DCHSDQQ@MD@M"N@RS
2/ (-$ /TAKHRGDC6J %%("2$15("$2
/(+.32$15("$25$22$+31
341*$8 -#/.13./$1 3(.-2
4*1 (-$
!1 9(+/(+.32$15("$25$22$+31 %%("2$15("$2
-#/.13./$1 3(.-2
,$7(".
#( &1 ,2 31(-(# # -#3.! &.
!1 9(+
,$7(".
/@FD
#( &1 ,2 31(-(# # -#3.! &.
/@FD 5.+4,$/ 13-/
/@FD /TAKHRGDC6J
/@FD
5.+4,$/ 13-/ 5.+4,$/ 13-/
/TAKHRGDC6J %%("2$15("$2
/(+.32$15("$25$22$+31
/TAKHRGDC6J -#/.13./$1 3(.-2
5.+4,$/ 13-/
/(+.32$15("$25$22$+31 %%("2$15("$2
-&.+
/TAKHRGDC6J %%("2$15("$2
/(+.32$15("$25$22$+31 -#/.13./$1 3(.-2
-#/.13./$1 3(.-2 ! '1 (-
"-&.+
,$1..-
4231 +(/(+.32$15("$25$22$+31
%%("2$15("$2
".-&.
-#/.13./$1 3(.-2 ! '1 (-
! -&+ #$2' #)(!.43(
" ,$1..-
(-#(
4231 +( & !.-
".-&.
(-#.-$2(
! -&+ #$2' &4(-$
#)(!.43(
*(1(!
(-#( 3( ,.9 ,!(04$
& !.-
, + 82(
(-#.-$2( ., -
&4(-$
-$69$3(
*(1(! + -# 0 3 1
,.9 ,!(04$
/'(+(//(-$2
, + 82( 2.43' %1("
., -
2(-& /.1$
-$69$ + -# 4-(3$# 1 !$,(1 3$2
0 3 1
/'(+(//(-$2 2.43' %1("
2(-& /.1$ 4-(3$# 1 !$,(1 3$2
6.23 Wk13/19
VII
Weekly
NP no Page(s) Title Edition
7.1
Wk13/19
VIII
a) Safety Notice
For a graphical way to establish that the ECDIS is correctly displaying the new symbols introduced in IHO S-52 Presentation Library
Edition 4.0 the mariner can check ECDIS Chart 1. ECDIS Chart 1 is a legend of the entire set of symbols that may be used within an
ENC and is installed on all type-approved ECDIS systems. See iho.int for further information.
This file is updated on a regular basis and should be consulted to ensure that all related issues are taken into consideration.
The latest confirmed status of T&P NM information in the ENCs that are available in ADMIRALTY services is shown in the ENC-
T&P-NM-Status.pdf file in the INFO folder on the service media and at: admiralty.co.uk/ENC-TP-NMs
ADMIRALTY Information Overlay (AIO) shows ADMIRALTY paper T&Ps where they are not already included in the ENCs. Most
countries now include temporary information in their ENCs.
From WK14/19, AVCS will only be available by download or on the weekly DVDs. The final AVCS Base CDs was issued in WK05/19
and the last AVCS weekly update CD will be released in WK13/19.
For more information, please contact your ADMIRALTY Chart Agent.
f) Important notice for users of AVCS and ARCS Online Updating Services (AVCS OUS and ARCS OUS)
The email service for AVCS OUS and ARCS OUS will no longer be available from 28 February 2019 due to technology infrastructure
changes at UKHO. Please note that the http service is unaffected.
From 1 March 2019, email calls to ARCS OUS and AVCS OUS will receive an auto-response that asks the customer to resubmit their
data request online by http. Please contact your ADMIRALTY Distributor if support is required for use of the http service.
i. ADMIRALTY ENC and ECDIS Maintenance Record (NP133C). This publication is designed to hold paper records on ENC
and ECDIS maintenance to assist information management and support inspections. Please note that V2.0 is the current
edition.
ii. ADMIRALTY Guide to ENC Symbols Used in ECDIS (NP5012). A companion to the ADMIRALTY Guide to Symbols and
Abbreviations Used on Paper Charts, NP5011. The 2nd edition of NP5012 includes the changes highlighted in the new S-52
standards and the new presentation library 4.0.
8.1
Wk 13/19
VIII
iii. ADMIRALTY Guide to the Practical Use of ENCs (NP231). Supports ECDIS training on the interpretation and use of ENC
data.
iv. ADMIRALTY Guide to ECDIS Implementation, Policy and Procedures (NP232). Provides clear guidance for any individual
or organisation responsible for the introduction of ECDIS, in particular those involved in the development of detailed ECDIS
operating procedures.
v. ADMIRALTY Port Approach Guides. Information from a range of official ADMIRALTY charts and publications on one
chart, helping bridge crews to plan for particular approaches and to support Master Pilot Exchange. Expanding coverage of
some of the world's most complex approaches, including Antwerp, Rotterdam and the Panama Canal. More information is
available at admiralty.co.uk/port-approach-guides
For information: Ensure that Activation Key Requests and Update Data Requests for ADP are sent to ADPMailGateway@ukho.gov.uk
ADMIRALTY Vector Chart Service (AVCS) DVDs and ADMIRALTY Information Overlay (AIO) CDs are issued
weekly and contain all base and update data available at the time of issue.
If you are using an unsupported version, contact your Chart Agent to upgrade to the latest version as soon as possible.
8.2
Wk 13/19
HYDROGRAPHIC NOTE FOR PORT
H.102A
INFORMATION (V7.0 Jan 2013)
(To accompany Form H.102)
NAME OF PORT
GENERAL REMARKS
Principal activities and trade.
Latest population figures and date.
ANCHORAGES
Designation, depths, holding ground,
shelter afforded.
PILOTAGE
Authority for requests.
Embark position.
Regulations.
DIRECTIONS
Entry and berthing information.
Tidal streams.
Navigational aids.
TUGS
Number available.
WHARVES
Names, numbers or positions & lengths.
Depths alongside.
CARGO HANDLING
Containers, lighters, Ro-Ro etc.
REPAIRS
Hull, machinery and underwater.
Shipyards.
Divers.
HYDROGRAPHIC NOTE FOR PORT
H.102A
INFORMATION (V7.0 Jan 2013)
(To accompany Form H.102)
SUPPLIES
Fuel.
(with type, quantities and methods of
delivery)
Fresh water.
(with method of delivery and rate of
supply)
Provisions.
SERVICES
Medical.
Ship Sanitation.
COMMUNICATIONS
Nearest airport or airfield.
PORT AUTHORITY
Designation, address, telephone, e-mail
address and website.
VIEWS
Photographs (where permitted) of the
approaches, leading marks, the entrance
to the harbour etc.
ADDITIONAL DETAILS
NOTES:
1. Form H.I02A lists the information required for ADMIRALTY Sailing Directions and has been designed to help the
sender and the recipient. The sections should be used as an aide-memoir, being used or followed closely,
whenever appropriate. Where there is insufficient space on the form an additional sheet should be used.
2. Reports which cannot be confirmed or are lacking in certain details should not be withheld. Shortcomings
should be stressed and any firm expectation of being able to check the information on a succeeding voyage should
be mentioned.
HYDROGRAPHIC NOTE FOR
GNSS OBSERVATIONS AGAINST CORRESPONDING BRITISH ADMIRALTY H.102B
(V7.0 Jan 2014)
CHART POSITIONS
(To accompany Form H.102)
Chart/ENC in use
(SEE NOTE 3a) Latitude/Longitude of position read Latitude/Longitude of position read from Additional
Time/Date of
Edition Date & from Chart/ECDIS GNSS Receiver (on WGS84) Information/Remarks
Observation Number /
NM / ENC (SEE NOTE 3b) (SEE NOTE 3c) (SEE NOTE 3d)
ENC
update status
HYDROGRAPHIC NOTE FOR
GNSS OBSERVATIONS AGAINST CORRESPONDING BRITISH ADMIRALTY H.102B
(V7.0 Jan 2014)
CHART POSITIONS
(To accompany Form H.102)
NOTES:
1. This form is designed to assist in the reporting of observed differences between WGS84 datum and the geodetic datum of British
ADMIRALTY Charts by mariners, including yachtsmen and should be submitted as an accompaniment to Form H.102 (full instructions
for the rendering of data are on Form H.102). Where there is insufficient space on the form an additional sheet should be used.
The UK Hydrographic Office would appreciate the reporting of Global Navigation Satellite Systems (GNSS) positions, referenced to WGS84 datum, at
identifiable locations or features on British ADMIRALTY Charts. Such observations could be used to calculate positional shifts between WGS84 datum and the
geodetic datum for those British ADMIRALTY Charts which it has not yet been possible to compute the appropriate shifts. These would be incorporated in future
new editions or new charts and promulgated by Preliminary Notices to Mariners in the interim.
It is unrealistic to expect that a series of reported WGS84 positions relating to a given chart will enable it to be referenced to that datum with the accuracy
required for geodetic purposes. Nevertheless, this provides adequate accuracy for general navigation, considering the practical limits to the precision of 0.2mm
(probably the best possible under ideal conditions – vessel alongside, good light, sharp dividers etc), this represents 10 metres on the ground at a chart scale of
1:50.000.
It is clear that users prefer to have some indication of the magnitude and direction of the positional shift, together with an assessment of its likely accuracy,
rather than be informed that a definitive answer cannot be formulated. Consequently, where a WGS84 version has not yet been produced, many charts now
carry approximate shifts relating WGS84 datum to the geodetic datum of the chart. Further observations may enable these values to be refined with greater
confidence.
3. Details required
a. It is essential that the chart number, edition date and its correctional state (latest NM) are stated. For ENCs, please state the ENC name and latest
update applied.
b. Position (to 2 decimal places of a minute) of observation point, using chart graticule or, if ungraduated, relative position by bearing/distance from
prominent charted features (navigation lights, trig. points, church spires etc.).
c. Position (to 2 decimal places of a minute) of observation point, using GNSS Receiver. Confirm that GNSS positions are referenced to WGS84 datum.
d. Include GNSS receiver model and aerial type (if known). Also of interest: values of PDOP, HDOP or GDOP displayed (indications of theoretical
quality of position fixing depending upon the distribution of satellites overhead) and any other comments.
HYDROGRAPHIC NOTE ± H.102 INSTRUCTIONS (V9.0 Dec 2017)
1. Mariners are requested to notify the United Kingdom Hydrographic Office (UKHO) when new or suspected dangers to
navigation are discovered, changes observed in aids to navigation, or corrections to publications are seen to be necessary.
Mariners can also report any ENC display issues experienced. The Mariner's Handbook (NP100) Chapter 4 gives general
instructions. The provisions of international and national laws should be complied with when forwarding such reports.
2. Accurate position or knowledge of positional error is of great importance. Where latitude and longitude have been used to
specifically position the details of a report, a full description of the method used to obtain the position should be given. Where
possible the position should be fixed by GPS or Astronomical Observations. A full description of the method, equipment,
time, estimated error and datum (where applicable) used should be given. Where the position has been recorded from a
smart phone or tablet, this is to be specifically mentioned. When position is defined by sextant angles or bearings (true or
magnetic to be specified), more than two should be used to provide a redundancy check. Where position is derived from
Electronic Position Fixing (e.g. LORAN C) or distances observed by radar, the raw readings of the system in use should be
quoted wherever possible. Where position is derived after the event, from other observations and / or Dead Reckoning, the
methodology of deriving the position should be included.
3. Paper Charts: A cutting from the largest scale chart is often the best medium for forwarding details, the alterations and
additions being shown thereon in red. When requested, a new copy will be sent in replacement of a chart that has been
used to forward information, or when extensive observations have involved defacement of the observer's chart. If it is
preferred to show the amendments on a tracing of the largest scale chart (rather than on the chart itself) these should be in
red as above, but adequate details from the chart must be traced in black ink to enable the amendments to be fitted correctly.
4. ENCs: A screen shot of the largest scale usage band ENC with the alterations and additions being shown thereon in red.
If it is to report an issue with the display of an ENC, a screen shot of the affected ENC should be sent along with details of
the ECDIS make, model or age and version in use at the time.
5. When soundings are obtained The Mariner's Handbook (NP100) should where possible be consulted. It is important to
ensure that full details of the method of collection are included with the report. This should include but not limited to:
(a) Make, model and type of echo sounder used.
(b) Whether the echo sounder is set to register depths below the surface or below the keel; in the latter case the vessel's
draught should be given.
(c) Time, date and time zone should be given in order that corrections for the height of the tide may be made where
necessary, or a statement made as to what corrections for tide have already been made.
(d) Where larger amounts of bathymetric data have been gathered, only those areas where a significant difference to
the current chart or ENC should be specifically mentioned on the H102. The full data set may also be sent in, with
an additional note added to this effect. If no significant differences are noted, the bathymetric data may still be of
use, and sent in accordingly. Where full data sets are included, a note as to the data owner and their willingness for
the data to be incorporated into charts and ENCs included.
6. FRU (FKR 6RXQGHUV WKDW XVH HOHFWURQLF µUDQJH JDWLQJ¶ FDUH VKRXOG be taken that the correct range scale and
appropriate gate width are in use. Older electro-mechanical echo sounders frequently record signals from echoes
received back after one or more rotations of the stylus have been completed. Thus, with a set whose maximum range is
500m, an echo recorded at 50m may be from depths of 50m, 550m or even 1050m. Soundings recorded beyond the set's
nominal range can usually be recognised by the following:
(a) the trace being weaker than normal for the depth recorded;
(b) the trace passing through the transmission line;
(c) the feathery nature of the trace.
As a check that apparently shoal soundings are not due to echoes received beyond the set's nominal range,
soundings should be continued until reasonable agreement with charted soundings is reached. However,
soundings received after one or more rotations of the stylus can still be useful and should be submitted if they
show significant differences from charted depths.
7. Reports which cannot be confirmed or are lacking in certain details should not be withheld. Shortcomings should
be stressed and any firm expectation of being able to check the information on a succeeding voyage should be mentioned.
8. Reports of shoal soundings, uncharted dangers and aids to navigation out of order should, at the mariner's discretion, also
be made by radio to the nearest coast radio station. The draught of modern tankers is such that any uncharted depth under
30 metres or 15 fathoms may be of sufficient importance to justify a radio message.
9. Changes to Port Information should be forwarded on Form H.102A and any GPS/Chart Datum observations should be
forwarded on Form H.102B together with Form H.102. Where there is insufficient space on the forms additional sheets
should be used.
10. Reports on ocean currents, magnetic variations and other marine observations should be made in accordance with
The Mariner's Handbook (NP100) Chapter 4 with forms also available at admiralty.co.uk/MSI.
Note. - An acknowledgement or receipt will be sent and the information then used to the best advantage which may mean
immediate action or inclusion in a revision in due course; for these purposes, the UKHO may make reproductions of any
material supplied. When a Notice to Mariners is issued, the sender's ship or name is quoted as authority unless (as
sometimes happens) the information is also received from other authorities or the sender states that they do not want to
be named by using the appropriate tick box on the form. An explanation of the use made of contributions from all parts of
the world would be too great a task and a further communication should only be expected when the information is of
outstanding value or has unusual features.
Hydrographic Note ± H.102
Reporting information affecting ADMIRALTY Maritime Products & Services
For emergency information affecting safety of life at sea forward to: navwarnings@ukho.gov.uk
Or alternatively contact T: +44 (0)1823 353448 (direct line) F: +44 (0)1823 322352
For new information affecting all ADMIRALTY Charts and Publications forward to: sdr@ukho.gov.uk
This form H.102 and instructions are available online: admiralty.co.uk/msi
Subject
Position
Latitude Longitude
(see Instruction 2)