Documenti di Didattica
Documenti di Professioni
Documenti di Cultura
lose this function and may become a mere bur- Inhibitory control of the pain process can take
den to the patient. Pain does not only indicate place in the periphery at the level of the nocicep-
physical suffering, but involves a strong men- tors or the primary afferents. These are the re-
tal and emotional component. According to the gions where local anesthetics and NSAIDs act.
definition of the International Association for the Central pain inhibition can take place at the level
Study of Pain “it is an unpleasant sensory and of the spinal cord, the thalamus, cortex, and the
emotional experience associated with actual or limbic system. The pain transmission at the level
potential tissue damage, or described in terms of of the spinal cord is under inhibitory control of
such damage”. descending fibers, which originate in different
The nervous system contains an afferent fiber parts of brain stem, mid brain, and cortex. They
system that is specialized for registration, trans- contain opioid synapses as well as noradrener-
mission, and processing of nociceptive infor- gic and serotoninergic synapses and represent
mation. In the periphery small unmyelinated the descending spinal pain inhibitory system.
nerve endings, called nociceptors, are activated Inhibitory opioid synapses are not only found
by mechanical, thermal, or chemical stimuli. in the spinal cord but are strategically located
One type, the mechano-heat nociceptor is spe- along the whole pain pathway. Opioid receptors
cialized for thermal and mechanical stimulation, are found in the cortex, limbic system, and for-
whereas the so-called polymodal receptor is less matio reticularis and this explains why opioids
specific and responds to all kinds of mechan- not only inhibit pain perception but also reduce
ical, thermal, or chemical irritation. Mechano- the emotional component of pain suffering and
heat nociceptors have a high stimulation thresh- mitigate the vegetative pain symptoms.
old and respond only to strong stimuli. They According to the clinical situation, pain can
are linked to small myelinated and rapidly con- be classified as acute and chronic pain. Acute
ducting Aδ fibers which produce a sharp and pain is induced by trauma, tissue damage, or
well located pain sensation. The sharp pain stim- disease and has a well defined localization and
ulus activates withdrawal reflexes and has to time course. Acute pain normally responds well
protect the body against further damage. The to NSAIDs and opioid analgesics. Chronic pain
polymodal receptors respond to weaker stim- is more complex in nature and often contains an
uli including endogenous compounds like his- inflammatory component. The association with
tamine, bradykinin, and prostaglandins. These trauma and lesion can be lost and then pain
receptors are mediators of pain and inflamma- no longer fulfills its alarming function. Chronic
tion and are released by tissue damage. The im- pain is often a heavy burden to the patient and
pulses of polymodal nociceptors are transmitted induces physical, psychological, and social dete-
more slowly via thicker, unmyelinated C-fibers rioration. Chronic pain treatment is an important
and provoke a dull, aching, and less precisely medical challenge.
localized pain sensation. The nerve fibers origi- Physiologically, pain can be differentiated
nating from nociceptors are named primary af- into nociceptive and neuropathic pain. Nocicep-
ferent fibers. They have their cell body in the tive pain results from activation of nociceptors
dorsal root ganglia and project to the dorsal root by acute or chronic stimulation and is not associ-
of the spinal cord where they form synapses with ated with damage of nerves. Neuropathic or neu-
fibers of the ascending spino-thalamic pathway. rogenic pain in contrast is the result of damage
Most of the spino-thalamic pain fibers pass the or dysfunction of the peripheral nerves or of the
thalamus and project to the limbic system and central parts of the pain processing system. Ex-
the cortex. The limbic system is responsible for amples of neuropathic pain of peripheral origin
the emotional component of pain whereas in the are deafferentiation pain (stump pain), diabetic
cortex realization and localization of the origin neuropathy, post herpetic neuralgia, trigeminal
of pain takes place. The spino-thalamic fibers neuralgia, and sympathetically maintained pain
form connections with the formatio reticularis like the complex regional pain syndrome. Cen-
of the brain stem, inducing the various vegeta- tral neuropathic pain may result from lesions of
tive reactions associated with the pain percep- the spinal cord or brain lesions following stroke.
tion such as sweating, palpitation, nausea, and In chronic cancer pain, nociceptive pain is of-
blood pressure increase. ten associated with a neuropathic component in-
Analgesics and Antipyretics 3
duced by neoplastic nerve infiltration or com- inflammatory drug and is used in almost every
pression of the nerve by tumor growth. household for the treatment of mild to moder-
Cancer pain is one of the most important ate pain states and fever. In 1971, it was shown
forms of chronic severe pain and guidelines for that the analgesic action of nonsteroidal anti-
the treatment of cancer pain were published by inflammatory drugs is due to the inhibition of
the WHO in 1986 (Fig. 1). the enzymatic production of prostaglandins. Cy-
clooxygenase (COX) is the key enzyme in the
conversion of arachidonic acid derived from
lipids of the cell membrane to prostaglandins
and other eicosanoids (Fig. 2).
[13–16]. The cloning of the two isoforms led → Prostaglandins, Chap. 3). As expected, the
to further characterization of the enzymes by gastrointestinal side effects of these drugs were
means of a whole range of molecular biology shown to be clearly lower than those of clas-
tools from knock-out mice [17–19] to protein sical nonsteroidal anti-inflammatory drugs like
structures [20, 21]. naproxen.
COX-1 is constitutively expressed in many The ongoing research on the COX isoforms
cells of the body and responsible mainly for the revealed that the strict differentiation of COX-
production of eicosanoids serving normal physi- 1 as the constitutive enzyme and source of
ological functions. One important physiological physiological (good) prostaglandins and COX-
role is the protection of the gastric mucosa. Pain 2 as the inflammation- and pain-mediated in-
relief by inhibition of COX-1 is therefore often duced form of the enzyme, producing the “bad”
accompanied with gastrointestinal side effects. prostaglandins is no longer valid. It was shown
COX-2 expression is induced during inflam- that COX-1 expression is also subject to regula-
mation and is thought to be responsible for the tory processes and can be increased in inflam-
production of eicosanoids in inflammatory con- matory conditions [25]. COX-2 expression on
ditions related to fever and pain. Furthermore, the other hand is increased in the gastric mucosa
COX-2 is expressed in the central nervous sys- by inflammatory stimuli and Helicobacter pylori
tem and might play a direct role in central pain infection [26, 27]. Finally, analysis of COX-1
processing. and COX-2 knock-out mice indicated that both
Many nonsteroidal anti-inflammatory drugs isoforms can contribute to an inflammatory re-
of different chemical structures have been in- sponse and have significant roles in the mainte-
troduced for the treatment of inflammatory and nance of physiological homeostasis and carcino-
painful conditions. Many years of clinical expe- genesis [28]. These data suggest a more com-
rience with these drugs have shown that there plex situation than the initial idea on the roles of
is no induction of tolerance and dependence COX-1 in normal and of COX-2 in inflammatory
and no respiratory depression as seen with opi- conditions, respectively.
oids. The major side effects of these compounds Nevertheless, the COX-2 inhibitors showed
with COX-1 specificity or balanced COX-1 and a clearly improved gastrointestinal side effect
COX-2 inhibition are damage of the gastric mu- profile and up to the year 2000 the newly de-
cosa, prolongation of bleeding time, and renal veloped coxibs seemed to displace the classical
failure. The discovery of the inducible isoform COX-1 selective NSAIDs from the market. The
led to the identification of drugs that show a situation totally changed when the results of on-
stronger inhibition of COX-2 compared to COX- going clinical studies and case reports revealed
1 (Table 1). that COX-2 inhibitors seem to increase the risk
The characteristic differences in expression of adverse thromboembolic events. The case re-
of the two COX isoforms suggest a potential for ports came from patients with connective tissue
new drugs addressing inflammatory and painful diseases who developed arterial thrombosis after
conditions specifically via inhibition of COX-2. starting celecoxib treatment [29]. An increased
The analgesic and anti-inflammatory potential number of cardiovascular events as compared to
of selective COX-2 inhibitors should come with- naproxen were seen in a large-scale randomized
out the well known gastrointestinal side effects controlled trial [30], which investigated the ef-
of classical NSAIDs targeting COX-1 alone or ficacy and tolerability of rofecoxib (the VIGOR
in combination with COX-2. trial).
The first generation of COX-2 inhibitors like The concern about the risk associated with
meloxicam still shows inhibition of COX-1 in the COX-2 inhibitors increased rapidly and in
physiological concentrations and hence, still September 2004 rofecoxib was withdrawn from
generates gastrointestinal side effects of COX- the market because a trial, designed to test the
1 inhibition although to a lower degree. The hypothesis that COX-2 inhibitors would pre-
second generation of COX-2 inhibitors reached vent recurrent colonic polyps, indicated an in-
the market in 1999 with celecoxib and rofe- creased cardiovascular toxicity [31]. A similar
coxib and shows a more than 100-fold selec- trial with celecoxib, performed at the National
tivity for COX-2 compared to COX-1 (see also Cancer Institute was stopped when an indepen-
Analgesics and Antipyretics 5
Table 1. COX-2 specific inhibitors
Group Compound COX-2 selectivity Reference
First generation (< 100-fold)
etodolac 10 [22]
meloxicam 10 [22, 23]
nimesulide 5 – 100 [22, 23]
Second generation (100 – 1000-fold)
celecoxib 375 [24]
rofecoxib 800 [561]
dent panel of cardiovascular experts reviewed ciples such as inhibition of 5-lipoxygenase (5-
the data and also found a greater incidence of car- LO) or release of nitric oxide (NO).
diovascular events among patients treated with
celecoxib [32]. Negative data on cardiovascu- Dual COX and 5-LO Inhibitors. This
lar tolerability were also seen with valdecoxib new class of compounds is reported to have
and its intravenous prodrug, parecoxib, given COX-2 and 5-lipoxygenase inhibiting proper-
for pain treatment to patients recovering from ties [35]. The compounds were effective in sev-
coronary-artery bypass surgery [33]. In the be- eral animal models of arthritis and were devoid
ginning, the mechanism of the cardiovascular of ulcerogenic properties. One of these com-
toxicity of the COX-2 inhibitors was unclear, but pounds, S-2474, ((E)-5-(3,5-di-tert-butyl-4-hy-
it emerged that it was a group effect of the coxibs droxybenzylidene)-2-ethyl-1,2-isothiazolidine-
and the most likely mechanism is a reduced pro- 1,1-dioxide), which has a γ-sultam skeleton, ad-
duction of the antithrombotic eicosanoid prosta- ditionally inhibits the production of interleukin-
cyclin without changing the production of the 2 (IL-2) in in vitro assays. S-2474 was selected
prothrombotic compound thromboxane [34]. as development candidate and is now under
Besides the cardiovascular intolerability, the clinical investigation [36].
COX-2 inhibitor valdecoxib showed an in- ML-3000 ((2,2-dimethyl-6-(4-chlorophe-
creased risk of serious and potentially fatal skin nyl)-7-phenyl-2,3-dihydro-1H-pyrrolizine-5-
reactions which was the reason for the suspen- yl)-acetic acid) is a nonoxidant dual cy-
sion of marketing autorization. The remaining clooxygenase and 5-lipoxygenase inhibitor and
COX-2 inhibitors, etoricoxib and lumiracoxib, has been compared with indometacin in a num-
although having in principle a similar cardiovas- ber of experimental models of inflammation
cular and skin tolerability risk, seem to be better and pain [37]. Corresponding to animal data
tolerated and are still on the market, but doctors the compound showed a wide range of ac-
are advised to use COX-2 inhibitors only after tivities in Phase II clinical studies, including
careful consideration, and to treat their patients anti-inflammatory, analgesic, antiplatelet and
with the shortest course and the lowest possible antiasthmatic properties [38, 39].
dose of these compounds.
The unexpected tolerability problems with NO Releasing COX Inhibitors. Nitric
the COX-2 inhibitors have strongly reduced the oxide (NO) releasing non-steroidal anti-
enthusiasm originally evoked by these com- inflammatory drugs are a new and promising
pounds and have re-established the therapeutic goup of analgesic and anti-inflammatory com-
reputation of the COX-1 inhibitors and of com- pounds. NO release is found as a mechanistically
pounds with a balanced COX-1 and COX-2 in- not yet resolved property of a few new COX-
hibition, although the gastrointestinal side ef- 1 inhibitors such as amtolmetin [40] or it can
fects remain a serious problem. Therefore there be induced by adding a NO releasing moiety
is increased need for new anti-inflammatory (e.g., nitroxybutyl) to existing COX-inhibitors
principles with better gastrointestinal tolerabil- [41]. The most advanced compounds are NO-
ity and research activities have been focussed naproxen and NO-flurbiprofen (NCX-2216).
on new compounds combining COX-inhibition Preclinical and clinical studies confirm that
with other analgesic and anti-inflammatory prin- both NO-release and COX-1 or COX-2 inhibi-
6 Analgesics and Antipyretics
tion take place in vivo, causing less adverse ef- mimics in vivo conditions like plasma binding
fects on the gastrointestinal tract than conven- [45]. It is commonly accepted that reasonable
tional NSAIDs and coxibs. In addition, the com- variations in COX inhibition is found in differ-
pounds reduce systemic blood pressure. Possi- ent laboratories. Therefore, whenever possible,
ble indications for NO-flurbiprofen are, besides data of several compounds, generated within the
pain inhibition and anti-inflammation, urinary same test situation, should be compared to each
incontinence, Alzheimer’s disease, osteoporosis other.
and Paget’s disease [42]. A topical formulation Using this classification based on isoenzyme
is under development for the treatment of der- selectivity, there is besides low-dose aspirin no
matological disorders such as contact urticaria. COX-1 selective inhibitor on the market. In-
A further group of NO-donating drugs (e.g., stead, most of the classical NSAIDs belong to
NCX-4016) has been obtained by coupling the group of nonselective COX inhibitors.
NO to aspirin. These compounds retain the
analgesic, anti-inflammatory and antithrombotic • Selective COX-1 inhibitors (low-dose as-
properties of aspirin but show an increased pirin)
gastrointestinal tolerability [43]. Animal stud- • Nonselective COX inhibitors (e.g., high-dose
ies have shown that NO-aspirins and the NO- aspirin, indometacin, and other NSAIDs)
donating NSAIDs maintain gastric mucosal • Preferential COX-2 inhibitors (e.g., meloxi-
blood flow and reduce leucocyte-endothelial cell cam)
adherence. • Highly selective COX-2 inhibitors (e.g., cele-
Up to 2006, no NO-COX inhibitor compound coxib and other second- and third-generation
has yet reached the market. COX-2 inhibitors, now called coxibs)
Classification According to Drug – Protein
Aspirin as an Antithrombotic Drug. As- Interactions. Another classification is based on
pirin, the archetype of the COX inhibitors, is still the mode of interaction between the inhibitor
one of the most interesting compounds of this drug and the enzyme [46].
group and has reached additional importance in
the last decades due to its inhibition of platelet • Irreversible inhibitors of COX-1 (aspirin)
aggregation. It is used in low dose [44] in the and COX-2 (APHS). Aspirin and APHS [47]
treatment of acute and the prevention of chronic acetylate the amino acid serine in the cat-
myocardial infarction and stroke (→ Cardiovas- alytic center of the enzyme to a stable ester
cular Drugs). derivative so that the endogenic arachidonic
acid is prevented from interaction with the
Classification of COX Inhibitors. COX in- enzyme.
hibitors, as it is done here, can be classified ac- • Reversible, competitive inhibitors of COX-
cording to their chemical structure. 1 and COX-2. Inhibitors such as ibuprofen,
Classification According to Inhibition Speci- piroxicam, or mefenamic acid block the en-
ficity. A more functional classification is related zyme by competing with arachidonic acid for
to the specificity for inhibition of the COX-1 binding at the catalytic center.
or COX-2 isoforms of the enzyme. The inhi- • Slow, time-dependent, reversible inhibitors
bition of the COX isoenzyme is strongly de- of COX-1 and COX-2. Compounds such as
pendent on the test system used. Inhibition of indometacin and flurbiprofen act by ionic in-
COX can be quantified in recombinant or natu- teraction between the acidic carboxyl group
ral enzyme preparations, cellular systems, iso- of the inhibitor and the basic arginine residue
lated human cell populations, such as platelets of the enzyme. This seems to influence the
(COX-1) and white blood cells (COX-2), or in helix D of the protein followed by a signifi-
ex vivo stimulated whole blood samples. The cant loss of flexibility of the enzyme protein.
more physiological the situation is, the smaller • Slow, time-dependent, irreversible inhibitors
is the selectivity of most of the COX-2 selec- of COX-2. The coxibs such as celecoxib, rofe-
tive inhibitors. The standard test for comparison coxib and lumiracoxib induce a strong, time-
is considered to be a whole blood assay which dependent inhibition of COX-2, but show
only a minor competitive inhibition of COX-
Analgesics and Antipyretics 7
Clinical use: Diflunisal [60] is a nonsteroidal of mild pain conditions including musculoskele-
anti-inflammatory drug used in the treatment tal, soft-tissue, and joint disorders. It is now
of mild to moderate pain including osteoarthri- mostly substituted by newer COX inhibitors.
tis, rheumatoid arthritis, and primary dysmenor- Trade names: Percutalgine (France), Intral-
rhoea. It is used as base or lysine- or arginine-salt gin (UK), Anabar (USA).
for oral or parenteral application.
Diflunisal is a weak inhibitor of both COX-1
and COX-2 [61]. 2.2. para-Aminophenol Derivatives
Peak plasma concentrations are reached
within 2 to 3 h after oral dosing. Diflunisal is Paracetamol [103-90-2], acetaminophen,
strongly bound to plasma protein (> 99 %), has N-(4-hydroxyphenyl)acetamide, C8 H9 NO2 , M r
a long elimination half-life (8–12 h) and non- 151.16, mp 168–169 ◦ C.
linear elimination kinetics. Hence, it is used with Synthesis:
an initial loading dose (1000 mg) and a lower
maintenance dose (500–1000 mg/d). a) classical route [48, 64]:
The main side effects are gastrointestinal dis-
turbances, headache and rash.
Trade names: Dolobis (France), Dolobid
(Italy, UK, USA).
b) Hoechst-Celanese process:
and there are speculations that a third COX nine, which increase glutathione conjugation of
isoenzyme, named COX-3, may be inhibited the metabolite, are used as antidote.
[66]. Recently, a new and unexpected mech- Paracetamol is not soluble in aqueous solu-
anism through which paracetamol could exert tions and cannot be given parenterally. A soluble
its analgesic effect was detected [67, 68]. Fol- glycine prodrug derivative has been developed
lowing deacetylation to its metabolite p-amino- for parenteral use (propacetamol, see below).
phenol, paracetamol is conjugated with arachi- Trade names: Benuron (Germany, Switzer-
donic acid to give a compound named AM404. land), Dafalgan (France) Tylenol (Austria,
The metabolite AM404 affects several important Canada, USA, Spain), Alvedon (Norway, Swe-
targets in the nervous system involved in pain. den, UK).
AM404 inhibits purified COX-1 and COX-2 and Combination with codeine: Co-Tylenol
prostaglandin formation in lipopolysaccharide- (USA).
stimulated macrophages. AM404 is also a po- Combination with tramadol: Zaldiar (Ger-
tent activator of the ion channel TRPV1 (tran- many, Austria, France, Spain, Switzerland), Tra-
sient receptor potential cation channel, former macet (UK), Ultracet (USA).
classified as the vanilloid receptor VR1 ) and has Paracetamol is also used in many generic for-
an effect on cannabinoid CB1 receptors. Both mulations.
TRPV1 and CB1 receptors are involved in pain
and in thermoregulatory pathways. Propacetamol [66532-85-2], 4-
(acetylamino)phenyl N,N-diethylglycinate,
C14 H2 ON2 O3 , M r 264.33, is a soluble glycine
prodrug derivative of paracetamol. It is used as
hydrochloride ([66532-86-3], C14 H2 ON2 O3 ·
HCl, M r 300.79), for intramuscular or intra-
venous application and is rapidly metabolized
to free paracetamol [70].
2.3. Anthranilates
with 1-(3-chloropropyl)-4-(2-hydroxyethyl)-pi-
perazine obtained from 1-(2-hydroxyethyl)pi-
perazine and 1-bromo-3-chloropropane by
means of sodium methanolate in DMSO at
105◦ C gives N-[3-(N-benzoyl-N , N -di-n-
propyl-dl-isoglutaminyl)oxypropyl]-N -(2-hy-
droxyethyl)piperazine, which is then conden-
sated with Indomethacin (1-(p-chlorobenzo-
yl)-5-methoxy-2-methylindole-3-acetic acid)
by means of dicyclohexylcabodiimide and
NaHCO3 in ethyl acetate [103, 104] (see on
top).
Proglumetacine is a prodrug of acemetacine
[105] and is used for the treatment of os-
teoarthritis, rheumatoid arthritis, gout, ankylos-
ing spondylitis, and pain [106].
Trade names: Protaxon (Gemany), Proxil
(Italy).
Synthesis:
a) The reaction of deoxyanisoin with hydroxyl-
amine in methanol gives the corresponding
1,2-bis(4-methoxyphenyl)ethanone oxime,
which is cyclized with ethyl acetate by means
of n-butyllithium in tetrahydrofuran yield-
ing 3,4-di(4-methoxyphenyl)-5-methylisox-
azole. Finally, this compound is condensed
with CO2 with n-butyllithium as catalyst
in tetrahydrofuran to yield mofezolac [130,
131]. The synthesis with ClCO2 C2 H5 in-
stead of CO2 is described in [132, 133].
Clinical use: Zaltoprofen is a non-steroidal yl)hydratropic acid, C13 H14 ClNO2 , M r 251.71,
anti-inflammatory drug originated by Nippon mp 98-100 ◦ C.
Chemiphar and jointly developed with Zeria. Synthesis:
It has been available on the market in Japan
a) Ethyl 4-nitrophenylacetate is methylated
since 1993 for the relief of pain and inflamma-
with NaH – CH3 I in dimethylformamide –
tion resulting from arthritis deformations, pe-
toluene to form ethyl 2-(4-nitrophenyl)-
riarthritis of the shoulder, neck-shoulder-arm
propionate, which is reduced with H2
syndrome, rheumatoid arthritis, lumbago, post-
over Pd/C in EtOH – H2 O to ethyl 2-(4-
surgery pain, trauma, and tooth extraction and
aminophenyl)propionate. This product is
used in oral doses of 80 mg [176]. According to
acetylated with acetic anhydride to yield
studies, the analgesic effects of zaltoprofen may
ethyl 2-(acetylaminophenyl)propionate. Al-
involve the inhibition of bradykinin-2 receptor-
ternatively, ethyl 4-aminophenylacetate can
mediated responses in primary afferent neurons
be acetylated with acetic anhydride to
[177, 178]. Although zaltoprofen is marketed as
ethyl 4-acetylaminophenylacetate followed
a racemate the anti-inflammatory activity resides
by methylation with CH3 I and sodium in
in the (S)-enantiomer.
liquid NH3 to give ethyl 2-(4-acetylami-
Trade name: Peon, Soleton (Japan).
nophenyl)propionate [179, 180]. Ethyl 2-(4-
acetylaminophenyl)propionate is chlorinated
Pirprofen [31793-07-4], rac-3-chloro-4-
with Cl2 in acetic acid to ethyl 2-(3-chloro-
(2,5-dihydro-1H-pyrrol-1-yl)-α-methylbenz-
4-acetylaminophenyl)propionate. This inter-
eneacetic acid, rac-3-chloro-4-(3-pyrrolin-1-
mediate is hydrolyzed with HCl in EtOH
Analgesics and Antipyretics 25
2.7.1. Pyrazolidine-3,5-diones
M r 308.37, mp 105 ◦ C; sodium salt [129-18-0], 335.34, mp 265–271 ◦ C (decomp.); sodium salt,
C19 H19 N2 NaO2 , M r 331.36; calcium salt (2 : 1) C14 H12 N3 NaO5 S, M r 343.29, mp 270–272 ◦ C.
[36298-23-4], C38 H36 CaN4 O4 , M r 656.83; pi- Synthesis [48, 231–233]:
perazine salt (1 : 1) [4985-25-5], C19 H20 N2 O2 ·
C4 H10 N2 , M r 395.51, mp 140–141 ◦ C.
Synthesis [48, 228]:
which is esterified with PCl5 and metha- interleukin-6, both of which could contribute
nol to the methyl ester. Condensation with to its potent anti-inflammatory and analgesic
methyl iodoacetate by means of NaH in action [237]. It is used orally (8–24 mg/d) for
DMF gives methyl 5-chloro-3-[N-(methoxycar- the treatment of mild to moderate pain includ-
bonylmethyl)-N-methylsulfamoyl]thiophene- ing postoperative pain, rheumatoid arthritis, os-
2-carboxylate, which is cyclized with sodium teoarthritis, and ankylosing spondylitis [238].
methoxide in methanol yielding methyl 6- Lornoxicam shows a high binding to plasma
chloro-4-hydroxy-2-methyl-2H-thieno[2,3-e]- protein and in contrast to other oxicams a short
1,2-thiazine-3-carboxylate-1,1-dioxide. Finally plasma half-life of 3 to 5 h [236].
this compound is treated with 2-aminopyridine Trade names: Telos (Germany), Taigalor
in refluxing xylene [235]. (Italy), Xefo (Austria, Denmark, Italy, Switzer-
land, UK).
tion with NaH in DMF yields dimethyl-5-benzo- the tromethamine salt. Due to a number of se-
yl-1,2-dihydro-3H-pyrrolo[1,2-α]pyrrole-1,1- vere side effects including gastrointestinal dis-
dicarboxylate, which is finally hydrolyzed and turbances, impairment of liver functions, renal
decarboxylated with KOH in refluxing methanol failures, skin irritations, and other hypersensi-
[48, 249–253]. tivity reaction it has been withdrawn in many
countries.
Trade names: Acular (UK, USA), Droal
(Spain), Tora-Dol (France, Italy), Toradol (UK,
USA).
The compound is well tolerated and gas- (valdecoxib), with propionic anhydride in a so-
trointestinal side effects were significantly lower lution of triethanolamine (TEA) and 4-dimeth-
than after treatment with COX-1 inhibitors like ylaminophenol (DMAP) in tetrahydrofuran
ibuprofen or naproxen [300, 301] The meta- gives N-[4-(5-methyl-3-phenylisoxazol-4-
analysis of all clinical trials in osteoarthritis and yl)phenylsulfonyl]propionamide, which is
rheumatoid arthritis gave no indication of an in- treated with NaOH in ethanol to give the sodium
creased risk of cardiovascular side effects [302]. salt of parecoxib [79, 306, 307].
Liver function tests showed a moderate and re- Clinical use: Parecoxib [77, 78, 80] is a third-
versible increase in liver enzymes [303]. generation COX-2 inhibitor. Parecoxib is a pro-
Lumiracoxib has a high oral bioavailability drug of valdecoxib with aqueous solubility suffi-
of about 74 %, is rapidly absorbed, reaches its cient for the use in parenteral formulations. The
peak plasma concentrations within 2 h and is compound induced potent pain inhibition in den-
strongly bound to plasma protein. The com- tal, gynecological and orthopedic surgery and
pound is strongly metabolized, is devoid of ac- produced less gastrointestinal side effects than
tive metabolites and has a plasma elimination conventional COX-1 inhibitors [81].
half-life of about 4 h [304]. Despite the short Parecoxib is rapidly hydrolyzed in the liver
half-life, a once-daily administration in doses of to its active metabolite valdecoxib. Plasma
100–400 mg is recommended. A dose of 100 mg peak concentrations for valdecoxib are achieved
is used for the symptomatic relief of osteoarthri- within 1.1 to 3.5 and 0.27 to 2 h after i.m.
tis and 400 mg for short-term relief of moderate and i.v. administration, respectively. The elim-
to severe pain, associated with dental or ortho- ination half-life for parecoxib is 15 to 35 min
pedic surgery. As with other COX-2 inhibitors, and 5 min for i.m. and i.v. administration, re-
the compound should be used with appropriate spectively. Metabolism of parecoxib follows the
precaution. metabolism of the active metabolite valdecoxib
Trade name: Prexige (EU, USA). which is a substrate for CYP3A4 and CYP2C9.
Parecoxib was used in doses of 20 and 40 mg
Parecoxib [198470-84-7], (free acid) of its sodium salt in the short-term treatment of
[198470-85-8], N-(4-(5-methyl-3-phenyl- postoperative pain.
isoxazol-4-yl)phen-ylsulfonyl)propionamide Parecoxib together with valdecoxib was with-
sodium salt C19 H17 N2 O4 SNa, M r 392.409, drawn from the market because of an increased
crystals, mp 271.5–272.7 ◦ C. risk of cardiovascular side effects [312, 313].
Trade names: Dynastat, Rayzon, Xapit (com-
pound withdrawn from EU and US markets).
dized with 2KHSO5 · KHSO4 · K2 SO4 (oxone) tion of dibutylurea (DBU) effected the cycliza-
[314]. tion to provide rofecoxib as the final product.
the risk of heart attack and stroke [31]. It is be- Valdecoxib is converted in rodents and dogs,
ing discussed with the health authorities that a and in a low abundance in humans, by hy-
relaunch should be possible under appropriate droxylation of the methyl group to an ac-
safety regulations [322]. tive metabolite (4-(5-hydroxymethyl-3-phenyl-
Trade name: Vioxx (EU, USA; currently isoxazol-4-yl)benzenesulfonamide).
withdrawn from the market). Valdecoxib induced severe allergic skin re-
actions [330, 331] which, together with an in-
Valdecoxib [181695-72-7], 4-(5-methyl- creased risk of cardiovascular side effects [332]
3-phenylisoxazol-4-yl)benzenesulfonamide, was the reason why the compound, together with
C16 H14 N2 O3 S, M r 314.366; mp 172-173 ◦ C. its prodrug derivative parecoxib, was withdrawn
Synthesis: Deoxybenzoin is converted to from the market in 2004.
the corresponding oxime by treatment with Trade name: Bextra (EU, USA; currently
hydroxylamine under basic conditions with withdrawn from the market).
sodium acetate in aqueous ethanol or in toluene
in presence of potassium hydroxide in absolute
ethanol. The treatment of the oxime under nitro- 3. Centrally Acting Analgesics
gen with two equivalents of butyllithium in tetra-
hydrofuran is followed by cyclization in ethyl 3.1. Opioids
acetate or acetic anhydride to the isoxazoline
derivative. Finally, treatment of the isoxazoline The term “centrally acting analgesics” is used
with cold chlorosulfuric acid followed by reac- for compounds which inhibit the pain reaction
tion of the intermediate with aqueous ammonia predominantly within the central nervous sys-
affords the desired product [79–81, 156, 316, tem. Most of them induce a very powerful pain
323]. inhibition and are thus named synonymously
“strong analgesics”. The most important repre-
sentatives of this group are the opioids [333]. In
respect to structural features [334] opioids can
be separated into three groups:
• The first group contains the natural products
morphine, codeine, and thebaine, which are
isolated from opium. The group contains in
addition various semisynthetic derivatives of
the three compounds, which are prepared by
chemical modifications of these natural prod-
ucts.
• The second group encompasses fully syn-
thetic compounds which often have a to-
Clinical use: Valdecoxib [79, 324–326] is tal different chemical structure than the
a third-generation COX-2 inhibitor. It shows semisynthetic analogues, but interact with
about 30-fold selectivity for COX-2 in a whole- the same opioid receptors and show the same
blood assay. The compound has a very low sol- spectrum of analgesia and side effects as the
ubility in water and can only be administered natural compounds. For both groups together
orally. For parenteral administration, a water- the older name “opiates“ is still in use.
soluble prodrug derivative, parecoxib, was de- • The third group consists of naturally occur-
veloped in parallel. Valdecoxib showed strong ring and synthetic peptides with opioid-like
analgesic and anti-inflammatory properties and properties. The opioid peptides were disco-
was developed for the treatment of osteoarthritis, vered during the search for endogenous lig-
rheumatoid arthritis [327] and acute and chronic ands of the opioid receptors and share the
pain of various origin [328] including migraine same action and side effect profile with the
headache [329]. nonpeptidic compounds, but they are not in
clinical use.
Analgesics and Antipyretics 43
Opioids interact with specific receptors (re- receptor (ligand= ketazocine) and the σ-receptor
ceptor ligands) and they can act as pure agonists, (ligand = SKF 100 81). This was later confirmed
as partial agonists (agonists with a reduced in- by binding experiments with radioactive-labeled
trinsic activity) or as antagonist (binding without ligands and by the different binding and action
intrinsic activity). Only few compounds of the profiles of the endogenous opioid peptides, the
opioid family are selective ligands for a single enkephalins and endorphines [342]. Up to now,
type of opioid receptor (Table 3). Most of them three types of receptors, the µ-, κ-, and δ-opioid
bind with similar or different affinities to more receptor have been confirmed [343, 344], the σ-
than one receptor type and the pharmacological receptor is no longer considered to be an opioid
effect is the result of the combined effects on all receptor.
receptors involved. Opioids may act as a full or More recently, a fourth opioid receptor type,
partial agonist on one receptor type and as an named opioid receptor like (ORL1) receptor has
antagonist on the other. These compounds are been identified [345]. The receptor was detected
named mixed agonist – antagonists and they are as a c-DNA, which coded for a protein with
an important subgroup of opioid analgesics (see opioid receptor-like properties. Within a short
Section 3.1.2.1). Opioid analgesics are the most time, the endogenous ligand, a peptide named
important drugs for the treatment of moderate, nociceptin, was isolated, which, depending on
severe, and very severe pain. the place and route of application, induced pro-
Humans and most animal species are nociceptive or anti-nociceptive actions. The full
equipped with opioid receptors and endogenous spectrum of biological activity of nociceptin and
ligands. This endogenous opioid system [336] is the physiological role of the ORL-1 opioid re-
widely distributed within the body, it is phyllo- ceptor in pain processing is still under investi-
genetically very old and is expressed in all ver- gation [367].
tebrates. A high density of opioid receptors is
found in the brain [337] and in the spinal cord, Subtypes of the Different Opioid Recep-
where it is involved in pain inhibition and ad- tors. Corresponding to other receptor systems,
ditionally in many other central regulatory pro- binding studies and functional investigations in-
cesses. In addition to the CNS localization, opi- dicate that subtypes of opioid receptors exist
oid receptors are expressed in many peripheral [346, 347]. Within the µ-receptor two subtypes,
organs [338]. Of great importance are the opioid the µ-1 and µ-2 receptor have been described.
receptors of the gastrointestinal system, which It was postulated by some investigators [347]
regulate stomach emptying, gut motility, and that analgesia and opioid side effects are differ-
intestinal fluid secretion. Opioid receptors are ently distributed between µ-receptor subtypes,
found in cells of the immune system and periph- which should allow separation of analgesia from
eral opioids seem to be involved in the regulation the unwanted opioid side effects. According to
of inflammatory and immunological processes Pasternak and Wood [347], analgesia should be
[339]. In addition to the outstanding role in the mediated by the µ-1 receptor site, whereas res-
central pain inhibition, action at peripheral opi- piratory depression and addiction is mediated
oid receptors, which are expressed in high quan- via the µ-2 receptor subtype. But in contrast to
tities during inflammation and immune stimula- binding experiments, the functional separation
tion, may add to central pain inhibition [340]. of the µ-1 and µ-2 subtype is more equivocal
and a clear separation of analgesia from res-
Opioid Receptor Types. Differences in piratory depression and addiction potential had
analgesic activity and in the side effect pro- never been found within the µ-opioids. There-
file of synthetic opioids reinforced speculations fore, a differentiation of µ-opioid analgesics ac-
that more than one type of opioid receptor ex- cording to subtype specificity is no longer main-
ists and is involved in the analgesic activity of tained.
these compounds. Martin and coworkers inves- The subtypes of µ-opioid receptors could
tigated in 1960 these differences in a specially not be confirmed in cloning experiments [348].
developed test model, the chronic spinal dog Therefore, possible heterogeneity of opioid re-
[341] and postulated three types of opioid recep- ceptor subtypes must result from a later modifi-
tors, the µ-receptor (ligand = morphine), the κ- cation which is independent from the gene level.
44 Analgesics and Antipyretics
Possible variations could include splice variants, a novel opioid-like cDNA was isolated [351],
receptor association, posttranslational modifica- which coded for an unknown opioid receptor.
tions (e.g., glycosidation) or coupling with dif- The new receptor had many similarities with the
ferent transduction mechanisms. classical opioid receptors [352] and was added
as the forth member to the opioid receptor family
Endogenous Opioid Peptides. For each under the name ORL-1. All four opioid recep-
class of opioid receptors endogenous ligands tors have been identified in humans. All together,
of peptidic structure exist, which show a dis- they show a high degree of structural identity,
tribution within the body corresponding to that which corresponds to their widely overlapping
of the receptor. Three distinct families of lig- biological functions [348, 353].
ands with various members have been identi- All opioid receptors belong to the group
fied and named endorphins, enkephalins, and of pertussis toxin sensitive G-protein-coupled
dynorphins (Table 2). The opioid peptides are receptors of the rhodopsin family with seven
split off in the organism from specific precursor transmembrane spanning hydrophobic domains.
polypeptides. Enkephalins are derived from pro- The N-terminal part is oriented to the outer side
enkephalin and interact with µ- and δ-opioid re- of the cell membrane and is involved in the selec-
ceptors. The precursor molecule of endorphin is tion and binding of the receptor specific ligands.
pro-opiomelanocortin (POMC), which addition- Studies with chimeric or point mutated recep-
ally releases peptidic hormones such as α-MSH, tors indicate that predominantly the second and
ACTH and β-LPH. Endorphins are specific lig- third extracellular loop determines receptor se-
ands of the µ-opioid receptor type. Dynorphins lectivity. The N-terminal sequence contains sev-
interact with the κ-opioid receptor and are de- eral free amino groups which can be conjugated
rived from pro-dynorphin. ORL binding sites with sugar residues. The carboxy-terminal is di-
have recently been identified together with its rected into the inner part of the cell and is in-
endogenous peptidic ligand named nociceptin volved in the signal transduction cascade. The
(Table 2). carboxy-terminal contains groups which can be
Various further natural and synthetic opioid phosphorylated and which are involved in recep-
peptides, acting as agonists or antagonist at the tor internalization and inactivation. The seven
different opioid receptors have been discovered. transmembrane regions are connected by extra-
They have the same effect and side effect profile cellular and intracellular loop regions of differ-
as their nonpeptidic counterparts. Opioid pep- ent length. Comparing the sequence of the µ-, δ-,
tides are only used experimentally and no com- and κ-receptor reveals that the highest degree
pound has reached clinical application. of similarity is located in the transmembrane
regions and in the intracellular loop, whereas
Molecular Pharmacology of Opioid Re- the external loops and both terminal regions are
ceptors. The first successfully cloned opioid re- more heterogeneous. The external loops and the
ceptor was the δ-opioid receptor of the mouse, terminal part are involved in the selection and
which was in parallel described by the groups binding of the ligands and contain the structural
of Kieffer [349] and Evans [350]. Both used elements, which determine the receptor selectiv-
neuroblastoma-glioma hybridoma cells which ity.
expressed a high density of δ-receptors in their
membrane. The isolated receptor protein con- Transduction Mechanisms of Opioid Re-
sisted of 372 amino acids and had a mo- ceptor Interaction. As described above, all
lecular mass of 40 644. The amino acid se- four receptor types belong to the group of G-
quence showed a partial overlap with the recep- protein-coupled receptors (GPCRs) [354]. Ag-
tors of somatostatin (37 %), angiotensin (31 %) onistic binding at the receptor induces associ-
and interleukine-8 (22 %). Similar to the so- ation of the α-, β-, and γ- subunit of the G-
matostatin receptor, seven hydrophobic domains protein which triggers several biochemical reac-
were identified by which the receptor is in- tions within the cell [355–358]. Most important
serted into the lipid bilayer of the cell mem- for the pharmacological effects of the opioids
brane. Shortly thereafter the rat and human δ- are:
receptors were cloned. With the same technique
Analgesics and Antipyretics 45
Table 2. Mammalian endogenous opioid peptides
Precursor Endogenous peptide Amino acid sequence
Pro-opiomelanocortin β-endorphin YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
361]. In these animals, morphine did neither δ-Opioid Receptors. In contrast to µ- and κ-
show an analgesic effect nor side effects. There receptors, indications for a prominent role of δ-
was no respiratory depression and no inhibi- receptors in the pain process are less obvious
tion of gastrointestinal motility and secretion. [364, 365]. There is a broad but still controversial
In behavioral models in µ-knockouts, morphine discussion concerning a genuine analgesic effect
did not induce liking or any other signs of ad- mediated by δ-1 or δ-2 receptors, because anal-
diction and repeated treatment with morphine gesia is scarcely observed in compounds with
did not produce signs of tolerance and physical pure δ-agonistic activity.
dependence. ORL-1 Receptors. The ORL-1 receptor [352,
κ-Opioid Receptors. Activation of κ- 366] differs in its peptide sequence from the clas-
receptors induces a clinically relevant pain in- sical opioid receptors. In contrast to these, ORL-
hibition [362, 363], which seems to be less 1 receptor activation at least at the supraspinal
efficacious than µ-receptor mediated analge- level has a pronociceptive effect and induces
sia. κ-Receptor interaction is a common action pain. Supraspinally induced release of spinal
component of the so-called partial opioid ago- CCK-8, NMDA or PGE-2 is discussed as the
nists or agonists – antagonists, such as penta- mechanism of pronociceptive activity. Spinal
zocine, nalbuphine, and butorphanol (see Sec- application of nociceptine incontrary induces
tion 3.1.1.1). The most prominent side effects of anti-nociception. With the aid of nonpeptidic
κ-activation are sedation and diuresis. In con- ORL-1 agonists and antagonists, which are cur-
trast to µ-agonists, which induce well-being and rently under development, it will be possible to
euphoria, activation of κ-receptors in the limbic elucidate the contribution of the ORL-1 opioid
system induces dysphoria and other unpleasant system to pain processing and to other physio-
psychic effects, such as hallucinations and spa- logical processes [367].
tial disorientation. The dose range of analgesia
and psychic side effects partly overlap and this Location of Opioid Receptors in the Pain
interferes with the medical use of κ-receptor ag- Pathway. The endogenous opioid system [368]
onists. In compounds with a marked κ-agonistic is the most important component of the pain in-
component (cyclazocine, nalorphine) the dys- hibitory system of the body. Opioids act at dif-
phoric side effects are so prominent that the ferent levels of the pain pathway and their action
compounds could not be used for therapeu- interferes with different aspects of the pain pro-
tic purposes. This may explain why despite an cessing [369, 370].
intensive search for κ-selective analgesics, no Opioids induce:
selective κ-agonist has ever reached the clinical • Inhibition of the transmission of the pain sig-
use. nal
Analgesics and Antipyretics 47
• Inhibition of the emotional aspect of pain clearly shown in well-controlled clinical stud-
• Inhibition of pain realization ies [372]. The most important use of opioids
Pain processing is inhibited at the spinal and in acute pain treatment is postoperative pain,
supraspinal level. Spinal opioid receptors are lo- whereas treatment of cancer pain, often accom-
cated pre- and postsynaptically at interneurons panied by a neuropathic pain component, is the
of the substantia gelatinosa of the dorsal horn. classical domain of chronic opioid treatment.
The opioid interneurons inhibit the release of
excitatory transmitters and reduce the transmis- Opioid Side Effects.
sion of the pain signal from the primary afferents Respiratory Depression. Opioids induce
to the secondary neurons of the spinal ascending respiratory depression via inhibition of the res-
pain pathway. Supraspinally, opioids are located piratory center of the medulla oblongata, which
in different regions of the brainstem, in the peri- respond to the pCO2 content of the blood [373,
aquaeductal grey matter, in the limbic system, in 374]. The inhibitory effect is more prominent in
the thalamic nuclei, in the basal ganglia, and in respect to the respiratory frequency than to the
the cortex. Cortical and thalamic localization is volume of respiration. At higher opioid dosages,
involved in the perception of the pain stimulus, respiration becomes irregular and grasping oc-
cortical regions in addition in the localization of curs. In awake persons, respiratory depression
the origin of the pain focus. by opioids can be voluntarily compensated over
Opioids in the different parts of the limbic a broad dose range. Respiratory impairment is
system suppress the emotional component of not a prominent feature in awake pain patients,
pain and the pain suffering. In the formatio retic- because pain itself is a strong stimulus for res-
ularis, they inhibit the pain induced activation of piration.
autonomous functions, such as increase in respi- Opioid-induced respiratory depression is
ration, increase in blood pressure and sweating. augmented by other CNS-depressant com-
Inhibitory actions at the formatio reticularis are pounds such as sedatives and hypnotics. Res-
the origin of the most prominent side effects of piratory depression becomes an important side
the opioids, like respiratory depression, brady- effect when opioids are used for postoperative
cardia and the centrally mediated part of the gas- pain treatment, because the anesthetic agent and
trointestinal inhibition. most adjuncts of anesthesia induce a long last-
In addition to the inhibitory effect at the as- ing depressant effect on respiration, which can
cending pain transmission, opioids activate a increase the opioid effects up to respiratory ar-
descending pain inhibitory system, which orig- rest. Therefore a careful supervision of respira-
inates from different centers of the pons and tion during the postoperative period is manda-
medulla, such as nucleus coeruleus, areas of the tory [375]. Opioid-induced respiratory depres-
periaquaeductal grey matter, and areas of the sion can be interrupted by the opioid antagonist
raphe nuclei. The descending nerve fibers termi- naloxone. Naloxone has a short duration of ac-
nate at the spinal interneurons in noradrenergic tion and repeated applications may be necessary
and serotoninergic inhibitory synapses, which to successfully counteract the effect of longer
suppress the ascending pain signal. Thus, opi- acting opioids. Highly potent opioids induce se-
oids inhibit the spinal pain processing by two vere respiratory depression in the higher dose
mechanisms, one is a direct pre- and postsynap- range. In addition, they induce a stiffness of the
tic inhibition of the ascending pain pathway and chest musculature [376], called chest rigidity or
the other is a centrally-mediated activation of the “wooden chest”, which is mediated via stimula-
descending pain inhibitory system. tion of dopamine release in the nucleus cauda-
tus. Chest rigidity further increases the respira-
Use of Opioids in Pain Treatment. Opioids tion impairment by these compounds. Therefore
are used for the treatment of moderate to se- higher doses of potent opioids such as fentanyl
vere or very severe pain of acute or chronic type and analogues, as used for anesthesia, need arti-
[371]. Nearly all forms of pain are sensitive to ficial or at least assisted ventilation.
opioid treatment and in contrast to traditional Cardiovascular Effects. Nearly all opioids
opinions even neuropathic pain is reasonably induce bradycardia [377], most likely mediated
sensitive to higher doses of opioids. This was
48 Analgesics and Antipyretics
via central stimulation of the vagus nerve. The Emetic Activity. Nausea and emesis are com-
cardiovascular depression of most opioids is mon unpleasant side effects of opioids [382,
moderate and only the stronger opioids of the 383]. They are most intensively experienced at
fentanyl group induce a more prominent effect. the beginning of the treatment. During chronic
Morphine and some analogues induce a non- application, tolerance may occur, which reduces
opioid receptor mediated release of histamine, the emetic sequelae. Nausea and emesis are in-
which can result in a decrease in blood pressure duced via activation of chemoreceptors, which
and a compensatory tachycardia. are located in the trigger zone of the area
Gastrointestinal Effects. Opioids induce an postrema of the formatio reticularis. The recep-
inhibitory effect on gastrointestinal motility and tors are located at the tissue surface and contact
fluid secretion [378]. The effect is peripherally the circulating blood. Thus the emetic effect of
and centrally mediated. The peripheral part is opioids is not mediated centrally, which means
related to µ- and κ-receptors at intestinal or- after penetration of the blood – brain barrier, but
gans, which are densely equipped with opioid rather peripherally via the part of the compound,
receptors. The receptors are located at parasym- which is distributed in the circulating blood.
pathic ganglions and inhibit the release of acetyl- After passage through the blood – brain bar-
choline, which stimulates the contraction of the rier, opioids have an antiemetic effect [384]. The
smooth muscles. Inhibition of the intestinal fluid emesis inhibition is induced via blockade of an
secretion is mediated via inhibition of adenylate emesis center located in a more central area
cyclase. The intestinal effects of opioids extend of the formatio reticularis. This explains why
to all parts of the gut and results in inhibition the emetic effect of opioids is most prominent
of stomach emptying and inhibition of secretion immediately after application, especially after
and motility in the duodenum, jejunum, colon, rapid intravenous administration and is reduced
and rectum. or terminated when the compound has reached
Reduced motility and secretion can let to con- the CNS. The more hydrophilic opioids such as
stipation, which is the most prominent side ef- morphine have stronger emetic side effects than
fect of chronic opioid treatment [379]. Opioid- lipophilic compounds like methadone or fen-
induced constipation can increase up to mega- tanyl [385], which are rapidly transported into
colon or paralytic ileus. Therefore chronic opi- the CNS.
oid treatment should be accompanied by con- Tolerance and Dependence. µ-Opioid com-
comitant use of laxatives. Besides their periph- pounds induce a feeling of well being and eu-
eral actions, opioids are involved in the central phoria, which is mediated by the release of
regulation of intestinal functions which is lo- dopamine within the limbic system. κ-Opioids
cated in the formatio reticularis. This explains induce an opposite effect with dysphoria, dis-
why the intestinal side effects of opioids are not orientation, and hallucinations [386]. Repeated
restricted to the more hydrophilic compounds activation of the µ-opioid rewarding system
such as morphine, but are seen likewise in the may induce a psychological dependence, which
more centrally active lipophilic analogues. Dur- leads to addiction and a compulsory behavior of
ing chronic opioid treatment a varying degree of drug seeking [387]. In addition, higher opioid
tolerance towards the intestinal side effects may dosages, as used for nonmedicinal purposes, in-
occur. duces tolerance and as a consequence a further
The intestinal inhibitory action of opioids can increase of the dose to achieve the intended ef-
be used for the treatment of diarrhea [380]. The fect. In the course of the tolerance development
clinically most important antidiarrheal opioid is opioid users becomes physically dependent on
loperamide [381]. After oral administration, lop- the supply of the compound [388] and suspen-
eramide acts locally within the gastrointestinal sion of the treatment or blocking of the opi-
tract. After parenteral administration, the com- oid receptors with an antagonist induces a with-
pound is rapidly inactivated and does not reach drawal reaction, characterized by strong dyspho-
the CNS. Therefore loperamide does not show ria, restlessness, pain, and various symptoms of
the typical central opioid side effects, has no autonomic dysregulation, like diarrhea, shiver-
analgesic action and has no abuse potential. ing, chills and cardiovascular collapse.
Analgesics and Antipyretics 49
The euphorigenic effect of opioids, the with water, precipitation with aqueous Na2 CO3 -
“opioid kick”, is more intensely induced by solution, washing of the precipitate with ethanol
lipophilic compounds such as diacetylmorphine and dissolving in diluted acetic acid [392–395].
(heroin), which rapidly penetrates into the CNS.
The feeling of euphoria on the one hand and the
absence of well-being on the other hand is more
prominent when brain concentrations of the opi-
oid change rapidly. This intensifies drug seeking
behavior and psychological as well as physical
dependence.
In contrast to recreational use, chronic pain
treatment with opioids afforts constant dosing Morphine in the conventional presentation
and has only a limited risk to induce psycho- (left) and in a stereoformula according to IU-
logical dependence and drug addiction [389]. A PAC rules (right)
proper dosing during chronic pain treatment can The total synthesis of (-)-morphine had been a
often postpone tolerance development for longer challenging target for organic chemists for many
time periods. The most important precaution to decades [316, 334, 396]. Although a number of
avoid tolerance and dependence development is successful syntheses were developed, only a few
to ensure constant plasma levels of the opioid, could produce the compound in an enantio- and
which have to be high enough to give complete diastereo-controlled manner [397–399].
pain relief. This can be reasonably achieved by Morphine biosynthesis: The studies on the
oral administration of retarded formulations or biosynthesis of morphine have been performed
by an opioid patch [390]. Breakthrough pain, on cell cultures mainly of Coptis japonica and
which is often induced by a fluctuation in pain species of Thalictrum. The overall biosynthetic
intensity, should be rapidly compensated by ad- pathway from tyrosine to morphine is depicted
ditional treatment with an immediate release for- in Figure 3.
mulation of the same or a similar opioid. Opioid receptor binding: Morphine has a
high (nanomolar) binding affinity for the µ-
opioid receptor. The affinity for the δ- and κ-
3.1.1. Opioids in Clinical Use opioid receptor is at least 10-fold lower.
Clinical use: Morphine is a very potent anal-
3.1.1.1. Morphine and Morphinane gesic and still the “gold standard” for the treat-
Derivatives ment of severe, acute, and chronic pain [400].
The compound is used in various salt forms,
Morphine [57-27-2], (5α,6α)-7,8-di- preferentially as the hydrochloride or sulfate.
dehydro-4,5-epoxy-17-methylmorphinan-3,6- Morphine can be administered orally or par-
diol, C17 H19 NO3 , M r 285.34, mp 254 ◦ C (de- enterally. Oral administration is preferred for
comp., 197 ◦ C is reported for a metastable chronic pain treatment and various slow-release
25
phase), [α]D −132◦ (c = 1, CH3 OH); hy- forms have been developed to reduce the ap-
drochloride [52-26-6], C17 H19 NO3 · HCl, plication frequency to 1–2 times per day. Par-
25
M r 321.80, mp 200 ◦ C (trihydrate), [α]D enterally, morphine is used in doses of 10
◦
−113.5 (c = 2.2, water); sulfate (2 : 1) [64- mg mostly for postoperative pain and self-
31-3], C17 H19 NO3 · 1/2 H2 SO4 , M r 668.76; administration devices have been developed for
sulfate pentahydrate [6211-15-0], C17 H19 NO3 · patient-controlled analgesia (PCA).
1/2 H2 SO4 · 5H2 O, M r 758.85, mp 250 ◦ C (de- Other morphine preparations are under eval-
25
comp.), [α]D −108.7◦ (c = 4, water). Mor- uation for local administration, e.g., inhalation
phine is the main alkaloid of opium, isolated via the broncho-pulmonal way.
from the milky liquid of the poppy seed capsule Pharmacokinetic properties: Morphine is ex-
[108]. tensively metabolized by glucuronidation at
Preparation: Morphine is obtained by extrac- both hydroxyl groups at positions 3 and 6 and by
tion of poppy capsules or opium (opium contains N-demethylation [401, 402]. The 3-glucuronide
9–14 % morphine, depending on the source) has a minimal opioid receptor binding affinity
50 Analgesics and Antipyretics
and is devoid of analgesic action, whereas the atives. Other frequent side effects are nausea,
morphine-6-glucuronide has a similar binding vomiting, dizziness, and sedation.
affinity as morphine, is analgesically active and Morphine is a controlled substance. It has a
seems to be involved in pain inhibition during high euphorigenic potential and is liable to abuse
chronic oral treatment with morphine [403]. De- and dependence. The euphorigenic effect is less
spite the polar sugar residue the glucuronide can expressed in the context of pain treatment and
pass the blood – brain-barrier. The morphine- tolerance and dependence can largely be avoided
6-glucuronide is being tested as an indepen- by appropriate dosing and application intervals,
dent opioid analgesic. The N-demethyl deriva- securing constant and pain-appropriate plasma
tive normorphine is analgesically active, but has levels of the compound.
a lower µ-receptor affinity, a lower potency and Trade names: M-Long (Germany), MST con-
a shorter duration of action than morphine. Nor- tinuous (Germany, UK), Capros (Germany), Ka-
morphine is not in clinical use. panol (Germany, USA), Moscontin (France), In-
The main metabolites of morphine are shown fumorph (USA), Oxamorph (USA).
in Figure 4. Morphine is also marketed in many generic
formulations.
affinity of the metabolites 6-acetylmorphine and [421] and as antitussive [422] (→ Cough Reme-
morphine [415]. dies, Section 2.1.1). Dihydrocodeine is mostly
Clinical use: Diamorphine [416] is a used as oral immediate- or sustained-release for-
lipophilic morphine derivative which rapidly mulations [423]. For pain treatment the dose
penetrates into the central nervous system, range is 30–80 mg, for cough inhibition doses
where 6-acetylmorphine and morphine are re- are in the range of 10 mg.
leased [417, 418]. The rapid brain access induces Dihydrocodeine induces morphine-like side
an immediate onset of action and this seems to be effects, but the intensity is less pronounced.
the reason for the strong euphorigenic effect and Chronic treatment may produce dependence,
the high abuse potential. Because of the wide- and abuse by opioid addicts has been reported.
spread abuse, therapeutic application is prohib- Trade names: Paracodin (Germany), Di-
ited in many countries including Germany and codin (France), DHC Continus (UK), Synalgos
the US. In other countries like the UK, parenteral (USA).
heroin is used for the relief of severe pain, espe-
cially in terminal illness. The compound is more Etorphine [14521-96-1], [5α,7α(R)]-4,5-
potent than morphine, but has a similar action epoxy-3-hydroxy-6-methoxy-α,17-dimethyl-
and opioid side effect profile. α-propyl-6,14-ethenomorphinan-7-methanol,
Trade name: Diagesil (UK). C25 H33 NO4 , M r 411.53, mp 214–217 ◦ C; hy-
drochloride [13764-49-3], C25 H33 NO4 · HCl,
Dihydrocodeine [125-28-0], (5α,6α)- M r 447.99, mp 266–267 ◦ C.
4,5-epoxy-3-methoxy-17-methylmorphinan-6- Synthesis: Starting from thebaine etorphine
ol, C18 H23 NO3 , M r 301.38, mp 112–113 ◦ C; can be synthesized in a similar way as buprenor-
tartrate (1 : 1) [5965-13-9], C18 H23 NO3 · phine (see page 66) [424–427].
C4 H6 O6 , M r 451.47, mp 192–193 ◦ C (com-
mercial medicinal grade usually melts at 186–
25
190 ◦ C, [α]D −72◦ to −75◦ (c = 1.0, water).
Synthesis: Hydrogenation of codeine yields
dihydrocodeine [48, 419, 420].
Synthesis [48, 457–460]: dine [463]. Severe side effects including coma
a) The original synthesis involved condensation and cyanosis have been observed in combina-
of benzyl cyanide with N,N-bis(2-chloro- tion with MAO-inhibitors [464]. Pethidine in-
ethyl)-N-methyl-amine, which is a skin ir- duces morphine-type tolerance and dependence
ritant and a carcinogen. and addicts using high doses of pethidine have
b) Another synthesis begins with pyridine-4- an increased risk of excitatory side effects.
carboxylic acid. Due to the high risk of severe side effects the
clinical use of the compound has strongly de-
creased [465–467].
Trade names: Dolantin (Germany), Dolosal
(France), Demerol (USA).
compound has a weak NMDA blocking effect Fentanyl and fentanyl derivatives (so-called
[472], which may contribute to the analgesic ef- designer drugs) have an essential abuse poten-
ficacy. It can be given orally, by injection or rec- tial [477] and induce a morphine type of physical
tally; usual doses are 5–10 mg. Ketobemidone dependence.
has a morphine-like side effect and abuse and Trade names: Actic (USA), Duragesic
dependence potential [473]. (USA), Durogesic, Durogesic-SMAT (Ger-
Trade names: Cliradon (Germany, out of many), Durogesic-Dtrans (UK), Fentanyl
use), Ketogan (Sweden, Norway). Janssen (Germany), Sublimaze (UK, USA).
Combination with Droperidol: Thalamonal.
Transdermal fentanyl patches are also mar-
3.1.1.3. Fentanyl and Congeners keted in generic formulations.
N-(4-methoxymethyl-4-piperidinyl)-N-
Opioid receptor binding: Alfentanil is a µ-
phenylpropionamide (3) is synthesized ac-
selective opioid [481] with a receptor affinity in
cording the following scheme starting from
the range of morphine and fentanyl.
1-benzyl-4-piperidone:
Clinical use: Alfentanil is a potent opioid
analgesic with a rapid onset and a shorter du-
ration of action than fentanyl [482]. The i. v.
formulation (dose range 1–4 mg) is mainly used
perioperatively as strong analgesic, supplement
to general anesthesia, or as a primary anesthetic
[483]. Alfentanil has a strong respiratory de-
pressant action and high doses induce chest wall
rigidity. The compound has a µ-type addiction
and dependence potential.
Trade names: Rapifen (Germany, France,
UK), Alfenta (USA).
Clinical use: Remifentanil [487, 488] is a Clinical use: Sufentanil [498] is a very potent
very short-acting and potent µ-opioid agonist and short-acting fentanyl derivative with pref-
with strong analgesic and anesthetic properties. erence for the µ-opioid receptor. It has strong
It has been developed as an ultra-short anes- sedating and analgesic properties and is used
thetic and adjunct to general anesthesia. [489, predominantly as an adjunct in anesthesia or
490]. It affords potent intraoperative analgesia as a primary anesthetic. Anesthetic doses in-
and has a sparing effect on concomitantly used duce respiratory depression and chest wall rigid-
sedatives and hypnotics [491]. Remifentanil is ity [499] which requires assisted ventilation.
given as intravenous short infusion in doses of For pain treatment intravenous or epidural on-
0.5–1 µg/kg or as continuous infusions in the demand procedures are in use and a patch for-
range of 0.0025–2 µg kg−1 min−1 . It is rapidly mulation for pain relief up to seven days is under
inactivated by plasma and tissue esterases [492]. development. Following parenteral administra-
The terminal elimination half-life is 10–20 min. tion sufentanil has a rapid onset and a short dura-
Remifentanil has a µ-opioid type side effect tion of action. The compound is very lipophilic
profile with strong CNS and respiratory depres- and has a high plasma protein binding of ≈ 90 %.
sant properties and a morphine-like addiction The short duration of action is more dependent
and dependence potential. on redistribution than on metabolic inactivation.
Trade name: Ultiva (Germany, UK, USA). Doses up to 8 µg/kg are adequate for pain treat-
ment and higher doses up to 30 µg/kg for surgery
Sufentanil [56030-54-7], N-[4-(meth- [500]. Sufentanil has a morphine-type side ef-
oxymethyl)-1-[2-(2-thienyl)ethyl]-4-piperi- fect profile and induces severe respiratory de-
dinyl]-N-phenylpropanamide, N-[4-methoxy- pression and chest wall rigidity in anesthetic
methyl-1-(2-thiophen-2-yl-ethyl)piperidin-4- dosages [501]. High dose levels have been asso-
yl]-N-phenylpropionamide, C22 H30 N2 O3 S, M r ciated with seizures. Prolonged use may induce
386.56, mp 96.6 ◦ C; citrate (1 : 1) [60561-17-3], tolerance and dependence.
C22 H30 N2 O3 S · C6 H8 O7 , M r 578.68. Trade name: Sufenta (Belgium, Germany,
Synthesis: Sufentanil is obtained by con- France, Norway, USA).
densation of N-(4-methoxymethylpiperidin-4-
yl)-N-phenylpropionamide with 2-thiophen-2-
3.1.1.4. Methadone and Congeners
yl-ethyl methanesulfonate [48, 493–496].
Levomethadone [125-58-6], (R)-6-
dimethylamino-4,4-diphenylheptan-3-one,
Analgesics and Antipyretics 61
C21 H27 NO, M r 309.45, mp 98–100 ◦ C (mp dence potential. Because of its slow elimination
20
racemic form [57-42-1] 78–79 ◦ C), [α]D −32◦ withdrawal reactions are more protracted and
(c = 1.8, CH3 CH2 OH), hydrochloride [5967- less severe than with morphine [517].
73-7], C21 H27 NO · HCl, M r 345.91, mp 240– Trade names: Eptadone (Italy), Dolophine
241 ◦ C (mp racemic form [1095-90-5] 231 ◦ C), (USA), Metasedin (Spain),Physeptone (UK), l-
20
[α]D −169◦ (c = 2.0, water). Polamidon (Germany).
Synthesis [502–509]:
Levomethadyl acetate [34433-66-4],
l-α-acetylmethadol (LAAM), 4-dimethyl-
amino-1-ethyl-2,2-diphenylpentyl acetate,
[S-(R*,R*)]-β-[2-(dimethylamino)propyl]-
α-ethyl-β-phenylbenzeneethanol acetate,
C23 H31 NO2 , M r 353.50; hydrochloride
C23 H31 NO2 · HCl, M r 389.96, mp 215 ◦ C,
25
[α]D −60◦ (c = 0.2, water).
Synthesis: Levomethadyl acetate is prepared
by reduction of dextromethadone and subse-
quent acylation [518].
effect via peripheral opioid receptors [539]. Sys- Piritramide [302-41-0], 1 -(3-cyano-3,3-
temic and central opioid side effects are widely diphenylpropyl)-[1,4 ]bipiperidinyl-4 -carbox-
missing. Orally administered loperamide acts lo- amide, C27 H34 N4 O, M r 430.59, mp 149–
cally in the gut by inhibition of intestinal motil- 150 ◦ C.
ity and secretion [540]. Besides the strong µ- Synthesis: Piritramide is prepared by conden-
opioid action, calcium and calmoduline antag- sation of 4-piperidinopiperidine-4-carboxamide
onism are involved in the antidiarrheal activ- with 3,3-diphenyl-3-cyanopropylbromide [48,
ity. The compound is used in doses of 4–8 mg 543].
for the treatment of acute and chronic diarrhea
and for the management of colostomies and
ileostomies [538]. Adverse effects include nau-
sea, dry mouth, dizziness. High doses can induce
toxic megacolon and paralytic ileus. The com-
pound has no abuse and dependence potential
and is meanwhile available as over the counter
(OTC) product [542].
salt. A crystallization process of the hydrate or 3.1.2.1. Mixed Opioid Agonist – Antagonists
hydrobromide salts is also described. The trans and Partial Agonists
isomer can be epimerized to the cis isomer by
strong acids [48, 552, 553]. Mixed agonist – antagonists are opioid com-
Opioid receptor affinity: Tramadol [554] it- pounds that have in vivo relevant affinity for
self has a weak opioid receptor affinity, the ac- more than one type of opioid receptors, com-
tive metabolite O-demethyltramadol shows µ- monly for the µ- and κ-types. The compounds
selective binding with an affinity about ten times of this group are historically derived from the an-
lower than morphine. tagonist nalorphine. At the µ-receptor they act as
Clinical use: Tramadol hydrochloride [555] antagonists or partial agonists with low intrinsic
is a centrally acting analgesic with a µ-opioid activity. At the κ-receptor they act mostly as ag-
and nonopioid action component [556]. The onists. These substances are used as analgesics
nonopioid component acts spinally via inhibi- and the κ-agonistic effect and/or the partial µ-
tion of noradrenaline (NA) and serotonin (5HT) agonistic effect is responsible for their analgesic
reuptake. Tramadol is a racemic mixture of two efficacy. The side effect profile and the misuse
optical enantiomers and uptake inhibition and potential depend on the relative prevalence of
opioid properties are differentially distributed either component in the individual compound.
between the enantiomers [557]. Opioid recep- The κ-component effects dysphoria, hallucina-
tor affinity is low, but like codeine, tramadol tions, and other psychotic reactions, but induces
is biotransformed to the O-demethyl derivative a low level of respiratory depression and ad-
(M1), which has an essentially higher µ-opioid diction. Compounds with a marked κ-agonistic
receptor affinity and may be responsible for the component such as pentazocine are meanwhile
opioid properties of the compound. Tramadol withdrawn from the market because of their un-
is marketed worldwide and has become one of pleasant side effect profile. The µ-component is
the most important centrally acting analgesics responsible for respiratory depression, eupho-
[558]. It is used in single doses of 50–100 mg ria, and dependence potential. Compounds with
for the treatment of acute and chronic medium a more µ-antagonistic profile have a low abuse
to severe pain. The compound has a high oral potential and are not under narcotic drug control,
bioavailability and can be given by mouth, rec- compounds with a stronger µ-agonistic com-
tally, or by intramuscular, subcutaneous, or slow ponent are scheduled. Application of a mixed
intravenous injection or infusion. Typical side agonist-antagonist in an opioid pretreated pa-
effects are nausea, sweating, and dizziness. High tient may reduce analgesia and induce a with-
doses may have a pro-convulsive effect. Tra- drawal reaction.
madol shows a reduced level of opioid side ef-
fects like respiratory depression and constipa- Buprenorphine [52485-79-7], 17-cy-
tion. It has a very limited abuse potential and in clopropylmethyl-α-(1,1-dimethylethyl)-4,5α-
most countries is not subject to narcotic control. epoxy-18,19-dihydro-3-hydroxy-6-methoxy-
Tramadol is used as a mono-compound or as α-methyl-6,14-ethanomorphinan-7-methanol,
a combination with paracetamol [559]. C29 H41 NO4 , M r 467.30, mp 209 ◦ C; hydro-
Trade names: Adolonta (Spain), Contra- chloride [53152-21-9], C29 H41 NO4 · HCl, M r
mal (Belgium, France, Italy), Nobligan (Skan- 504.10.
dinavia), Tramal, Tramal Long (Germany, Synthesis [48, 424–427] (see next page).
Switzerland, Austria), Tramacet (UK), Ultram Opioid receptor binding: Buprenorphine
(USA), Ultracet (USA), Xprim (France), Zydol [560] has a mixed agonistic – antagonistic ac-
(UK, Ireland). tion profile with a high affinity at the µ-, κ-, and
Combination with paracetamol: Ultracet δ-opioid receptor. A ca. 100-fold lower affinity
(USA), Zaldiar (Germany, Austria, Switzer- was observed at the ORL1-receptor. The com-
land). pound shows a slow receptor dissociation which
Tramadol is also marketed in many generic can explain some peculiarities in the pharmaco-
formulations. logical actions [561].
Clinical use: Buprenorphine [562] is used
against moderate to severe pain, mostly for
Analgesics and Antipyretics 67
chronic pain treatment. The potency is about 20– as a matrix patch formulations with release rates
30 times higher than that of morphine. Buprenor- of 35, 52.5, and 70 µg/h.
phine may be used for anesthesia premedication The use of buprenorphine for opioid addic-
or as adjunct to anesthetics. The compound has tion becomes more and more important. For this
a long duration and a slow offset of action and indication, buprenorphine is used in doses up to
is therefore suited for the substitution treatment 24 mg sublingually alone or in combination with
of opioid addiction [563, 564]. Due to its par- naloxone.
tial agonistic properties buprenorphine can act in Adverse reactions of buprenorphine are typi-
combination with full agonists as an antagonist, cal of µ-opioids and include respiratory depres-
reducing their effect and precipitating a with- sion, drowsiness, nausea, and vomiting. Respi-
drawal reaction in opioid dependent persons. ratory depression often occurs delayed, is long
Antagonistic properties are seen in doses much lasting, and may need higher doses of naloxone
higher than the analgesic dose range. There- [566, 567]. Buprenorphine has a limited abuse
fore no special precaution is necessary when potential and withdrawal reactions, due to slow
changing the treatment with a standard opioid receptor dissociation, are mild and delayed.
agonist to buprenorphine or vice versa [565]. Trade names: Buprenex (USA), Buprex,
Buprenorphine is given parenterally, orally (sub- Subutex (Germany, France, USA), Temgesic
lingual), or by the transcutaneous route as a (Germany, France, UK), Transtec (Germany,
patch. The doses for slow intravenous or in- Austria, Switzerland.
tramuscular administration are 300–600 µg, the Combination with naloxone: Suboxone
sublingual doses are 200–400 µg, both given ev- (USA).
ery 6–8 h. Buprenorphine patches are available
68 Analgesics and Antipyretics
has a side effect profile combining morphine- ment of moderate to severe pain. It is given by
and pentazocine-like symptoms. They include injection in the dose range of 5–20 mg. Side ef-
drowsiness, weakness, sweating, feelings of fects include nausea, vomiting, and drowsiness.
floating, and nausea. It has respiratory depres- Overdosing can be treated with naloxone. In opi-
sant properties similar to morphine but with a oid pretreated patients, dezocine may precipitate
ceiling effect. As antidote naloxone can be used. withdrawal symptoms.
Overt hallucinations or other psychotic effects Trade name: Dalgan (USA, no longer mar-
are rare and less often reported than with penta- keted).
zocine. The compound has a low abuse potential
and has not been submitted to narcotic control. Meptazinol [54340-58-8], 3-(3-ethyl-
Trade name: Stadol (USA). 1-methylazepan-3-yl)phenol, 3-(3-ethyl-
hexahydro-1-methyl-1H-azepin-3-yl)phenol,
Dezocine [53648-55-8], 15-amino-1- C15 H23 NO, M r 233.35, mp 127.5–133 ◦ C; hy-
methyltricyclo[7.5.1.0127,255 ]pentadeca-2,4,6- drochloride [59263-76-2], C15 H23 NO · HCl,
trien-4-ol, [5R-(5α,11α,13S*)]-13-amino- M r 269.81.
5,6,8,9,10,11,12-octahydro-5-methyl-5,11- Synthesis [48, 581, 582]:
methanobenzocyclodecen-3-ol, C16 H23 NO,
M r 245.36; hydrobromide [57236-36-9],
C16 H23 NO · HBr, M r 326.27, mp 269–270 ◦ C.
Synthesis [48, 575, 576]:
Clinical use: Meptazinol [585] is used par- Synthesis: Starting material for the nal-
enterally (50–100 mg) or orally to treat moder- buphine synthesis is oxycodone (see page 55).
ate or moderately severe pain. The compound After ether cleavage to oxymorphone the prod-
has a shorter duration of action than morphine. uct is acylated and the N-methyl group is re-
The most common side effects are nausea, vom- moved by treatment with cyanogen bromide.
iting, and dizziness. Sweating and hypotension The acetyl groups are hydrolyzed with dilute
can also occur. Meptazinol has opioid antago- hydrochloric acid. The resulting 14-hydroxydi-
nistic properties and can induce withdrawal in hydronormorphinone 6 is N-alkylated with cy-
opioid-dependent persons. The compound has a clobutylmethyl bromide, and the carbonyl group
very low dependence potential and is not under at C-6 is reduced [48, 586, 587].
narcotic drug control. The compound is reported Opioid receptor binding: Nalbuphine is a
to be relatively free of respiratory depressant ac- mixed agonist – antagonist opioid with a high
tivity, which was attributed to selective binding affinity at the µ- and κ-opioid receptor. At the
to a µ-1 subtype of the opioid receptor [584]. κ-receptor the compound is an agonist, at the µ-
This is not confirmed by others and the effect receptor a partial agonist with a very low intrin-
may be alternatively explained by a choliner- sic activity, thus acting more as a µ-antagonist
gic action component [583] of the compound. [588].
In accordance with a low κ-receptor affinity, the Clinical use: Nalbuphine [589, 590] is an opi-
incidence of psychotomimetic actions and hal- oid analgesic with a mixed agonist – antagonist
lucinations is low. action profile. Analgesia is limited by a “ceiling”
Trade name: Meptid (Germany, UK). effect. The compound has a low oral availability
and is used as hydrochloride only for parenteral
Nalbuphine [20594-83-6], (5α6α)-17-(cy- application to treat moderate to severe pain and
clobutylmethyl)-4,5-epoxymorphinan-3,6,14- as adjunct to anesthesia. The dose for pain re-
triol, C21 H27 NO4 , M r 357.44, mp 230.5 ◦ C; hy- lief is 10–20 mg. The most frequent side effects
drochloride [23277-43-2], C21 H27 NO4 · HCl, are drowsiness, sweating, nausea, and vomiting.
M r 393.91, mp 291–292 ◦ C (decomp.). Hallucinations and psychotomimetic reactions
are less frequent than with pentazocine, reflect-
ing a relative weak κ-agonistic component of the
compound. Nalbuphine induced respiratory de-
pression is less severe than with morphine and is
limited by a ceiling effect [591]. The dependence
potential is low and nalbuphine is not subject to
narcotic control.
Trade name: Nubain (Germany, France, UK,
USA).
Efficacy and intended clinical use: N- neuropathic pain as pain initiated or caused by
Methylnaltrexone [617] is the polar derivative a primary lesion or dysfunction in the nervous
of naltrexone, which does not reach the central system. This malfunction of the nervous system
nervous system but can block intestinal opioid can occur at any point along the sensory path-
receptors. The compound is under development way (peripheral nerve, dorsal root ganglion, and
to counteract opioid induced bowel dysfunction CNS). The term peripheral neuropathic pain is
such as constipation and megacolon [618]. usually used to refer to abnormalities in the pe-
ripheral nervous system. Central pain is retained
Nalmefene [055096-26-9], N-(cyclopro- as the term when the lesion or dysfunction oc-
pylmethyl)-4,5α-6-methylenemorphinan-3,1β- curs in CNS.
diol, C21 H25 NO3 , M r 339.43, mp 105–110 ◦ C;
hydrochloride [58895-64-0], C21 H26 ClNO3 , Table 4. Etiological classification of neuropathic pain [623]
M r 375.89, mp 188–190 ◦ C. Injury Examples
Synthesis: Nalmefene is synthesized by a Infection/inflammation
Wittig reaction of naltrexone with triphenyl- • postherpetic neuralgia
methylphosphonium bromide in DMSO under • HIV
Ischemia
• diabetic neuropathy
• central post-stroke pain
Compression
Nalmefene is a 6-methylene analogue of nal- • sciatica
• carpal tunnel
trexone. It is a pure opioid receptor antagonist • trigeminal neuralgia
and has a high affinity for the κ-opioid receptor.
Nalmefene has a long duration of action and is Neoplasm
used in oral and parenteral formulations. • invasion of neural structures
Nalmefene is used to reverse opioid intoxica- • compression by tumor
expansion
tion [619] and for the treatment of opioid depen-
dence [620]. The compound is in clinical devel- Iatrogenic
opment for the treatment of alcoholism [621], to • vinca alkaloids
support smoking cessation and to control patho- • antiretrovirals
• post-irradiation
logical gambling [622].
Trade name: Revex (USA). Idiopathic
• multiple sclerosis
• trigeminal neuralgia
• complex regional pain
3.2. Antineuropathic Analgesics and syndrome
Other Non-opioid Compounds
Classification: Neuropathic pain has been
3.2.1. Neuropathic Pain Treatment
traditionally classified according to its etiology
[623–629, 658, 659]
(Table 1) and tends to be chronic and unremit-
ting. Patients with neuropathic pain are often dif-
Definition: Neuropathic pain results from dam-
ficult to treat, the pain is sometimes relatively un-
age to the nervous system due to many diverse
responsive to conventional analgesics and thus
processes. The damage causes persistent, dis-
a wide variety of drugs from many classes have
tressing pain, that is reputedly unresponsive to
been suggested for this indication. Table 4. indi-
conventional analgesics. The International As-
cates that neuropathic pain refers to a group of
sociation for the Study of Pain (IASP) defines
Analgesics and Antipyretics 75
painful disorders characterized by pain due to fer the best treatment options. Other interven-
dysfunction or disease of the nervous system at tions such as stimulation, blockade, or destruc-
a peripheral level, a central level, or both. In con- tion of nerves and psychological treatments are
trast to nociceptive pain, which results from the also part of the armament for treating neuro-
activation of pain receptors (nociceptors), neu- pathic pain. Table 5. gives an overview on the
ropathic pain is the result of injury to the pain- current available evidence-based treatment op-
conducting nervous system. tions for neuropathic pain.
Symptoms: Neuropathic pain is a complex en-
tity with many symptoms and signs that fluctu- Table 5. Evidence-based treatment options for neuropathic pain
ate, in number and intensity, with time. The de- [623]
scriptors associated with neuropathic pain have Drug class Proposed mechanism Examples
of action
been described qualitatively as burning, stab- Tricyclic
bing, shooting, aching and electric shock-like, antidepressants
• unspecific sodium • amitryptiline
amongst others. Pain may be continuous or channel blockade • nortriptyline
paroxysmal and felt superficially or deeply. It • inhibition of • desipramine
norepinephrine • imipramine
may also occur spontaneously, independent of a and serotonin
stimulus. Sensory changes in the injured area reuptake
are common. There may be areas of sensory • blockade of
α-adrenergic
loss but also of altered sensation to cutaneous receptors
stimuli. Non-noxious stimuli, e.g. stroking, may
elicit pain (allodynia). Mildly painful stimuli Serotonin and/or blockade of serotonin
norepinephrine and/or norepinephrine
may cause excessive pain (hyperalgesia) and reuptake inhibitors reuptake • duloxetine
• venlafaxine
repetitive stimulation can cause an explosive
build-up of pain that lasts well beyond the stim- Anticonvulsants
ulus (hyperpathia). These sensory abnormalities • unselective block • benzodiazepines
can be classified by type of stimulus – thermal, of sodium • carbamazepine
channels • oxacarbazepine
mechanical, and chemical. Mechanically evoked • phenytoin
events can be further subdivided into dynamic • lamotrigin
(brush-stroke evoked), static (pressure-evoked) • topiramate
• zonisamide
and punctate.
Anticonvulsants
Current Treatment Options in Neuro- • selective block of • gabapentin
pathic Pain. There are several rationales to calcium channels • pregabalin
Condensation of 2,3-dichlorobenzoyl
cyanide with aminoguanidine in the presence
of polyphosphoric acid (PPA) as catalyst in hot
acetonitrile yields 2,3-dichlorobenzoylcyanide
amidinohydrazone, which is cyclized to the
target 1,2,4-triazine by heating in refluxing
propanol with or without DMSO.
82 Analgesics and Antipyretics
40. C. Pisano et al., Dig. Dis. Sci. 44 (1999) 66. D. A. Willoughby et al., Lancet 355 (2000)
713–724. 646–648.
41. S. Fiorucci, E. Antonelli, Curr. Top. Med. 67. P. Kirkpatrick, Nature Reviews Drug
Chem. 5 (2005) 487–492. Discovery 4 (2005) 883.
42. R. Scatena, Curr. Opin. Investig. Drugs 5 68. E. D. Hogestatt et al., J. Biol. Chem. 36 (2005)
(2004) 551–556. 31405–31412.
43. J. L. Wallace et al., Am. J. Physiol. 69. R. K. Lewis, F. P. Paloucek, Clin. Pharm. 10
Gastrointest. Liver Physiol. 286 (2004) (1991) 765–774.
G76–81. 70. M. Depre et al., Fundam. Clin.Pharmacol. 6
44. C. Patrono, N. Engl. J. Med. 330 (1994) (1992) 259–262.
1287–1294. 71. U. C. Dubach et al., N. Engl. J. Med. 308
45. Patrignani et al., Br. J. Pharmacol. 118 (1996) (1983) 357–362.
1285–1293. 72. K. H. Boltze, H. Kreisfeld,
46. R. G. Kurumbail et al., Nature 384 (1996) Arzneim.-Forsch./Drug Res. 27 (1977) no. 1,
644–648. 1300–1312.
47. A. S. Kalgutkar et al. Science 280 (1998) 73. R. Coletta et al., Int. J. Clin. Pharmacol. Res. 8
1268–1270. (1988) 295–298.
48. A. Kleemann, J. Engel, B. Kutscher, D. 74. Parke Davis, FR 1 341 M, 1961.
75. R. B. Moffett, B. D. Aspergen, J. Am. Chem.
Reichert: Pharmaceutical Substances,
Soc. 82 (1960) 1605.
Synthesis, Patents, Applications, Thieme,
76. S. Ravi et al., Postgrad. Med. J. 62 (1986)
Stuttgart – New York,
773–776.
1999 (available in print and CD-ROM).
77. H. Gögelein et al., FEBS Lett. 268 (1990)
49. N. Kuhnert, Chem. Unserer Zeit 33 (1999)
79–82.
213–220.
78. M. M. White et al., Mol. Pharmacol. 37 (1990)
50. Am. J. Med. 74 (1983) no. 6A, 1–109.
720–724.
51. I. Tegeder et al., FASEB J. 15 (2001) 79. L. Sorbera et al., Drugs of the Future 26
2057–2072. (2001) 133–140.
52. C. J. Needs, P. M. Brooks, Clin. 80. G. J. Grover et al., J. Pharmacol. Exp. Ther.
Pharmacokinet. 10 (1985) 164–177. 269 (1994) 536–540.
53. R. J. Waldmann et al., JAMA 247 (1982) 81. Y. T. Lee, Q. Wang, Eur. J. Pharmacol. 378
3089–3094. (1999) 349–356.
54. Merck & Co., US 4 225 730, 1980, (H. Jones, 82. Parke Davis, US 3 313 848, 1967;
R. Houser. DE 1 149 015, 1961.
55. For alternative synthesis: US 3 992 495, 83. P. F. Juby et al., J. Med. Chem. 11 (1968)
(Merck & Co.). 111–117.
56. For alternative synthesis: US 4 131 618, 84. E. Arrigoni-Martelli, Drugs Future 3 (1978)
(Merck & Co.). 307–310.
57. J. Hannah et al., J. Med. Chem. 21 (1978) 85. J. R. McLean, M. I. Geuckman,
1093. Arzneimittel-Forsch. 33 (1983) 627–631.
58. E. Arrigoni-Martelli, Drugs Future 3 (1978) 86. A. Peretz et al. Mol. Pharmacol. 67 (2005)
28–33. 1053–1066.
59. J. Hannah et al., J. Med. Chem. 21 (1978) 87. Y. T. Lee, Q. Wang, Eur. J. Pharmacol. 378
1093–1100. (1999) 349–356.
60. M. Cotton, R. A. Hux, Anal. Profiles Drug 88. Parke Davis, US 3 138 636, 1964;
Subst. 14 (1985) 491–526. DE 1 163 846, 1961.
61. J.M. Young et al., Inflamm Res. 45 (1996) 89. G. R. Singh, P. Choudhury, Indian Pediatr. 26
246–253. (1989) 577–579.
62. Lunbeck, GB 656 746, 1948. 90. M. Ottolia, L. Toro, Biophys. J. 67 (1994)
63. D. S. Hoffenberg, C. R. Hauser, J. Org. Chem. 2272–2279.
20 (1955) 1496–1500. 91. J. S. Marks, M. H. Gleeson, Br. Med. J. 4
64. Warner-Lambert, US 2 998 450, 1961, (G. (1975) 442.
Wilbert, J. De Angelis). 92. Labs. U.P.S.A., US 3 415 834, 1968;
65. B. Ameer et al., Ann. Int. Med. 87 (1977) US 3 337 570, 1967.
93. J. Auclair et al., Curr. Ther. Res. 46 (1989)
202–209.
782–788.
Analgesics and Antipyretics 87
94. M. Civelli et al., Agents Actions 33 (1991) 123. J. R. Carson et al., J. Med. Chem. 14 (1971)
233–239. 646–647.
95. Park Davis, US 3313848 (A. Scherer, F. W. 124. R. N. Brogden, Drugs 15 (1978) 429–450.
Short), 1967 125. C. Brideau et al., Inflamm Res. 45 (1996)
96. M. Zovko, B. Zorc, M. J.-M. Takac, B. 68–74.
Metelko, P. Novac, Croatica Chemica Acta 76 126. E. Arrigoni-Martelli, J. Prous, J. Castaner,
(2003), 335–341. Drugs of the Future 14 (1989) 963.
97. T. Corell, Pharmacol. Toxicol. 75 Suppl 2 127. G. Biasi, R. Marcolongo, Minerva Med. 92
(1994) 14–21. (2001) 315–324.
98. H. Isomaki, Pharmacol. Toxicol. 75 Suppl 2 128. G. Coruzzi et al., Curr. Drug Targets Inflamm.
(1994) 64–65. Allergy. 3 (2004) 43–61.
99. J. Delgado et al. Pharmacol. Toxicol. 75 Suppl 129. G. Coruzzi et al., Dig. Liver Dis. 34 (2002)
2 (1994) 89–91. 403–410.
100. P. E. Hansen, Pharmacol. Toxicol. 75 Suppl 2 130. J. Prous, J. Castaner, Drugs of the Future 13
(1994) 81–82. (1988) 1050.
101. K. H. Boltze et al., Arzneim.-Forsch./Drug 131. CDC Life Sciences Inc., US 4 327 222, 1982
Res. 30 (1977) no. 2 1314–1325. (R. G. Micetich et al.).
132. Teiho Pharmaceuticals, EP 454 871, 1990 (H.
102. H. Jacobi, H. D. Dell, Arzneimittel-Forsch. 30
Tanaka, Y. Hagiwara, H. Kajitani, H.
(1980) 1348–1362.
Yasumoto).
103. Rotta Research Lab., DOS 2 535 799, 1975.
133. Taiho Pharmaceuticals, EP 464 218, 1991 (H.
104. Rotta Research Lab., US 3 985 878, 1974.
Tanaka, Y. Hagiwara, H. Kajitani, H.
105. F. Makovec et al., Arzneimittelforschung 37
Yasumoto).
(1987) 806–813.
134. CDC Life Science, EP 26928, 1981 (R. G.
106. V. Fossaluzza et al., Minerva Med. 74 (1983)
Micetich et al.).
723–726. 135. T. Ushio et al, Iykuhin Kenkyu 22 (1991) 892.
107. N. P. Buu-Hoi et al., Hebd. Seances Acad. Sci. 136. N. Ono et al., Nippon Yakurigaku Zasshi. 95
261 (1965) 2259. (1990) 63–81.
108. P. Moser et al., J. Med. Chem. 33 (1990) 137. K. Goto et al., Prostaglandins Other Lipid
2358–2368. Link Mediat. 56 (1998) 245–254.
109. P. A. Todd, E. M. Sorkin, Drugs 35 (1988) 138. D. A. Walch et al., J. Med. Chem. 27 (1984)
244–285. 1379–1388.
110. T. Y. Shen et al., J. Am. Chem. Soc. 85 (1963) 139. US 4 126 635, 1977 (H. Robins et al.).
488–489. 140. A.H. Robinson Co., Inc. US 4 568 695, 1983
111. Merck & Co., US 3 161 654, 1964, (H. Robins et al.).
DE 1 232 150, 1962. 141. J. Prous, J. Castaner, Drugs of the Future 13
112. H. Yamamoto et al., Chem. Pharm Bull. 16 (1988) 943.
(1968) no. 17, 647. 142. T. Ogawa et al. Nippon Ganka Gakkai Zasshi
113. Byk Gulden, US 4 4 325 962, 1982; 99 (1995) 406–411.
DE 1 946 370, 1969. 143. R. J. Fontana et al., Liver Transpl. Surg. 5
114. G. Rainer et al., Arzneim.-Forsch./Drug Res. (1999) 480–484.
31 (1981) 649–655. 144. E. B. Hunter et al., Am. J. Gastroenterol. 94
115. B. Unterhalt, Drugs Future 7 (1982) 110–111. (1999) 2299–2301.
116. Merck & Co., US 3 882 239, 1975; 145. P. L. Moses et al., Am. J. Gastroenterol. 94
DE 1 039 426, 1970. (1999) 1393–1396.
117. R. F. Shuman et al., J. Org. Chem. 42 (1977) 146. Beecham, US 4 420 639, 1983;
1914–1919. DE 2 463 219, 1974.
118. R. N. Brogden et al., Drugs 16 (1987) 97–114. 147. A. C. Goudie et al., J. Med. Chem. 12 (1978)
119. A. Whelton et al., JAMA 249 (1983) 2892. 1260–1264.
120. T. D. Warner et al., Proc. Natl. Acad. Sci. 148. M. Neumann, Drugs Future 6 (1981) 35–36.
U.S.A. 96 (1999) 7563–7568. 149. C. Prabhakar et al., Org. Process Res. Dev. 3
121. C. Haanen, Curr. Opin. Investig. Drugs 2 (1999) 121–125.
150. H. A. Friedel et al., Drugs 45 (1993) 131–156.
(2001) 677–683
151. Degussa, US 3 513 171, 1970;
122. McNeil, US 3 752 826, 1973;
DE 1 670 522, 1966.
GB 1 428 272, 1973. 152. Drugs Future 8 (1983) 773–775.
88 Analgesics and Antipyretics
153. W. v. Bebenburg, et al., Chem. Ztg. 105 (1981) 183. J. Pirotte et al., Gastroenterol. Clin. Biol. 11
217–219. (1987) 520.
154. W. v. Bebenburg, G. Steinmetz, K. Thiele, 184. J. R. Hannequin et al., Rev. Rheum. Mal.
Chem. Ztg. 103 (1979) 387–399. Osteoartic. 55 (1988) 983–988.
155. M. L. Brochier, Eur. Heart J. 14 (1993) 185. A. C. Depla et al., Neth. J. Med. 37 (1990)
951–957. 32–36.
156. W. J. Wechter et al., Cancer Res. 60 (2000) 186. M. Eugene et al., Rev. Med. Interna 8 (1987)
2203–2208. 115.
157. J. M. Mayer, B. Testa, Drugs Future 22 (1997) 187. Ely Lilly, DOS 1 941 625, 1969.
1347–1366. 188. Ely Lilly, US 3 600 437, 1971 (W. S.
158. M. Cleij et al., J. Org. Chem. 64 (1999) Marshall).
5029–5035. 189. Mitsubishi Petrochemical, DOS 2 646 792,
159. M. Busson, J. Int. Med. Res. 14 (1986) 53–62. 1976 (M. Takeda, M. Uchide, H. Masayuka).
160. Rhône-Poulence, US 3 641 127, 1972. 190. Nissin Flour Milling, US 4 016 196, 1977 (K.
161. G. G. Liversidge, Anal. Profiles Drug Subst. Katsura Kogure, T. Noriyoshi Sueda, T.
10 (1981) 443–471. Youziro Yoshino, K. Kunio Nakagawa).
162. J. L. Hommeril et al., Br. J. Anaesth. 72 (1994) 191. Sagami, DAS 2 709 504, 1977 (G.
383–387. Tsuchihashi, K. Ogura).
163. P. Patrignani et al., J Physiol. Pharmacol. 48 192. C. M. Gruber Jr., J. Rheumatol. 2 (1976) 8–17.
(1997) 623–631. 193. R. N. Brogden et al., Drugs 13 (1977)
164. R. L. Dorfman, Arzneim.-Forsch./Drug Res. 25 241–265.
(1975) 278–281. 194. R. N. Brogden et al., Drugs 21 (1981) 1–22.
165. T. Y. Shen, Angew. Chem. Int. Ed. Engl. 11 195. J. R. Ryan et al., Clin. Pharmacol. Ther. 42
(1972) 460. (1987) 28–32.
166. H. R. Bellur, J. R. Ahuja, D. G. Kulkarni, 196. M. L. Wendland et al., Mayo Clin. Proc. 55
Tetrahedron: Asymmetry 3 (1992) 163–192. (1980) 103–107.
167. Syntex, US 3 663 584, 1972. 197. J. S. Stotts et al., J. Am. Acad. Dermatol. 18(4
168. Syntex, US 4 605 758, 1986. Pt 1) (1988) 755–757.
169. P. A. Todd, S. P. Clissold, Drugs 40 (1990) 198. CERM, US 4 218 473, 1980 (J. J. Godfroid, E.
91–137. Steiner).
170. J. Rautio et al., J. Med. Chem. 43 (2000) 199. M. Hoeijmakers et al., J. Vet. Pharmacol. Ther.
1489–1494. 28 (2005) 305–312.
171. Roussel-Uclaf, DOS 2 055 264, 1970. 200. T. Nell et al., J. Small Anim. Pract. 43 (2002)
172. G. L. Plosker, A. J. Wagstaff, Drugs 50 (1995) 208–212.
1050–1075. 201. P. Lees et al., J. Vet. Pharmacol. Ther. 22
173. F. G. Mayall et al., Br. Med. J. 309 (1994) (1999) 96–106.
599–600. 202. D. A. Walsh et al., J. Med. Chem. 33 (1990),
174. J. Prous, J. Castaner, Drugs of the Future 14 2296–2304.
(1989) 302. 203. Alcon, WO 09932104, 2000 (J. H. Yanni, M.
175. Nippon Chemiphar, US 4 247 706, 1981 (Y. R. Hellberg).
Fujimoto, S. Yamabe). 204. T. L. Ke et al., Inflammation 24 (2000)
176. M. Hatori, S. Kokubun, Curr. Med. Res. Opin. 371–384.
14 (1998) 79–87. 205. K. Takahashi et al., Invest. Ophthalmol. Vis.
177. N. Murakami et al., Jpn. J. Pharmacol. 72 Sci. 44 (2003) 409–415.
(1996) 29–37. 206. D. A. Gamache et al., Inflammation 24 (2000)
178. H. B. Tang et al., Neuropharmacology 48 357.
(2005) 1035–1042. 207. R. Linstrom, T. Kim, Curr. Med. Res. Opin. 22
179. R. W. Carney et al., Experientia 29 (1973), (2006) 397–404.
938. 208. W. J. Welstead et al., J. Med. Chem. 22 (1979),
180. Ciba, US 3 641 040, 1972 (R. W. Carney, G. 1074–1079.
DeStevens). 209. Robins Co., Inc., DE 2 324 768, 1973 (W.
181. P. A. Todd, R. Beresford, Drugs. 32 (1986) Welstead, H. W. Moran)
509–537. 210. Robins Co., Inc., US 1972 254 285, 1972 (W.
182. M. Guidotti et al., J. Int. Med Res. 17 (1989)
Welstead, H. W. Moran)
48–54.
Analgesics and Antipyretics 89
211. G. Ehrhart, H. Ruschig: Arzneimittel, 243. Hoffmann-La Roche, DOS 2 537 070, 1975.
Entwicklung, Wirkung, Darstellung, vol. 1, 244. R. N. Brogden et al., Drugs 22 (1981)
Verlag Chemie, Weinheim 1972, pp. 171–172. 165–187.
212. I.G. Farben, DRP 476 663, 1922. 245. R. N. Brogden et al., Drugs 28 (1984)
213. Z. Fendrich, Cas. Lek. Cesk. 139 (2000) 292–323.
440–444. 246. J. A. Mitchell et al., Proc. Natl. Acad. Sci. USA
214. F. Arellano, J A. Sacristan, Eur. J. Clin. 90 (1993) 11693–11697.
Pharmacol. 38 (1990) 617–619. 247. E. Arrigoni-Martelli, Drugs Future 7 (1982)
215. M. Levy et al., Clin. Pharmacokinet. 28 (1995) 493–494.
216–234. 248. P. A. Todd, S. P. Clissold, Drugs 41 (1991)
216. Hoffmann-La Roche, DRP 565 799, 1931. 625–646.
217. Riedel-deHaen, DE 962 254, 1954. 249. Synthex, US 4 347 186, 1982;
218. K. Brune, Agents Actions 25 Suppl. (1988) US 4 458 081, 1984;
9–19. US 4 873 340, 1989.
219. E. Gores et al., Med. Monatsschr. Pharm. 27 250. E. Arrigoni-Martelli, Drugs Future 8 (1983)
(2004) 72–76. 871–874.
220. R. Denss et al., Helv. Chim. Acta 40 (1957) 251. A. Guzman et al., J. Med. Chem. 29 (1986)
402. 589–591.
221. M. Kühn et al., J. Prakt. Chem. 156 (1940) 252. J. M. Muchowski et al., J. Med. Chem. 28
103. (1985) 1037–1049.
222. Horakova et al., Pharmacotherapeutica (1963) 253. F. F. Franco et al., J. Org. Chem. 47 (1982)
335–350. 1682–1688.
223. J. Büchi et al., Helv. Chim. Acta 36 (1953) 75. 254. M. M. T. Buckley, R. N. Brogden, Drugs 39
224. Comm. Farmaceutica Milanese, GB 839 057, (1990) 86–109.
1957. 255. John Wyeth and Brothers, Ltd, US 3578671,
225. D. Loew et al., Z. Rheumatol. 44 (1985) 1971 (K. Brown).
186–192. 256. E. Arrigoni-Martelli, Drugs of the Future 3
226. Geigi, US 2 745 783, 1956. (1978) 539–542.
227. L. E. Westerholm, Br. Med. J. 3 (1973) 257. L. G. Miller, Clin. Pharm. 11 (1992) 591–603.
339–343. 258. American Home Products, US 3 843 681,
228. Geigi, US 2 562 830, 1951. 1974.
229. S. L. Ali, Anal. Profiles Drug Subs. 11 (1982) 259. L. Castaner, E. Arrigoni-Martelli, Drugs
483–521. Future 2 (1977) 21–23.
230. G. A. Faich, Pharmacotherapy 7 (1987) 260. C. A. Demerson, et al., J. Med. Chem. 19
25–27. (1976) 391–395.
231. Warner-Lambert, DOS 2 208 351, 1972. 261. C. A. Demerson et al., J. Med. Chem. 18
232. J. G. Lombardino, E. H. Wisemann, J. Med. (1975) 189.
Chem. 14 (1971) 973. 262. N. Bellamy, Inflammopharmacology 5 (1997)
233. H. Zinnes et al., J. Med. Chem. 25 (1982) 12. 139–152.
234. W. W. Downie, Semin. Arthritis Rheum. 12 263. A. S. Taha et al., Gut 30 (1989) A751.
(1982) Suppl. 2, 170–174. 264. G. Bianchi Porro, et al., J. Intern. Med. 229
235. Drugs Future 17 (1992) 683–686.
(1991) 5–8.
236. T. Pruss et al., Postgrad. Med. J. 66 (1990)
265. Thomae GmbH, DE 2 756 113, 1979.
Suppl. 4818–821.
266. G. Trummlitz, G. Engelhardt, U. Busch, Drugs
237. T. Christoph et al., Inflamm. Res. 44 (1995)
Future 14 (1989) 1047–1048.
Suppl. 3 Abstr. W16/17.
267. G. Engelhardt et al., Inflamm. Res. 44 (1995)
238. J. A. Balfour et al., Drugs 51 (1996) 639–657.
423–433.
239. Pfizer, US 3 591 584, 1971;
268. J. A. Lopez-Garcia et al., Neuroreport 9
US 4 469 866, 1984.
(1998) 647–651.
240. J. G. Lombardino et al., J. Chiaini, J. Med.
269. Riker, US 3 840 597, 1974;
Chem. 5 (1973) 493–496.
DOS 2 333 643, 1973.
241. E. H. Wisemann et al., Arzneim.-Forsch./Drug
270. R. Davis, R. N. Brogden, Drugs 48 (1994)
Res. 26 (1976) 1300–1303.
431–454.
242. L. Castaner, E. Arrigoni-Martelli, Drugs
271. A. Azab et al., Life Sci. 63 (1998) PL 323–327.
Future 2 (1977) 124–127.
90 Analgesics and Antipyretics
272. P. A. McCormick et al., Lancet 353 (1999) 299. E. Packman et al., Headache 45 (2005)
40–41. 1163–1170.
273. C. Ferreiro et al., Gastroenterol. Hepatol. 23 300. J. A. Rosenberg et al., Nat. Clin. Pract.
(2000) 428–430. Gastroenterol. Hepatol. 2 (2005) 14–15.
274. Drugs Future 22 (1997) 711–714. 301. C. J. Hawkey et al., Clin. Gastroenterol.
275. Searle & Co., US 5 521 207; EP 731 795; WO Hepatol. 4 (2006) 57–66.
9 515 316 (J. J. Talley, T. D. Penning, P. W. 302. P. Matchaba et al., Clin. Ther. 27 (2005)
Collins et al.). 1196–214.
276. G. Steinbach et al., N. Engl. J. Med. 342 303. H. Tannenbaum et al., Ann. Rheum. Dis. 63
(2000) 1946–1952. (2004) 1419–1426.
277. J. L. Goldstein et al., Am. J. Gastroenterol. 96 304. C. M. Rordorf et al., Clin. Pharmacokinet. 44
(2001) 1019–1027 (2005) 1247–1266.
278. F. E. Silverstein et al., JAMA 284 (2000) 305. Pfizer Inc., WO 2005123701, 2005 (L. J.
1247–1255. Letendre, C. K. Snoddy, G. H. Klemm, J. P.
279. J. M. Brophy, Expert Opin. Drug. Saf. 4 (2005) Lawson, M. J. Bauer).
1005–1015. 306. J. J. Talley et al., J. Med. Chem. 43 (2000)
280. L.A. Sorbera et al., Drugs of the Future 26 1661–1663.
(2001) 346–353. 307. Searle & Co. WO 9515316;
281. R.W. Friesen et al., Biorg. Med. Chem. Lett. 8 US 5 521 207;
(1999) 2777–2782. EP 731 795 1995 (J. J -Talley et al.).
282. I. W. Davies et al., J. Org. Chem. 65 (2000) 308. S. M. Cheer, K. L. Goa, Drugs 61(2001)
8415–8420. 1133–1141.
283. I. W. Davies et al., J. Org. Chem. 65 (2000) 309. A. W Gotta, Idrugs 4 (2001) 939–944.
8571–8574. 310. A. S. Dalpiaz, D. Peterson, Expert. Rev.
284. J. F. Marcoux et al., Org. Lett. 2 (2000) Neurother. 4 (2004) 165–177.
2339–2341. 311. S. Aldington et al., N. Z. Med. J. 118 (2005)
285. A. Dallob et al., J Clin Pharmacol. 43 (2003) U1755.
573–585. 312. C. D. Furberg et al., Circulation 111 (2005)
286. D. J. Cochrane et al., Drugs. 62 (2002) 249.
2637–2651. 313. E. G. Harks et al., J. Pharmacol. Exp. Ther.
287. A. D. Rodrigues et al., Drug Metab. Dispos. 31 298 (2001) 1033–1041.
(2003) 224–232. 314. L. A. Sorbera et al. Drugs Future 23 (1998)
288. K. Kassahun et al., Drug Metab. Dispos. 29 1287–1296.
(2001) 813–820. 315. L. A. Sorbera et al., Drugs of the Future 23
289. N. Chauret et al., Bioorg. Med. Chem. Lett. 11 (1998) 1287–1296.
(2001) 1059–1062. 316. M. Therien et al., Synthesis (2001) 1778–1779.
290. D. R. Ramey et al., Curr. Med. Res. Opin. 21 317. L. J. Scott, H. M. Lamb Drugs. 58 (1999)
(2005) 715–722. 499–505.
291. S. P. Curtis et al., Clin Ther. 26 (2004) 70–83. 318. A. J. Matheson, D. P. Figgitt, Drugs. 61 (2001)
292. S. Aldington et al., N. Z. Med. J. 118 (2005) 833–865.
U1684. 319. C. C. Chan et al., J. Pharmacol. Exp. Ther. 290
293. L. A. Sorbera et al., Drugs of the Future 27 (1999) 551–560.
320. L. Laine et al., Gastroenterology 117 (1999)
(2002) 740–747.
776–783.
294. Novartis, WO 2001 023346, 2001 (M. Murat,
321. C. Bombardier et al., N. Engl. J. Med. 343
T. Allemendiger, J. Calienni, J. Cercus, O.
(2000) 1520–1528.
Loiseleur).
322. M. Wadman, Nature 433 (2005) 790.
295. Novartis, WO 1999 011605, 1999 (L.
323. J. J. Talley in F. D. King A. W. Oxford (eds.):
Mcquire, B. Mugrage, J. Van Duzer).
Progress in Medicinal Chemistry-Vol 36,
296. K. A. Lyseng-Williamson et al., Drugs 64
Elsevier, Amsterdam 1999.
(2004) 2237–2246.
324. D. Ormrod et al., Drugs 62 (2002) 2059–2071.
297. F. Berenbaum et al., J. Int. Med. Res. 33
325. M. L. Chavez, C. J. De Korte Clin Ther. 25
(2005) 21–41.
(2003) 817–851.
298. P. Geusens et al., Int. J. Clin. Pract. 58 (2004)
326. C. Fenton et al. Drugs. 64 (2004)1231–1261.
1033–1041.
327. J. E. Edwards et al. Pain 111 (2004) 286–296.
Analgesics and Antipyretics 91
328. G. P.Joshi Expert Rev. Neurother. 5 (2005) 353. R. J. Knapp et al., FASEB J. 9 (1995) 516–525.
11–24. 354. S. R. Childers Life Sci. 48 (1991) 1991–2003.
329. D. Kudrow et al. Headache 45 (2005) 355. I. McFadzean, Neuropeptides 11 (1988)
1151–1162. 173–180.
330. C. Talhari et al., J. Allergy Clin. Immunol. 115 356. W. F. Simonds, Endocr. Rev. 9 (1988) 200–212.
(2005) 1089–1090. 357. A. D. Blake et al. Channels 5 (1997) 231–235.
331. F. L. Byerly et al., Burns 31 (2005) 383–387. 358. P. Y. Law, H. H. Loh, J. Pharmacol. Exp. Ther.
332. N. A. Nussmeier et al. N. Engl. J. Med. 352 289 (1999) 607–624.
(2005) 1081–1091. 359. N. I. Cherny, Drugs 51 (1996) 713–737.
333. A. F. Casy, R. T. Parfitt: Opioid Analgesics, 360. H. W. Matthes et al., Nature 383 (1996)
Chemistry and Receptors, Plenum Press, New 819–823.
York 1986. 361. B. L. Kieffer, Trends Pharmacol. Sci. 20
334. A. F. Casy, R. T. Parfitt, Opioid Analgesics. (1999) 19–26.
Chemistry and Receptors, Plenum Press, New 362. D. I. Scopes, Drug of the Future 18 (1993)
York -London 1986. 933–947.
335. A. F. Casy, R. T. Parfitt, Opioid Analgesics. 363. A. Barber, R. Gottschlich, Exp. Opin. Invest.
Chemistry and Receptors, Plenum Press, New Drugs 6 (1997) 1354–1368.
York -London 1986. 364. G. Dondio et al., Exp. Opin. Ther. Patents 7
336. H. Akil et al. Annu. Rev. Neurosci. 7 (1984) (1997) 1075–1098.
223–255. 365. M. A. Scheideler, Curr. Opin. CPNS Invest
337. A. Mansour et al., Trends Neurosci. 18 (1995) Drugs 2 (2000) 171–177.
22–29. 366. C. Mollereau, L. Mouledous, Peptides. 21
338. A. Herz J. Neural. Transm. Suppl. 18 (1983) (2000) 907–917.
227–233. 367. R. Bertorelli et al., Trends Pharmacol. Sci. 21
339. G. B. Stefano, et al. Crit. Rev. Immunol. 16 (2000) 233–234.
(1996) 109–144. 368. A. Mansour et al., Trends Neurosci. 18 (1995)
340. C. Stein et al.,in C. Stein (ed.): Opioids in Pain 22–29.
Control. Basic and Clinical Aspects, 369. J. Lipp, Clin. Neuropharmacol. 14 (1991)
Cambridge University Press, Cambridge 1999, 131–147.
pp. 96–108. 370. T. L Yaksh, Acta Anaesthesiol. Scand. 41
341. W.R. Martin et al., J. Pharmacol. Exp Ther. (1997) 94–111.
197 (1976) 517–5132. 371. C. Stein, Opioids in Pain Control. Basic and
342. C. J. Fowler G. L. Fraser Neurochem. Int. 24 Clinical Aspects, Cambridge University Press,
(1994) 401–426. Cambridge 1999.
343. W. R. Martin, Pharmacol. Rev. 35 (1983) 372. C. P. Watson, Clin. J. Pain, 16 (2 Suppl.)
283–323. (2000) S49–55.
344. B. N. Dhawan et al., Pharmacol Rev. 48 373. R. C. Etches et al., Can. J. Anaesth. 36 (1989)
(1996) 567–592. 165–185.
345. J. C. Meunier et al., Nature 377 (1995) 374. J. E. Shook et al., Am. Rev. Respir. Dis. 142
532–535. (1990) 895–909.
346. P. L. Wood, Neuropharmacology 21 (1982) 375. M. F. Mulroy, Reg. Anesth. 21 (6 Suppl.)
487–497. (1996) 89–93.
347. G. W. Pasternak, P. J. Wood, Life Sci. 38 376. F. W. Jackson, Gastroenterology 106 (1994)
(1986) 1889–1898. 820–821.
348. G. Gaveriaux-Ruff, B. Kieffer, in C. Stein, 377. T. A. Bowdle, Drug Saf. 19 (1998) 173–189.
(ed.): Opioids in Pain Control. Basic and 378. W. Kromer, Dig. Dis. 8 (1990) 361–373.
Clinical Aspects, Cambridge University Press, 379. I. Mancini, E. Bruera, Support Care Cancer 6
Cambridge 1999, pp. 1–20. (1998) 356–364.
349. B. L. Kieffer et al., Proc. Natl. Acad. Sci. U S 380. A. De Luca, I. M. Coupar, Pharmacol. Ther.
A. 89 (1992) 12048–12052. 69 (1996) 103–115.
350. C. J. Evans et al., Science, 258 (1992) 381. R. C. Heel et al. Drugs. 15 (1978) 33–52.
1952–1955. 382. E. Campora et al., J. Pain Symptom Manage. 6
351. R. K. Reinscheid et al. Science, 270 (1995) (1991) 428–430.
792–794. 383. R. Aparasu et al., J. Pain Symptom Manage. 18
352. G. Calo’ et al. Peptides, 21 (2000) 935–947. (1999) 280–288.
92 Analgesics and Antipyretics
384. J. P. Blancquaert et al. Eur. J. Pharmacol. 128 412. V. Ozdemir et al., Pharmacogenetics 10
(1986) 143–150. (2000) 373–388.
385. N. M. Barnes et al., Neuropharmacology 30 413. G. Ehrhart, H. Ruschig: Arzneimittel,
(1991) 1073–1083. Entwicklung, Wirkung, Darstellung, vol. 1,
386. A. Pfeiffer et al., Science 233 (1986) 774–776. Verlag Chemie, Weinheim 1972, pp. 79, 115.
387. R. Brown, R. Lo, Aust. N. Z. .J Ment. Health 414. C.E. Inturrisi et al., Life Sci. 33 Suppl 1 (1983)
Nurs. 9 (2000) 65–74. 773–776.
388. D. A. Taylor, W. W. Fleming, Pharmacol. Exp. 415. J. G. Umans, C. E. Inturrisi, J. Pharmacol.
Ther. 297 (2001) 11–18. Exp. Ther. 218 (1981) 409–415.
389. H. A. Heit, Eur. J. Pain 5 Suppl A (2001) 416. D. K. Wyatt, L. T. Grady, Anal. Profiles Drug
27–29. Subst. 10 (1981) 357–403.
390. R. F. Reder, Eur. J. Pain. 5 Suppl A (2001) 417. U. Boerner et al., Drug Metab. Rev. 4 (1975)
109–111. 39–73.
391. F. J. Muhtadi, Anal. Profiles Drug Subs. 17 418. C. E. Inturrisi et al., N. Engl. J. Med. 310
(1988) 259–366. (1984) 1213–1217.
392. Knoll, DOS 2 726 925, 1977. 419. G. Ehrhart, H. Ruschig: Arzneimittel,
393. T. Hudlicky et al.: “A historical perspective of Entwicklung, Wirkung, Darstellung, vol. 1,
morphine synthesis,” in: Atta-ur-Rahman Verlag Chemie, Weinheim 1972, p. 180.
(ed.): Studies in Natural products Chemistry, 420. A. Stein, Pharmazie 10 (1955) 180–186.
Elsevier, Amsterdam 1996, pp. 43–116. 421. J. E. Edwards et al. Cochrane Database Syst.
394. D. Trauner et al., Synthesis 1983 203–204. Rev. (2000) CD 2760.
395. J. Mulzer, D. Trauner, Chirality 11 (1999) 422. H. Matthys et al., Schweiz. Med. Wochenschr.
475–482. 115 (1985) 307–311.
396. J. Frackenpohl, Chem. u. Zeit 34 (2000) 423. R. S. Lloyd et al., Curr. Med. Res. Opin. 13
99–112. (1992) 37–48.
397. G. J. Meuzelaar et al., Eur. J. Org. Chem. 424. Reckitt & Colman, DE 1 620 206, 1966.
(1999) 2315–2321. 425. Reckitt & Sons Ltd., US 3 433 791, 1969.
398. J. Mulzer, D. Trauner, Chirality 11 (1999) 426. K. W. Bentley, D. G. Hardy, Proc. Chem. Soc.
475–482. (London) 1963, 220.
399. H. Nagata, et al. Chem. Commun. (2001) 427. W. G. Dorner, Chem. Unserer Zeit 15 (1986)
1094–1095. 33–46.
400. H. J. McQuay, B. J. Anaest. 63 (1989) 428. K. O. Lee et al., Eur. J. Pharmacol. 378 (1999)
213–226. 323–330.
401. L L. Christrup, Acta Anaesthesiol. Scand. 41 429. G. F. Blane, J. Pharm. Pharmacol. 19 (1967)
(1997) 116–122. 367–373.
402. R. Osborne et al., Clin. Pharmacol. Ther. 47 430. T. Alford et al., J. Am. Vet. Med. Ass. 164
(1990) 12–19. (1974) 702–705.
403. J. Lotsch, G. Geisslinger, Clin. 431. G. Ehrhart, H. Ruschig: Arzneimittel,
Pharmacokinet. 40 (2001) 485–499. Entwicklung, Wirkung, Darstellung, vol. 1,
404. G. Ehrhart, H. Ruschig: Arzneimittel, Verlag Chemie, Weinheim 1972, pp. 119–120.
Entwicklung, Wirkung, Darstellung, vol. 1, 432. Knoll, DRP 607 931, 1935.
Verlag Chemie, Weinheim 1972, pp. 117–118. 433. Z. R. Chen et al., Life Sci. 48 (1991)
405. Boehringer, DRP 247 180, 1912. 2165–2171.
406. B. L. Posey, N. S. Kimble, J. Anal. Toxicol. 8 434. A. B. Morrison, Can. Med. Assoc J. 120
(1984) 68–74. (1979) 1338.
407. F. J. Muhtadi, M. M. A. Hassan, Anal. Profiles 435. Merck, US 2 715 626, 1955.
Drug Subs. 10 (1981) 93–138. 436. H. Rapoport, R. Naumann, E. R. Bissel, R. M.
408. Q. Y. Yue et al., Ther. Drug Monit. 19 (1997) Bonner, J. Org. Chem. 15 (1950) 1103–1107.
539–542. 437. G. Lindena et al., Schmerz 12 (1998) 195–204.
409. G. Ehrhart, H. Ruschig: Arzneimittel, 438. D. E. Moulin et al., Lancet 337 (1991)
Entwicklung, Wirkung, Darstellung, vol. 1, 465–468.
Verlag Chemie, Weinheim 1972, 118. 439. J. L. Hill, J. P. Zacny, Psychopharmacology
410. E. Merck AG, DRP 131 980, 1902.
(Berlin). 152 (2000) 31–39.
411. E. Tani et al., Arzneimittelforschung 39 (1989)
1399–1402.
Analgesics and Antipyretics 93
500. J. A. Grass, J. Pain Symptom Manage. 7 530. A. A. Lawson, D. B. Northridge, Med. Toxicol.
(1992) 271–286. Adverse Drug Exp. 2 (1987) 430–444.
501. M. Goldberg et al., Anesthesiology 63 (1985) 531. Janssen, US 2 898 340, 1959;
199–201. Searle, US 4 086 234, 1978.
502. Farbw. Hoechst, DBP 865 314, 1941. 532. C. J. Niemegeers et al., Arzneimittelforschung
503. Merck & Co., US 2 644 010, 1953. 22 (1972) 516–518.
504. Abott, US 2 983 757, 1961. 533. D. D. Hung, Anal. Profiles Drug. Subst. 7
505. E. M. Schultz et al., J. Am. Chem. Soc. 69 (1978) 149–169.
(1947) 2454–2459. 534. Janssen, US 3 714 159, 1973;
506. N. R. Easton et al., J. Am. Chem. Soc. 69 ED-OS 2 126 559, 1971.
(1947) 2941–2942. 535. R. A. Stokbroekx et al., J. Med. Chem. 16
507. A. A. Larsen et al., J. Am. Chem. Soc. 70 (1973) 782–786.
(1948) 4195–4196. 536. M. R. Dashwood et al., Prog. Clin. Biol. Res.
508. E. E. Howe, M. Sletzinger, J. Am. Chem. Soc. 328 (1990) 165–169.
71 (1949) 2935. 537. R. C. Heel et al., Drugs 15 (1978) 33–52.
509. M. Bockmühl, G. Ehrhart, Justus Liebigs Ann. 538. R. C. Heel et al., Drugs. 15 (1978) 33–52.
Chem. 561 (1948) 52–85. 539. D. L. DeHaven-Hudkins, et al., Life Sci. 71
510. S. K. Sim, Can. Med. Assoc. J. 109 (1973) (2002) 2787–2796.
615–619. 540. F. Awouters et al., Dig. Dis. Sci. 38 (1993)
511. R. H. Biskara, Anal. Profiles Drug Subs. 3 977–995.
(1974) 365–439. 541. R. C. Heel et al., Drugs. 15 (1978) 33–52.
512. G. D. Olson et al., Clin. Pharmacol. Ther. 21 542. C. D. Ericsson P. C. Johnson, Am. J. Med.
(1977) 147–157. 88(6A) (1990) 10S–14S.
513. M. P.xs Davis, D. Walsh, Support Care Cancer 543. Janssen, DE 1 238 472, 1961.
9 (2001) 73–83. 544. F. Weyne et al., Acta anaesth. belg. 19 (1968)
514. H. Joseph et al., Mt. Sinai J. Med. 67 (2000) 33–45.
347–364. 545. Gödecke, DE 1 518 959, 1965;
515. M. Farell et al., Br. Med. J. 309 (1994) Warner-Lambert, US 3 557 126, 1969.
997–1001. 546. L. E. Overman et al., J. Org. Chem. 44 (1979)
516. M. J. Kreek, JAMA. 223 (1973) 665–668. 4183–4185.
517. J. Lowinson et al., Curr. Psychiatr. Ther. 18 547. G. Satzinger, Justus Liebigs Ann. Chem. 758
(1978) 165–172. (1972) 43–64, 65–71; 728 (1969) 64–87.
518. F. I. Carroll et al., J. Org. Chem. 41 (1950) 548. G. Satzinger et al., Pharm. Ind. 40 (1978)
3521–3524. 657–664.
519. S. A. Walczak et al., Eur. J. Pharmacol. 72 549. R. Schulz et al., Naunyn Schmiedebergs Arch.
(1981) 343–349. Pharmacol. 304 (1978) 89–93.
520. J. D. Blaine et al. Ann. N. Y. Acad. Sci. 362 550. M. Hermann et al., Arzneimittel-Forsch. 20
(1981) 101–115. (1970) 977–983.
521. A. Wolven et al., NIDA Res. Monogr. (1976) 551. K. O. Vollmer, Fortschr. Med. 106 (1988)
29–38. 593–596.
522. J. Kang et al., Eur. J. Pharmacol. 458 (2003) 552. Grünenthal, GB 997 399, 1964;
25–29. US 3 564 100, 1971 (E. Frankus, K. Flick).
523. R. L. Deamer et al., J. Addict Dis. 20 (2001) 553. K. Flick et al., Arzneim.-Forsch./Drug Res. 28
7–14. (1978) no. 1, 107–113.
524. Janssen, DE 1 117 126; 1956; 554. M. C. Frink et al., Arzneimittelforschung 46
GB 822 055, 1956. (1996) 1029–1036.
525. A. J. Grace, Br. Med. J. 281 (1980) 1285. 555. E. Friderichs et al., Arzneimittel-Forsch. 28
526. A. Pohland, H. R. Sullivan, J. Am. Chem. Soc. (1978) 122–134.
75 (1953) 4458–4461; 77 (1955) 3400–3401. 556. R. B. Raffa, E. Friderichs, Pain Rev. 3 (1996)
527. A. Pohland et al., J. Org. Chem. 28 (1963) 249–271.
2483–2484. 557. R. B. Raffa et al., J. Pharmacol. Exp. Ther. 267
528. H. R. Sullivan et al., J. Org. Chem. 28 (1963) (1993) 331–340.
2381–2385. 558. C. R. Lee et al., Drugs 46 (1993) 313–340.
529. D. Boven et al., Hum. Toxicol. 3 (1984) Suppl., 559. K. McClellan, L. J. Scott, Drugs 63 (2003)
1S–238S. 1079–1088.
Analgesics and Antipyretics 95
560. P,Huang et al., J. Pharmacol. Exp. Ther. 297 590. W. K. Schmidt, Drug Alcohol Depend. 14
(2001) 688–695. (1985) 339–362.
561. B. Kögel et al. Eur. J. Pain. 9 (2005) 599–611. 591. G. C. Pugh et al., Br. J. Anaesth. 62 (1989)
562. R. C. Heel et al., Drugs. 17 (1979) 81–110. 601–609.
563. J. Martin, J.Psychoactive Drugs Suppl 2 592. Merck & Co., US 2 364 833, 1944;
(2004) 129–137. US 2 891 954, 1959.
564. S. Sung, J. M. Conry, Ann. Pharmacother. 40 593. M. U. Zubair et al., Anal. Profiles Drug Subs.
(2006) 501–505. 18 (1989) 195–219.
565. T. J. Gal, Clin. Pharmacol. Ther. 45 (1989) 594. Sterling Drug, BE 611 000, 1961.
66–71. 595. S. Archer et al., J. Med. Chem. 7 (1964)
566. N. Griessinger et al., Curr. Med. Res Opin. 21 123–127.
(2005) 1147–1156. 596. R. N. Brogden et al., Drugs 5 (1973) 6–91.
567. A. Dahan et al., Br. J. Anaesth. (2006) 96, 597. D. A. Reed, S. H. Schnoll, JAMA 256 (1986)
627–632. 2562–2564.
598. H. Schmidthammer, Prog. Med. Chem. 35
568. Bristol-Myers, US 3 775 414, 1973.
(1998) 83–132.
569. J. Monkovic et al., J. Am. Chem. Soc. 95
599. G. Ehrhart, H. Ruschig: Arzneimittel,
(1973) 7910.
Entwicklung, Wirkung, Darstellung, vol.1,
570. J. Monkovic et al., J. Am. Chem. Soc. 100
Verlag Chemie, Weinheim 1972, pp. 131–132.
(1978) 4609–4610.
600. J. Hellerbach et al., Helv. Chim. Acta 39
571. C. E. Rosow, Acute Care 12 Suppl 1 (1988)
(1956) 429–440.
2–7. 601. O. Schnider, A. Grüssner, Helv. Chim. Acta 24
572. R. C. Heel et al., Drugs 16 (1978) 473–505. (1951) 2211–2217.
573. B. Ameer, F. J. Salter, Am. J. Hosp. Pharm. 36 602. D. M. Paton, Drugs Future 4 (1979) 438–441.
(1979) 1683–1691. 603. W. Leimgruber et al., Adv. Biochem.
574. R. V. Homan, Am. Fam. Physician 49 (1994) Psychopharmacol. 8 (1973) 45–50.
188–192. 604. F. F. Foldes et al., Can. Anaesth. Soc. J. 16
575. American Home, BE 776 173, 1971; (1969) 151–161.
DE 2 159 324, 1971. 605. J. M. Evans et al., Anaesthesia 29 (1974)
576. M. E. Freed et al., J. Med. Chem. 16 (1973) 721–727.
595–599. 606. US 3 254 088, 1966;
577. J. C. Chen et al., Life Sci. 52 (1993) 389–396. DE 1 183 508, 1962 (M. J. Lewenstein).
578. J. J. O’Brien, et al., Drugs 38 (1989) 226–248. 607. R. A. Olofson et al., Tetrahedron Lett. 1977
579. J. L. Malis, J. Pharmacol. Exp. Ther. 194 1567–1577.
(1975) 488–498. 608. R. Simantov, S. H. Snyder, Biochem. Soc.
580. J. J. O’Brien, P. Benfield, Drugs 38 (1989) Trans. 5 (1977) 62–65.
226–248. 609. K. A. Handal et al., Ann. Emerg. Med. 12
581. Wyeth, DE-OS 1 941 534, 1969; (1983) 438–445.
GB 1 285 025, 1969. 610. P. M. Goodrich, AANA J. 58 (1990) 14–16.
582. G. Bradley et al., Eur. J. Med. Chem. 15 (1980) 611. Endo Laboratories, GB 1 119 270, 1968;
375. US 3 332 950, 1967.
583. B. Holmes, A. Ward, Drugs 30 (1985) 612. V. Höllt, A. Herz, Fed. Proc. 37 (1978)
285–312. 158–161.
584. G. W. Pasternak et al., Postgrad. Med. J. 61 613. B. L. Crabtree, Clin. Pharm. 3 (1984)
Suppl 2 (1985) 5–12. 273–280.
585. B. Holmes, A. Ward, Drugs 30 (1985) 614. J. P. Gonzalez, R. N. Brogden, Drugs 35
285–312. (1988) 192–213.
586. Endo Laboratories, GB 1 119 270, 1968; 615. B. A. Judson et al., Drug Alcohol Depend. 7
US 3 332 950, 1967. (1981) 325–346.
616. Boehringer Ingelheim Pharma GmbH & Co.
587. L. Castaner, P. J. Roberts, Drugs Future 2
KG, US 4176186, 1979 (L. Goldberg, H.
(1977) 613–615.
Merz, K. Stockhans).
588. E. B. De Souza, et al., J. Pharmacol. Exp.
617. C. S. Yuan, J. F. Foss, Neuropharmacology 38
Ther. 244 (1988) 391–402.
(1999) 425–432.
589. J. K. Errick, R. C. Heel, Drugs 26 (1983)
618. C. S. Yuan et al., J. Pharmacol. Exp. Ther. 300
191–211.
(2002) 118–123.
96 Analgesics and Antipyretics
619. D. S. Wang et al., J. Emerg. Med. 16 650. H. A. Friedel, A. Fitton, Drugs 45 (1993)
(1998):471–475. 548–569.
620. H. E. Jones et al., Drug Alcohol Depend. 60 651. Pfizer, US 4152326, (J. Hartenstein, G.
(2000) 29–37. Satziger).
621. L. C. Costantini et al., Int. J. Pharm. 283 652. Pfizer, US 4024175, (G. Satzinger, J.
(2004) 35–44. Hartenstein, M. Hermann, W. Heldt).
622. J. E. Grant et al., Am. J. Psychiatry 163 (2006) 653. Zambon Group, WO 2005 044 779, 2005 (K.
303–312. Arrighi, F. Corcella, G. Marchioro, A. Nicoli,
623. K. Hempenstall, A. S. Rice, Curr. Opin. M. Paiocchi, M. Villa).
Investig. Drugs 3 (220) 441–448. 654. Taro Pharmaceutical Industries Ltd., WO 2003
624. R. H. Dworkin et al., Arch. Neurol. 60 (2003) 089403, 2003
1524–1534. 655. R. Cagnoli et al., Tetrahedron 59 (2003) 9951.
625. H. Ueda, Pharmacol Therap. 109 (2006) 656. G. J. Sills, Curr. Opin. Pharmacol. 6 (2006)
57–77. 108–113.
626. D. B. Gordon, G. Love, Pain Manage. Nurs. 5 657. J. K. Baille, I. Power Curr. Opin. Investig.
(2004) 19–33. Drugs 7 (2006) 33–39.
627. G. T. Carter, M. D. Sullivan, Curr. Opin. 658. I. W. Tremont-Lukats et al., Drugs 60 (2000)
Investig. Drugs 3 (2002) 454–458. 1029–1052.
628. J. Zhou, Drugs of the Future 29 (2004) 659. J. Devulder et al., Acta Neurol. Belg. 102
1235–1244. (2002) 97–103.
629. J. Lai et al., Ann. Rev. Pharmacol. Toxicol. 44 660. Wellcome Foundation, EP 21 12, 1981 (M. G.
(2004) 371–397. Baxter, et al.).
630. Ciba, US 3 471 548. 1969. 661. Wellcome, US 4 560 687, 1985 (M. G. Baxter,
631. Ciba, US 3 978 216, 1972. A. R. Elphick, A. A. Miller, D. A. Sawyer).
632. N. G. Bowery, Curr. Opin. Pharmacol. 6 662. Wellcome, US 4 602 017, 1986 (M. G. Baxter,
(2006) 37–43. A. R. Elphick, A. A. Miller, D. A. Sawyer).
633. Geigi, US 2 948 718, 1960 (W. Schindler). 663. E. Eisenberg et al., Rev. Neurotherapeutics 5
634. DD 133 052, 1977 (R. Müller). (2005) 729–735.
635. D. Soyka et al., Schmerz 12 (1998) 419–427. 664. M. Guven, H. Bozdemir, J. Gunay, Y. Sarica, J.
636. Boehringer Ingelheim, DE 1 303 141, 1961; Kahraman, F. Koc, The actions of lamotrigine
US 3 236 857, 1966. and levetiracetam on the conduction properties
637. VEB Arzneimittelwerke Dresden, DE-AS 1 of isolated rat sciatic nerve, Eur. J. Pharmacol.
770 874, 1968. 553 (2006), 129–134.
638. H. Schmitt, Handb. Exp. Pharmacol. 39 665. Rexall, US 3 487 153, 1969.
(1977) 299–396. 666. Riker, US 3 830 803, 1974.
639. C. Lund et al., Br. J. Anaesth. 63 (1989) 667. R. C. Heel et al., Drugs 19 (1980) 249–267.
516–519. 668. Park Davis, US 2 409 754, 1946 (H. R. Henze).
640. D. R. Jasinki et al., Arch. Gen. Psychiatry 42 669. H. Biltz et al., Ber. Dtsch. Chem. Ges. 41
(1985) 1063–1066. (1908) 1391.
641. J. Deeter et al., Tetrahedron Lett. 31 (1990) 670. Warner-Lambert WO 99/48876, 1999 (R. L.
7101. Bosch)
642. L. A. Sorbera et al., Drugs of the Future 25 671. B. D. Maryanoff, B. L. Margul, Drugs of the
(2000) 907–916. Future 14 (1989) 342.
643. H. Liu et al., Chirality 12 (2000) 26–29. 672. B. E. Maryanoff, et al., Med. Chem. 30 (1987)
644. S. Attila, E. Leinonen, Curr. Opin. 880–887.
Investig.Drugs 3 (2002) 1217–1221. 673. Ortho-McNeil Pharmaceuticals Inc., US
645. N. Pitsikas, Curr. Opin. Investig. Drugs 1 4513006, 1985 (B. E. Maryanoff, J. F.
(2000) 116–121. Gardocki).
646. Degussa, DE 1 795 858, 1968; 674. Ortho-McNeil Pharmaceuticals Inc., WO 2004
US 3 513 171, 1970. 078769, 2004 (J. E. Berkner, S. Duncan)
647. Drugs Future 8 (1983) 773–775. 675. C. E. Heading, IDrugs 4 (2001) 339–350.
648. W. von Bebenburg et al., Chem. Ztg. 103 676. C. E. Heading, Curr. Opin. Investig. Drugs 3
(1979) 387–399. (2002) 915–920.
649. W. von Bebenburg et al., Chem. Ztg. 105 677. S. Tries et al., Inflamm. Res. 51 (2002)
(1981) 217–219. 129–134.
Analgesics and Antipyretics 97
678. J. J.Talley, .J Med. Chem. 43 (2000) 775–777. 681. Troponwerke, US 3 692 818, 1972,
679. US 2 806 033, 1955 (M. J. Lewenstein, U. DE 1 939 112, 1969.
Weiss). 682. Syntex, US 3 896 157, 1975.
680. T. Appelboom, P. Franchimont, Adv. Therapy 683. Geigi, US 3 558 690, 1971.
11 (1994) 228–234.