Documenti di Didattica
Documenti di Professioni
Documenti di Cultura
OF PTERIDINES
AND FOLATES
ADVANCES IN EXPERIMENTAL MEDICINE AND BIOLOGY
Editorial Board:
NATHAN BACK, State University of New York at Buffalo
IRUN R. COHEN, The Weizmann Institute of Science
DAVID KRITCHEVSKY, Wistar Institute
ABEL LAJTHA, N. S. Kline Institute for Psychiatric Research
RODOLFO PAOLETTI, University of Milan
Volume 331
FRONTIERS IN CEREBRAL VASCULAR BIOLOGY: Transport and Its Regulation
Edited by Lester R. Drewes and A. Lorris Betz
Volume 332
MECHANISM OF MYOFILAMENT SLIDING IN MUSCLE CONTRACTION
Edited by Haruo Sugi and Gerald H. Pollack
Volume 333
OPTICAL IMAGING OF BRAIN FUNCTION AND METABOLISM
Edited by Ulrich Dirnagl, Arno Villringer, and Karl M. Einhaupl
Volume 334
NEW CONCEPTS IN THE PATHOGENESIS OF NIDDM
Edited by Claes Gdran Ostenson, Suad Efendic, and Mladen Vranic
Volume 335
DRUGS OF ABUSE, IMMUNITY, AND AIDS
Edited by Herman Friedman, Thomas W. Klein, and Steven Specter
Volume 336
ANCA-ASSOCIATED VASCULITIDES: Immunological and Clinical Aspects
Edited by Wolfgang L. Gross
Volume 337
NEUROBIOLOGY AND CELL PHYSIOLOGY OF CHEMORECEPTION
Edited by P. G. Data, H. Acker, and S. Lahiri
Volume 338
CHEMISTRY AND BIOLOGY OF PTERIDINES AND FOLATES
Edited by June E. Ayling, M. Gopal Nair, and Charles M. Baugh
A Continuation Order Plan 1s available for th1s senes. A contmuation order will bring delivery of each new volume
immediately upon publication. Volumes are billed only upon actual shipment. For further mformat10n please contact the
publisher.
CHEMISTRY AND BIOLOGY
OF PTERIDINES
AND FOLATES
Edited by
June E. Ayling
M. Gopal Nair
Charles M. Baugh
University of South Alabama
Mobile, Alabama
Proceedings of the Tenth International Symposium on Chemistry and Biology of Pteridines, held March
21-26, 1993, in Orange Beach, Alabama
ISBN 978-1-4613-6287-6
No part of this book may be reproduced, stored in a retrieval system, or transmitted in any form or by
any means, electronic, mechanical, photocopying, microfilming, recording, or otherwise, without written
permission from the Publisher
PREFACE
The pteridines in their multitude of forms fulfill many roles in nature ranging from
pigments to cofactors for numerous redox and one-carbon transfer reactions. This
extraordinary diversity of function is unified by the unique chemistry of the pteridine
heterocycle. The International Symposium on the Chemistry and Biology of Pteridines and
Folates is a forum for presenting recent and exciting advances in this expanding field. In
bringing together various disciplines, a synergy of ideas results that has often stimulated
fresh approaches to major problems. The Tenth International Symposium held at Orange
Beach, Alabama, March 21-23, 1993, proved no exception by providing new insights into
folate enzymology, tetrahydrobiopterin and molybdopterin biosynthesis and function,
enzyme synthesis and regulation, along with novel synthetic strategies for producing
compounds that will expedite further study. The many outstanding scientific contributions
found in the following chapters, which represent the work presented at the Symposium, are
a reflection of the significant advances made since the Ninth International Symposium held
in Zurich in 1989.
Since the 7th International Symposium in St. Andrews, Scotland, a tradition has
evolved of honoring scientists who have made outstanding contributions to pteridine
research with a Gowland Hopkins medal and lectureship. Sir Frederick Gowland Hopkins
initiated the first investigation of what later proved to be pteridines in his studies of the
yellow and white colors of butterflies. The selection of Edward Taylor and Wolfgang
Pfleiderer for the 1993 Hopkins award seems especially appropriate in view of the
impending 1OOth anniversary of the first synthesis of a pteridine (lumazine 6,7-dicarboxylic
acid) by Ktihling in 1894. Almost every chemist in the field, as well as many others, have
greatly benefited from the careful and insightful work of these two scientists. Their many
contributions are summarized on the following pages by Peter Beardsley, a former Ph.D.
student of Edward Taylor, and Max Viscontini, still a very active pteridine chemist himself.
We would like to acknowledge members of the Advisory Committee who were of
great assistance in various aspects of planning the Symposium. We would also like to
thank the sponsors, listed on the Acknowledgments page, who made the meeting possible.
The breadth of the support we have received from both governmental and corporate
sponsors is an indication of the continuing recognition of the major role that pteridines play
in biology and medicine. The efforts of members of the finance committee in helping to
obtain this support are also greatly appreciated. Special thanks to Dusti Steelman and Judi
Naylor for so cheetfully helping with the mailings, the preparation of the program and
abstract book and with the registration before and during the meeting. Finally, we would
like to acknowledge the invaluable involvement of Steven Bailey.
v
We were pleased to host this meeting in Alabama where significant and continuous
contributions have been made to this field over the past 30 years. We look forward to the
11th International Symposium which will be organized by Wolfgang Pfleiderer and Hartmut
Rokos and held in Germany.
June Ayling
Gopal Nair
Charles Baugh
College of Medicine
University of South Alabama
Vl
GOWLAND HOPKINS LECTURESHIP
EDWARD C. TAYLOR
The choice of Ted Taylor as one of the two Gowland Hopkins Lecturers for this
International Symposium could not be more appropriate. His contributions to the field of
pteridine chemistry and biochemistry over a career spanning more than 45 years are
equalled only by those of Wolfgang Pfleiderer, the co-recipient of this honor. No one else
even comes close!
While his work in general ts so broad-based to perhaps defy specific
characterization, yet through it all run the traits of exceptional cleverness, imagination and
"elegant simplicity". He has a knack not only for designing and implementing novel
synthetic approaches, but also for noticing the unexpected result and exploiting it in many
variations to synthetic advantage. Taylor is famous for making the complex seem simple.
His work is replete with examples of the synthesis of complex heterocyclic and other
compounds in a short series of steps, many of which involve clever sequences of
condensation, ring cleavage and rearrangement reactions, often occurring "in one pot".
Taylor's contributions to pteridine chemistry include a series of more than 125
papers on pteridines, aza- and deaza-pteridines, numerous patents, and the classic volume
Ptendine Chemzstry, co-edited with Pfleiderer. These describe work which ranges from
the basic chemistry of these ring systems, through development of synthetic methodology,
to applications in the synthesis of natural products and the development of novel folate
antimetabolites. The classtc "Taylor Synthesis" involves elaboration of a pyrazine
intermediate and allows unequivocal synthesis of the biologically important 6-substituted
pteridines. He has applied this approach to the synthesis of natural pteridines including
xanthopterin, folic acid, L-erythro-biopterin, neopterin, urothione, and Form A of the
molybdenum cofactor- only a partial list.
Vll
Probably the most striking achievement recently has been the synthesis of a wide
variety of deaza analogs of tetrahydrofolate. This work began with the synthesis nearly ten
years ago of 5,10-dideazatetrahydrofolate (DDATHF, Lometrexol). This compound was
shortly found to be a potent inhibitor of de novo purine biosynthesis. Broad spectrum
antitumor activity was then found in pre-clinical models, and Lometrexol is now
undergoing clinical trials with encouraging early results. The initial discovery of DDATHF
has had a major impact on subsequent antifolate drug development. Not only was a new
class of structures opened to further investigation, but added impetus was provided to the
search for other novel inhibitors of previously unexplored enzymatic targets for antifolate
attack. The result has been a major rekindling of interest in antifolate drug development,
an area in which Taylor himself has been a major participant. This work has been full of
new synthetic chemistry and biochemical surprises, and forms the basis for this Gowland
Hopkins Lecture.
Many whose relationship to Taylor is through a common interest in pteridines may
not realize that, despite the magnitude of his achievements in our field, this represents only
a portion of the overall scope of his work. He has also made major contributions to basic
chemistry and synthetic methodology in purines, pyrimidines, triazines and diazetidinones.
In fact, he has contributed very significantly to our knowledge of virtually all heterocyclic
systems. His contributions extend much further than heterocyclic chemistry and include
elegant total syntheses of Chinchona alkaloids. His well known one step synthesis of
tetrahydrocannabinol is a particularly illustrative example of his clever and imaginative
approach to synthetic design. Finally, Taylor has made numerous major contributions to
the whole field of synthetic organic chemistry. While there are many examples,
particularly outstanding has been his pioneering and extensive work in the use of thallium
reagents in organic syntheses. A long and highly productive collaboration between Taylor
and Prof. Alexander McKillop has led to the development of extraordinarily versatile
thallium reagents and reactions which have wide application in virtually every area of
synthetic organic chemistry.
Taylor's role as a teacher and mentor may be almost as important as his own work.
Those who hear his lectures and seminars are treated not only to exciting chemistry, but
to presentations of extraordinary organization and clarity. To students and others who work
with him, he transmits not only some of his profound understanding of how molecules
work and how to assemble them but, perhaps more importantly, a considerable measure of
his boundless enthusiasm and perpetual optimism. For Ted, it's never that a good idea
"doesn't work", it's just that it "hasn't worked yet". Those who come to know him soon
realize that these same qualities of vigor, enthusiasm and optimism apply to his whole
approach to life. Those who have known him over the years realize that these are not
diminishing, rather they are on a continuing upswing. We, therefore, look forward to a
great deal more in the way of exciting new developments and contributions to pteridines
and to chemistry in general.
G. Peter Beardsley
Yale University School of Medicine
viii
GOWLAND HOPKINS LECTURESHIP
WOLFGANG PFLEIDERER
The year 1955 was a milestone in pteridine chemistry. After four years of intense,
exciting work, we had just published in Helvetica Chimica Acta three articles together with
P. Karrer and E. Hadom, in which we described the isolation of new compounds from the
small fly Drosophila melanogaster, two of which had a deep sky blue (in German "Himmel
J!lau", H ID fluorescence and were therefore baptized HB 1 and HB2 in our laboratory slang.
We found out very quickly that HB 1 corresponded to pterin, while the structure of HB2
gave us a lot of trouble. Experienced chemists like those of Stokstad's team would have
immediately identified HB 2 as L-biopterin. My lack of experience in pterin chemistry
plunged me into an abyss of doubt, because I trusted blindly the elemental analyses, which,
I must admit, in case of pterins, were far from being as accurate as they are today. To end
a long story, our work remained more or less unnoticed - what were we looking for in
these small flies, everybody wondered - especially because some weeks later Stokstad
published the isolation of a growth factor, starting from a thousand liters of human urine,
which he called L-biopterin, and determined its structure. Our work remained more or less
overlooked, except in the eyes of a young chemist who recognized rapidly the importance
of the research which was going on in our laboratory. In the beginning of 1956, a
handsome looking man of good appearance, tall, with a determined face, missing the left
arm, entered my office. A war-wounded man, I thought as I looked at him. I had in front
of me Wolfgang Pfleiderer, not the Professor Pfleiderer we know today, but a young man.
At that time he was 29 years old and well resolved to make his way in life.
"Professor Viscontini, I am a chemist at the University of Stuttgart, where in 1952
I gained my Ph.D. under the supervision of Professor Bredereck. My dissertation was
devoted to the chemical and physicochemical properties of some purine derivatives. Now
IX
I am writing my Habilitation about lumazines. Unfortunately, the topic does not really fill
my supervisor with enthusiasm. As a consequence I am obliged to work by myself without
people with whom I can discuss results, problems or difficulties. Recently I read your
papers on pteridines isolated from Drosophila melanogaster and I was greatly impressed
by the results you published on the research carried out on this fly. I have, therefore,
ventured to come to Zurich in order to make contact with a person who shares my
scientific interest. I would like to know, if I am correct or mistaken in involving myself
so strongly in the field of pteridine chemistry". Here was finally somebody with whom I
was in perfect communication! I felt that my work attracted him. I did my best to
convince him how right he was, taking the way of hard research where results do not
manifest themselves in kilograms of publications, but brings out the author's originality.
I emphasized, that in my opinion, pteridines might play a great role in nature, that he had
to go on in the direction he chose and that he would find later the benefit of it. In a short
time we became close friends, with a very similar scientific philosophy. We separated,
promising to meet again and to discuss as often as possible the results of our research.
Some months later, in 1957 Pfleiderer gained his Habilitation and his appointment as
Dozent at the University of Stuttgart. In 1958 he spent one year as Research Associate
at the University of Princeton with Professor Edward Taylor.
In the meantime we went on with the isolation of three orange pigments,
drosopterin, isodrosopterin, and neodrosopterin from Drosophila. In 1959 we published the
first hypothetical structures that we proposed for these pigments. After one year of absence
Pfleiderer did not hesitate to come to Zurich. "Sir, your structures are wrong. The UV and
the VIS spectra do not match the proposed formulae". I understood perfectly his point of
view, and suddenly it came to me: I felt isolated with my research, my results were not
especially well appreciated, I was short of money and coworkers and now I had in front
of me a promising young chemist, who, as I sensed, had a mind to get involved with the
field of natural pterins. My decision was immediate: "Listen, Herr Pfleiderer, in my
opinion, from the pteridines we just isolated there are two classes of compounds that seem
important, the drosopterins and the L-biopterin. Both are difficult to study, but both will
bring recognition to the chemist who elucidates their properties. I have confidence in you,
devote yourself to the chemistry of drosopterins and I, for my part, will work on the
chemistry of the L-biopterin".
From that day on I stopped working with drosopterin. In 1962 Professor Pfleiderer
formulated his first ideas on their structure. I could have as easily proposed to Pfleiderer
the study of L-biopterin and chosen the drosopterin for myself. Why did I choose L-
biopterin? Don't ask me, I have no idea myself. Anyway, we never regretted our oral
agreement, neither he nor me. We have remained close friends and loyal to our agreement.
As it turned out, destiny and my choice made Professor Pfleiderer the oracle for
drosopterins while I became the expert for tetrahydrobiopterins. Nevertheless, it is quite
certain, that without my encouragement Professor Pfleiderer would have become famous,
because of his personality. Some hundreds of communications and seven books published
between 1953 and 1992 about pteridines and their derivatives bear witness to the wideness
of the research he carried out, and the importance of the results he obtained. Let us cite
succinctly: tautomeric structures of pteridines, photochemistry, electrochemistry, and most
especially the chemistry of natural pteridines: structure of eugleniapterin, partial synthesis
of tetrahydromethanopterin and, to my opinion the most important and the most admirable
of all his works the structure and the synthesis of the drosopterin pigments.
Good luck for the future, dear Wolfgang!
Max Viscontini
University of ZUrich
X
ACKNOWLEDGMENTS
xi
CONTENTS
CHEMISTRY
N2-(N,N-Dimethylaminomethylene)-04-(2-p-Nitrophenylethy1)-Biopterin:
A Versatile Intermediate for a Glycosidation Reaction ................. 21
H. Yamamoto, T. Hanaya, K. Torigoe, and W. Pfleiderer
xiii
Structure-Function Studies of the Phenylalanine Hydroxylase Active Site
and a Summary of Structural Features ............................ 55
R.G.H. Cotton, D.W. Howells, J.A. Saleeba, I. Dianzani, P.M. Smooker,
and I.G. Jennings
xiv
Spectroscopic Characterization of Human Liver Pterin 4a-Carbinolamine
Dehydratase ............................................. Ill
I. Rebrin, H.Ch. Curtius, S. Ghisla, and F.H. Herrmann
TETRAHYDROBIOPTERIN BIOSYNTHESIS
XV
Regulation of Tetrahydrobiopterin Biosynthesis in Cultured
Hypothalamic and Mesencephalic Neurons by Cyclic
AMP-Dependent GTP Cyclohydrolase I Gene Expression . . . . . . . . . . . . . . 179
K. Hirayama, M. Zhu, and G. Kapatos.
Purification and Properties of Human Sepiapterin Reductase from Placenta ...... 199
J. Maier and I. Ziegler
TETRAHYDROBIOPTERIN REGULATION
xvi
Nicotinic Cholinergic Regulation of Tetrahydrobiopterin Levels in
Bovine Adrenal Chromaffin Cells .............................. 235
J.C. Waymire, J.E. Ayling, and G.L. Craviso
TETRAHYDROBIOPTERIN DEFICIENCY
xvii
Macrophage Nitric Oxide Synthase: Tetrahydrobiopterin Decreases
the NADPH Stoichiometry ................................... 285
J.M. Hevel and M.A. Marietta
6R-L-Erythro-5,6,7,8-Tetrahydrobiopterin: A Regulator of
Neurotransmitter Release . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 313
K. Koshimura, T. Ohue, Ya. Watanabe, and S. Miwa
xviii
Increase of Tetrahydropterins in Cell-Free Retinal Extracts in Response
to Light Exposure . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 339
G. Cremer-Bartels, H. Gerding, and K. Krause
MOLYBDOPTERIN COFACTORS
xix
Synthesis and Biological Evaluation of Analogues of 5,8-Dideazaisofolic
Acid (IAHQ) Modified at Positions 2, 4 and 9 . . . . . . . . . . . . . . . . . . . . . 417
J.B. Hynes, R.L. Hagen, B. Shane, and J. Freisheim
XX
DIHYDROFOLATE REDUCTASE
xxi
Selective Inhibition of Dihydrofolate Reductase from Problem Human Pathogens . . 533
R.L. Then, P.G. Hartman, I. Kompis, and D. Santi
THYMIDYLATE SYNTHASE
xxii
Use of Murine L5178Y Lymphoma Thymidine Kinase Mutants for
in Vitro and in Vivo Antitumour Efficacy Evaluation of Novel
Thymidylate Synthase Inhibitors ............................... 589
T.C. Stephens, M.N. Smith, S.E. Waterman, M.L. McCloskey, A.L. Jackman,
and F.T. Boyle
xxiii
Increased Activity of y-Glutamyl Hydrolase in Human Sarcoma Cell Lines:
A Novel Mechanism of Intrinsic Resistance to Methotrexate . . . . . . . . . . . . 635
W.W. Li, M. Waltham, W. Tong, B.l. Schweitzer, and J.R, Bertino
Two Novel HPLC Methods which Rapidly Detect the Substrates and
Cleavage Products of y-Glutamyl Hydrolase . . . . . . . . . . . . . . . . . . . . . . . 655
Y. Wang, R.F. Rotundo, Z. Nimec, T.J. Ryan, and J. Galivan
ONE-CARBON METABOLISM
xxiv
MTX Does Not Affect Enhanced Biosynthesis and Metabolism of S-Adenosyl-
Methionine in Testosterone-Induced Hypertrophic Mouse Kidney ........ 699
W. Chmurzynska, M. Manteuffel-Cymborowska, M. Szlazak, and
B. Grzelakowska-Sztabert
Influence of Gestation and Lactation on the Levels of Plasma Folates in Sows . . . . 733
M. Natsuhori, E. Kokue, and M. Shimoda
XXV
Contribution of Plasma Protein Binding to the Stability of
Tetrahydrofolate in Pig Plasma ................................ 749
K. Sasaki, M. Shimoda, Y. Aoki, M. Natsuhori, and E. Kokue
Altered Transport of Folic Acid and Antifolates Through the Carrier Mediated
Reduced Folate Transport System in a Human Leukemia Cell Line
Resistant to (6R)5,10-Dideazatetrahydrofolic Acid (DDATHF) .......... 775
M. Pavlovic, J.J. Leffert, 0. Russello, M.A. Bunni, G.P. Beardsley,
D.G. Priest, and G. Pizzomo
xxvi
NATURAL PTERIDINES - A CHEMICAL HOBBY
Wolfgang Pfleiderer
INTRODUCTION
NflY~~
~L,lsJJ
N N
1
2 3 4
BUTTERFLY PIGMENTS
:;..J::x:a,
0 H
H
2
to
I
5 COOH 6
From the dark red coloured butterfly Appias nero native in Java a violet
pigment was isolated and identified as pterorhodin15. This finding was very
interesting regarding the fact that the chemistry of pterorhodins is related to the
beginning of pteridine chemistry, in general, when Frederick Gowland
Hopkins2 noticed already in 1895 during his attempts to isolate butterfly
pigments the formation of a dark-red to violet coloured component which he
called "lepidoporphyrin". This artifact, which is formed under acid catalysis
2
from the simple naturally occurring butterfly pigments, has also troubled
SchOpf's and Wieland's group during their investigations, but only in 1942
Hopkins16 described more details about his studies with coloured material
which he renamed now "rhodopterin". Purrmann et al.17 were able to elucidate
the structure of this artificial component by oxidative degradation and called it
"pterorhodin" in 1944. The structure of this highly insoluble substance was also
proven by chemical synthesis from xanthopterin and 7-methylxanthopterin by
oxidative coupling in acidic medium18. Two structures, the linear (7) and the
bent, hydrogen-bound form (8) are still under discussion accounting for the
deep violet colour of this substance.
/SO-PTERORHODIN ALLO-PTERORHODIN
3
There is also the theoretical possibility that the formation of pterorhodin
by oxidative coupling progresses further giving rise to condensation products
of type 11 or 12 .
11
13 Me H H Me
14 Me Me H Me
15 Me Me Me Me
5.0
4.5
4.0 \
lgE
3.5
0 1'1 " 0
"''·•A..,-"l.o oy"v'-•·""•
H,NJ...N..lN C,I...IIIIJ...H...t..NH 1 - - """"''
H H
3.0
• --.-. ICt'II.H,SQ.
2.5
2.0+......--.-...........~~..-...-.......~~T"""'"~...,......~.......-,........,..........~.........,....,.....~..........,.........~
200 250 300 350 400 450 500 550 600 650 700
~ [nm]
Figure 1 UV I VIS spectra of pterorhodm (8) and 1ts methyl denvanves 13,14,15 m 80% sulfuriC aCid
4
The UV I VIS spectra of pterorhodin (8) and its N-methyl derivatives 13,
14, and 15 in cone. formic acid and 80 % sulfuric acid, respectively, are almost
super-imposed with each other indicating that the same molecular species,
presumably the dication of the hydrogen chelated form 9 is present. The shape
of the curves is of a cyanine-type structure accounting for the strong absorption
in the visible region.
Analogous studies with iso- and allo-pterorhodin, respectively, and their
N-methyl derivatives look even more complex and do not yet allow to draw
obligatory conclusions regarding the fine-structural assignments.
From solubility reasons we then continued other investigations in the
lumazine series where several N-methyl derivatives have been available to
form under acid catalyzed oxidative coupling reactions the corresponding
lumarhodin, isolumarhodin, and allo-lumarhodin analogs. We synthesized
first the 1,1',3,3'-tetramethyl derivatives 20, 21, and 22 from 1,3-dimethyl-(16)
and 1,3,7-trimethyl-6-oxo-5,6-dihydrolumazine (17) as well as from 1,3-
dimethyl(18) and 1,3,6-trimethyl-7-hydroxy-lumazine (19), respectively.
----
16 17
16 19
5
+
y 19
R R1
22 H H
23 CH3 H
24 CH 3 CH 3
5.0 , - - - - - - - - - - -- - - - -- - - - - - - - - - . . ,
log~
3.0
2.5
2.0+--~--.....--~~~~~~---.--~~~-r-~~ ...........---.--.....--.........- i
200 250 300 350 400 450 500
'). (nm]
6
the pure forms which showed the expected physical properties consistent with
the pro-posed structures (Fig. 3).
27 •• I ..
~
+
29 30
5.0 . , . . - - -- - - - - -- - -- -- - -- - - - - - - -,
4.5
I I
!\.'\ I '\
\
1~ '' ~
-.-'
I I
I
I
~ 1"--
\
- I
I
3.5
I
I
I
' '
\
3.0
2.5+--~........~~"'T"""'~"""'""T"""'""T""T""'""T"""""T""'.........,....;..................~........,,...........,....,,_,.,,.......;;....,....,,.......~-;
200 250 300 350 400 450 500 550 600 650 700
nm
Since from the so far available physical data an exact structural assignment
of 29 could not be made regarding the four most probable conformers 29 and 31
and the cis-trans isomers 32 and 33 respectively, more studies had to be 1
performed.
7
33
high symmetry is reflected by finding actual half of the electron density tor the
chelate hydrogen at both N-8 and N-8' positions (Fig. 4).
This structure reveals very nicely that the two 1,1'-methyl groups do not
interact sterically, which should give rise to some other isomeric form missing
the intramolecular stabilization by hydrogen bonding. In order to find out,
8
which of the proposed 5 structures 29 - 33 will be the second stable isomer, we
synthesized from 3,5-dimethyl-1-sec.butyl-6-oxo-5,6-dihydrolumazine (34) and
the corresponding 3,5,7-trimethyl derivative 35 in 4 N HCl in the usual manner
the pterorhodin analog 36, which turned out to consist, as expected, of slightly
yellow but not red to violet crystals. It is obvious that the bulky sec.butyl groups
in 1- and 1'-position do not allow a stable chelated structure (36) but
tautomerizes to bis-3,5-dimethyl-1-sec.butyl-6-oxo-5,6-dihydrolumazin-7-yl-
methane (37).
CHa 0
OtNJLN'CH 3
+
N N~O
I
CH2
I
H3C-CH-CH 3
34 35
I 02
36 37
During the synthesis of 37 the reaction solution turned red, from which
yel-lowish crystals separate on cooling. In solution an equilibrium between 36
and 37, preferring very strongly the latter tautomeric form, must exist according
to the red colour, but it is not possible to isolate the hydrogen chelate. The UV I
VIS spectrum in MeOH also proved the presence of a small amount of 36 or its
anion spectrophotometrically, whereas in HCOOH a colourless solution was
observed.
In conclusion it was proven by these extended studies with various model
substances that the structure of the natural butterfly pigment pterorhodin (8) is
most likely also represented by a hydrogen-bonded hydrogen chelate.
DROSOPHILA PIGMENTS
9
was named neodrosopterin. After the determination of the chiroptical
properties of droso- and isodrosopterin 25 it was obvious that these pigments are
not composed of isomers but of enantiomers showing mirror image ORD and
CD spectra 26. two-dimensional paper chromatography of the drosopterin
fraction finally led to the discovery of two more orange coloured pigments
designated as aurodrosopterin 27 and present again in form of an enantiomeric
mixture28.
Several attempts were made to elucidate the structure of droso- and
isodrosopterin29,30 but only in 1978 Theobald and Pfleiderer31 were able to solve
this difficult problem by proposing the following constitution from NMR and
mass-spectral data.
38 Drosopterin 39
A simple synthesis for this pentacyclic ringsystem was found from 7,8-
dihydropterin (40) and a-hydroxy-13-ketobutyric acid under special pH
conditions 31,32 to become independent from the tedious isolation from
Drosophila heads. The proposed mechanism 32 of this intersting reaction has to
be revised since 6-acetyl-homopterin (41) has been found as a natural
intermediate 34,34 in the biosynthesis of drosopterins.
COOH
I
CHOH -C~
bo
I
CH 3
40
H3C H3C'c
'CHOH HOH
- --
I
0 H~:O o ,.....C-OH
- HN~N~H ~Ni H
H N~.J,
-- H
2
N~N I NJc:::
H
~ H
2
N~N N
H ~
10
41
:z;~NH,
0H,:TtN NHN
HN~ H
H
2
N~N).__NH H
Drosopterin
42 43
11
1 5
16
~
·"f :/
~NH2
HN:.XN H H H H
O~N N H 1.2
" "
E
'h
o.a 08
44 45
12
These results (Table 1) again revealed no significant differences which
could be used for a structural assignment. The problems encountered with
these studies are due to the distorted rings in the drosopterins which do not
allow to correlate the dihedral angles with the experimentally determined
coupling constants. From the structures 44 and 45 as well as from Dreiding
models it can be seen that the cis-drospterin exhibits a much more planar shape
of the rings then trans-drosopterin with its bent and distorted conformation.
Presumably the cis-form is thermodynamically more stable.
The 250 MHz NMR spectrum of natural drosopterin was taken in D20 I
DCl and revealed informative resolution and spitting of the signals of the
aliphatic region (Figure 6). Neodrosopterin is the most difficult Drosophila eye
pigment to work with since its purification is associated with partial
decomposition. Very little material has so far been available which did not
allow to get a high resolution NMR spectrum. Further studies have to be made
to determine its molecular composition and the chemical structure.
·--- - - - - - -- -- - -- - - - - - - - - - ,
..
....
~
....
~ ...
....,,.
.._~
4..$ u •3 u •·• •.o 3.t 3.t 3.7 ~e 3.5 :u 3..3 u 3., l .O 2.e 2.a u 2s
PPm
13
Acknowledgments
I would like to thank Prof.J.Yim, Seoul I Korea for the isolation of the
natural eye pigments from Drosophila melanogaster, Dr.G.Kollmannsberger-
v.Nell forthe simulation and calculations of the NMR spectra and Dr.B.Fischer,
University of Zurich I Switzerland for the X-ray analysis of the pterorhodin
analog. The experimental help of Mr.L. Kyriases during the synthetic efforts and
of Mr.E. Krienitz in measuring various NMR spectra is also appreciated.
REFERENCES
14
17. R. Purrmann and M. Maas, Zur Kenntnis des Pterorhodins, Liebigs
Ann.Chem. 556: 186 (1944).
18. P.B. Russell, R. Purrmann, W. Schmitt and G.H. Hitchings, The Synthesis of
Pterorhodin (Rhodopterin), J.Am.Chem.Soc. 71: 3412 (1949).
19. A. Kuhn and A. Egelhaf, Der rote Augenfarbstoff von Ephestia und Ptycho-
poda- ein Pterinpigment, Z. Naturforsch. 14b: 654 (1959).
20. M. Viscontini, W. Hummel and A.Fischer, Isolierung von Pterindimeren
aus den Augen von Platynereis dummerilli 1833, Helv.Chim. Acta 53: 1207
(1970).
21. G. Misuraca, G. Prota, J.T. Bagnara and S.K. Frost, Identification of the leaf-
frog melanophore pigment, Rhodomelanochrome, as pterorhodin, Comp.
Biochem.Physiol. 57B: 41 (1977).
22. W. Pfleiderer, Ober 7-Hydroxy- und 7-Hydroxy-6-methyl-2,4-dioxo-
tetrahydropteridine, Chem.Ber. 90: 2588 (1957).
23. M. Lederer, Les Pigments des Invertebres (a !'Exception des Pigments Respi-
ratoires), Biol.Rev. Cambridge Phil.Soc. 15: 273 (1940).
24. M. Viscontini, E. Hadron and P. Karrer, Fluoreszierende Stoffe aus
Drosophila melanogaster: die roten Augenfarbstoffe, Helv.Chim. Acta 40:
579 (1957).
25. M. Viscontini and P. Karrer, Fluoreszierende Stoffe aus Drosophila melano-
gaster, Helv.Chim. Acta 40: 986 (1957).
26. H. Schlabach and W. Pfleiderer, Die physikalischen Eigenschaften der roten
Augenpigmente aus Drosophila melanogaster, einer neuen Klasse atropiso-
merer Naturstoffe, Helv.Chim. Acta 55: 2525 (1972).
27. I. Schwinck and M. Mancini, The drosopterin pattern in various eye color
mutants of the fruit fly Drosophila melanogaster, Arch.Genetik 46: 41 (1973).
28. K. Rokos and W. Pfleiderer, Isolierung, physikalische Eigenschaften und al-
kalischer Abbau der Augenpigmente Neodrosopterin und
Aurodrosopteriaus Drosophila melanogaster, Chem.Ber. 108: 2728 (1975).
29. M. Viscontini, Beitrag zur KonstitutionsaufkHirung der Drosopterine,
Helv.Chim. Acta 41: 1299 (1958).
30. H. Schlabach and W. Pfleiderer, Isolierung,,Molekulargewichtsbestimmung
und alkalischer Abbau von Drosopterin und Isodrosopterin-
Augenpigmente der Fruchtfliege Drosophila melanogaster, Helv.Chim.Acta
55: 2518 (1972).
31. N. Theobald and W. Pfleiderer, Ein neuer Strukturvorschlag fur die roten
Augenpigmente Drosopterin und Isodrosopterin aus Drosophila melano-
gaster, Chem.Ber. 111: 3385 (1978).
32. H.Schlobach and W. Pfleiderer, Synthese und Reaktionen von Droso- und
Isodrosopterin, Helv.Chim. Acta 55: 2533 (1972).
33. G.J. Wiederrecht, D.R. Paton and G.M. Brown, The Isolation and Identifica-
tion of an Intermediate involved in the Biosynthesis of Drosopterin in Dro-
sophila melanogaster, J.Biol.Chem. 256: 10399 (1981).
34. K.B. Jacobson, D. Dorsett, W. Pfleiderer, J.A. McCloskey, S.S. Sethi, M.V.
Buchanan and I.R. Rubin; A Naturally Occurring Pyrimidodiazepine in
Drosophila: Chemical and Spectral Properties and Relationship to
Drosopterin, Biochemistry 21: 5700 (1982).
15
35. D.R. Paton and G.M. Brown, The nonenzymatic synthesis of' drosopterin'
from dihydropterin and 2-amino-4-oxo-6-acetyl-3H,9H-7,8-
dihydropyrimido-4,5-b][1,4]diazepine, in: "Chemistry and Biology of
Pteridines 1986", B.A. Cooper and V.M. Whitehead, ed., W. de Gruyter,
Berlin, New York (1986), p. 295.
36. W. Pfleiderer, S.J. Kim and J. Yim, The nonenzymatic Synthesis of Droso-
pterins, in: "Pteridines and Related Biogenic Amines and Folates", ed.,
N.Blau, H.Ch. Curtius, R. Levine and J. Yim, Hanrim Publ. Co. Seoul,
Korea, 1992), p. 54.
16
PROPERTIES AND REACTIONS OF PTERIDINES CARRYING
FUNCTIONALISED SIDE CHAINS AT THE 3-POSITION.
It is already known that some pteridines can act as photosensitisers, 1 and it has been
observed recently 2 that ultraviolet irradiation of DNA in presence of a pteridine can cause
widespread but random cleavage of the DNA chain. The chemistry described here arose out
of a requirement to attach a pteridine to a synthetic oligonucleotide for purposes of inducing
a photochemical lesion on a DNA chain at a specific targeted position. This paper reports
on some new compounds, reactions, and ring systems, which were investigated during the
preparation of a pteridine with a functionalised side chain at position 3. This pteridine was
successfully attached to the 5' -OH of a synthetic oligonucleotide.
The starting point for the study was 5-amino-7-(3-chloropropoxy)furazano[3,4-d]-
pyrimidine (1), obtained by treating 5-amino-7-methylthiofurazano[3,4-d]pyrimidine with
3-chloropropanol in presence of bromine.3 On hydrogenolysis4 in tetrahydrofuran solution
followed by treatment with benzil, (1) was readily converted via 2,4,5-triamino-6-(3-chloro-
propoxy)pyrimidine (2) into 2-amino-4-(3-chloropropoxy)-6,7-diphenylpteridine (3).
Tetrahydro·
luran
A
0
HO~ N~NXPh
I ""' ......1 -HO"
--
~ , Benzil
H2N N N Ph
MeO
Benzt
(7)
(10)
A marked red shift in the u.v. spectra of both (6) and (8) was observed on going from
neutral to basic conditions in ethanol solution. With the chloropropyl compound (8),
however, the spectrum changed further with time, and revealed the formation of a new
compound (14), containing a tricyclic ring system, only a few examples of which have been
reported previously in the literature. 5 The structure of (14) follows from its spectroscopic
properties, and from several chemical interconversions as shown in the diagram. For
example, when (6) was refluxed in methanolic potassium hydroxide it underwent a Dimroth
rearrangement to give the isomeric compound (17), with the 3-hydroxypropylamino side
chain attached at position 2 of the pteridine. Treatment of (17) with triphenylphosphine in
carbon tetrachloride gave tricyclic compound (14), identical with the product obtained from
18
(8), and presumably formed via chloropropyl compound (15). Acetylation of (8) afforded
its N-acetyl derivative (11). Under different reaction conditions, the unusual
2-diacetylamino derivative (13) was obtained. Both (11) and (13) cyclised under basic
conditions to the same tricyclic compound (12), and this was identical with the product
obtained by acetylation of (14).
In alkaline solution the tricyclic compound (14) underwent further rearrangement, via
lumazine (16), to give another tricyclic compound (18). This was unstable in solution, so
that an analytically pure sample of it could not be obtained. Its structure could be assigned,
however, from its high resolution mass spectrum which included the required molecular
ion, from its n.m.r. spectra, and from its u.v. spectrum which corresponded with that
reported 6 for compound (20), having a similar chromophore. To our knowledge the ring
system in (18) has not been reported before. Pteridine (16) was also unstable, since it
showed a marked propensity to cyclise to (18). It was characterised as its N-acetate (19).
CNt.J!.;XPh
~N ~~N
;..t.J!..XPh
Ph
+--
Ph
Ao t (12) Ao (13)
(14) t (15)
1 I :X -+
~ N Ph LHN ~
HN''.(N I N~Ph
H2N N N Ph
(6) (17)
(18)
19
chlorophosphine, rather than before, the phosphorus atom was found to have undergone
oxidation to the (V) oxidation state. For example, when (6) was treated with
chloro(di-iso-propylamino)(methoxy)phosphine the phosphine oxide (25) was obtained,
which could then be converted into its formamidine derivative (26). Both (25) and (26)
were stable, and were obtained in analytically pure form. Their elemental analysis and
spectroscopic properties are in accordance with the assigned structures. Of particular
importance are the 31 P n.m.r. spectra, showing signals at() 14.5 and() 22.4 for (25) and (26)
respectively (relative to phosphoric acid).
0
.J)~-):x:
~NMe2 (21)
(24)
A )-£ :J[O N
X Ph A )-~ :J[O N
X Ph
o=P1'0
N
HN~N
N
I, I """
N Ph
o=P1'0
N
N~N
N
I, I """
N Ph
0 2
0 ~
CHa (25) CH3 NMe 2 (26)
ACKNOWLEDGEMENTS
REFERENCES
20
N2-(N ,N-DIMETHYLAMINOMETHYLENE)-04·(2-p-NITROPHENYL-
ETHYL)-BIOPTERIN: A VERSATILE INTERMEDIATE FOR A
GLYCOSIDATION REACTION
INTRODUCTION
A certain number of pteridines having a glycosidated side-chain occur in nature; e.g.,
biopterin glucoside 1 isolated from a blue-green alga, Anacystis nidulansl and riboside 2
from a blue alga, Spirulina platensis.2 For the structural proof, some efforts to prepare these
compounds were made by direct glycosidation. However, the overall yields remained unsat-
isfactory; e.g., 1 and 2 were produced in less than a 1% yield by the condensation of bio-
pterin 3 respectively with D-glucose and D-ribose in DMF in the presence of TsOH at 60 °C
for 2 days.3,4 A slightly improved preparation of the D-Ribofuranoside 2 was achieved
through the sequences shown below (3 --? 4 --? 6 --? 2).4
0 OH
HN~N~
H2N~N'!l.N~ "
HO~
f
HOOH
2 (mp 200 "C decomp.)
1 NaOMe I MeOH
r.t, 24 h, 81%
0 OH
"1
Biopterin
(Me3 SihNH HN~N~
3
125 "C, 3d
H2N,k.NJlN~
4 BzO~
BzO OBz
6 (11% yield from 3)
Because various types of glycosides of biopterin and related pteridines were considered
to be of interest in view of potent biological activities, we have -attempted to explore more
efficient and versatile glycosidation methods of biopterin and found that an N2,04-protected
biopterin can conveniently be subjected to various reactions including glycosidation.
~OH
NPEO OAc NPEO OAc
o2Nv
PPh,. EtO,CN-NCO,Et NJ......N~ MeOH, r.t,15h NJ......N~
/1 ,4-Dioxane, r.t., 30 h AcHNkN!lNJ OAc 82% H2NkN!lNJ OAc
72%
S(mp 140 °C) 9 (mp 163-4 °C)
I
I
NPE = -CH~HAH4NQip) I
NPEO f OAc
NJ......N~
RHNkN!lNJ OAc
Me2NCH(OEtk I DMF
r.t., 11 h
80-85%
~NCs~C~CHp-1
Ac20 I Py, r.t., 15 h PPh 3, E102CN=NC02Et
11 ,4-Dioxane, r.t., 24 h
90%
12 ( mp 194-5 °C) 85%
·:~·~
'~~NAN N_. OAc
MeOH, 50 °C, 15 h
94%
14 (mp 122 °C)
13 (mp 205 °C)
22
oside 16 and 1',2'-di-0-~-D-ribofuranoside 17,10 the yields of which depended upon the
molar ratio of 5 to 14.
I CH2CI2 , 40 "C, 20 h
14
Bzol0~Ac
\-( + SoCI4
BzOOBz
5
15 +
I CH,c12, r.t., 18-24 h
Yield from 14
Various efforts were made to selectively obtain a mono-glycoside of type 16, but so far
without appreciable success. For example, an application of Hanessian's methodll to the
1',2'-0-(N,N-dimethylaminomethylene) derivative 1812 (prepared from 14) resulted in only
a low yield of the expected mono-furanoside 20, besides a much larger proportion of the
non-glycosidated product 19.
M9:2NCH(OEtl2
BzOl-o.?Ac
\-( + SoC4 NPNE:):O Nn:;OCHO
BzOOBz I • +
'N~ AN No& OH
I N
19 (42%) BzO O
BzOl--0~
+ 14 (4%) + )--( Ac BzO OBz
Selective deprotection of 16 and 17 was sought under various conditions. The 04-
NPE group of 16 was cleaved by the action of DBU in DMF5 to give 21 (R = H), whereas
the treatment with DBU in pyridine produced N2-deprotected 22 (R =H) and N2,04-depro-
tected 23. On the other hand, debenzoylation was effected by treatment of 16 with sodium
methoxide at 25 oc to give initially 24 (R" = H), then slowly several products including 2'-
23
P-D-riboside 2. Similar results were obtained for deprotection of the his-riboside 17. Opti-
mization of these deprotection steps, as well as glycosidation of 14 with other sugars, are in
progress.
16 R·H
17 R·R'
R·~
H~:t~~ 22
"6:·rY
BzO OBz
1. MeONa I MeOH
1,4-Dioxane, r.t, 1 d
:~::· ~
2. Amberlite IRC-50
~0-ribofuranosyl HO OH
We are grateful to Kanegafuchi Chemical Co. Ltd. (Osaka) for the supply of biopterin to us. The
present work was partially supported by a Grant-in-Aid for Scientific Research No. 03045035 from the
Japanese Ministry of Education, Science, and Culture.
REFERENCES
1. H.S. Forrest, C. van Baalen, and J. Myers, Science, 125, 699 (1957); C. van Baalen, H.S. Forrest, and
J. Myers, Proc. Nat/. Acad. Sci. USA., 43, 701 (1957); F.I. MacLean, H.S. Forrest, and J. Myers,
Arch. Biochem. Biophys., 114, 95 (1966).
2. H.S. Forrest, C. van Baalen, and J. Myers, Arch. Biochem. Biophys., 78, 95 (1958).
3. W. Pfleiderer and M. Beeck, unpublished results; M. Beeck, Dissertation, Univ. Konstanz (1981).
4. W. Pfleiderer and M. Kappel, unpublished results; M. Kappel, Dissertation, Univ. Konstanz (1981).
5 F. Himmelsbach, B.S. Schulz, T. Trichtinger, R. Charubara, and W. Pfleiderer, Tetrahedron, 40, 59
(1984) and references cited therein.
6 H. J. Furrer, J.H. Bieri, and M. Viscontini, Helv. Chim. Acta, 62, 2577 (1979); 7 was reported as an
oil which solidifies on standing. We obtained 7 as pale yellow crystals. A partial hydrolysis of 1' ,2'-0-
acetyl groups of 7, desirably to provide N2-acetyl-biopterin, was attempted under various conditions:
e.g., 0.5 N LiOH (1-3 equiv.) in 80% aqueous t-BuOH, or 2-2.5 equiv. K2C03 in aqueous t-BuOH
at 20 oc for 1-2 h. In all cases, the hydrolysis resulted in the formation of biopterin 3.
7 It should be noted that 7 was found to give 1',2'-di-0-acetyl-biopterin, only upon refluxing with MeOH
(after 36 hr, 76% yield).
8 Prolonged heating of 13 in methanol slowly caused cleavage of the N2-aminomethylene group as well.
9 The glycosidation procedures essentially followed those for related pteridines: cf., .Ref. 4; P.R. Boyle
and W. Pfleiderer, Chern. Ber.,l13, 1514 (1980). We found that Lewis acid SnCLJ gave a more satis-
factory resulL
10 Separation of 16 and 17 was achieved by silica gel column chromatographl with EtOAc-hexane -+
MeOH-CHCl3. The structures of 16 and 17 were established by 500-MHz H-NMR spectroscopy in
CDCl3, as well as by the spectral analysis of the 1'-0-acety1 derivative of 16.
11 S. Hanessian and J. Banoub, Tetrahedron Lett. 1976, 661.
12 Compound 18 was obtained as a ca. 1:1 mixture of two diastereomers with respect to the MezN-1 group
on the dioxolane ring (by NMR). Purification of 18 by silica-gel column chromatography with MeOH-
CHCl3 as an eluent resulted in a facile decomposition. Thus the crude product 18 had to be immedi-
ately subjected to the subsequent glycosidation.
24
THE SYNTHESIS OF FLUORINE-CONTAINING PTERINS
IINTRODUCTION
The introduction of fluorine into molecules has been well demonstrated to modifY
the biological properties significantly!. In heterocyclic compounds this effect is clearly
demonstrated through the action of 5-fluorouracil and its nucleosides as inhibitors of
thymidylate synthetase. In folic acid derivatives, fluorine has been introduced into the
glutamate side chain2 and into the aminobenzoic acid ring to promote nmr observations of
interactions with dihydrofolate reductase3. Some side-chain fluorinated pteridinones have
been prepared previously'! but analogues of natural products appear to be novel. It would be
of interest to investigate the properties of pterins with fluorine as a substituent of the
pyrazine ring and also at C-9 of the methylene group. To approach this study we have
examined the reactions of 2,4,5-triaminopteridin-6(1H)-one (1) with a number of readily
available di- and trifluoromethyl carbonyl compounds. We have also examined the
electrostatic potentials of the molecules associated with the introduction of fluorine into the
pyrazine ring and its substituents.
SYNTHESIS OF PTERINS
26
Scheme 2 Reactions of 1 with chlorodifluorocarbonyl compounds
that standard methods for the synthesis of pterins can be adapted to afford compounds with
fluorine in the pyrazine ring or at the C-9 substituent.
If the fluorpterins of interest are to be useful in the study of folate transport and
metabolism, it is important that the introduction of fluorine should not perturb the normal
hydrogen bonding properties of the amino-amide pyrimidine system. To provide some
reassurance that this would not be the case, we have carried out semi-empirical molecular
orbital calculations (AM14) of electrostatic potentials of representative fluoropterins in
comparison with 6-methyl-7,8-dihydropterin. The results shown in the table below make it
clear that the influence of fluorine, even in polysubstitution, is limited to two atoms from the
fluorine-bearing atom; there is essentially no change in the potentials observed in N-1 to 0-4
of the pyrimidine ring. The results obtained from these calculations indicate that the
insertion of fluorine will have a highly localised effect, a property that is important in the
planned investigation ofbiological mechanisms and action.
27
Table AMI electrostatic potentials of 6-methyl-7,8-dihydropterin ( 8), 6- trifluoro
methyl-7 ,8-dihydropterin (9), and 7, 7-difluoro-7,8-dihydropterin (10)
Compound 8 9 10
Atom
REFERENCES
28
FORMATION OF Fem OR Fen COMPLEXES WITH ACETYLACETO-
NATE AND 5,6,7,8-TETRAHYDROPTERIN AS LIGANDS AND THEIR
ACTIVATION OF OXYGEN
INTRODUCTION
The formation of a Felli ~ Fen complex 3a ~ 3b with acetylacetonate [acac] and
N(5)-methyl-5,6,7,8-tetrahydropterin [N(5)MTHP] (1) as ligands was demonstrated by
electrospray ionization mass spectrometry (ESI-MS) 1 •2 •
H
o" o
+
3a ~
1 2 4
mw: 181 mw: 353 mw: 100
RESULTS
5 6 7
mw: 167 mw:254 mw:254
THP (5) displays in the ESI-MS a more complicated behaviour than the [N(5)MTHP].
Immediately after adding THP · 2 HCl (5 · 2 HCl) to a equimolar solution of Feiii(acach
(2) (10- 3 M, acetonitrile, argon) the ESI-MS given in Figure 1 can be observed.
254 E+ 06
100
6 1.69
255
7
80
60 8
~
421
]
40
10
286 9
20 I
4
101
I
We propose the following structures for the compounds (or clusters) explaining the
most prominent peaks in this spectrum.
30
Peak 254: corresponds to [Feiii(acach]+, (cf. 6).
Peak 255: corresponds to [Ferr(acach 0 +H]+, (cf. 7).
Peak 320: corresponds to [Ferr(acac)-quinonoid-(6H)-7,8-dihydropterin]+, (cf. 9).
Peak 354: corresponds to [Fem(acach 0 +H]+, (cf. 2).
Peak 419: corresponds to [Feiii(acac)Tquinonoid-(6H)-7,8-dihydropterin]+, (cf. 10).
Peak 421: corresponds to [Feiii(acach(THP)]+, (cf. 8).
9
mw: 320
8
mw: 421
10
mw: 419
The ESI-MS in Figure 1 is not stable and changes within minutes. In particular
the relative intensity of the signal at m/z 421 drops rapidly. This indicates dynamical
processes in the reaction mixture. The THP in 8 looses two electrons and two protons to
form the two Fe-quinonoid-dihydropterin complexes 9 and 10. We assume the electrons
and protons to react with traces of oxygen dissolved in the solution. To verify this hy-
pothesis, we measured the oxygen uptake versus time, to oxidize THP to dihydropterin
and pterin with and without Feiii(acac)J. The results of these experiments are shown
in Figure 2.
The oxidation of THP in the presence of air is accomplished at a slower rate without
Feiii(acach (curve B) than with Fem(acac)3, and needs approximately one molecule of
oxygen. Oxidation with Feiii(acach is, in particular at the beginning, much faster and
uses almost three atoms of oxygen. There is a break in the oxidation curve after the
consumption of one atom of oxygen. This fact can be related to the formation of the
Fe-quinonoid-dihydropterin complexes 9 and 10. Further oxidation of these complexes
involve mechanisms, that are unknown so far. The formation of Fe-oxo species and/or
higher oxidized pterins could explain the additional consumption of oxygen. This in-
terpretation is strengthened by thin layer chromatography (TLC). Without Feiii(acach
TLC shows only pure pterin in the reaction mixture; with Fem(acach, TLC reveals a
series of other, not yet identified products beside small amounts of pterin.
31
1.5 '-j-----+-----+~-----t---- I
1
!
-----r--- Curve A
~I
0"'
1 ~ i j
10 20 30 40 50 60 time (hours)
Figure 2. Oxidation curves of 10-3 M THP (5) in dioxan/water (9:1) solution, pH range
1.5-7.5, 22-24°C, 725 Torr, air. Curve A: with Felii(acac)a. Curve B: without Feiii(acac)a.
We summarize that the reaction of N(5)MTHP with Fe1u(acac) 3 leads to stable, but
not yet isolable complexes, whereas that of THP with Felli( acac )a results in very unstable
complexes and the ESI-MS shows dynamical processes. The measurements of the oxygen
uptake of THP solutions with and without Feiii(acac)a confirm this assumption.
REFERENCES
1. B. Fischer, A. Schii.fer, R. Bosshard, M. Hesse, and M. Viscontini, "6th International Confer-
ence on Pteridines and Related Biogenic Amines and Folates", N. Blau, H. Ch. Curti us,
R. Levine, J. Yim, eds., Hanrim Publishing Comp., 56-1 Soopydong, Chung-ku, Seoul
100-230, South Korea (1992), 35.
2. A. Schii.fer, B. Fischer, H. Paul, R. Bosshard, M. Hesse, and M. Viscontini, Helv. Chim.
Acta 75:1955, (1992).
32
STEREOELECTRONIC EFFECTS IN THE AUTOXIDATIVE
DESTRUCTION OF REDUCED FOLATE DERIVATIVES
Anthony L. Fitzhugh
INTRODUCTION
One of the most well studied and remarkable properties of reduced folate derivatives is
their varying sensitivity to autoxidative destruction. I Depending on the substituent(s)
attached to the N5 and/or NlO positions, they are either quite stable to or rapidly destroyed
by 02. Noteworthy examples of derivatives displaying such contrasting sensitivities are
tetrahydrofolic acid, 5-methyl tetrahydrofolic acid, and 5-formyl tetrahydrofolic acid. The
chemical basis for this divergence in reactivity is unknown. Stereoelectronic theory ,2
however, provides a qualitative means of reconciling the experimentally observed pattern of
02-reactivity.
DISCUSSION
Tetrahydrofolate
Stereoelectronic theory is a more recent molecular orbital concept in organic chemistry.
It argues that chemical intermediates breakdown under the constraints imposed on them by
the precise stereo orientation of their substituents and nonbonded electron pairs. For
tetrahydrofolate the relevant chemical intermediate for such analysis is the 4a-hydroperoxy
dihydrofolate derivative. This intermediate is formed following exposure of tetrahydrofolate
to 02 (Fig. 1, 1a and 1b) The specific nature of 02 addition to the 4a-position is due to the
extensive resonance delocalization provided by the three electron pairs at positions N2', N4,
and N8. These atoms redistribute their electron density in such a manner that the 4a-position
becomes more electron dense. Theoretically, four 4a-hydroperoxy dihydrofolate
intermediates are possible (Fig. 1, 2a-d). Stereoelectronic theory argues, however, that
only two of the four intermediates (2a and 2c) can displace the hydroperoxy group from the
4a-position. The reason for this is simple. Intermediates in which the N5 nonbonded
electron pair is oriented antiperiplanar to the departing hydroperoxy group (2a and 2c)
proceed along a much lower energy pathway than synperiplanar derivatives (2b and 2d).
The breakdown of 2b and 2d therefore is not competitive with 2a and 2c. In reality,
however, the negligible barrier to inversion between these derivatives means that 2b and 2d
are in equilibrium with 2a and 2c. Accordingly, stereoelectronic theory predicts that the
autoxidation of tetrahydrofolate should be a facile process. Appreciable experimental
evidence supports this postulate. I
5-Methyl Tetrahydrofolate
From lH NMR studies, the N5 and C6 substituents of 5-methyl tetrahydrofolate occur
in a trans configuration relative to one another.3 This factor and the unfavorable steric
J HN'O
!
02
re H I
la
----
---
----
---
2c
interactions between the 4a-hydroperoxy, NS-methyl, and C6 substituents indicate that only
one intermediate is likely to be formed following exposure of this derivative to 02 (Fig. 2).
Stereoelectronic analysis indicates that this intermediate cannot breakdown to a quinonoid 5-
methyl dihydrofolate derivative given the synperiplanar orientation of its NS nonbonded
electron pair and 4a-hydroperoxy group. Cleavage of the C3-4a bond, however, is
stereoelectronically allowed. Remarkably, there is ample experimental evidence indicating
34
that the autoxidation of 5-methyl tetrahydrofolate proceeds through cleavage of this bond to
give a pyrazino[1,2-a]-s-triazine derivative.4
~~~~
6 OH
N~N~
H,N)lN~N'-cu,
0
Figure 2. Breakdown of 4a-Hydroperoxy 5-Methyl Dihydrofolate
5-Formyl Tetrahydrofolate
lH NMR studies of 5-formyl tetrahydrofolate5 indicate that the formyl group of this
derivative occurs as two slowly interconverting conformers (Fig. 3, Ia and lb).
Sterle interactions between the carbonyl oxygen of the tetrahydropteridine ring and the formyl
group prevent Ia from adopting a planar conformation. As a result, the attack of 02 on the si
face of the 4a-position is blocked by overwhelming steric interactions (Fig. 4). In addition,
like 5-methyl tetrahydrofolate, the re face attack of 02 on Ia yields a 4a-hydroperoxy
35
si
~~~H
H'(s H
..
O\ NH
OH
CONCLUSION
Previously, the chemical basis for the relative susceptibility of reduced folate derivatives
to 02-mediated autoxidation was not clear. The stereoelectronic and electronic principles
outlined above provides a simple, qualitative means of understanding of this phenomenon.
ACKNOWLEDGMENT
The content of this publication does not necessarily reflect the views or policies of the
Department of Health and Human Services, nor does mention of trade names, commercial
products, or organizations imply endorsement by the U.S. Government.
36
REFERENCES
1. R L. Blakely."Frontiers of Biology, V.13: The Biochemistry of Folic Acid and Related
Pteridines," American Elsevier, New York, 58 (1969); C. Temple, Jr. and J.A.
Montgomery." Folates and Pterins," R.L. Blakey and S.J. Benkovic, ed., J.
Wiley & Sons, New York, 61(1984).
2. P. Deslongchamps."Stereoelectronic Effects in Organic Chemistry,"Pergamon, New
York, 1983.
3. M. Poe, O.D. Hensens, and K. Hoogsteen, J. Biol. Chern., 254:10881(1979).
4. J.A. Jongejan, H.I.X. Mager, and W. Berends."Chem. Biol. Pteridines," R.L. Kisliuk
and G.M. Brown, ed., Elsevier, New York, 241(1979); J.M. Whiteley and A.
Russell, Biochem. Biophys. Res. Commun., 101:1259(1981).
5. M. Poe and S.J. Benkovic, Biochemistry, 19:4576(1980); J. Feeney et al., J. Chern.
Soc., Perkin Trans II, 176(1980).
37
MIND0/3 MOLECULAR-ORBITAL CALCULATIONS ON THE 6R-BH4 MOLECULE AND ITS
INTRODUCTION
Tetrahydrobiopterin [6-(1',2'-dihydroxypropyl)-5,6,7,8-tetrahydro-
pterin ; BH4] acts as a cofactor of aromatic amino acid hydroxylases and
nitric oxide synthase. Of the total of eight configurational isomers of
the BH4 molecule (L-erythro,L-threo, D-erythro and D- threo forms for
each of the 6R- and 6S-enantiomers), naturally-occurring BH4 cofactor in
mammals is the 6(R)-L-erythro isomer (6R-BH4) (Fig. 1). The stereo-
H
1 H H H He
4•
~):'
s c-c
1,• 12• :s;../
-~..-Hb
-C-C-CH3
II II [1]
1 I I '
0 0
OH OH Ha
N
• 7
Hb H
1 Ha -C-C-CH3
H II I [2]
0 OH
H
-<r-R-cH3 [31
OH 0
Fig. 1. Natural tetrahydrobiopterin (6R-BH4). Structure {2-Amino-(6R
l'R,2'S)-6-(1',2'-dihydroxypropyl)-5,6,7,8-tetrahydropteridln-4(3H)-onej
and its metabolic precursors: [1]6-Pyruvoyl PH4, [2] 6-Lactoyl PH4, [3]
6-Hydroxyacetonyl PH4. PH4;tetrahydropterin.
40
(a)
(c)
(d)
(e)
41
+0.24
0-0.58 '!Lo.49
+0.04 \ -0 04 -0.01
+o.o8
\
+0.66 \ +0.33 / ~o.o1 I
'-.. /f.""-.. /o.No~ /C~ -c\o.o1
c c/
-o. 25/t/.
+0.44
-o. 32
+0.34
I - 0 · 06
l ,-0.07/\+.
+o. 10 c, 0
-0.12
36 -o. o1
REFERENCES
42
IDENTIFICATiON, STEREOCONFIGURATION, CHROMATOGRAPHIC
AND FLUORESCENCE PROPERTIES OF NATURAL PTERINS
Roger Klein
INTRODUCTION
Several years ago, we reported the identification of dictyopterin as 6-[D-threo]-1 ', 2'-
dihydroxypropyl-pterin1. Such a result had been obtained after numerous and tedious
purification steps. In order to facilitate the determination of the stereoconfiguration of natural
pterins, which are found in very small amounts in living organisms, we aimed to find a
sensitive method. This was achieved in using chiral HPLC. The separation of D- and
L-enantiomers of 6-(polyhydroxypropyl)-pterins was obtained by ligand exchange
chromatography in using a reversed-phase column with a mobile phase containing
D-phenylalanine as the chiral modifier and Cu(II) as the metal ion. This enantiomeric
separation allowed the stereoconfiguration of some natural pterins to be determined in the
picomole range, by comparison of their chromatographic and fluorescence properties with
those of reference enantiomeric pterins2. The present paper briefly reports an aspect of the
method dealing with the fluorescence quantum yields of pterins and describes one application
which answers the following questions : what is the stereoconfiguration of urinary
monapterin ? Are there any differences in human urine from cancer and non-cancer patients?
01.02
D-E a
w L-E
0
z
<(
CD
a:
0
(/)
CD
Figure 1. Separation of enantiomers of monapterin
<( and euglenapterin by HPLC.
Conditions: reversed-phase column LC18DB
A
(Supelco), SIJffi, 4.6x250 mm, 24°C.
Mobile phase: 8 mM D-phenylalanine + 4 mM
D-M b
~
Urinary Pterins
Using the chiral HPLC method, the stereoconfiguration of optically active pterins
could be obtained from only 25 microliters of human urine. D-neopterin, D-monapterin and
L-biopterin were found in urines from healthy individuals2. The determination of D-
neopterin and L-biopterin agreed with determinations obtained earlier from as much as 1000
liters of human urine3.4, whereas the determination of D-monapterin in urines from healthy
individuals was in disagreement with the finding of L-monapterin by Fukushima and
Shiota5. This result was in press2 when Ogiwara et al.6 reported that D-monapterin was
present in the urine of cancer patients. The authors6 suggested that the urinary D-monapterin
might be considered as an eventual biochemical marker of cancer, since the enantiomeric
L-monapterin had been previously found in the urine of healthy individualsS. The suggestion
of using urinary D-monapterin as a biochemical marker of cancer prompted us to investigate
the origin of the disagreement about the stereoconfiguration of urinary monapterin. The use
of a bioassay method based on the growth of Crithidia fasciculata by Fukushima and Shiota5
could be questionable. Another hypothesis might explain the above contradiction : an urinary
infection might be at the origin of L-monapterin, since this compound is excreted by bacteria,
for example, Escherichia coli 7 and Serratia indica 8.
The main goal of the present work was to compare, by using the same chiral HPLC
method, the stereoconfiguration of optically active pterins in urine samples collected from 25
44
cancer patients with various carcinomas, from 2S patients with bacterial, fungal or parasitic
urinary infections and from 4 healthy individuals. Urine samples from cancer patients under
therapeutic treatment were collected at the lnstitut Curie, Section Medicale et Hospitaliere,
Paris; urine samples from patients with infectious deseases, before or under therapeutic
treatment, were collected at the Centre Medico-Chirurgical de laPorte de Choisy, Paris.
Urine was deproteinized with perchloric acid and oxidized with acidic iodine as
described elsewhere2. Neutralized samples were chromatographed as shown in Figure 2.
Four fluorescent peaks, labeled Ul to U4 were found in the urine of a healthy individual
(Figure 2a). In the urine of a cancer patient a fifth peak, (US), was found in addition to peaks
Ul to U4 (Figure 2b).
The peak US, was not specific for cancer patients. It was present in ten urine samples
from cancer patients, in two urine samples from non cancer infected patients and, at a very
low level, in the urine from one healthy individual. This peak, characterized by fluorescence
::J
U1 a us b
U3
:5. U1
w
0
z
w U3
0
UJ
w
a: U4
0 U2
::J
...I
IL
::J U1
U3+L-B c us d
:5. U3+L-B
w U1
0
z L-N
L-D
w L-M
0
UJ
w L-D
a:
0
::J
...I
IL
::J
U1+D-N
e us f
:5. U1 +D-N
w
0 U2+D-M U2
z
w +
0 U3 D-M
UJ
w D-D U3
a:
0
::J
...I
IL
0 s 10 1S 20 2S 30 0 s 10 1S 20 2S 30 3S
TIME (min) TIME (min)
45
excitation and emission maxima at 320 nm and 420 nm, respectively, remained so far
unidentified. By comparison with the chromatographic and fluorescence properties of model
compounds2, the peaks Ul to U4 were identified as neopterin, monapterin, biopterin and
?-xanthopterin respectively. The fluctuations observed in the retention times showed that the
retention time alone is not an accurate parameter to determine the stereoconfiguration by
comparison with that of reference compounds. The method, systematically adopted, was to
co-inject each sample, first with the four L-enantiomers, and then with the four
D-enantiomers of the stereoisomers of biopterin and neopterin. Figure lc and Figure ld
compared with Figure le and Figure 1f clearly show that Ul coeluted with D-neopterin, U2
with D-monapterin and U3 with L-biopterin in the urines of both a healthy individual and a
cancer patient. L-monapterin has never been observed, even in the urines with high densities
of bacteria. Regardless of the origin of the urine, from cancer or non cancer patients, ill or
healthy individuals, pterins were always found with the following steroconfigurations :
D-neopterin, D-monapterin, and L-biopterin. Clearly, D-monapterin is not specific for cancer
patients. Rather, it is the normal stereoconfiguration of human urinary monapterin. Recently,
Ogiwara et al.9 have also confirmed, by using circular dichroism measurements, that
D-monapterin was present in human urine of both cancer patients and non-cancer controls.
The main advantage of the chiral HPLC method over the previous physico-chemical
ones is its greater sensitivity. Using circular dichroism, 50 liters of urine were required,
pooled from several cancer patients, whereas chiral HPLC could be applied by using only 25
microliters of urine collected from a single individual. Identification of compounds by on-line
fluorescence spectroscopy and comparison with pure enantiomeric pterins makes the chiral
HPLC method more reliable than the method based on the growth of Crithidia fasciculata.
The latter advantage is obvious in the case of urinary monapterin and in the case of ciliapterin
as well. Indeed, the major pterin of Tetrahymena pyriformis had been deduced from the
Crithidia test as L-threo-biopterin and named ciliapterinlO. In contrast to that conclusion,
D-monapterin, clearly identified for the first time as a natural compound by using chiral
HPLC, was proven to be the major pterin in four strains of Tetrahymena!! and in another
ciliate protozoan, Colpidium campylum12.
Acknowledgements
This work was supported by Centre National de la Recherche Scientifique (U. A. 198
and Comite National de la Chimie). I am grateful to Professor Pfleiderer (University of
Konstanz, Germany), to Professor Sugimoto (University of Nagoya, Japan) and to
Professor Viscontini (University of Zurich, Switzerland) for their generous gifts of reference
compounds. I thank Dr P. Pouillart, L. Deneux (lnstitut Curie) and M. Finetti (CMC Choisy)
for supplying with urine samples. I also wish to thank Brad Factor and Professor P. Y.
Turpin for critical reading of the manuscript and G. Tham for skilfull technical assistance.
REFERENCES
1. R. Klein, R. Thiery, and I. Tatischeff, Eur. J. Biochern. 187 : 665 (1990)
2. R. Klein, Anal. Biochern. 203 : 134 (1992)
3. E. L. Patterson, M. H. von Saltza, and E. L. R. Stockstad, J. Arner. Chern. Soc. 78: 5871 (1956)
4. A. Sakurai and M. Goto, J. Biochern. 61 : 142 (1967)
5. T. Fukushima and T. Shiota, J. Bioi. Chern. 247: 4549 (1972)
6. S. Ogiwara, T. Nagatsu, R. Teradaira, K. Fujita, and T. Sugimoto,Tetrahedron letters 33: 1341 (1992)
7. H. Wachter, A. Hausen, E. Reider, and M. Schweiger, Naturwissenschaften 67: 610 (1980)
8. K. Iwai, M. Kobashi, and H. Fujisawa, J. Bacterial. 104: 197 (1970)
9. S. Ogiwara, T. Nagatsu, R. Teradaira, K. Fujita, and T. Sugimoto, Bioi. Chern. Hoppe-Seyler 373 : 1061
(1992)
10. G. W. Kidder and V. C. Dewey, J. Bioi. Chern. 243: 826 (1968)
11. R. Klein, I. Tatischeff, G. Tham, and C. A. Groliere, Biochirnie 73 : 1281 (1991)
12. R. Klein and C. A. Groliere, Chrornatographia 37 : (1993), in press.
46
THE MECHANISM OF COFACTOR REGENERATION DURING
PHENYLALANINE HYDROXYLATION
Department of Pharmacology
College of Medicine
University of South Alabama
Mobile, AL 36688
INTRODUCTION
Although the ability of the liver to convert phenylalanine to tyrosine has been known
since 1913 1, characterization of the components of the system did not begin until the mid
1950's. Tetrahydrobiopterin was identified as the cofactor for the hydroxylase reaction2,
which uses molecular oxygen as the source of the new hydroxyl group, Figure 1. It was
first thought that only one other enzyme, dihydropteridine reductase (DHPR), was involved
in the overall process. This converts the oxidized form of cofactor, a quinoid
dihydropterin3, back to the starting tetrahydrobiopterin at the expense of NADH allowing
cofactor to be used catalytically. The clinical symptoms of patients with a deficiency of
DHPR have shown that cofactor regeneration is essential4•
It is now well accepted, however, that the initial product of phenylalanine hydroxylase
is the C4a,N5-hydrate of quinoid dihydrobiopterin*, which was first detected by its UV
spectrums. Isotope labeling studies using pyrimidine cofactor analogs6 and 6-methyl-
tetrahydropterin7 then definitively identified this structure. Further, a protein was
discovered which was at first called phenylalanine hydroxylase stimulating factors, but was
later shown to be capable of catalyzing the dehydration of the C4a,N5-hydrate to give a
quinoid dihydropterin8• Thus we would seem to have all of the enzyme reactions needed
for cycling of cofactor. However, the dehydration reaction proceeds quite well non-
enzymatically. In fact, almost all assays that suggest a need for a dehydratase enzyme have
been done at alkaline pH where the quinoid dihydropterin C4a,N5-hydrate is more stable.
As a result one might question whether this dehydratase activity is physiologically relevant.
O - y N H2 HO--o-vNH 2
C02H C02 H
~ ~~
s~~Y'("'
H
8~ rr~l(~~NH2
+ o.
~~~NH HYDROXYLASE
H 0 H H 0
\
TETRAHYDROBIOPTERIN QUINOID DIHYDROBIOPTERIN C4a,N5-HYDRATE
DIHYDROPTERIDINE
REDUCTASE
NAD
~ DEHYD;.,.TASE
H20
NADH
H
H N~~H
~ II
2
N~ N
0
QUINOID DIHYDROBIOPTERIN
For many years one of our main goals has been to elucidate the rate limiting step in
overall phenylalanine hydroxylation. Therefore, we felt it necessary to determine if an
enzyme is really necessary to perform the dehydration reaction in a physiological
environment. Further, in any event is this reaction rate limiting? Probably the main reason
this question has not already been clearly answered is that the only way to generate quinoid
dihydropterin C4a,N5-hydrates has been by using the phenylalanine or tyrosine hydroxylase
reaction9•10•11 • Therefore, a general synthesis for this class of compounds was devised.
This procedure is similar to that recently described for the generation of the
C6-stereoisomers of tetrahydropterins 12, except that the cyclization conditions are modified
to accumulate the C4a,N5-hydrate. The central intermediate is a triamino-4-pyrimidinone
containing an aminoethyl side-chain (1). This intermediate can be assembled in four or five
relatively simple steps starting from an amino acid enantiomer. The chirality of the
a-carbon is retained through the entire synthesis thus determining the stereochemistry of
the pteridine-C6. The triaminopyrimidine is rapidly oxidized by halogen, and the resulting
iminoquinone (II) then hydrolyzed in mild acid. By carefully taking a solution of the
ketone (III) to about pH 9, a Schiff's base cyclization occurs giving the desired
C4a,N5-hydrate. Figure 2 illustrates this reaction for the production of the (6S)-methyl-
derivative (IV) (which has the same C6-configuration as in (6R)-tetrahydrobiopterin), where
the initial chirality has been incorporated using L-alanine. The sequence starting with I is
performed in one pot over about 45 minutes. In this way gram quantities of
C4a,N5-hydrates can be conveniently generated. However, due to their instability (solutions
can be kept for about 2 days at -80"C) typical reactions are done on a 10 mg scale. The
synthesis of tetrahydropterin stereoisomers differs primarily in that the dehydration is
promoted by a shift in pH and temperature, and the resulting quinoid dihydropterin is then
reduced12 •
48
6-Methyl- (65)-Methyl-qulnold· (65)-Methyl-qulnold·
7,8-dlhydropterin dlhydropterin dlhydropterln C4a,N5-hydrate
Q)
u
c::::
ctS
..0 200 400 600
0en Seconds
..0
<
49
the isosbestic point between quinoid and 7,8-dihydropterin, usually near 340 nm, showed
first-order increases in absorbance over three or four half-lives. HPLC analysis of the
dehydration products of 6-alkyl-quinoid-dihydropterin-C4a,N5-hydrates indicates that the
quinoid- and 7,8-dihydropterins are the only significant compounds that absorb in this
wavelength region. The inset to Figure 3 is the progress of the absorbance increase at
340 nm which has been digitized and fitted to an exponential decay to give the rate
constant.
Several C4a,N5-hydrates with varied C6-substituents were synthesized and their
spontaneous dehydration studied under a variety of conditions. Figure 4 illustrates the
effect of pH and buffer concentration (insert). The data using several buffers were fitted
simultaneously to a model equation for hydrogen ion and buffer catalysis. The dashed line
represents the rate at each pH extrapolated to zero buffer concentration.
0.12
0.033
0.08
~
'u 'o
(])
.e ! ~
0.04
~ 0.023
so
of a further decrease in AS*. At 37° in 0.025M Tris-Cl pH 7.4 the rate of nonenzymatic
dehydration of the C4a,N5-hydrate of quinoid dihydrobiopterin was 0.038 sec· 1• Even
considering buffer catalysis by bicarbonate, various forms of phosphate and other buffers
present in the cytoplasm, it is unlikely that spontaneous dehydration in vivo would be much
greater than this.
Whether a dehydration rate of about 0.04 sec· 1 would be rate limiting for overall
tyrosine formation in vivo depends upon the rate of the phenylalanine hydroxylase reaction.
In the presence of sufficient DHPR activity the hydroxylase and dehydration reactions
compete with each other to establish a partitioning of the available pool of cofactor (about
6 pM in rat liver) between the reduced (6R)-tetrahydrobiopterin and the C4a,N5-hydrate.
The instantaneous rate of the phenylalanine hydroxylase reaction in an animal subject
to a phenylalanine load is difficult to determine. The time course of phenylalanine
clearance from a rat is shown in Figure 5. A number of studies indicate that phenylalanine
exchanges with several compartments 16• For example, there appears to be a significant pool
of free phenylalanine in the peripheral tissues. Therefore, one cannot reliably interpret the
downward slope in Figure 5. On the other hand, typically by about 3 hours the resting
level of plasma phenylalanine is restored. At this point, presumably, all the pools will have
re-equilibrated. Since comparatively little L-phenylalanine would be excreted in the urine
or used for protein synthesis 16•17 , the only mechanisms for clearance are by hydroxylation
or transamination. However, experiments in which phenylalanine hydroxylase activity in
rats has been mostly abolished by pretreatment with p-chloro-phenylalanine 18 have shown
that tyrosine formation is responsible for the majority of the clearance.
1.4
1.2
:?
§.
Q)
·c:c::
.!!! 0.8
~
c::
Q) 0.6
.s::::.
a..
ctl
E 0.4
Ul
ctl
a: 0.2
51
manner. This agrees well with the rate of phenylalanine removal by isolated rat livers
perfused with 1 mM phenylalanine20• The rate of appearance of 0 20 in the blood of rats
given phenylalanine-Dt, when expressed in pmoles/g liver/sec, indicates a slightly faster
rate within the first 60 minutes of injection that may represent the rate of hydroxylation
during the load peak**.
At these rates of hydroxylation, spontaneous dehydration would cause almost all of
the available cofactor to reside in the form of the C4a,N5-hydrate. In other words, if 99%
of cofactor is to be maintained in the reduced form, a rate of dehydration of between 50
to 130 sec·' would be required. This is greater than 103 faster than that provided by
nonenzymatic dehydration under physiological conditions. A typical dietary load in a
human raises plasma phenylalanine levels only by a factor of 2 or 3, rather than by about
25-fold as in Figure 5. Still, spontaneous dehydration is at least two orders of magnitude
too slow to prevent depletion of the pool of reduced cofactor during a meal. Clearly, there
is a need for a dehydration catalyst.
One must then ask whether the previously described phenylalanine hydroxylase
stimulating protein fulfills this need. This is of particular concern since it has recently been
shown that the protein to which dehydratase activity has been attributed is identical to
DCoH, a regulator of hepatic nuclear homeodomain transcription factor 1a dimerization21 .22 •
The physical chemistry of the nonenzymatic dehydration reaction gives several clues
to the mechanism of enzymatic dehydration. On first consideration, it would be reasonable
to expect that simple enzyme promoted protonation of the C4a-hydroxyl group might be
involved. On the other hand, as shown in Figure 4, base catalysis can also be quite
effective. There is the additional possibility that the mechanism of the dehydratase may
also involve obviation of the negative entropy of activation of the spontaneous reaction.
Sequestration of substrate by the catalytic site in a manner that can avoid solvent
organization in the transition state of hydroxide elimination might also provide some rate
acceleration. Recent measurements of dehydratase kinetics have revealed the relative
importance of these mechanisms 14•
As a result of the new method for the synthesis of substrates, steady-state kinetics of
the dehydratase with several quinoid dihydropterin C4a,N5-hydrates have been measured
including (6R,S)-methyl-, (6S)-methyl-, (6S)-propyl-, and (6R)+erythro-dihydroxypropyl.
The ~ for the C4a,N5-hydrate of quinoid (6R)-dihydrobiopterin is close to the
concentration of tetrahydrobiopterin in the liver. The dehydratase activity in rat liver is
such that even given the rate of hydroxylation calculated for the high phenylalanine load
illustrated in Figure 5, less than 1% of the biopterin pool would be present as the quinoid-
dihydrobiopterin C4a,N5-hydrate 14 • Also, the tissue distribution of dehydratase activity has
been reported to parallel hydroxylase activity in several organs23 • All of these factors
strongly suggest that despite the other role of the protein in regulating transcription, that the
dehydratase activity specifically evolved to participate in the regeneration of
tetrahydrobiopterin. A dehydratase does not typically appear to be significant in vitro, since
reactions are rarely performed at rates as fast as those in the liver during a dietary load, and
the nonenzymatic rate of dehydration, especially at neutral pH and high buffer
concentrations, is adequate to regenerate cofactor.
Thus we can now conclude that the carbinolamine dehydratase is an important
•• From reference 17, Figure 1, the rate of 0 20 liberated into the blood was 4 mM/hr for a female rat
injected i.p. with 0.2 g/kg L-phenylalanine. Assuming nearly complete metabolism of the phenyl ring to
C02 and 2.5 0 20, and equilibration of this 0 20 with the total body volume of the rat (100-150 g), this
equals about 55 nmols/sec/animal, which for a -4 g liver gives about 14 pM/sec.
52
component of phenylalanine metabolism. This adds support to the proposal that a transient
form of hyperphenylalaninemia not yet associated with any of the known defects in
aromatic amino acid hydroxylation24•25 could be due to an absence of this activity. Having
a ready source of the C4a,N5-hydrate substrates has enabled us to develop a sensitive assay
which is linear with dehydratase activity. This will facilitate the evaluation and kinetic
characterization of the defect in patients suspected of being deficient in this enzyme.
ACKNOWLEDGMENTS
This work was supported by NIH grants GM30368 and NS26662. SRB was recipient of
a Juvenile Diabetes Foundation summer research fellowship.
REFERENCES
1. G. Embden and K. Baldes, Ober den Abbau des Phenylalanins in Tierischen Organismus, Biochim.
Z. 55:301-322 (1913).
2. S. Kaufman, The Structure of the Phenylalanine-Hydroxylation Cofactor. Proc. Nat/. Acad. Sci.
USA 50:1085-1093 (1963).
3. S. Kaufman, Studies on the Structure of the Primary Oxidation Product Formed from
Tetrahydropteridines during Phenylalanine Hydroxylation, J. Bioi. Chern. 239:332-338 (1964).
4. R.G.H. Cotton, Inborn errors of pterin metabolism, in "Folates and Pterins", Vol.3 R.L. Blakley and
V.M. Whitehead, eds. Wiley & Sons, New York, (1986).
5. S. Kaufman and D.B. Fisher, Pterin-requiring aromatic amino acid hydroxylases, in "Molecular
Mechanisms of Oxygen Activation, 0. Hayaishi, ed., Academic Press, New York, (1974).
6. S.W. Bailey, S.T. Weintraub, S.M. Hamilton, and J.E. Ayling, Incorporation of Molecular-Oxygen
into Pyrimidine Cofactors by Phenylalanine-Hydroxylase, J. Bioi. Chern. 257:8253-8260 (1982).
7. T.A. Dix, G.E. Bollag, P.L. Domanico, and S.J. Benkovic, Phenylalanine Hydroxylase: Absolute
Configuration and Source of Oxygen of the 4a-Hydroxytetrahydropterin Species, Biochemistry
24:2955-2958 (1985).
8. R.A. Lazarus, S.J. Benkovic, and S. Kaufman, Phenylalanine Hydroxylase Stimulator Protein is a
4a-Carbinolamine Dehydratase, J. Bioi. Chern. 258:10960-10962 (1983).
9. R.A Lazarus, C.W. DeBrosse, and S.J. Benkovic, Phenylalanine Hydroxylase: Structural
Determination of the Tetrahydropterin Intermediates by Carbon-13 NMR Spectroscopy, J. Am.
Chern. Soc., 104:6869-71 (1982).
10. J. Haavik, K.A. Andersson, and T. Flatmark, Native and Phosphorylated Bovine Adrenal Tyrosine
3-Monooxygenase. Interactions with Tetrahydropterins and Substrate and Stability of the Formed
4a-Hydroxy-Tetrahydrobiopterin, Pteridines 1:11-16 (1989).
11. M.D. Davis, and S. Kaufman, Evidence for the Formation of the 4a-Carbinolamine During the
Tyrosine-dependent Oxidation of Tetrahydrobiopterin by Rat Liver Phenylalanine Hydroxylase,
J. Bioi. Chern. 264:8585-8596 (1989).
12. S.W. Bailey, R.Y. Chandrasekaran, and J.E. Ayling, Synthesis of Tetrahydropteridine
C6-Stereoisomers, Including N5-Formyl-(6S)-tetrahydrofolic Acid, J. Org. Chern. 57:4470-4477
(1992).
13. S.W. Bailey and J.E. Ayling, 6,6-Dimethylpterins: Stable Quinoid Dihydropterin Substrate for
Dihydropteridine Reductase and Tetrahydropterin Cofactor for Phenylalanine Hydroxylase,
Biochemistry 22:1790-1799 (1983).
14. S.W. Bailey, S.R. Boerth, and J.E. Ayling, manuscript in preparation (1993).
15. A. Albert, Covalent hydration of pteridines, in "Pteridine Chemistry", W. Pfleiderer and
E.C. Taylor, eds. Macmillan Co., New York (1964).
16. S. Kaufman, Phenylketonuria: biochemical mechanisms, in "Advances in Neurochemistry",
B.W. Agranoff and M.H. Aprison, eds., Plenum Press, New York, (1977).
17. S. Milstien and S. Kaufman, Studies on the Phenylalanine Hydroxylase System in Vivo, J. Bioi.
Chern. 250:4782-4785 (1975).
18. K.N. Antonas, W.F. Coulson, and J.B. Jepson, Simulation of Phenylketonuria in Rats by Extended
p-Chlorophenylalanine Treatment, Biochem. Soc. Trans. 2:105-107 (1974).
53
19. M.A. Lipton, R. Gordon, G. Guroff, and S. Udenfriend, p-Chlorophenylalanine-lnduced Chemical
Manifestations of Phenylketonuria in Rats, Science 156:248-250 (1967).
20. M.B. Youdim, B. Mitchell, H.F. Woods, The Effect of Increasing Phenylalanine Concentration on
Phenylalanine Metabolism in Perfused Rat Liver, Biochem. Soc. Trans. 3:683-684 (1975).
21. B.A. Citron, M.D. Davis, S. Milstien, J. Gutierrez, D.B. Mendel, G.R. Crabtree, and S. Kaufman,
Identity of 4a-Carbinolarnine Dehydratase, a Component of the Phenylalanine Hydroxylase System,
and DCoH, a Transregulator of Homeodomain Proteins, Proc. Natl. Acad. Sci. USA 89:11891-11894
(1992).
22. C.R. Hauer, I. Rebrin, B. Thony, F. Neuheiser, H.C. Curtius, P. Hunziker, N. Blau, S. Gisla, and
C.W. Heizmann, Phenylalanine Hydroxylase-stimulating Protein/Pterin-4a-carbinolarnine
Dehydratase from Rat and Human Liver, J. Bioi Chern. 268:4828-4831 (1993).
23. M.D. Davis, S. Kaufman, and S. Milstien, Distribution of 4a-Hydroxytetrahydropterin Dehydratase
in Rat Tissues - Comparison with the Aromatic Amino Acid Hydroxylases, FEBS Letters 302:73-76
(1992).
24. H.C. Curtius, C. Adler, I. Rebrin, C. Heizmann, and S. Ghisla, 7-Substituted Pterins: Formation
During Phenylalanine Hydroxylation in the Absence of Dehydratase, Biochem. Biophys. Res.
Commun. 172:1060-1066 (1990).
25. M.D. Davis, S. Kaufman, and S. Milstien, Conversion of 6-Substituted Tetrahydropterins to
7-Isomers via Phenylalanine Hydroxylase Generated Intermediates, Proc. Natl. Acad. Sci. USA
88:385-389 (1991).
54
STRUCTURE FUNCTION STUDIES OF THE PHENYLALANINE
HYDROXYLASE ACTIVE SITE AND A SUMMARY OF STRUCTURAL
FEATURES
It has been known for some time that PAH contains iron (1) however there is as
yet no indication where the iron is bound although the concentration of iron ligands
from amino acids 263 to 289 makes this a likely iron binding location. Once all three
aromatic amino acid hydroxylases were cloned, sequence comparisons allowed
localization of a strongly conserved region in theN terminal portion of the C terminal
half of the molecule (2) and see below). Limited chymotryptic digestion produces a
36Kd fragment which retains PAH catalytic activity but is unaffected by
phosphorylation or phenylalanine activation (3). This cleavage removes 11Kd from the
N-terminal of PAH including the phosphorylation site Ser 16 (4) and 5Kd from the
C-terminus of PAR. More recently a photoaffinity pterin analogue was used to label
PAH from which a labelled peptide was isolated with subsequent identification of lys
198 as the labelled amino acid (5). The same paper describes identification of the
reactive cysteine residue associated with activation of PAH enzyme activity (5). Also
use of a pterin mimicking antiidiotype antibody has allowed the identification of a 27
amino acid peptide which binds pterin (6). This peptide is referred to as the putative
BH4 binding site (PPBS) and is in the same region as the concentration of potential iron
binding ligands mentioned above. The sequence of this peptide is as follows:
Consideration of the whole PAH sequence and its relationship to that of tyrosine
hydroxylase (TYH) has suggested a series of 5 domains within the linear sequence of
PAH (Table 2).
Domain A has a radically different sequence to TYH and has only 20%
homology. This domain ends near the N-terminal chymotrypic and V8 protease
cleavage sites (6). Domain B stretches through a region of 30% charged amino acids
(66 amino acids) with an abrupt change to 20% at the start of Domain C. Domain
B&C have 58 and 65% homology with respect to TYH. They also have 14&18%
charge changes with respect to TYH respectively. Domain D is the most conserved
(87%) with respect to TYH and is marked by only a 4% charge change with respect to
TYH over the 93 amino acids. Domain E contains the remaining 117 amino acids and
is 40% homologous to TYH and has 17% charge changes with respect to TYH. About
half of this domain is removed on chymotrypic digest. These features can be seen
mapped together with monoclonal antibody binding sites in Fig 1.
Domain A B c D E
TyH
9 7
I
(PJ
I
v
te {! •• ~
PPBS V
t
homology(%) 1 20 I 58 65 87 40
Residue *I *
100 *
200 *
300 *
400 *
452
The map shows that the putative pterin binding site maps in domain D, the 87%
conserved region. The conserved cysteine residues map in Domains C&D. V8
protease digestion leaves a core of domain B,C and 2/3 of D. Lysine 198 is in domain
C well away from the PPBS and must be brought into its vicinity by folding. The
cysteine labelled on activation of PAH is that at 236 (5).
56
We have initiated a range of studies to further define the amino acid residues
binding tetrahydrobiopterin. These include (a) alteration and deletion of amino acids of
a synthetic peptide corresponding to PPBS (see above) (b) sequence comparisons with
other known pterin binding enzymes and (c) in vitro mutagenesis.
Cleavage of the PPBS peptide with cyanogen bromide at met 275 renders the
two pieces (mixed or alone) incapable of binding pterin. Removal of 2 N terminal
amino acids also eliminates binding except under certain conditions, but removal of 3
amino acids from the C terminal only reduces binding 40%. However removal of a
further 4 amino acids from the C-terminal end renders the peptide inactive (in
preparation). This suggests (a) that amino acids at each end of the peptide may be
needed for pterin binding and (b) secondary structure of this peptide may be involved.
In the search for a motif which may bind reduced biopterin derivatives in
proteins we used the sequence of PPBS to search the sequence of proteins in the data
base (Howells et al submitted) (Fig 2).
FIRST SEQUENCE
RESIDUE
Figure 2. Comparison of sequences of rat PAH, TYH, DHPR and GTPGH aligned to
show regions demonstrating a common motif. A synthetic peptide corresponding to
PAH peptide 263-289 has been shown to bind reduced pterins (6).
REFERENCES
1. D. B. Fisher, R. Kirkwood and S. Kaufman, 1. Biol. Chern. 247:5161-5167 (1972).
2. H.E. Grennet, F.D. Ledley, L.L. Reed and S.L.C. Woo, PNAS 84:5530-5534 (1987).
3. D.B. Fisher and S. Kaufman, 1. Biol. Chern. 248:4345-4353 (1973).
4. M. Wretbom, E. Humble, U. Ragnarsson and L. Engstrom, Biochern. Biophys. Res. Comrnun.
93:403-408 (1980).
5. B.S. Gibbs and S. Benkovic, Biochem. 30:6795-6802 (1991).
6. I.G. Jennings, B.E. Kemp and R.G.H. Cotton, PNAS 88:5734-5738 (1991).
7. G. Schoedon, V. Redweik, F. Gerhard, R.G.H. Cotton and N. Blau, Eur. 1. Biochern.
210:561-568 (1992).
57
EXPRESSION OF WILD TYPE AND MUTANT FORMS
OF HUMAN PHENYLALANINE HYDROXYLASE IN E. COLI
INTRODUCTION
METHODS
To obtain an appropriate distance between the Shine-Dalgamo sequence and the start
codon, ATG, a Nco! restriction site was created by PCR-based mutagenesis in PAH. This
was performed by amplification of PAH eDNA, using the mismatch primer, A-N col, and
the normal primer B3. The PCR product was treated with proteinase K2, digested with
Ncoi/BamHI, and the resulting DNA fragment corresponding to PAH eDNA position 222-
1036 was ligated into the Ncoi/BamHI digested plasmid pET11d. Then, the remaining 1393
bp fragment of PAH eDNA corresponding to position 1036-2429 was cut out of phPAH247 3
The Ncoi site introduced in the initial PCR cloning step altered the second codon in
PAH from serine to alanine. In order to restore the wild type PAH codon 2 and introduce
the mutations in exon 7 and 8 of the normal PAH, a PCR-based procedure4 was used. The
introduction of each mutation was verified by DNA sequencing. The oligonucleotides used
for PCR mutagenesis are shown in Table 1.
Assay of P AH activity
PAH activity was assayed (t = 5-30 min) at 25 oc with 0.05 M K-phosphate pH 6.8,
5 mM L-Phe, 0.6 mg/ml catalase, 100 pM Fe(II), 5 mM DTT and 6-methyltetrahydropterin
(6-MPH4) or (6R)-tetrahydrobiopterin (BH4). The reaction was stopped by adding 1 % (v/v)
acetic acid in ethanol, and after centrifugation tyrosine was measured by HPLC and
fluorimetric detection 5•
60
RESULTS AND DISCUSSION
The wild type recombinant PAH, expressed with high yield (about 10 % of total
soluble cellular protein, revealed high catalytic activity, and was immunoreactive in Western
blot analysis using affinity purified polyclonal rabbit anti-rat PAH antibodies. The mutations
introduced and expressed in the pET-system were situated in the eDNA area corresponding
to exon 7 and 8, and represent mutations occurring in patients with PKU/HPA. The mutated
enzymes were recovered with similar yields and had catalytic activities (homospecific
activities) ranging from zero to 47 % (6-MPH4 as the cofactor) or 32 % (BH4 as the
cofactor) of the wild type recombinant PAH activity (Table 2).
Table 2. In vitro activity of wild type (wtPAH) and mutant PAH proteins
•The amount of PAH protein in crude extracts was measured by densitometric scanning of Western blots, using
purified rat PAH as standar<f. The activities represent the average of at least three experiments (SD < 10 %).
~iterature values.
'The R261Q-protein of COS cells is reported to give a specific activity close to the wild type
protein, but the amount of immunoreactive material was only about 30 % of that observed for the
wilde type PAH7•
ND = not determined
Western blot analysis of the crude extracts with anti-rat PAH antibodies gave two
major bands of slightly different Mr-values, the main band at about 50 kDa (shown in Fig.
1 for wild type PAH). The lower M. forms are most likely due to intracellular proteolysis,
and partial purification of the two main immunoreactive proteins by DEAE-chromatography
revealed no significant difference in their specific enzymatic activity. High level of
expression was also found for the mutant forms (PAH protein was 5-10 % of total soluble
protein).
The high recovery of the recombinant forms of PAH allowed precise activity
measurements, even for the mutant forms with extreme low activity (Table 2). Homo specific
activities lower than 0.3 % of that of wild type could reproducibly be measured (i.e. for the
mutations A259V/A259T). This finding explains the problem faced with in the reliable assay
of PAH activity in liver biopsies from PKU patients 10 •
61
l 2
Figure 1. Expression of PAH in E. coli. Western blot of 0.7 Jig purified rat PAJI9 (lane 1) and crude extract
of induced bacteria containing the pETPAH (wild type) plasmid (lane 2), using affinity purified polyclonal
rabbit anti-rat PAH antibodies.
A comparison between published data on eukaryotic COS cell PAH expression and our
results from the prokaryote system is made in Table 2. In the COS cell system no activity
could be measured for the mutations R252W and E280K. The measurements were carried
out with very small amounts of gene product in the COS cells 1• With the pET system,
however, the low activity detected for these mutants can be directly related to low-functional
gene products since the activities are measured with large amounts of expressed protein. It
has been reported that the homospecific activity of the mutant R261Q is similar to that of
the wild type when both are expressed in COS cells 1, but the amount of functional protein
detected was 70 % lower for the mutant than for the wild type. Thus, the differences in
activity were related to instability of the R261Q PAH protein. In the pET/E. coli expression
system, in which we have a similar degree of expression for both this mutant and the wild
type form, we have been able to measure a homospecific activity of 32 % of that of wild
type (Table 2), indicating that this mutation in fact affects the catalytic function of the
protein. Due to the high level of expression, the pETPAH-system thus represents an
important source to obtain both normal and mutated forms of PAH for further studies on the
relation between structure and function of this enzyme.
Acknowledgements-We are grateful to Professor S.L.C. Woo for supplying the PAH eDNA
clone. This study was supported in part by the Research Council of Norway.
REFERENCES
1. Y. Okano, R.C. Eisensmith, F. Guttier et a!., New Eng. f. Med. 324:1232 (1991).
2. J.S Crowe, H.J. Cooper, M.A. Smith et al., Nucleic Acid Res. 19: 184 (1991).
3. S.C.M. Kwok, F.D. Ledley, A.G. DiLella et al., Biochemistry 24:377 (1985).
4. R.M. Nelson and G.L. Long, Anal. Biochem. 180:147 (1 989).
5. A.P. D¢skeland, S.O. D(llskeland, D. 0greid eta!. , J. Bioi. Chem. 259:11242 (1984).
6. T. Wang, Y. Okano, R.C. Eisensmith et al., Somal. Cell. Mol. Genet. 16:85 (1990)
7. Y. Okano, T. Wang, R.C. Eisensmith et al., Genomics 9:96 (1991).
8. R .C. Eisensmith and S.L.C. Woo, Hum. Mut. 1:13 (1992).
9. R. Shiman, D.W. Gray, and A. Pater, J. Bioi. Chem. 254:11300 (1979).
10. P.A. Friedman, D.B. Fisher, E.S. Kang et al., Proc. Nat/. Acad. Sci. USA 70:552 (1973).
62
A RE-EXAMINATION OF THE METAL REQUIREMENT OF
CHROMOBACTERIUM VIOLACEUM PHENYLALANINE HYDROXYLASE
Department of Chemistry
The Pennsylvania State University
University Park, PA 16802
to 4a-OH-6MPH 4 of 7050 M-Icm-I at 257 nM was calculated from standard spectra (Lazarus
et al., 1983; 15). This wavelength is isosbestic for the background reactions of pterin and DTI
oxidation.
Copper was removed from the enzyme by extraction with DTI. Routinely 20-30 mg of
enzyme in 15 ml HEPES buffer (pH 7.4) was made 0.1 M in DTI and incubated for 10 min.
This solution was then concentrated by a factor of 20 using a Centriprep 10 (Amicon)
centrifugal ultrafilter, and then rediluted with fresh 0.1M DTI to make up the original15 ml
volume. The concentration and redilution was repeated two more times. To remove the DTI,
the final concentrate (-1 ml) was then applied to a 15 em Sephadex G-25 (Pharmacia) column
which had been washed extensively with "metal-free" 50 mM HEPES buffer.
The copper content of the enzyme was routinely determined by atomic absorption, and
was periodically double-checked colorimetrically using bathocuproine disulfonate (e 483 =
12,250) in 50 mM ascorbate. Atomic absorption was also used to detect the presence of iron,
cobalt, nickel, chromium, and zinc.
Results
The first indication that the copper in CVPAH might not be required for activity
occurred when we found that DTT readily removed the copper from the enzyme, even though
previous observations had shown that prolonged incubation with DTI caused no loss in
activity. The extraction procedure gave "copper-free" enzyme with residual copper between 40
and 100 ppb, or an average Cu/enzyme ratio of 0.015 (Table 1). The overall yield of "copper-
free" enzyme is about 80%.
The specific activity of the recombinant CVPAH is generally 10-19 units per mg 10.
The specific activity of the "copper-free" preparations averaged ca. 11 units/mg (Table 1),
which is approximately 85% of a control taken through the Cu extraction steps but omitting the
DTI chelator. Side by side comparison of"copper-free" and copper complexed CVPAH gave
identical Michaelis constants for both phenylalanine and pterin substrates.
The ratio of the total amount of copper in the entire reaction mixture to the moles of
enzyme used amounted to only 0.09, whereas the activity was 85% of that of the copper-
complexed control. The addition of the copper chelators bathocuproine and neocuproine had
no inhibitory effect on the activity of either "metal-free" or copper complexed CVPAH up to a
concentration of 20 11M chelator, beyond which the high background absorbance at 275 nm
interferes with the assay. Pember et al.I5 noted a moderate inhibition by these chelators at
higher concentrations but this may have been due to an interference with the assay. Cyanide
64
Table 3. Activity of CVPAH Under Non-reducing Conditions
also had no inhibitory effect at millimolar concentrations. EOTA, listed by Pember et al.l5 as
an inhibitor of CVPAH, must inhibit the enzyme by a mechanism other than copper removal
since we fmd no activity restored by addition of excess copper over EOTA.
Table 2 shows the tight coupling between the substrates and products of the reaction
with "copper-free" enzyme. For each phenylalanine molecule consumed one oxygen molecule
is consumed and one tyrosine molecule is formed. Also under conditions where the 4a-
hydroxypterin can be measured the ratio of its formation to tyrosine produced is unity.
Pember et al. 4 reported that the copper center of CVPAH must be reduced for activity,
requiring a relatively strong reducing agent such as dithionite or a thiol. OTT, which is used in
the normal assay mixture, provided an additional activation that increased the rate of
hydroxylation about tenfold over enzyme pre-reduced with dithionite.
If "copper-free" enzyme is indeed active without the need for copper then a copper
reducing agent should not be necessary. In fact, the specific activity of "copper-free" CVPAH
in the pterin oxidation assay, which does not contain OTT, is -4 units/mg (Table 3). This is
more than 20 times the activity of eu2+-complexed enzyme measured in the same assay.
When copper is added back to the "metal-free" enzyme the activity decreases proportionately.
When the assay is run in 20 mM imidazole buffer the rate is the same for both "Cu-free" and
Cu complexed CVPAH (Table 3). These rates are slower than those measured by the 275 nm
assay that includes OTT by a factor of 2-3. The reason for this is not clear but might involve
inhibition by residual metal or aggregation of CVPAH in the absence of OTT.
The titration of "Cu-free" CVPAH with Cu2+ was monitored fluorometrically and
produced a binding curve that follows simple saturation behavior (Fig. 1). At pH 7.4
computer fit gives a Kd value of 0.5 IJ.M.
Discussion
The copper Kd reported here indicates a rather modest affinity compared to most copper
enzymes ( "blue" copper proteins for example have affinities greater than can be determined by
standard techniques).
The results here in fact do not support a requirement for copper. The main evidence is
that CVPAH with a Cu/enzyme ratio ofO.Ol is nearly as active (at least 85%) as enzyme with a
Cu/enzyme ratio of 1.2. The possibility that "metal-free" CVPAH is being reconstituted by
copper in the assay solutions is disproved by the finding that the ratio of total copper to
enzyme in the assay mixture was only 0.07, whereas the activity was within 85% of a fully Cu
constituted control.
Copper then, instead of being a requirement for activity, should be thought of as an
inhibitor that is removed by the thiol for enzyme activation. The hysteretic product
accumulation seen when the assay is initiated by OTT was thought to be due to reductive
activation of the copper center (5). It now appears that the lag in product accumulation is
related to the activation of the enzyme by the ability of OTT to remove and sequester the
copper from the enzyme. Binding of the substrates blocks this site causing a much slower
activation when the thiol is added after the substrates. This hypothesis fits very well with the
observation that the "metal-free" enzyme is active without a thiol or other reducing agent
whereas the copper complexed form is not, and is further confirmed by the finding that
imidazole, a non-reducing metal ligand, is capable of activating copper inhibited enzyme.
If CVPAH is not a copper enzyme, is it in fact a metalloenzyme at all? Iron, nickel and
cobalt, the most likely metals to perform an electron transfer-type role proposed originally for
65
4000
3500
Kd=0.5 j..LM
3000
g
Q)
Q)
() 2500
"'
~
0
::s 2000
~
1500
1000
500
0 1 2 3 4 5
j..LMCopper
Figure 1. Copper (II) Kd at pH 7.4
the copper in CVPAH, were not found in significant proportions in the "metal-free" CVPAH
(less than 3 mole%), and all are inhibitory. The simplest conclusion then is that this enzyme
can perform the hydroxylation reaction without the need of any redox active metal. This
immediately excludes any oxygen-metal intermediate including a hypervalent "cupryl" ion
(Cu=O)+ or a metal-pterin peroxo species. For this enzyme then, a pterin hydroperoxide
remains as the most likely activated oxygen intermediate.
The relevance of this study to the mammalian pterin dependent hydroxy lases is founded
on the structural and functional similarity between CVPAH and its mammalian counterpart,
RLPAH. Structurally the bacterial enzyme is smaller and less complex but has a sequence
homology that would indicate that the two enzymes share important structural elements. There
is, for example, a conserved region that could be the metal binding site 10. Functionally both
enzymes perform the same reaction on the same substrates with only slight differences in
binding affinities. The enzymatic rates are nearly the same when the two are compared on a
subunit basis, though the regulation of RLPAH is more complex4. Taken together then, it is
likely that these enzymes share a common mechanism, and our data would question the
intermediacy of iron-oxygen species.
REFERENCES
1 Gottschall, D. W., Dietrich, R. F., Benkovic, S. J., & Shiman, R. (1982) 1. Bioi. Chem. 257, 845-849.
2 Dix, T. A., Bollag, G. E., Domanico, P., & Benkovic, S. J. (1985) Biochemistry 24, 2955-2958.
3 Kuhn, D. M., & Lovenberg, W. (1985) in Folates and Pterins (Blakely, R. L., & Benkovic, S. J., Eds.) Vol. 2,
pp 353-382, Wiley-Interscience, New York.
4 Pember, S. 0., Villafranca, J. J., & Benkovic, S. J. (1986) Biochemistry 25, 6611-6619.
5 Wallick, D. E., Bloom, L. M., Gaffny, B. J., & Benkovic, S. J. (1984) Biochemistry 23, 1295-1302.
6 Marota, J. J. A., & Shiman, R. (1984) Biochemistry 23, 1303-1311. Academic Press, New York.
7 Pember, S. 0., Benkovic, S. J., Villafranca, J. J., Pasenkiewicz-Gierula, M., & Antholine, W. E. (1987a)
Biochemistry 26, 4477-4483.
8 McCracken, J., Pember, S. 0., Benkovic, S. J., Villafranca, J. J., Miller, R. J., & Peisach, J. (1988)
J. Am. Chem. Soc. 110, 1069-1074.
9 Blackburn, N. J., Strange, R. W., Carr, R. T., & Benkovic, S. J. (1992) Biochemistry 31, 5298-5303.
10 Onishi, A., Liotta, L. J., & Benkovic, S. J. (1991) J. Bioi. Chem. 266, 18454-18459.
11 Miller, M. R., McClure, D., and Shiman, R.(1975) J. Bioi. Chem. 250, 1132
12 Ayling, J., Pirson, R., Pirson, W., & Boehm, G. (1973) Analytical Biochemistry 51, 80-90.
13 Lazarus, R. A., Dietrich, R. F., Wallick, D. E., & Benkovic, S. J. (1981) Biochemistry 20, 6834-6841.
14 Dix, T. A., & Benkovic, S. J. (1985) Biochemistry 24, 5839-5846.
15 Pember, S. 0., Villafranca, J. J., & Benkovic, S. J. (1987b) Methods Enzymol. 142, 50-56.
66
HISTIDINES 138 AND 143 ARE COPPER BINDING LIGANDS IN
CHROMOBACTERIUM VIOLACEUM PHENYLALANINE HYDROXYLASE
INTRODUCTION
Phenylalanine hydroxylase (PAH) from Chromobacterium violaceum (CV) is known
to bind an equivalent of divalent copper.1 Studies using pulsed EPR spectroscopy2 have
suggested that there are two equatorial imidazoles coordinated to Cu(II) of CV PAH. This
observation has been supported by copper-histidine model complexes of the active site3 and
more recently by X-ray absorption spectroscopy of the copper containing enzyme.4 We
have used a combination of site directed mutagenesis and pulsed EPR spectroscopy to
probe the copper binding site of CV PAH and identify the Cu(II) ligands.
The gene for CV PAH has been cloned and overexpressed in Escherichia coli.5 The
amino acid sequence of CV PAH contains 17 histidine residues, making the initial choice
of the potential Cu(II) ligand difficult. Alignment of the amino acid sequence of CV PAH
with those of rat liver and human PAHs, both of which bind iron, shows a region of high
sequence homology (Figure 1) containing two conserved histidine residues. Histidines 138
and 143 (as numbered in CV PAH) are the only conserved histidines in the entire amino
acid sequence and were thus considered to be strong candidates for the Cu(II) ligands.
Histidine to serine single mutants were generated from the E. coli expression systemS using
the PCR overlap extension method, 6 and were purified by the published protocol. 7
!!
73 (numbering in C. violaceum PAH)
l •• • • ** * * * * * * * *
RESULTS
Catalytic Activity of Mutants
The two mutant PAH enzymes, Hl38S and Hl43S, were assayed for catalytic activity
by two independent methods:a the standard 275 nm UV assay to detect the fotmation of
tyrosine7 and by a more sensitive HPLC assay of the phenylisothiocyanate (PIT) derivative
of any tyrosine produced. We were unable to detect any phenylalanine turnover by either
mutant under conditions that would have detected 0.01 % of the corresponding turnover by
wild type PAH. The mutants remained inactive both with and without the presence of
Cu(II). We were still unable to detect any activity when supplementing the buffer with 30
mM imidazole.
Table 1.
Cu(ll) Binding Affinities for CV PAH
Kd {Cu(ll)} I mM
a Assays were carried out at 25 °C, pH 7.4 (HEPES, 80 mM), and included 4.5 mM CV PAH, 1 mM L-
phenylalanine, 180 mM 6-methyltetrahydropterin, 6 mM DTT and 1 mg/ml catalase.
68
Pulsed EPR Experiments
The Cu(II)-bound mutants H138S and H143S, and the Cu(m-bound wild type enzyme,
were studied using pulsed EPR spectroscopy. Electron spin-echo modulation (ESEEM)
measurements were taken essentially as previously described by McCracken et af.2 to
elucidate any apparent changes in the ligand to Cu(II) interactions due to the histidine
mutations. The insert of Figure 2 shows the ESEEM data for wild type protein (A), and
mutants H143S and H138S (B and C respectively). The resultant Fourier transformed
spectra are presented in the main figure. The key features shared by all three Fourier
transfonned spectra are the three sharp lines near 0.55, 1.00 and 1.55 MHz and a broader
line near 4 MHz. These spectral features are characteristic of the coupling between the
electron spin of the Cu(II) with the remote 14N of coordinated histidyl imidazole.2 The
lower intensity spectral lines at 2.1, 2.6 and 3.2 MHz in the spectrum of wild type protein
(indicated by arrowheads in Figure 2) are combination lines that arise as a consequence of
two or more nuclei being coupled to the electron spin. These combination lines are absent
in the spectra of both mutants H143S and H138S suggesting the presence of only one,
rather than two copper-coordinating histidine.
2
FREQUENCY
(MHz )
Figure 2. ESEEM traces (insert) and Fourier transformed spectra (main figure) of Cu(II) bound to wild type
(A), H143S (B) and Hl38S (C) CV PAHs.
69
DISCUSSION
The most straightforward interpretation of the electron spin echo experiments is that
the Cu(II) of CV PAH is indeed equatorially coordinated by two histidine imidazoles as
previously predicted,2,3 and that histidines 138 and 143 can be assigned as these ligands.
This is the first piece of structural data to be obtained for CV PAH. Clearly the single
mutations were insufficient to remove the protein's ability to bind Cu(II), with the Kd
values not falling by 2-3 orders of magnitude, as might be predicted on loss of a ligand.
The fact that the Kd{Cu(II) } is actually slightly reduced for the mutant H138S suggests
that there are protein ligands, other than histidine, capable of coordinating Cu(II). We
cannot exclude the possibility that the serine amino acid replacement itself may coordinate
the Cu(II). The complete loss of catalytic activity for both mutants can be explained by one
of three possibilities. First, a catalytically essential role for the Cu(II) may have been
disrupted by the removal of a natural ligand. In the light of recent experiments by Carr and
Benkovic8, it now appears that the Cu(II) is not required for enzyme activity, making this
possibility unlikely. Another possibility is that both histidines 138 and 143 themselves play
an essential role in the catalytic mechanism. If this is so, it is currently unclear how the
histidines may be involved. A third possibility is that the integrity of the active site
structure was not preserved by the mutations. We have tested this possibility by carrying
out binding assays for wild type and mutant proteins using radiolabelled L-phenylalanine
and ultrafiltration. The three Kd(phenylalanine) values estimated by this method are all
within a factor of 3 of each other, suggesting that the substrate binding site structure has not
been significantly altered by the mutations. Finally, it is interesting to note that the
corresponding histidine mutants (by sequence alignment) of the rat liver PAH were also
found to show no catalytic activity.9 Given that this pair of histidines are also homologous
to histidines in human PAH and the pterin dependent eukaryotic tryptophan and tyrosine
hydroxylases, it is probable that they play some important, but as yet undetermined, role.
ACKNOWLEDGMENTS
We thank SERC I NATO for a Postdoctoral Fellowship for S.B. and the NSF for
supporting this work.
REFERENCES
1. S. 0. Pember, J. J. Villafranca, and S. J. Benkovic, Biochemistry, 25, 6611-6619,(1986).
2. J. McCracken, S. 0. Pember, S. J. Benkovic, J. J. Villafranca, R. J. Miller, and J. Peisach, J. Am. Chem.
Soc.,llO, 1069-1074 (1988).
3. T. Kohzuma, H. Masuda,andO. Yamauchi,]. Am. Chem. Soc., Ill, 3431-3433 (1989).
4. N.J. Blackburn, R. W. Strange, R. T. Carr, and S. J. Benkovic, Biochemistry, 31, 5298-5303 (1992).
5. A. Onishi, L. J. Liotta, and S. J. Benkovic, J. Bioi. Chem., 266, 18454-18459 (1991).
6. S. N. Ho, H. D. Hunt, R. M. Horton, J. K. Pullen, and L. R. Pease, Gene, 77, 51-59 (1989).
7. S. 0. Pember, J. J. Villafranca, and S. J. Benkovic, Methods Enzymol., 142,50-56 (1987).
8. R. T. Carr and S. J. Benkovic, manuscript in preparation; R. T. Carr and S. J. Benkovic, paper presented
at this symposium.
9. B. S. Gibbs and S. J. Benkovic, J. Bioi. Chem., in press (1993).
70
CHARACTERIZATION OF THE IRON ENVIRONMENT IN RECOMBINANT
HUMAN TYROSINE HYDROXYLASE, USING MOSSBAUER AND EPR-
SPECTROSCOPY
INTRODUCTION
57Fe in the metallic form was from Amersham Buchler (Darmstadt, Germany).
Fe(II)Cl2 was prepared by dissolving the metal in 1 M HCl under argon (99.99 %), using
platina as catalyst and drying the product under nitrogen (99.996 %). The concentration and
redox state of the product was verified by UV-visible absorption spectra of their 1,10-
phenanthroline complexes, in the presence and absence of ascorbic acid. The solid 57Fe(II)Cl2
was dissolved in oxygen-free water to a concentration of approx. 5 mM and added to the
apoenzyme in 20 mM Na-Hepes and 150 mM NaCl, pH 7.5010 •
All four isoforms of TH were expressed in E. coli and purified as previously
described9 • A typical yield was 80-100 mg of enzyme with a purity > 95 %, starting from 50
g of cell paste. The purified preparations of hTH1, hTH2 and hTH4 used in the present study
contained 0.02 ± 0.01, 0.02 ± O.Ql and 0.09 ± 0.02 (mean ± S.D., n = 3-4) atoms of
iron/subunit, respectively, as determined by atomic absorption spectrometry 10 • The
concentration of purified enzyme was measured using an extinction coefficient at 280 nm of
1.04 cm· 1 for 1 mg/ml2 • The enzyme activity was measured as described 1\
The EPR spectrometer was a conventional X-band apparatus (Bruker, model ER200D),
equipped with a helium flow cryostat (Oxford Instrument ESR910), which provided
temperatures down to 1.8 K. The Mossbauer spectrometer was of conventional type with
constant acceleration 12 and 1.856 GBq 57 Co in 6 pm Rh-matrix as y-source (Amersham
Buchler). Standard line width of a calibration absorber was 0.24 mm s· 1. Isomer shifts are
given relative to a-iron at ambient temperature.
As shown in Fig. 1, the activity of hTH1 is stimulated about 40-fold by the presence
of Fe(II) and this effect is similar for both 57Fe(II) and 56Fe(II). Previous experiments have
demonstrated that the iron is rapidly bound in stoichiometric quantities under these
conditions 10 , indicating that the added iron is "correctly" inserted into the enzyme.
1000
~
I
CJl
E
800
~
I
c
E 600
0
E
c 400
"'
-
~
> 200
u
0
0
I
1-
0 10 20 30 40 50
[Fe(ll)] (I'-M)
Figure 1. The effect of added 5'Fe(II) and 57Fe(II) on the activity of tyrosine hydroxylase (hTHl ). The
enzyme activity was assayed for 1 min at pH 7.0, in the presence of either 5'Fe(II)S04 (•) or 57Fe(II)Cl2 (•)-
72
Mossbauer spectra of 57Fe(II) reconstituted tyrosine hydroxylase
The 57Fe Mossbauer spectra of hTHl, hTH2 and hTH4 in the temperature range 1.8
to 77 K in zero and weak applied magnetic fields are dominated by intense quadropole
o
doublets (solid line in Fig. 2) with isomer shifts (1.8-77 K) = 1.26 - 1.24 mm s·1 and
temperature independent quadropole splittings Ll£0 = 2.68 mm s·1 (typical errors for both
parameters: ±0.02 mm s·1). These values are characteristic of high-spin Fe(Il) in 6-
o,
coordination with oxygen- or nitrogen ligands. The isomer shift, which measures charge
density p(O) of s-electrons at the 57Fe nuclear site, is a sensitive parameter for the coordination
state of the Mossbauer atom, especially in the high-spin ferrous state. Shorter bond lengths
in 4-coordination with respect to 6-coordination, as well as the presence of covalent ligands
like sulfur in contrast to ionic ligands like oxygen, increase the s-density at the 57Fe nucleus
and hence reduce the isomer shift. Thus, for 4-coordination with oxygen or nitrogen ligands
we would expect isomer shifts for high-spin Fe(II) < 1 mm s· 1 at these temperatures and,
alternatively, 6-coordination would yield isomer shifts > 1.20 mm s·113 • Substitution of one
oxygen or nitrogen by one sulfur ligand would reduce the isomer shifts by about 0.1 mm s· 1•14 •
It is therefore very likely that the high-spin Fe(II) in hTH is exclusively coordinated to
oxygen and nitrogen ligands.
In addition to the dominant ferrous species, the spectra of hTH exhibited minor
contributions of ferric iron (dashed line in Fig. 2), which were preparation-dependent, but
never exceeded relative intensities of 5%. It is interesting to note that this ferric spectrum
appears to be distinct from the ferric species obtained after addition of dopamine, which is
a magnetically split spectrum (see below). The protein was found to stabilize the Fe(II)-state,
even in the presence of dioxygen, implying a relatively high redox-potential for the iron.
1.000
1:
0
'iii
.!!! .995
E
(/)
1:
0
.....
l-
Cll
.::: .990
0
Cll
0:::
.985
-10 -5 0 5 10
Velocity [mm s-'J
Figure 2. Mossbauer spectrum of 57Fe-tyrosine hydroxylase (hTHl) at 4.2 K. The apoenzyme (0.52 mM
subunit concentration) was incubated with 0.5 mM 57Fe(II)CI2 for 1 min at 20 •c before freezing in liquid
nitrogen. The solid line and the dashed line represent a least squares fit to the data, showing the major Fe(II)
species and a minor Fe(III) species, respectively.
73
The effect of added catecholamines on the Mossbauer- and EPR-spectra of tyrosine
hydroxylase
1.001
r:::: 1.000
-~
II)
.E
II)
~ .999
...0
1-
Q)
>
~
..2 .998
Q)
a::
.997
-10 -5 0 5 10
Velocity [mm s·'J
hyperfine pattern due to internal magnetic fields, originating from S = 5/2. Spin relaxation is
in the slow or intermediate range, with respect to the Mossbauer time window("' 10·7 s), even
at elevated temperatures (77 K). This is not unusual for Fe(III) in biological systems, in which
a large separation of the paramagnetic sites in the protein moiety results in slow spin-spin
relaxation. Furthermore, in such systems weak spin-orbit coupling between the 6S ground-state
and an excited spin quartet of Fe(III) results in a small spin-lattice relaxation. Detailed spin-
Hamiltonian analyses of Mossbauer spectra are in progress, in conjunction with
complementary EPR studies.
74
As recently shown 10, the oxidation of enzyme-bound Fe(II) and formation of the
characteristic catecholamine-iron-enzyme complex occurs rapidly upon addition of
stoichiometric amounts of catecholamines. However, based on visible spectroscopic studies
on the formation of this complex, the second order rate constant (k = 1.3'103 M-Ls- 1 at 20 oc
and pH 7.5) for the formation of the dopamine complex with hTHl, is still at least 500-fold
smaller than the rate of iron incorporation into the apoenzyme (data not shown). The
dopamine complexes of hTHl and hTH4 have also been studied by EPR spectroscopy. The
g-va lues
20 10 6.0 4 .0 3.0 2.0 1.5
QK" \
dB __ _j \
Figure 4. EPR-spectra of iron-reconstituted tyrosine hydroxylase and the effect of stoichiometric amounts of
added dopamine. The samples were prepared as described in the legend to Fig. 3 and the spectra were
recorded at 2.8 K, using 2 mW microwave power (upper trace) and 20 11W (lower trace), 1 mT field
modulation, 9.43 GHz microwave frequency and 100kHz modulation frequency . The lower trace represents
the spectrum of the Fe(II)-enzyme before addition of dopamine.
75
Acknowledgments-We are grateful to Dr. Beatrice Le Bourdelles and professor Jacques
Mallet at CNRS, Gif-sur-Yvette, France for supplying the bacterial strains expressing human
tyrosine hydroxylase. Sidsel E. Riise and Ali J. Sepulveda at Department of Biochemistry and
Molecular Biology, University of Bergen are thanked for expert technical assistance. This
study was supported by the Research Council of Norway, Rebergs legat and Medizinische
Universitiit Dilbeck.
REFERENCES
1. M. Levitt, S. Spector, A. Sjoerdsma, and S. Udenfriend, J. Pharmacal. Exp. Ther. 148:1 (1965).
2. J. Haavik, K.K. Andersson, L. Petersson, and T. Flatmark, Biochim. Biophys. Acta 953:142 (1988).
3. K.K. Andersson, C. Vassort, B. Brennan, L. Que Jr., J. Haavik, T. Flatmark, F. Gros, and J. Thibault,
Biochem. J. 284:695 (1992).
4. T.A. Dix and S.J. Benkovic, Biochemistry 24:5839 (1985).
5. D.E. Wallick, L.M. Bloom, B.J. Gaffney, and S.J. Benkovic, Biochemistry, 23:1295 (1984).
6. B. Grima, A. Lamouroux, C. Boni, J.-F. Julien, F. Javoy-Agid, and J. Mallet, Nature 326:707 (1987).
7. N. Kaneda, K. Kobayashi, H. Ichinose, F. Kishi, A. Nakazawa, Y. Kurosawa, K. Fujita, and T. Nagatsu,
Biochem. Biophys. Res. Commun. 146:971 (1988).
8. K.L. O'Malley, M. Anhalt, B.M. Martin, J.R. Kelsoe, S.L. Winfield, and E.I. Ginns, Biochemistry
26:6910 (1987).
9. J. Haavik, B., Le Bourdelles, A. Martinez, T. Flatmark, and J. Mallet, Eur. J. Biochem. 199:371 (1991).
10. J. Haavik, A. Mardnez, S. Olafsdottir, J. Mallet, and T. Flatmark, Eur. J. Biochem. 210:23 (1992).
11. J.F. Reinhard Jr., G.K. Smith, and C. A. Nichol, Life Sci. 39:2185 (1986).
12. A.X. Trautwein, E. Bill, E.L. Bominaar, and H. Winkler, in: Structure and Bonding 78, pp.1-95, Springer
Verlag, Berlin (1991).
13. R. Reschke, A.X. Trautwein, and J.P. Desclaux, J. Phys. Chern. Solids 38:837 (1977).
14. E. Bill, C. Haas, X.-Q. Ding, W. Maret, H. Winkler, A.X. Trautwein, and M. Zeppezauer, Eur. J.
Biochem. 180:111 (1989).
15. K.K. Andersson, D.D. Cox, L. Que Jr., T. Flatmark, and J. Haavik, J. Bioi. Chern. 263:18621 (1988).
76
INTERACTION OF SUBSTRATE AND PTERIN COFACTOR WITH THE METAL
OF HUMAN TYROSINE HYDROXYLASE AS DETERMINED BY 1H-NMR
INTRODUCTION
Tyrosine hydroxylase (EC 1.14.16.2, TH) catalyses the rate-limiting step in the
biosynthesis of catecholamines. Human TH exists as four different isofmms (hTH1 to hTH4)
which have been expressed in E. colt The purified apoenzymes are rapidly activated (up
to 40-fold) by the incorporation of stoichiometric amounts of Fe++ 2 • All isozymes are
competitively inhibited by other divalent metal ions, e.g. zn++, Co++ and Ni++ which bind
with similar affinity and stoichiometty as Fe++ 2 •3.
Several mechanisms have been proposed for the reaction catalyzed by TH4 , but the
actual catalytic mechanism is not clear. Little is also known about the specific interactions
of substrates and inhibitors with the enzyme. The present paper reports the conformation of
the substrate (i.e. phenylalanine, Phe) and the pterin cofactor (i.e. 6-methyltetrahydropterin,
6-MPH4) bound to hTHl. These conformations were determined based on the metal-
substrate and metal-pterin distances measured by the paramagnetic probe-T 1 method 5.
As forTH isolated from other mammalian sources, Phe is a good substrate for hTHl
which hydroxylates Phe both to tyrosine (Tyr) and DOPA, with a ~<u, = 85 ± 4.9 11M and
a Vmax (for the hydroxylation to both products)= 461 ± 89 nmol/min/mg (n = 3) at pH 7.0
with tetrahydrobioptetin (BH4 ) as the cofactor. The low affinity of the enzyme for Phe is
in the ideal range in order to get fast exchange between Phe in the bound and the free states
in our NMR experiments. In contrast, Tyr has too high affinity for the enzyme (Km = 11 ±
1.7 11M) and very low solubility.
The 600-MHz 1H-NMR spectmm of Phe in the presence of hTH1 apoenzyme and the
assignment of proton resonances is shown in Figure lA. The addition of Co++ results in a
paramagnetic line broadening of the Phe signals and detailed titrations adding CoC12 (from
IIllS ()
I ~:tt.:l ,
114
IIJ.S I 112.6 IIN:xll
1/(,
I ,N~N ~
\ I
I 117S
111H
II
llu 1
r·L
1171!
---' "---'
___..il
7.5 7.0 4.0 J .! J.O 2.! J.S J.O l.S I.S 1.0
ppm ppm
Figure 1. 1H-NMR spectra ofPhe and 6-MPH4 taken in the presence of hTHI at 20 °C. A) 600-MHz 'H-NMR
spectrum of 5 mM Phe and 0.21 mM subunit hTHl, prepared in D20 containing 4 mM NaHepes (pH' = 7.5)
and 0.2 M NaCI. Peaks a, band care signals from Hepes. B) 400-MHz 1H-NMR spectrum of 4.6 mM 6-MPH4
and 22 pM subunit hTHl prepared in 0.1 M deuterated K-phosphate buffer, 0.1 M NaCJ (pH' = 7.45).
The correlation time ('tc) for the enzyme-substrate complex was calculated from the
frequency dependence of l/fT1p of the Hex proton at 250 and 600 MHz5•6• From the ratio
/f1p(600 MHz)/fT1p(250 MHz) of 1.38 ± 0.13, a 'tc of 1.8 ± 0.1 ps was calculated. This 'tc-
value, which represents the longitudinal electron spin relaxation time ('t8) of co++5, was used
to calculate the distances from the Phe protons to the Co++ ion (Table 1).
Based on the proposed ordered kinetic mechanisms for TH, with the order of binding
being pterin cofactor, oxygen and Tyr (or Phe)4•7 •8, a different conformation for Phe might
exist when it binds to the enzyme-pterin complex, than when it binds to the enzyme alone.
Since some activity is detected for the apoenzyme as isolated2, the conformation of Phe
could not be studied in the presence of BH4 • L-erythro-1 ,8-dihydrobiopterin (BH2) inhibits
hTHl competitively vs. BH4 with a Ki of 0.07 mM and it was used as a BH4 analogue (0.5
mM BH2 for 0.2 mM hTHl subunit). As found by the paramagnetic probe-T1 method, when
Phe binds to hTHl-Co++ (pterin absent) the aromatic H4 proton is slightly closer to the metal
(6.56 ± 1.18 A) (Table 1) than when it binds to the hTHl-Co++· BH2 complex (7.03 ± 1.25
A), other distances not being significantly different from those shown in Table 1.
78
Table 1. Distances from Co++ to protons of Phe in the hTH1-Co++, Phe complex
nucleus o• (ppm)
H3,5 7.39 31.7 ± 1.5 6.80 ± 1.20c
H4 7.35 38.4 ± 3.2 6.56 ± 1.18
H2,6 7.31 31.0 ± 1.6 6.80 ± 1.21c
Ha 3.97 22.3 ± 2.1 7.18 ± 1.28
HBS 3.25 19.5 ± 2.5 7.35 ± 1.31
HBR 3.10 ::;17 "?.7.52
Table 2. Distances from Co++ to protons of 6-MPH4 in the hTHl-Co++· 6-MPH4 complex
79
CONCLUSIONS
The conformations of Phe and of 6-MPH4 bound to hTHl that we have determined
from the experimental distances obtained by the paramagnetic probe-T1 method have
mechanistic implications. Thus, the distances from the aromatic protons of Phe to Co++, both
in the presence and the absence of BH2, place the aromatic ring in the second coordination
sphere of the metal (Table 1). Then, the metal could contribute to the correct orientation of
the substrate but no group from the aliphatic chain of Phe (i.e. the carboxyl group) could
coordinate to the metal-ion (Fe++ in the catalytic form of the enzyme). For 6-MPH4 ,
however, proton-metal distances are shorter than for Phe (Table 2) and a direct coordination
to the metal may be presumed, both the carbonyl group at C4 or the NS being candidates
to directly coordinate to Fe++. Moreover, the calculated distances from the metal to the
aromatic ring of the substrate seem to be adequate for a Fe++-bound oxy or peroxy species,
acting as an hydroxylating intermediate, to approach molecular contact with C3/C4, which
are the positions in which Phe is hydroxylated by TH. Such a highly reactive oxygen
containing intermediate could be an activated enzyme bound iron-oxy, a peroxy adduct or
a 4a-peroxytetrahydropterin-iron species 4 ' 8, the latter being in agreement with the distances
from the metal to 6-MPH4 here reported. The final and unambiguous determination of the
conformation of both substrate and pterin cofactor when bound to the enzyme awaits the
determination of structures satisfying both the metal-proton distances calculated by the
paramagnetic probe-T 1 method and the intramolecular distances obtained by NOESY studies.
In the case of Phe, both sets of data are mutually consistene 0 , and in the case of 6-MPH4
experiments are in progress.
Acknowledgments
We are very grateful to Dr. Beatrice Le Bourdelles and professor Jacques Mallet,
Centre National de la Reserche Scientifique, Gif-sur-Yvette, France, for the supply of the
bacterial strains expressing human tyrosine hydroxylase isozymes. This work was supported
by grants from the Norwegian Research Council For Science and the Humanities and the
National Institutes of Health Grant DK-28616.
REFERENCES
1. B. Le Bourdelles, P. Horellou, J.-P. Le Caer, P. Denefle, M. Latta, J. Haavik, B. Guibert, J.-F. Mayaux,
and J. Mallet,]. Bioi. Chern 266:17124 (1991).
2. J. Haavik, B. Le Bourdelles, A. Martinez, T. Flatmark, and J. Mallet, Eur. J. Biochem 199:371 (1991).
3. J. Haavik, A. Martinez, S. Olafsdottir, J. Mallet, and T. Flatmark, Eur. J. Biochem. 210:23 (1992).
4. T.A. Dix and S.J. Benkovic, Ace. Chern. Res. 21:101 (1988).
5. A.S. Mi1dvan, J. Granat, G.M. Smith, and M. Liebman, Adv. Inorg. Biochem. 2:211 (1980).
6. E.H. Serpersu, D.W. Hibler, J.A. Gerlt, and A.S. Mildvan, Biochemistry 28:1539 (1989).
7. P.F. Fitzpatrick, Biochemistry 30:3658 (1991).
8. S. Kaufman and E.S. Kaufman, in: "Folates and Pterines" (R.L. Blakley and S.J. Benkovic, eds., Vol. 2,
pp 251-352, John Wiley & Sons, New York (1985).
9. T.C. Williams and C.B. Storm, Biochemistry 24:458 (1985).
10. A. Martinez, C. Abeygunawardana, J. Haavik, T. Flatmark, and A.S. Mildvan, Biophys. J. 64:A368 (1993).
80
MECHANISTIC STUDIES OF TYROSINE HYDROXYLASE
Paul F. Fitzpatrick
Departments of Biochemistry and Biophysics and Chemistry
Texas A&M University
College Station, TX 77843
INTRODUCTION
Tyrosine hydroxylase catalyzes the rate-limiting step in the biosynthesis of thecate-
cholamine neurotransmitters, the hydroxylation of tyrosine to dihydroxyphenylalaninel.
The other substrates for the reaction are molecular oxygen and a tetrahydropterin. In addi-
tion, tyrosine hydroxylase requires one atom of ferrous iron per active site for activity2,3;
the role of the iron atom is unknown. While the central position of tyrosine hydroxylase in
the function of the central nervous system has resulted in a great deal of interest in the
enzyme over the years, very little is known about the actual mechanism of catalysis. This
report describes recent studies towards elucidating the mechanism of this important
monooxygenase.
v = V[tyr][02][6MPI4]/([tyr][02][6MPJ4] + Ktyr[02][6MPJ4]
+ Koz[tyr][6MPJ4] + KMP14[tyr][02] + coef(tyr)[tyr] (1)
+ coef(6MPJ4)[6MPJ4] + coef(02)[02] +constant)
k16-MePH4
E E·6-MePH4 E
k10 n 2
kgty:
E·tyr
Scheme 1
82
0.08
c
'E• 0.04
~
0
0 0.05 0.1 0.15
1/[6-Me-PH,J, J.1M' 1
Burst kinetics
To determine if the rate limiting step in the enzyme reaction occurs after oxygen trans-
fer to tyrosine, the rate of DOPA formation during the first few enzyme turnovers was de-
termined. At saturating levels of 6-MePH4 and oxygen and high levels of tyrosine, there
was no detectable burst of DOPA formation (Figure 2). This result establishes that no slow
step occurs after oxygen transfer to tyrosine, so that product release must be rapid.
Consequently, the rate-limiting step in catalysis is a chemical step.
2
c..
Q)
20 t 40 60
•s
Figure 2. Rate of DOPA formation during the fD'st turnover. The rate of
DOPA production was determined at pH 7 at 2 oc with 150 1J.M tyrosine, 500 IJ.M
6-methyltetrahydropterin, and 440 IJ.M oxygen. p/e is the number of molecules of
DOPA formed per enzyme monomer.
83
Kinetic isotope effects
To determine if cleavage of the tyrosine CH bond occurs in a slow step, kinetic isotope
effects were determined with [3,5-2H2]tyrosine as substrate. The measured isotope effects
on the Vmax and V/K!Yr values were 0.98±o.06 and 1.02±o.06, respectively. Neither is
significantly different from one. Since no significant isotope effect was seen on the VIKtyr
value, carbon-hydrogen bond cleavage either occurs after the first irreversible step or 1s
much faster than another step preceding or including the first irreversible step. The lack of
an observed isotope effect on the Vmax value indicates that carbon-hydrogen bond cleavage
is much faster than another chemical step, since product release is rapid.
Transition state analogs as tests of an electrophilic mechanism
A plausible mechanism for hydroxylation by tyrosine hydroxylase involves attack of the
aromatic ring of the substrate on an electrophilic pterin peroxide (Scheme 2); this would be
assisted by the electron donating ability of the phenolic group8,9. Carbon-hydrogen bond
cleavage would occur during the tautomerization of the hydroxycyclohexadienone-like
intermediate II; such a step is expected to be quite rapid, so that no isotope effect would be
expected. As a test of this mechanism, several compounds similar to the proposed inter-
mediates were tested as inhibitors (Scheme 3). 4-Pyridylalanine N-oxide (III) was tested as
a mimic of the proposed phenoxide. The preferred tautomers of both IV and V are the keto
specieslO, so they were tested as analogs ofii. With all three proposed inhibitors, only very
weak or no inhibition was seen, and the inhibition was more characteristic of catechols than
amino acids. Also, no time-dependent inhibition was seen with IV or V, either alone or
when S-deaza-6-MePH4 was added.
m
Scheme 3. Transition state analogs for tyrosine hydroxylase based on the mechanism of Scheme 2.
The lack of any inhibition by the phenoxide analog III suggests that phenoxide formation is
not obligatory for catalysis. The weak inhibition with IV and V is consistent with a lack of
enzymatic catalysis of the formation of a hydroxycyclohexadienone intermediate in the
hydroxylation of tyrosine by tyrosine hydroxylase.
Evidence for rate-limiting oxygen activation
The effect of changing the reactivity of the amino acid substrate upon the rate of catalysis
was determined. The total rate of tetrahydrobiopterin oxidation was measured, to ensure
84
that the total flux through the catalytic cycle was detected, using a coupled reaction with
dihydropterin reductase. Steady state kinetic parameters were determined with a number of
tyrosine analogs, varying both the amino acid and tetrahydrobiopterin. The KM values for
tetrahydrobiopterin were about 20 J..LM with all the substrates tested. Also, no
tetrahydrobiopterin oxidation was detected in the absence of an amino acid. The Vmax and
Kaa values are summarized in Table 2. Surprisingly, the Vmax values are essentially inde-
pendent of the reactivity of the amino acid substrate, with an average value of about 100
min-1. This clearly establishes that the rate-limiting step in catalysis by tyrosine hydroxy-
lase does not involve the amino acid substrate, although the amino acid must be bound to
the enzyme for catalysis to occur. Further, 4-CH30-phenylalanine is efficiently hydroxy-
lated by tyrosine hydroxylase, establishing that there is no requirement for removal of the
phenolic proton as depicted in Scheme 2.
Table 2
Steady State Kinetic Parameters for Alternate Substrates of Tyrosine Hydroxylasea
Among the possibilities for the identity of the hydroxylating intermediate, the one which is
most frequently proposed is a 4a-peroxytetrahydropterin (Scheme 2). Studies by Eberlein et
al.11 are consistent with the mechanism of Scheme 4 for the reaction of molecular oxygen
with tetrahydropterins. In the slow first step single electron transfer from the reduced pterin
to 02 forms superoxide and the pterin radical cation. These two radicals rapidly recombine
in a second step to form the peroxytetrahydropterin.
Scheme4
Obviously, no primary kinetic isotope effect is expected if single electron transfer is rate-
limiting. In addition, no solvent isotope effect should be seen, since no exchangeable
proton is in flight in the rate-limiting transition state. Consistent with such a prediction, the
Vmax and VIKtyr values are unchanged when the reaction is run in D20 instead of water,
when the values at the pH optima are compared.
Conclusions
The ready availability of significant amounts of purified rat tyrosine hydroxylase has
allowed us to begin investigating the mechanism of hydroxylation by this enzyme. The
steady state kinetic mechanism has been determined. Further, all results to date are consis-
85
tent with the rate-limiting step in catalysis being fonnation of the hydroxylating intermedi-
ate.
Acknowledgments
The support of the National Science Foundation, the National Institutes of Health, and
the American Heart Association during the course of this work is gratefully acknowledged.
P.F.F. is an Established Investigator of the American Heart Association.
REFERENCES
1. S. Kaufman and E.E. Kaufman. Tyrosine hydroxylase, in: "Folates and Pterins, Vol. 2", R.L. Blakley et
a!., eds., John Wiley & Sons, New York (1985).
2. P.F. Fitzpatrick. The metal requirement of rat tyrosine hydroxylase, Biochem. Biophys. Res. Comm.
161:211 (1989).
3. J. Haavik, B. LeBourdelles, A. Martinez, T. Flatmark, and J. Mallet Recombinant human tyrosine
hydroxylase isozymes. Reconstitution with iron and inhibitory effect of other metal ions, Eur. J.
Biochem. 19:371 (1991).
4. P.F. Fitzpatrick, L.J. Chlumsky, S.C. Daubner, and K.L. O'Malley. Expression of rat tyrosine hydroxylase
in insect tissue culture cells and purification and characterization of the cloned enzyme, J. Bioi. Chem.
265:2042 (1990).
5. F.W. Studier, A.H. Rosenberg, J J. Dunn, and J.W. Dubendorff. Use of T7 RNA polymerase to direct
expression of cloned genes, Methods Enzymol. 185:60 (1990).
6. S.C. Daubner, C. Lauriano, J.W. Haycock, and P.F. Fitzpatrick. Site-directed mutagenesis of serine 40 of
rat tyrosine hydroxylase effects of dopamine and cAMP-dependent phosphorylation on enzyme activity,
J. Bioi. Chem. 267:12639 (1992).
7. F.B. Rudolph and HJ. Fromm. Plotting methods for analyzing enzyme rate data, Methods Enzymoi.
63:138 (1979).
8. K. Detmer and V. Massey. Effect of substrate and pH on the oxidative half-reaction of phenol
hydroxylase, J. Bioi. Chem. 260:5998 (1985).
9. G. Guroff, J.W. Daly, D.M. Jerina, J. Renson, B. Witkop, and S. Udenfriend. Hydroxylation-induced
migration: The NIH shift, Science 157:1524 (1967).
10. A.R. Katritzky and J.M. Lagowski. "Chemistry of the Heterocyclic N-Oxides", Academic Press, New
York (1971).
11. G. Eberlein, T.C. Bruice, R.A. Lazarus, R. Henrie, and S.J. Benkovic. The interconversion of the 5,6,7 ,8-
tetrahydro-, 7,8-dihydro-, and radical forms of 6,6,7 ,7-tetramethyldihydropterin. A model for the
biopterin center of aromatic amino acid mixed function oxidases, J. Am. Chem. Soc. 106:7916 (1984).
86
ALLEVIATION OF CATECHOLAMINE INHIBITION OF TYROSINE
HYDROXYLASE BY PHOSPHORYLATION AT SERINE40
INTRODUCTION
Tyrosine hydroxylase (TYH) catalyzes the rate-determining step in the synthesis of
catecholamine neurotransmitters, the hydroxylation of tyrosine to L-dihydroxyphenylala-
nine with the oxidation of tetrahydrobiopterin to dihydrobiopterin 1. The activity of TYH is
highly regulated. Tyrosine hydroxylase is inhibited by catecholamines and high levels of
tyrosine, and activated by anions, polyanions, phospholipids and phosphorylationl,2.
cAMP-Dependent protein kinase phosphorylates serine40; calmodulin-dependent protein
kinase II phosphorylates serinel9 preferentially, but also phosphorylates serine40; and ser-
ine31 is also phosphorylated2. Phosphorylation at serine40 has been studied more thor-
oughly than phosphorylation at the other serines. The reported effects have varied widely2.
At pH 6, phosphorylation of the rat enzyme decreases the KM value for 6-methyltetrahy-
dropterin four to eight-fold, and increases the V max value up to threefold. Much less work
has been done with the physiological substrate tetrahydrobiopterin at the physiological pH
of 7. Under these assay conditions with partially or fully purified enzyme, the effect on the
KBH4 value is reported to be about threefold, while the increase in the Vmax value is up to
tenfold. This variability may be due to different preparations containing variable amounts
of phosphate at each of the serine residues. In addition, TYH purified from PC12 cells or
bovine adrenal medulla contains substoichiometric amounts of bound catecholamines3;
several labs have noted a relationship between phosphorylation and feedback inhibition by
catecholamines4.
We recently reported the expression and isolation of large quantities of rat TYH5.
This paper reports work done with the enzyme expressed in E. coli. We focused initially on
the effect of phosphorylation of serine40, producing a S40A mutant of TYH. With the pro-
duction of large quantities of unphosphorylated and catecholamine-free TYH, we have
been able to study the relationship between the two modes of regulation of TYH.
METHODS
Preparation of recombinant DNA molecules
The eDNA for rat TYH was initially cloned into a baculovirus expression vectorS. It
was removed from this vector by Bamm digest and inserted into the Bamm site of
pTZ18R, giving plasmid pTH5. This vector was used as the substrate for oligo-directed
mutagenesis6. Best expression results from pET3b (a T7 RNA polymerase promoter-con-
taining vector?) if the insert is placed between the Ndei and the Bamffi sites; accordingly, a
new Ndel restriction site was required at the start codon of the TYH eDNA.
NIB digest,
isolation of
UJ
band with TYH
NIB digest, eDNA
$10 band
promotor isolation
_ _ _ _ _ _...,.mix DNA
fragments
ligate
$10 N Jp
pETOHl
6410 bp
Figure 1. Construction of the plasmid pETOHl, allowing overexpression of rat tyrosine hydroxylase in E.
coli. The $10 promoter is a T7 RNA polymerase promoter (8). Restriction enzyme sites are abbreviated: E
refers to EcoRI; N, Ndel; B, Bamlll; P, Pstl; and H, Hindiii. Ampr refers to the 8-lactamase gene.
88
(loss of
EBNEP Hinfl site)
E
E
N/B digest,
zo... isolation of TYH eDNA
N/B digest,
portion of plasmid
isolation of
pET3b
portion of
-!:P:::Ia:::s~m;,;.:id:-..----t~~ mix DNA
pETOH1
fragments
6410 bp ligate
~.P10
! S40A
(loss of
Hinfl site)
promotor
pETOH1S40A
6410 bp
Figure 2. Construction of the vector coding for tyrosine hydroxylase with alanine substituted for serine at po-
sition 40. Notations for restriction enzyme sites are the same as for Figure 1.
89
Plasmid pTH5 was subjected to mutagenesis, giving plasmid pTH6. Plasmids pET3b and
pTH6 were digested with Ndel and BamHI; both the opened pET3b vector and the eDNA-
containing fragment from pTH6 were purified from agarose gels and exposed to T4 DNA
ligase. Possible recombinants were screened by restriction enzyme analysis. The plasmid
which contained the TYH eDNA inserted between the Ndel and BamHI sites of pET3b was
named pETOHl. These DNA manipulations are pictured in Figure 1.
To substitute alanine for serine40, oligo-directed mutagenesis was performed on plas-
mid pTH6 to generate plasmid pTH6S40A. Introduction of the mutation into pETOHl was
performed by exchanging the Ndei-BamHI fragment of pTH6S40A for that of pETOHl, by
digesting the plasmids with the enzymes, isolating the correct fragments from agarose gels,
and ligating with T4 DNA ligase. Digestion with Hinjl provided the screen for S40A muta-
tion, and one positive plasmid was sequenced to insure that it did contain the mutation.
This vector was designated pETOH1S40A. These steps are shown in Figure 2.
Enzyme purification
A major advantage of isolation of TYH from E. coli is that enzyme is obtained in fully
unphosphorylated form without bound catecholamine; the S40A mutant serves also as non-
phosphorylatable enzyme. For purification of the enzyme from bacteria, competent cells of
the E. coli strain BL2l(DE3) pLysE were transformed with pETOHl or pETOH1S40A.
Luria-Bertani medium plus carbenicillin and chloramphenicol was inoculated with an
overnight culture. When the cells were well into logarithmic growth expression was in-
duced by addition of IPTG. After 2 hours cells were pelletted by centrifugation. Pellets
were lysed by sonication and TYH was purified using a protocol consisting of centrifuga-
tion, polyethyleneimine precipitation, ammonium sulfate precipitation, and heparin-
Sepharose chromatography. Tyrosine hydroxylase purified from PC12 cells was a gift from
Dr. R. Roskoski of the Louisiana State University. Tyrosine hydroxylase was assayed as
previously describeds with an assay which measures tritium release from 3,5-[3H]-tyrosine.
Effects of phosphorylation and catecholamine inhibition
To study the effects of phosphorylation two parameters had to be measured, the extent
of phosphorylation and its impact on activity. For incorporation of 32p into TYH by cAMP-
dependent protein kinase, the method of Roskoski et al. 8 was used. To determine the effect
of phosphorylation on enzyme activity, TYH was incubated with cAMP-dependent protein
kinase catalytic subunit (60-80 Jlg/ml final concentration), ATP (0.1 mM), and MgCb (10
mM) for various times before an aliquot (10-40 J,l.l) was added to the TYH assay mix.
To determine the effect of dopamine on the enzyme activity, TYH (6-10 J.!M) was in-
cubated for varying times in 50 mM HEPES-TEA, pH 7, at 30 °C in the presence or ab-
sence of an excess of dopamine. A 10 J,1.1 aliquot of this reaction mixture was then added to
assay mix containing 20 J.!M tyrosine and tetrahydrobiopterin. Controls established that the
small amounts of dopamine carried over into the assay mix (-50 nM) had no effect on the
observed initial rates.
To ensure that excess dopamine was not interfering with TYH activity after preincu-
bations of enzyme plus dopamine, the enzyme was separated from free dopamine on a col-
umn of Sephadex G-50. This chromatography was carried out in 50 mM Tris-HCl, 10%
glycerol, pH 7.0. Tyrosine hydroxylase (2-6 nmoles in 250 Jll) was incubated for 20 min-
utes at 20 °C with an excess of dopamine and applied to the Sephadex G-50 column.
Fractions were assayed for dopamine and for protein. Enzyme eluting from this column
was used in steady-state kinetic experiments after further incubation with cAMP-dependent
protein kinase with or without MgATP as described above.
90
sults are shown in Table 1. Both preparations exhibited the kinetic parameters expected of
phosphorylated enzyme. Remarkably, the S40A enzyme, serving as totally unphosphory-
lated enzyme, had a slightly lower KBH4 value (rather than the higher value predicted from
the literature) and a slightly lower Vmax value (Table 1). The KtYl: values were unaffected
by the mutation or by the expression system. No phosphate could be detected by direct
phosphate assay of enzymes expressed in E. coli. Wild-type TYH incorporated 0.9±o.2
moles [32P]-phosphate per mole monomer. No [32P]-phosphate was taken up by the S40A
enzyme exposed to the same phosphorylating conditions.
91
Table 3. Steady-State Kinetic Parameters of Recombinant and Nonrecombinant Tyrosine
Hydroxylase
REFERENCES
1. S. Kaufman and E. E. Kaufman, in Folates and Pterins, Vol. 2, Blakley, R. L. and Benkovic, S. ]., eds.,
John Wiley & Sons, New York (1985)
2. R. E. Zigmond, M.A. Schwarzschild, and A. R. Rittenhouse, Ann. Rev. Neurosci. 12:415 (1989)
3. K. K. Andersson, J. Haavik, L. Que, T. Flatmark, J. Thibault, and L. Petersson,J./norg. Biochem. 36:323
(1989)
4. J. Haavik, A. Martinez and T. Flatmark, FEBS Letts. 262:363 (1990)
5. P. F. Fitzpatrick, L. J. Chlumsky, S.C. Daubner, and K. L. O'Malley, J. Bioi. Chern. 265:2042 (1990)
6. T. A. Kunkel, J.D. Roberts, and R. A. Zakour, Methods Enzymol. 154:367 (1987)
7. F. W. Studier, A. H. Rosenberg, J. J. Dunn, and J. W. Dubendorff, Methods Enzymol. 185:60 (1990)
8. R. Roskoski, Jr., P.R. Vulliet, and D. B. Glass, J. Neurochem. 48:840 (1987)
92
GL YCERYL ETHER MONOOXYGENASE [EC 1.14.16.5]:
STOICHIOMETRY AND INHIBITION
Scheme 1
We investigated two aspects of the stoichiometry of the reaction viz: (i) the determination
of the ratio of the amount of 6-MePR4 oxidised to q-6-MePH2 in the direct assay with the
amount of NADH oxidised in the coupled reaction using DHPR and (ii) the determination
of the ratio of the amount of 6-MePR4 oxidised to q-6-MePH2 to the amount of batyl
alcohol consumed.
(i) For this study, 6-MePR4 oxidation was followed by the direct assay (Scheme
1) in order to obtain the initial rates of oxidation, and compared these with the initial rates
of conversion of NADH to NAD in a separate coupled reaction (Scheme 2). Catalase was
added to the reaction mixtures to minimise autoxidation of 6-MePR4. The rates are
summarised in Table 1. The data shows that at concentrations of 6-MePR4 below 0.1
mM, the stoichiometry of NADH consumed per 6-MePR4 oxidised was- 1 as expected
Abbreviations: DHPR = dihydropteridine reductase [EC 1.6.99.7]; 6-MePH4 =RS-6-methyl-5,6,7,8-
tetrahydropterin; q-6-MePHz = RS-6-methyl-7,8(6H)dihydropterin; Mega-10 = decanoyl N-methyl-N-glycamide;
lyso-P AF = 3-1' -hexadecyloxy-2-hydroxypropane-1-phosphocholine; DCIP = dichloroindophenol
',~OH ',~OH
"7
MONOOXYGENASE
o-...,.CH, ~ o- £~
02
.a-
6-MePH 4 q-6-MePH 2
NAD NADH
Scheme 2
from Scheme 2. It should be noted that the Km for 6-MePR4 is 138 J.l.M, and the Km for
batyl alcohol was 25 J.l.M.4 At concentrations of 6-MePR4 above 0.1 mM the ratio
decreases. One possibility for these results could be that DHPR in the coupled assay is
inhibited by the higher concentrations of 6-MePR4. This was tested by determining the
a In 0.1 M Tris-HCl buffer pH 7.5 and 25°C; RS-Batyl alcohol at 0.1 mM, per 0.5 mg of microsomal
protein. b Direct assay (Scheme 1) c Coupled assay with NADH at 100 J1.M (Scheme 2).
nitial rates of oxidation of NADH in the DHPR reaction using DCIP (two electron oxidant)
and K3Fe(CN)6 (one electron oxidant) in which increasing excesses of 6-MePR4 were
present in solution. Inhibition of DHPR was observed (Table 2) and may partly account
for the apparent decoupling of the reaction in Scheme 2. Another contributor to the
apparent decoupling at high concentrations of 6-MePR4 could be due to theE value for 6-
MePR4 used for determining the reaction extinction coefficient. In Table 1 (column 1)
94
the initial rates in the direct assay at 0.48 mM of
6-MePI4 gave a ratio of 0.83 when the E value of
3440 M-lcm-1 at pH 2.5 (4 mM HCl) was used.
If an E value of 3705 M-1cm-1 is used the ratio
becomes 0.89. The possibility of uncoupling
makes the assays that use NADH consumption in
a coupled reaction as a measure of
monooxygenase activity for comparing the
activity of cofactors or substrates unreliable (cfref
3 when 6-MePH4 was compared with 6,7-
DiMePf4).
(ii) In the second study the amounts of 6-
4 6 10 12 MePH4 oxidised in the direct assay at various
Time(min) time intervals were determined. The direct
Figure 1. Stoichiometry of 6-MePH4
reaction was then repeated using the same
oxidised and batyl alcohol consumed. conditions but with a-14C-batyl alcohol (3-
1'[14C]octadecyloxypropane-1,2-diol) as the
substrate. Aliquots were withdrawn from the mixture at time intervals, the reaction was
stopped with formic acid, and the solution was lyophilised. The residues were extracted
with CH2Ci2 and the lipids were separated on tlc plates [silica gel, with n-hexane, ethyl
ether, acetic acid (80:30:1) as eluant], and the Rpvalues of the radioactive lipid bands were
visualised by autoradiography. The various bands were collected, extracted with ethanol
and the radioactivity was determined by scintillation counting. The combined results are in
Figure 1. This Figure shows that during the first two minutes of the reaction the
stoichiometry of 6-MePI4 oxidised to the batyl alcohol consumed is one and confirms that
initial rates measured during the first two minutes are reliable for kinetic studies.
95
0.05
0.04
~:?
015 0.03
~i:l
~o
~'""
=to
=·- o.oz
=~
=::
~~
0.01
0.00 +-T"""T.....,.....,..-T"""''.....,.....,..-T""'I-r....
0.0 0.1 0.2 0.3 0.4 0.5 0.6 0.0 0.5 1.0
Mega-10 (%) Batyl alcohol (11 S) )lM-1
0.20
f
2
~
0.15
~ 0.10
=
~
Q 0.05
~
::;
0.00 0.05 0.10 0.15
0.0 0.1 0.2 0.3
Batyl alcohol (liS) !lM-1
lyso PAF (1/S) J.l.M-1
Figure 4 Monooxygenase inhibition by Figure 5 Monooxygenase inhibition
octadecanol: A= 0 mM, B = 0.10 mM, by Mega-10: A= 0 mM, B = 0.14 mM
C=0.30mM
REFERENCES
1. Teitz, A., Lindberg, M. & Kennedy, E.P. (1964) J.Biol.Chem. 239, 4081-4090
2. Armarego, W.L.F. & Kosar-Hashemi, B. (1990) Chemistry and Biology of Pteridines (Curtius,
H.Ch., Gisla, S. & Blau, N, eds) Walter de Gruyter pp. 620-623
3. Kotting, J., Unger, C. & Eibl, H. (1987) Lipids 22, 824-830
4. Armarego, W.L.F. & Kosar-Hashemi, B. (1992) Pteridines 3, 95-96
5. Kosar-Hashemi, B. & Armarego, W.L.F. (1993) Hoppe-Seyler, (in press)
6. Neugebauer, J.M.. (1990) Methods Enzymol. 182, 239-253
96
THE ISOLATION AND CHARACTERIZATION OF CLONES OF
4a-HYDROXYTETRAHYDROBIOPTERIN DEHYDRATASE
0.3
J
'tl
.!! 0.2
()
...l!!
0
0
0.1
2 4 6 8 10
Time (min)
Figure 2A. 4a-Carbinolamine dehydratase activity. Stimulation of phenylalanine hydroxylase-catalyzed
hydroxylation of phenylalanine with the addition (at arrow) of rat liver dehydratase, cloned DCoH, or the
GST-DCoH fusion protein. Neither the addition of glutathione alkyltransferase nor glutathione
alkyltransferase fusion protein with FK506-binding protein 12 stimulated this activity (data not shown).
99
0.3
0
}
0.2
0.1 +----...------.-~-----.-----,-----J
0 100 200 300 400
Time (sec)
Figure 28. 4a-Carbmolamme dehydratase acuvlty Effect of the DCoH (added at ~~w) on the UV
absorbance changes dunng OXIdation of tetrahydrob10ptenn by phenylalarune hydroxylase .
0
~
~ k<J
~ ~
c; c; cY (g
A B
- 50
- 33
- 28
20- -19
14-
6.1- -
Figure 3. Gel electrophoresis and 1mmunoblot analySIS of 4a-tetrahydrob1optenn dehydratase (CDH),
dlmenzauon cofactor (DCoH), and GST-DCoH fus1on protem. (A) Punfied dehydratase (3 Jl.g) stamed
w1th Coomass1e blue R-250. (B) lmmunoblots (16) of 7 IJ.g of dehydratase or DCoH and 20 IJ.g of GST-
DCoH fus10n protem. Dashes mdlcate the pos1Uons of molecular mass (kDa) markers. The molecular
mass of the dehydratase/DCoH 1s 12 kDa, and that of the fus10n protem IS 38 kDa.
100
The final test of the hypothesis that mild HPA patients who are characterized by the
excretion of elevated amounts of 7-biopterin suffer from a defective 4a-carbinolamine
dehydratase depends on the demonstration that such a patient does, in fact, have a defect in
the gene coding for the dehydratase.
We have recently isolated genomic DNA from such a patient, as well as from both
of his parents. An examination of the two alleles of the dehydratase revealed that both
alleles in the patient are defective; one is a premature termination mutation and the other is a
substitution mutation. The father had the wild-type and termination alleles and the mother
carried the wild-type and the substitution mutation (B. Citron, S.Kaufman, S. Milstien,
E.W. Naylor, C. Green and M.Davis, submitted for publication).
These findings confirm the hypothesis that a defect in the 4a-carbinolamine
dehydratase gene impairs the ability of BH 4 to function as a coenzyme for phenylalanine
hydroxylase and thereby leads to mild hyperphenylalaninemia. Together with previously
identified disorders in phenylalanine hydroxylase and dihydropteridine reductase, there are
now identified genetic deficiences in the three enzymes involved in the phenylalanine
hydroxylation system.
It is of interest that the patient that we have studied shows no signs of impaired
catecholamine or serotonin metabolism, a result that is coherent with the finding that these
patien<V' have been reported to have normal levels of biogenic amines in their cerebral spinal
fluid2 . These findings are consistent with results of our studies of the tissue distribution
of the dehydratase in the rat, which showed that except for the pineal gland, the level of
dehydratase is low in tissues that contain high levels of tyrosine and tryptophan
hydroxylase activity. Based on these results, we concluded that if the tissue distribution of
the dehydratase in humans is the same as in the rat, then this enzyme may not play an
important role in the regulation of the synthesis of those neurotransmitters that are derived
from the hydroxylated amino acids 16•
Finally, the demonstration that genetic defects in the dehydratase gene exisf when
considered together with our finding that this enzyme is the same as DCoH, 1 which
together with HNFl- a. is involved in the regulation of transcription, raises questions about
whether any biochemical and physiological processes regulated by the DCoHIHNFl-a.
complex are impaired in these patients.
Table llists some of the genes that are regulated by the DCoH/HNFl-a. system.
As can be seen, some of these regulated gene products function in such diverse processes
as blood clotting, glycolysis and gluconeogenesis. Our results, therefore, should serve to
focus attention on these physiological functions in this subset of HPA patients to ascertain
whether they are within the normal range during the neonatal period and remain in this
range during development. If these processes prove to be normal in our
hyperphenylalaninemic patients, it would suggest that the mutant dehydratase with an
amino acid substitution may still be sufficiently active in its HNF-1 a. binding role, even
though it is devoid of dehydratase activity.
Although it is conceivable that the dimerization cofactor activity of the dehydratase
involves its dehydratase enzymatic activity, it is probably more likely that this represents
another example of two disparate activities being carried on the same polypeptide chain.
101
REFERENCES
1. S. Kaufman, Proc. Natl. Acad. Sci. USA 50:1085-1093 (1963).
2. S. Kaufman."Chemistry and Biology ofPteridines," Walter de Gruyter, Berlin (1975) pp. 291-304.
3. S. Kaufman, and D.B. Fisher. "Molecular Mechanisms of Oxygen Activation," Academic Press, New
York (1974) pp. 285-369.
4. R.A. Lazarus, S.J. Benkovic, and S. Kaufman, J. Bioi. Chem. 258:10960-10962 (1983).
5. C.Y. Huang, E. E. Max, and S. Kaufman, J. Bioi. Chem. 248:4235-4241 (1973).
6. J. E. Craine, E. S. Hall, and S. Kaufman, J. Bioi. Chem. 247:6082-6091 (1972).
7. S. Kaufman,!. Bioi. Chem. 245:4751-4759 (1970).
8. S. Kaufman. "Iron and Copper Proteins, Advances in Experimental Medicine and Biology," Plenum
Press, New York (1976) pp. 91-102.
9. S. Kaufman. "Phenylketonuria and Allied Metabolic Diseases," U.S. Govt. Printing Office, Washington
D.C. (1967) pp. 205-213.
10. S. Kaufman. "Advances in Human Genetics," Plenum Press, New York (1983) pp. 217-297.
11. N. Blau, H-Ch. Curtius, T. Kuster, A. Matasovic, G. Schoedon, JL. Dhondt, T. Guibaud and M..
Blascovics, J. Inherited. Metab. Dis. 12:335-338 (1989).
12. H-Ch. Curtius, C. Adler, I. Rebrin, C. Heizmann, and S. Ghisla, Biochem. Biophys. Res. Commun.
172:1060-1066 (1990).
13. M.D. Davis, S. Kaufman, and S. Milstien, Proc. Natl. Acad. Sci. USA 88:385-389 (1991).
14. M.D. Davis, and S. Kaufman, FEBS Lett. 285:17-20 (1991).
15. M.D. Davis, P. Ribeiro, J. Tipper, and S. Kaufman, Proc. Natl. Acad. Sci. USA 89:10109-10113
(1992).
16. M.D. Davis, S. Kaufman, and S. Milstien, FEBS Lett. 302:73-76 (1992)
17. B. A. Citron, M.D. Davis, S. Milstien, J. Gutierrez, D. B. Mendel, G. R. Crabttee, and S. Kaufman,
Proc. Natl. Acad. Sci. USA 89:11891-11894 (1992).
18. D. B. Mendel, P.A. Khavari, P. B. Conley, M. K. Graves, L. P. Hansen, A. Admon, and G.R. Crabttee,
Science 254:1762-1767 (1991).
19. C. Y. Huang, and S. Kaufman, J. Bioi. Chem. 248:4242-4251 (1973).
20. N. Blau, L. Kierat, H-Ch. Curtius, M. Blaskovics, and T. Giudici, !.Inherit. Metab. Dis. 15:409-442
(1992).
102
MOLECULAR CLONING AND RECOMBINANT EXPRESSION OF THE
HUMAN LIVER PHENYLALANINE HYDROXYLASE STIMULATING FACTOR
REVEALED STRUCTURAL AND FUNCTIONAL IDENTITY TO THE
DIMERIZATION COFACTOR FOR THE NUCLEAR TRANSCRIPTION
FACTOR HNF-la
INTRODUCTION
Standard PCR was performed using rat liver eDNA as a template and the
oligonucleotides PCDH4 (5'-CGGAA TTCGGC(TCGA)GT(TCGA)GG(TCGA)TGGAA
(TC)GA-3') and PCDH5 (5'-CGGGATCCTT(AG)TA(TCGA)AC(AG)TT(AG)AACCA
(TC)TC-3') to amplify the intervening region between amino acid 21 and 70 of the PHS
sequence (Fig. 3 in ref. 7). The resulting fragment of 150 bp was confirmed to be coding
104
"(:> "(:>
-$. -$ ~
\ ' \X 0
~'-> ~'-> ~c;
~~~ ~~~ q,x;~' M kD
A
'"'"" 120
B PHS/DCoH
......
-..
0 IK)
E
2:
Q)
&J
..
66 c:
(ii
45
31
...>-
0 40
--
t-
-
21.5 a>
......
pGEMEX
14.4
6.5 0
0 a:xl 400 roo eoo 1000 1200
2 3 4 Protein (ng)
Figure 1. Recombinant expression of PHS/DCoH and stimulation of tyrosine production by the addition of
PHS/DCoH to PAH. (A) Silver-stained SDS-polyacrylamide gel containing 400 ng crude extract from E. coli
cells harboring the plasmid pHDH5 not induced with IPTG (lane I) or IPTG-induced (lane 2), and 300 ng
purified PHS/DCoH from human liver (lane 3). Lane 4 contains the marker proteins. The dash indicates the
11.9 kDa PHS/DCoH. (B) The activity of the purified human liver PHS/DCoH is compared to the crude
protein extracts from E. coil cells harboring the expression vector with the human eDNA (pHDH5) or the
expression vector alone (pGE.MEX).
purified human liver enzyme. The reaction was strictly dependent on the addition of the
cofactor BI4 and the DHPR, the enzyme that reduces the q-BH2 to BI4 (data not shown).
In a more direct assay, we followed the formation of 4a-CA and q-BH2 during
phenylalanine hydroxylation in the presence of the purified PHS/DCoH compared to the
crude E. coli extract containing the recombinantly expressed protein (Fig. 2). At distinct
wavelengths, we followed directly the educt 4a-CA (at 244 nm) and the product q-BH2 (at
334 nm). Control experiments showed that, depending on the amount of PHS/DCoH
added, part of the accumulated 4a-CA is converted immediately, as reflected by the
decrease in absorption. At the same time, the product q-BH2 increases. This effect can be
observed when using either the purified human liver protein, or the recombinant
PHS/DCoH expressed in E. coli.
Thus, because the enzyme produced in E. coli has the same characteristics as those
described for the authentic human liver enzyme, the recombinant protein appears to be
identical and does not need any specific accessory functions. In addition, these results
clearly demonstrate that the nuclear protein required for dimerization of HNF-la, DCoH,
is identical to the cytosolic stimulatory factor for PAH. Whether primapterinuric patients
harbor a defect in PHS/DCoH, i.e. in 4a-CA dehydratase activity, as it is postulated,
remains to be clarified.
ACKNOWLEDGMENTS
We are grateful to Dr. I. Rebrin for the gift of purified PHS/DCoH and PAH. This
work was supported by a grant from the Swiss National Science Foundation (No. 31-
33897 .92), and in part by the Helmut Horten Stiftung, Stiftung fiir wissenschaftliche
Forschung an der Universitat Zurich, and Ciba-Geigy-Jubilaums-Stiftung.
105
0.08
0.12
A B PHS/DCoH
E E
c c
~ 0.08
v
C')
C\1
...
C') 0.04
1ii 1ii
0 0.3j.lg 3119 0
0 0 .04 0
PHS/DCoH
0 0
0 20 40 80 80 100 120 0 20 40 60 80 100 120
Time (seconds) Time (seconds)
....... ........
0.4 0.08
c pGEMEX
D
E E
c c 35#lg Fr. I pHDHS
v pHDHS v
v C')
C\1 0.2 C') 0.04
a; 1ii
0 0 pGEMEX
0 0
35#lg Fr.!
0 0
0 20 40 60 80 100 120 0 20 40 60 80 100 120
Figure 2. Formation of 4a-CA and q-BH2 during phenylalanine hydroxylation in the presence of
PHS/DCoH. Parallel detection of 4a-CA (A, C) and q-BH2 (B, D) was performed by following the
absorption at 244 nm and 334 nm, respectively. At the indicated time points (arrows) PHS/DCoH was added
either as purified human liver enzyme (A, B; dotted line: no protein added; dashed line: 0.3 Jlg PHS/DCoH
added; solid line: 3 Jlg PHS/DCoH added), or as a crude protein fraction (35 Jlg Fr. I) from E. coli (C, D;
dotted line: crude fraction harboring pGEMEX alone; solid line: crude fraction harboring pHDH5). The
addition of E. coli crude protein fraction itself in panel C resulted in a nonspecific increase of absorption at
244 nm.
REFERENCES
1. C.R. Scriver, S. Kaufman and S.L.C. Woo, The hyperphenylalaninemias, in: "The Metabolic Basis of
Inherited Disease," C.R. Scriver, A.L. Beaudet, W.S . Sly and D. Valle, eds., McGraw-Hill, New York
(1989).
2. R.A. Lazarus, S.J. Benkovic and S. Kaufman, J. Bioi. Chem. 258:10960 (1983).
3. F.K. Trefz, U. Lichter-Konecki and D. Konecki, Current Opinion in Pediatrics. 1:421 (1989).
4. N. Blau, H.-Ch. Curtius, T. Kuster, A. Matasovic, G.Schoedon, L. Dhondt, P. Guibaud, T. Giudici and M.
Blaskovics, J. lnher. Metab. Dis. 2:335 (1989).
5. N. Blau, L. Kierat, H.-Ch. Curtius, M. Blaskovics and T. Giudici, J. Inher. Metab. Dis. 15:409 (1992).
6. D.B. Mendel, P.A. Kahavari, P.B. Conley, M.K. Graves, L.P. Hansen, A. Admon and G. Crabtree,
Science. 254:1762 (1991).
7. C.R. Hauer, I. Rebrin, B. ThOny, F. Neuheiser, H.-Ch. Curtius, P. Hunziker, N. Blau, S. Ghisla and C.W.
Heizmann, J. Bioi. Chem. 268:4828 (1993).
8. B.A. Citron, M.D.Davis, S. Milstien,J. Gutierrez, D.B. Mendel, G.R. Crabtree and S. Kaufman, Proc.
Nat/. Acad. Sci. USA. 89:11891 (1992).
9. J. Sambrook, E.F. Fritsch and T. Maniatis. "Molecular Cloning: A Laboratory Manual," Cold Spring
Harbor, New York (1989)
10. C.Y. Huang, E.E. Max and S. Kaufman, J. Bioi. Chem. 248:4235 (1973).
106
PROGRESS IN THE STUDY OF BIOSYNTHESIS AND ROLE OF 7-SUBSTITUTED
PTERINS: FUNCTION OF PTERIN-4a-CARBINOLAMINE DEHYDRATASE
INTRODUCTION
DHPR
Tetrahydrobiopterin • I quinonoid -Dihydrobiopterin
Phe, 02 ~ NADH PC~ H:P
rvr ·4~:c~~bi~~i~~~~~·
~ t
~ t
Spiro-Compound
~ rearrangement
~
Primapterin
(L-7-Biopterin)
TABLE 1
Activity of phenylalanine hydroxylase and pterin-4a-carbinolamine dehydratase (in ).lmol
tyrosine/min/ g tissue).
Activity of PAH and PCDH were measured as described in (6) and (9).
108
TABLE 2
Quantity of phenylalanine hydroxylase and pterin-4a-carbinoamnine dehydratase (in
mg/ g tissue).
The two tables show, that the PCDH content of the tissues is about one fourth
of the amount of PAH. But when the enzyme activities are compared, they are twice as
high for PCDH compared to PAH. These findings allow the hypothesis, that PCDH is
not only involved in the aromatic amino acid hydroxylation but also acts in the cata-
lysis or regulation of other biochemical processes. The findings of Davis et a!. (9) that
the distribution of PCDH in rat tissues is not related to the distribution of TH and
TPH is in favour of this hypothesis. Most importantly, it has been shown by Hauer et
a!. (10) as well as by Citron et a!. (11) that PCDH is identical with a dimerization
cofactor of hepatocyte nuclear transcription factor HNF -1 a.
109
the effect of 7-BH4 on the other two mamalian aromatic amino acid hydroxylases
indicated that 7-BH4 is a weak competitive inhibitor and a poor substitute for the
natural cofactor in both hydroxylation reactions.
We have investigated this question using purified TPH isolated from mouse
mastoma cells. We found a Ki value of approx. 225 ).lM compared to Davis et a!. (5)
who found a Ki value about 15 times higher (3,3 mM) in the crude extract from rabit
brain. In contrast to the experiments of Davis et a!., we have used purified enzyme
from a different source, using Hasegawa's procedure.
As previously mentioned, we have also found that NH4 is converted to the
corresponding 7-isomer and serves as cofactor in the PAH reaction in vitro. The de-
tection of 7-N in the urine of patients and controls requires that NH2 is reduced in
vivo to its tetrahydroform by DHFR and subsequently acts as cofactor of the pteridine
dependent hydroxylases. It could be shown by our group and others that in vitro NH4
can act as cofactor for the PAH reaction, however, the co-factor activity is only 20%
compared to that of BH4.
The concentration of 7-iso-N in urine is very low but on the other hand NH4
is very unstable due to cleavage of the side chain which is not the case with NH2 or
neopterin (N).
Thus, upon in vitro incubation of D-NH2 with DHFR and NADPH at pH 7.4
the formation of D-NH4 was clearly demonstrated.
This result and the finding of ?-substituted N in patients with atypical PKU but
also in normal individuals, is an indirect but clearcut evidence that D-NH4 acts as
cofactor of pterin dependent aromatic amino acid hydroxylases also in vivo. In our
opinion this is the only possible rationalization for the finding of 7-N both in the
patients and in normal controls. It is very unlikely that in vivo the formation of 7-N
is based on an other yet unknown mechanism.
Attempts to detect NH4 in the body cells by HPLC with EC detection have not
been successful up to date.
REFERENCES
(1) Curtius, H.-Ch., Kuster, T., Matasovic, A., Blau, N. and Dhont, J.-L. (1988)
Biochem. Biophys. Res. Commun. 153, 715.
(2) Dhont, J.-L., Guibaud, P., Rolland, M.O., Dorche, C., Andre, S., Forzy, G.
and Hayte, J.M. (1988) Eur. J. Pediatr. 147, 153.
(3) Blaskovics, M. and Giudici, T.A. (1988) New Eng. J. Med. 319, 1611.
(4) Curtius, H.-Ch., et a!. (1990) Biochem. Biophys. Res. Commun. 172, 1060.
(5) Davis, M.D., Kaufmann, S. and Milstein S. (1991) Proc. Natl. Acad. Sci. 88,
385.
(6) Adler, C., Ghisla, S., Rebrin, J., Haavik, J., Heizmann, C.W., Blau, N.,
Kuster, T. and Curtius, H.-Ch. (1992) Eur. J. Biochem, 208, 139-144.
(7) Hasegawa, H. and Ichinyama, A. (1987) "Methods in Enzymology" vol. 142, ed.
S. Kaufmann, Academic Press, Orlando, pp. 88 - 93.
(8) Fujisawa, H. and Nakata, H. (1987) "Methods in Enzymology" vol. 142, ed.
S. Kaufmann, Academic Press, Orlando, pp. 93 - 96.
(9) Davis, M.D., Kaufmann, S. and Milstien, S. (1992) FEBS Lett. 302, 73- 76.
(10) Hauer, C.R., Rebrin, J., ThOny, B., Neuheiser, F., Curtius, H.-Ch., Hunziker,
P., Blau, N., Ghisla, S. and Heizmann, C.W. (1993) J. Bioi. Chern. 268.
( 11) Citron, B.A., Davis, M.D., Milstien, S., Gutierrez, J., Mendel, D.B., Crabtree,
G.R. and Kaufmann, S. (1992) Proc. Natl. Acad. Sci. U.S.A. 89: 11891.
110
SPECTROSCOPIC CHARACTERIZATION OF HUMAN LIVER PTERIN
4a-CARBINOLAMINE DEHYDRATASE
INTRODUCTION
The P AH and PCD were purified to homogenity from human livers of kidney
transplantation donors bathe method reported (6). The 6(R)-BH4 was from Dr. B.Shirks
Laboratory (Jona, Switzerland). Fluorescence spectra were measured with a corrected
spectrofluorometer Shimadzu RF5001PC, slit width used was 3 nm for excitation and
emission. Molar concentrations of native enzymes were expressed in terms of the tetramer
(Mr 45000) for PCD and of monomer (Mr 50000) for PAH. All buffers were filtered,
degassed and saturated with nitrogen before use.
RESULTS
results in a peak with emission maximum at 225 nm. When enzyme was incubated in 0.1 M
Tris/HCl buffer, pH 8.4, the maximum wavelength shifted toward longer wavelength by 9
nm, without change in the intensity. On the other hand the fluorescence intensity decreased
by 60% with the emission maximum wavelength at 334 nm, upon addition of 40 pM BH4 to
native enzyme (Figure 1). A comparison of two difference spectra calculated by substracting
the initial fluorescence and those after incubation with BH4 shows that the resulting two
difference spectra are similar, although at pH of 8.4, a larger change in intensity is observed
as at pH of 6.8. The titration of native PCD with BH4 exhibits positive cooperativity (nH
1.5), with half maximal effect at about 12 .uM. Excitation spectra of tryptophan monitored
at various emission wavelengths shows maximum intensity at 280-285 nm, which are identical
with wavelength of the maximum absorption of 282 nm (data not shown). The intensity ratio
of the excitation spectrum at 280 nm to that at 300 nm varied and decreased as the emission
wavelength monitored was changed from a shorter to a longer one (Figure 2), which
suggests that two tryptophans are in different environments. The values of the intensity ratio
decreased when dehydratase is pre incubated with BH4, which implies that the absorption
band with longer emission peak also shifted to longer wavelength upon incubation.
112
8~----------------------------~
... ...
...
6
0
i= +
<!: + + +
a: ...
~ +
U) +
z ...
w ...
1- +
z 4
+
...
...
I I I I
300 320 340 360 380
EMISSION WAVELENGTH (nm)
Figure 2. Intensity ratios of excitation spectra at 280 nm to those at 300 nm. Intensity ratios were obtained from
excitation spectra of PCD in the absence ( +) and in the presence of 20 pM tetrahydrobiopterin (A). Corrected
excitation spectra were measured by changing the emission wavelength monitored : 310, 320, 330, 340, 350, 360,
370 and 380 nm.
We have inspect the effect of PCD on intrinsic fluorescence spectra of the PAH. We have
found that pre incubation of PAH with PCD at molar ratio of 10:1 is accompaned by a
change in the fluorescence emission spectrum of hydroxylase (spectra not shown). The
corrected emission spectrum of PAH upon incubation with PCD exhibits a three distinct
peaks, with maximum at 338 nm (major peak), at 325 nm and 350 nm (minor peaks or
shoulders) which have different relative fluorescence quantum yields (Table 1).
DISCUSSION
Our results provide the first direct evidence for different conformational states of PCD.
The red shift in the fluorescence emission spectrum of the dehydratase at high pH or in the
presence of BH4 demonstrates that buried tryptophan residues ( >-em=325 nm) in
hydrophobic interior become some exposed to solution. The single emission peak of native
enzyme at pH 8.4 with maximum at 334 nm can be due one tryptophan residue (.\em =330
nm) which buried in the protein interior (not exposed to solvent) and second (.\em =340 nm
) which is partially exposed to solvent (8). Measurements of fluorescence excitation spectra
confirmed that the two tZsPtophan residues exists in the different microenvironment. The
estimated Kd of about 10· M for binding of BH4 suggest on lower affinity of dehydratase
to cofactor in comparison with PAH (9).
113
Table 1. Relative fluorescence quantum yieldsa of PAH, effect of incubation with PCD.
tryptophan
fluorescence
REFERENCES
1. S.Kaufman, in:"Amino acid in Health and Disease", S.Kaufman, ed., Alan R.Liss, New York (1987).
2. C.Y. Huang, E.E. Max, and S.Kaufman, J.Biol.Chem.248: 4235-4251 (1973).
3. RA. Lazarus, S.J. Bencovic, and S.Kaufman, J.Biol.Chem. 258: 10960 (1983).
4. H.Ch. Curtius, A. Matasovic, G.Schoedon, T.Kuster, P.Guibaud, T.Guidici, and N.Biau, J.Biol.Chem. 265:
3923 (1990).
5. H.Ch. Curtius, CAdler, I. Rebrin, C. Heizmann, and S. Ghisla, Biochem.Biophys.Res.Commun. 172: 1060
(1990).
6. I. Rebrin, L.Petruschka, H.Ch. Curtius, CAdler, and F.H.Herrman, Pteridines 3: 55 (1992).
7. C.R. Hauer, I.Rebrin, B.Thony, F.Neuheiser, H.Ch.Curtius, P.Hunziker, N.Blau, S.Ghisla,and C.W.Heizmann,
J.Biol.Chem. 268:(1993).
8. EA. Burstein, N.S. Vedenkina, and M.N. Irkova, Photochem.Photobiol. 18: 263(1983).
9. R.S. Philips, MA.Parniak, and S.Kaufman, Biochemistry 23: 3836 (1984).
10. MA. Parniak, M.D.Davis, and S.Kaufman, J.Bioi.Chem. 263: 1223 (1988).
114
IS DffiYDROPTERIDINE REDUCTASE AN ANOMALOUS DffiYDROFOLATE
DEHYDROGENASE?
INTRODUCTION
COOH COOH
Figure 1: The biosynthetic reductive pathways converting qBH2 and 7,8-FH2 to BH4 and FH4
respectively.
clearly enhanced specificity for NADH4 which contrasts with the preference for NADPH
exhibited by DHFR. 3 The specificity for the dihydropteridine substrate also differs.
Although a quinonoid dihydrofolate can be generated that can be a substrate for DHPR,
the quinonoid form cannot be a substrate for DHFR nor can the 7,8-dihydroform be a
substrate for DHPR. This is really not surprising as the ground state distribution of
electron density around the two dihydropteridine rings is distinctly different (J. Gready,
personal communication) and would suggest a priori an altered receptor site might be
necessary for reactivity. Moreover, the specific activities of the two enzymes are ver~
different (approx. 300 and 25 units/mg protein for DHPR2 and DHFR,
respectively) suggesting both a different mechanism and site of reaction for the two
enzymes. This is further substantiated by the clear lack of affinity exhibited by DHPR
Table 1
Comparative Properties of Dihydropteridine
Reductase and Dihydrofolate Reductase
116
for the oxidised dinucleotide product of reaction, NAn+, 6 which is a very different
situation to that of DHFR, where NADP+ has been identified as a participant in the
kinetic turnover of the enzyme7 and has also been used in the generation of ternary
complexes that have sufficient stability to be examined by X-ray crystallography. 8 Other
experimentally observed differences would include a single pH optimum for DHPR4
compared to the two for DHFR, 3 the hydrophobic nature of DHPR, exhibited by its
binding to phenyl sepharose, 9 and the lack of unique titratable amino acids which can
cause abrupt changes in specific activity .10 This contrasts markedly with the
characteristic enhancement of eukaryotic DHFR specific activity when this enzyme is
titrated with mercury salts. 3 Moreover, there is no sequence correlation between the two
enzymes.2,3
DHPR
DHFR
Figure 2: Comparison of the backbone folding of DHPR with DHFR. The a-helices are
represented as cylinders, and the B-sheets are represented as triangles.
Both enzymes have now been crystallised 11,8 with resolution - 2.0 A and
comparison of the two structures illustrated diagrammatically in Figure 2 shows a
distinct change in format between the two proteins. Each structure contains eight B-
sheets with seven parallel and one antiparallel, however, DHPR has a higher a-helical
content with helices E and F forming the interface of the dimeric active enzyme. Of
greater significance is the arrangement of the dinucleotide cofactor on the protein matrix.
With DHFR the nicotinamide component is close to the N-terminal with the adenine
sector buried in the body of the enzyme whereas with DHPR the reverse is true, as the
adenine is close to the N-terminal and the nicotinamide is closer to B-sheets E and F and
a-helix G where it is poised to participate at the enzymatic active site. Moreover, theN-
117
Figure 3: Stereoview of the active site of DHPR showing a possible binding mode for qBH 2
and amino acids pertinent to the binding site and mechanism of action.
terminal region of DHPR has a classic Rossman fold12 suggesting similarities between it
and lactate dehydrogenasel3 rather than the folate reductases. In addition DHFR differs
insofar as it contains two sites, one for dinucleotide and one for folate. In the case of the
Escherichia coli enzyme the amino acids Asp 27, Phe 31 and Arg 57 play major roles in
folate binding. However, with DHPR the active site for pteridine binding does not
appear to exist until NADH is bound to the protein. The site is then created from the
connecting regions between fin and fip and the crossover that occurs between fiE and
fia. Thus rather than having a separate binding domain for substrate such as is observed
with lactate dehydrogenase or folate reductase, DHPR uses a strategy of simply
elaborating connecting loops to facilitate substrate binding that is intimately connected to
a requirement for prior NADH interaction.
Figure 4: Differing possible NADH-mediated reductive routes for qBH2 when bound to DHPR.
(R = -CH-CH-CH3).
OHOH
118
The generally accepted mechanism for the reduction of 7 ,8-dihydrofolate by
NADPH and DHFR necessitates the reduced nicotinamide ring be aligned and
sufficiently close to the C6 position of the folate molecule - 3 A) such that hydride
transfer might occur followed by a proton transfer from solvent to the N5 position to
give the fully reduced pteridine molecule. This concept has been supported by a wealth
of kinetic data3 and more recently by definitive molecular structures derived for ternary
complexes from high resolution crystallographic studies of DHFR. 8 The situation with
DHPR is somewhat different. The quinonoid structure of the substrate pteridine has
distinct similarities to that of the flavin molecule and thus mechanisms of reduction such
DHPR 125 G G L L T L A G A K A A L D G T P G M I G Y G M A K --
PGDH 130 G G I I I N M S S L A G L M P V A Q Q P V Y C A S K --
17,8DH 134 S G R V L V T G S V G G L M G L P F N D V Y C A S K --
DADH 131 G G I I C N I G S V T G F N A I Y Q V P V Y S G T K --
20,8DH 131 G G S I V N I S S A A G L M G L A L T S S Y G A S K --
Figure 5: Alignment of common selected regions of five short chain dehydrogenases. Strictly
conserved residues are outlined. Residue numbers at the start of each line refer to each sequence
and those above to the rat liver DHPR. Abbreviations are: DHPR, rat liver dihydropteridine
reductase; PGDH, human 15-hydroxyprostaglandin dehydrogenase; 176DH, human 176-
hydroxysteroid dehydrogenase; DADH, Drosophila melanogaster alcohol dehydrogenase and
206DH, Streptomyces hydrogenans 20 6-hydroxysteroid dehydrogenase.
119
the exocyclic and endocyclic isomeric forms of the quinonoid dihydropteridines19
therefore a priori it is difficult to assign a certain course of reductive action.
Nevertheless, specific features of the DHPR active site containing a "docked" qBH2
suggest a course of reaction in which the Tyr 146 XXX Lys 150 motif participates in
proton donation. A structure can be realised in which the hydroxyl substituent of Tyr
146 is within 3 A of the 4-oxo group on the pteridine, hence direct protonation could
occur. However, more recent high resolution X-ray structures suggest a water molecule
is situated such that proton donation could be translocated to N3 of the pteridine. Both
the lysine E-amino groups and tyrosine hydroxyl groups have pKs - 10, thus it is
possible that a protonated Lys 150 influences Tyr 146 sufficiently so that it or the
adjacent water molecule is the source of the compensatory proton. Compelling
supportive evidence stems from the observation that a Lys 150 Gin mutant has a specific
activity of only 50 units/mg protein compared to - 300 units/mg for the natural enzyme
and that a Tyr 146 Phe mutant has virtually no activity, yet has an equally strong affinity
for NADH as the wild-type enzyme, and also responds to the rat DHPR polyclonal
antibody. However, Lys 150 is also close to the nicotinamide ribose hydroxyl groups
(Figure 3) therefore an additional or alternate function of this amino acid could be to aid
in the correct orientation of NADH relative to substrate. Such issues have yet to be
clarified.
It has been reported that the Tyr XXX Lys pattern is present throughout a diverse
group of enzymes classified as the short chain dehydrogenases1 (Figure 5).
Each has a binding domain for a dinucleotide cofactor and each has a second
domain containing the sequences outlined in the figure. In every case, and more than
twenty examples are now known, the Tyr XXX Lys motif appears essential for
enzymatic activity. One other crystal structure has been reported, that of 20J3DH20 and
here again it is suggested that the tyrosine participates in proton donation via linked
water molecules. 21
CONCLUSION
ACKNOWLEDGEMENT
This investigation was supported by grants from NIH: CA11778 (TSRI), RR01644
(UCSD); NSF: DIR88-22385 (UCSD) and the Markey Foundation (UCSD).
120
REFERENCES
121
TWO CRYSTAL STRUCTURES OF RAT LIVER DYHYDROPTERIDINE
REDUCTASE
INTRODUCTION
All the studies described here were carried out using rat liver enzyme which was
purified using the procedures reported earlier1. DHPR crystallizes in a monoclinic and an
orthorhombic form. The first form to be grown was monoclinic 2 and it was obtained using
PEG as a precipitant at pH 7.8 by hanging drop methods. The orthorhombic form was also
crystallized under the same conditions3 and the crystal data for the two forrhs are given
below.
Orthorhombic: a= 50.10 A, b = 139.13 A, c = 64.93 A, Space group C222 1.
Monoclinic: a= 222.2 A, b = 46.5 A, c = 94.3 A, p= 100.1°, Space group C2.
The geometry of the DHPR molecule is the same in both the crystal fonns. It is an
alP protein with a central P-sheet and a-helices on either sides as is seen in figure 1.
Figure 1. A backbone drawing of the DHPR dimer. The N and C-terminals of one of the
monomers are marked by the residue numbers 5 and 240 respectively.
A number of hydrophobic residues from each protomer come together at the dimer inter-
face to form the hydrophobic core and these hydrophobic interactions are a major stabiliz-
ing force for the dimer. Even though the molecular geometry is very similar in both crystal
fonns, the crystal packing is different in the two forms. The orthorhombic form is more
closely packed and it appears that the active site is less accessible due to crystal contacts.
The packing of the two forms are depicted in Figure 2.
124
a
Figure 2. The packing diagrams for the orthorhombic (a) and monoclinic (b) crystal
forms. A solvent channel is formed parallel to the b-axis in the monoclinic form and it
makes the active site more accessible for substrate diffusion. The active site of DHPR is
only a surface channel and not a deep pocket. Figure 3 shows the active site of the
molecule.
Figure 3. A stereoview of a model of the ternary complex. Residues Trp86, Tyr 146 and
Lys150 are numbered. These residues appear to play key roles in the enzyme mechan-
ism(9).
125
ACKNOWLEDGEMENT
This investigation was supported by Grant RR01644 (UCSD) from the National Institutes
of Health, Grant DIR88-22385 from the National Science Foundation (UCSD), the Lucille
P. Markey Foundation (UCSD), and Grant CA11778 from NIH (TRSI).
REFERENCES
1. S. Webber and J. M. Whiteley, Chemistry and Biology of Pteridines (Kisliuk, R.L. and
Brown, G.M. eds) Elsevier/North Holland, Amsterdam pp.211-214 (1978)
126
NEW INHIBITORS OF
DIHYDROPTERIDINE REDUCTASE (HUMAN BRAIN)
The dihydropteridine reductase (DHPR) gene from rat liver has recently been clonedl
and the protein that was expressed from the eDNA was crystallised as the binary DHPR-
NADH complex. 2 The X-ray structure of the enzyme was determined and although the exact
location of NADH in the enzyme was determined in the binary complex, the precise position
of the pteridine cofactor was not obtained and had to be deduced from known kinetic data of
various pteridine cofactor analogues. 2 In order to obtain the precise position of the pteridine
cofactor it is necessary to crystallise the ternary complex ofDHPR, NADH and an inhibitor
whose structure is so close to that of a viable cofactor (eg 1) that it would bind at the active
site in the same manner as the pterin.
H2N
J~NtM•N N
1 H
[1] [2a] R = SMe
[2b] R = SCHzC6Hs
[2c] R = SCHz C6H4COzH(p)
[2d] R = NH2
[2e] R = OH
[2f] R = Me
Several inhibitors of sheep, rat and beef dihydropteridine reductases (DHPR) were
described more than a decade ago. These include methotrexate,3 aminopterin,4
amethopterin,5 folic acid6 and 6,7-dimethylpterin4,6 which were studied because they
inhibited dihydrofolate reductase (DHFR) which catalyses an apparently similar reaction, i.e.
the reduction of a dihydropterin [7 ,8(3H)-dihydrofolic acid] using a reduced pyridine
nucleotide cofactor (NADPH). These inhibitors were believed to bind at the pteridine domain
of the reductase. Other inhibitors of DHPR were Blue Dextran, Cibacron Blue F3GA and p-
0 0
r Me 3 :rN-~.:.C1 =NH
A A
HN H2N-N-C =NH. HX HN
Br + 1 2 ! .. R HX
H2N N O [ 4a] R = SMe, X Br= HzN ~N O •
[4b] R = SCH2 Ph, X = Br
[3] [4c] R = SCH2C6H4·P· C02H [S]
X= Br
[4d] R = NH2, X= Br [2 a-d,f]
[4e] R=Me,X=CI
SCHEME 1
0 1 0
N~N;wM• HN~N:N>
HN
~N
2
.. N
~R
HzN
~N '?..
N 3 R
128
At first we thought that the products of the reaction were the intermediates [5] but ionization
data (Table 1), the stability of the free bases, 13C nmr chemical shifts and uv spectrall
confirmed that the products of these reactions are pyrimido[4,5-e][l,2,4]triazin-8-ones [2].
The ionization data are consistent with resonance stabilised cations (Scheme 2) but more
SCHEME2
important show that at the pH of the enzymic reaction (7 .4) these compounds are non-ionic
except for the dioxo compound [2e]. The open structures [5] would have pKa values above
9 in order to be consistent with an amidinium cation.12
a The substrate was quinonoid 6-methyl-7,8-dihydro(6H)pterin [1], values in chain brackets are from
alternative computations. b Using a single beam spectrophotometer. c Using a double beam
spectrophotometer.
129
All the pyrimidotriazinones inhibit human DHPR and the inhibition constants were
determined by measuring the rates at various concentrations of quinonoid 6-methyl-
7,8(6H)dihydopterin [1] and various concentrations of the triazinones [2 a-f]. The rate data
were computed for the different types of inhibition and the constants in Table 2 were those
which gave inhibition constants with the smallest error values. All the data fitted reasonably
well for competitive inhibition as we suspected from the close similarity of the structures of
the inhibitors [2] and substrate [1].
The sulphur derivatives [2a], [2b] and [2c] hydrolysed slowly at neutral pH to the
same dioxo derivative [2e] and would not be very good candidates for the ternary complex.
Also the sulphur compounds could be affected by X-ray radiation. The triazinedione [2e] is
not a very satisfactory example because it is predominantly in the anionic form at pH 7.4 and
because the presence of the 3-oxo group may allow the compound to bind at the active site
differently from the substrate [1], ie the 3-oxo group may bind at the site where the 4-oxo
group of the substrate [1] normally binds. Similarly the 3-aminotriazinone [2d] may bind
such that the triazine ring may bind at the pyrimidinone domain, ie the 3-amino group may
bind at the site of the 2-amino group of [1]. All these deficiencies are overcome in 2,3-
dimethyl-6-aminopyrimido[4,5-e][1,2,4]triazin-8-one [2f] which should bind to the binary
complex in the expected manner. This is further supported by the fact that quinonoid 6,7-
dimethyl-7,8(6H)dihydropterin is a very good substrate forDHPR. We have now expressed
human DHPR from cloned eDNA and crystallised the binary complex.13 Crystallisation of
the ternary complex with [2f] is in progress.
REFERENCES
130
CYS ....,..SER MUTATIONS IN
ch-HUMAN DIHYDROPTERIDINE REDUCTASE
The eDNA sequence of dihydropteridine reductase (DHPR) showed that the enzyme
has four cysteine residues_l,2 These are cys26, cys85, cys104 and cys161 . Evidence from
titration experiments of human and rat DHPR with thiol reagents and platinum II
complexes suggested that when one of the cysteines was masked by addition of NADH
then it did not react with these reagents and the enzyme was protected from inactivation.3.4
In order to see if one of these cysteine residues was the proton source for the enzymic
reduction of quinonoid dihydropterin substrates, we investigated the effect of replacing the
cysteine residues by serine residues, which are weaker acids, and we examined the kinetics
of the mutant proteins.
For this purpose a new plasmid was constructed from pWLA8 [which expressed
human DHPR in E.coli. K12 (AN1459) when the strain was grown at 300 and then at
45°C],5 and a phagemid vector, pMA200U, which had been derived from pCE30 into
which anjl ori sequence was inserted so as to allow the synthesis of single stranded DNA
for the purpose of sequencing the DNA.6 The original plasmid, pCE30, contained the
tandem A bacteriophage PR and PL promoters, the A ci857ts gene and the AmpR gene.
pWLA8 was digested with the restriction enzyme Bgl I (eleven base cutter) which gave
three fragments (1120 + 1130 + 2760 bps). Two fragments were of the same size so the
products were further digested with Sea I to allow removal of the unwanted fragment ( 1120
....,.. 755 + 365 bps). pMA200U was also digested with Bgl I to give two fragments (1270
+ 2882 bps). The purified (Gene Clean) 1270 bp fragment from pMA200U and the 1130
bp and 2760 bp fragments from pWLA8 were ligated to give the construct pWAM (Figure
1). When pWAM was transformed into E.coli (AN1459) it expressed chDHPR under
conditions similar to those used for pWLA8.
Synthetic 20-mer oligonucleotide primers in which the cysteine coding triplets are
replaced by serine coding triplets were prepared. The plasmid p W AM in the bacterial
strain XLI Blue was used to prepare single stranded DNA. With the Amersham
Mutagenesis System (version 2, code RPN 1523), which uses dCTP(S), we found that the
nicking experiment with the restriction enzyme Nci I was unsuccessful (probably because
pWAM has 13 cleavage sites), but with the enzyme Pvu I (pWAM has two such sites) the
mutated plamids were obtained. The mutageneses were confrrmed by sequencing and
reading only the G tracks because the triplets for cysteine (TGC or TGT) were replaced by
serine triplets (TCC or TCT) with replacement of G by C. Three mutant plasmids
pWAM3, pWAM6 (single mutations) and pWAM8 (double mutation) were prepared
(Figure 2).
The plasmids pWAM, pWAM3, pWAM6 and pWAM8 were transformed into
E.coli (AN1459) and the human proteins were expressed by growing the cells (20-40 L
0<1 Q-i
l
-
Bgl I
+
Sea I Bg/1
~
11 30 bps
1270bps
2760 bps
ligate
Figure 1 Insertion of the ch-DHPR gene into vector pWAM for site directed
mutagenesis
ch-DHPR
J
Met
(ATG) I (TAG)
I
Cys26 Cys85
I
Cys104 Cysl61
r.+ +
pW 8
~
pWAM3
+
¥
+
pWAM6
Figure 2 The plasmids pWAM3, pWAM6 and pWAM8 are the same as pWAM
except for the changes in the DHPR genes indicated
132
M), followed by naphthoquinone affinity chromatography (see ref 7). The purity of the
proteins was checked by SDS-PAGE (Pharmacia Phast System). The DHPR protein from
pWAM and pWAM6 gave a single band (27 kDal), whereas pWAM3 (and to a lesser
extent) pWA8 was contaminated with a second minor protein (35 kDal) which could be due
to an oxidised form of DHPR. This was less than 40% in pWAM8 but slightly more in
pWAM3.
The absence of E.coli DHPR8 in the preparations was confirmed by the lack of
pterin-independent K3Fe(CN)6 activity in all samples. Amino acid analyses revealed that
the wild-type DHPR contained 2.4 times as much cysteine as the protein from the double
133
mutant pWAM8, and confirmed that indeed a double mutation had been achieved. The
kinetic parameters (Km and Vmax values) for the DHPR produced by WAM, WAM3,
WAM6 and WAM8 were determined for quinonoid 6-methyl-7 ,8(6H)dihydropterin and for
NADH (Tables 1 and 2). The kinetic data show little difference in the parameters (except
perhaps for DHPR from WAM6) when cysteine residues are replaced by serine. These
imply that cysteine residues are either not involved in the chemistry of the reaction and the
binding of substrates, or are not involved in the rate limiting reactions.
Further comparative studies of the mutant DHPR with the wild-type enzyme are
warranted in order to see if the amino acid changes affected enzyme activity in ways other
than in the kinetic parameters. We have examined the thermal stability of the enzymes
under similar conditions and the results are in Table 3. These data were obtained for
measurements in 0.8 M sodium chloride. This was done because in the absence of salt the
rates of inactivation were too fast to measure except for the wild-type enzyme. In the
absence of salt, the activity of this enzyme was unchanged during 4 hours at 40°C, but had
a half life of 3 minutes at sooc. DHPR from WAM6 was the least stable mutant.
Table 3 Thermal stability of DHPR and mutants (50 mM Tris/HCl pH 7.4, 2mM DTT
and 0.8 M NaCl)
Dithiothreitol (DTT) was added to all the enzymes because DHPR loses activity
rapidly in its absence. In the presence of 2 mM DTT human DHPR is stable for over one
year at -2ooc. In the presence of 2 mM DTT the wild-type enzyme is more stable than the
mutant enzymes.
ACKNOWLEDGEMENT- We thank Dr N.E.Dixon for generous supplies of the plasmid
pMA200U.
REFERENCES
1. Dahl, H.-H.M, Hutchinson, W., McAdam, W., Wake, S., Morgan, F.J. and Cotton, R.G.H. (1987)
Nucleic Acids Res., 15, 1921-1936
2. Lockyer, J., Cook, R.G., Milstein, S., Kaufman, S., Woo, S.L.C. and Ledley, F.D. (1987)
Proc.Natl. Acad.Sci.USA, 84, 3329-3333
3. Armarego, W.L.F. and Ohnishi, A., (1987) Eur.J.Biochem. 164, 403-409
4. Webber, S. and Whiteley, J.M. (1981)Arch.Biochem.Biophys. 206, 145-152
5. Armarego, W.L.F., Cotton, R.G.H., Dahl, H.-H.M. and Dixon, N.E. (1989) Biochem.J. 261, 265-268
6. Elvin, C.M., Thompson, P.R., Argall, M.E., Hendry, P., Stamford, P.J., Lilley, P.E. and Dixon, N.E.
(1990) Gene 87, 123-126
7. Cotton, R.G.H. and Jennings, I. (1978) Eur.J.Biochem. 83,319-324
8. Vasudevan. S.. Shaw. D.C. and Armarego, W.L.F. (1988) Biochem.J. 255. 581-588
134
THE SPECTRUM OF MUTATIONS IN DIHYDROPTERIDINE
REDUCTASE DEFICIENCY
INTRODUCTION
Dihydropteridine reductase (DHPR, EC 1.6.99.7) is the enzyme required for the
recycling of tetrahydrobiopterin, an essential cofactor of the three aromatic amino acid
hydroxylases (1). A rare inherited disorder is due to a deficiency of this enzyme, resulting in
hyperphenylalanemia and disorders of dopamine and serotonin metabolism. DHPR-deficiency
was recognized as an inheritable disorder, distinct from PKU, in the 1960's, and the disease
state was later correlated with an absence of enzyme activity in cultured fibroblasts (2). This
lack of enzymatic activity was shown in some cases to be due to an absence of protein.
We have collected and cultured fibroblasts from a number of DHPR-deficient patients
throughout the world. Using the fibroblasts as a source of genetic material we have embarked
on a programme to determine the molecular defects resulting in DHPR-deficiency. The first
such mutation was found in 1990 (3), which was a three base-pair insertion resulting in the
insertion of a single threonine residue after amino acid 122 (Thr123 ins.). Since this time we
have found a further 9 mutations, the nature of which will be discussed here. Some of the
mutations have been expressed in E. coli and the purified proteins examined by a number of
means. This has enabled the effects of these mutations on the structure and function of the
DHPR enzyme to be characterized.
EXPERIMENTAL PROCEDURES
Identification of mutations
Fibroblasts from patients were cultured in roller bottles and approximately 2 x 107 cells
used for the extraction of RNA. The extraction of whole cell RNA and conversion to eDNA
was as previously described (4). The amplification of first strand eDNA by the polymerase
chain reaction and the subsequent use of the PCR products in the mutation screening CCM
method have also been described (3, 5-6). Briefly, the DHPR coding region was amplified
from fibroblast eDNA by PCR, and this was hybridized to a wild-type PCR product derived
from our reference eDNA clone (7). Mismatched nucleotides were detected by CCM and the
nucleotide change determined by sequencing the relevant portion of amplified patient eDNA.
The in vitro mutagenesis ofDHPR and cloning into the expression vector pGEX-2T has
been described in detail in Smooker et al1993 (5). The DHPR enzymes were expressed as a
fusion protein with glutathione-S-transferase, enabling easy purification by absorbtion to
glutathione-agarose beads. The DHPR moiety was released by digestion with thrombin,
which cleaves at the junction between the fused proteins. The mutant DHPR enzymes thus
obtained were examined for enzymatic activity, susceptibility to digestion with chymotrypsin,
and structural integrity (by gel filtration).
We have found a total of 10 different mutations in the DHPR coding region to date, with
one mutation (Trp36---tArg) reported by Matsubara et al (8). Table 1 shows the mutations we
have found.
Table 1. Mutations causing DHPR deficiency. The list is given in the order in
which mutations appear from the 5'-end of the coding region. All mutations, except
for those in MB and NF, are homozygous. CRM =cross-reacting material, measured
in fibroblasts.
The majority of mutations identified are missense mutations, with only two resulting in
premature termination of the peptide chain, resulting in a loss of 40 amino acids (NF) or 24
amino acids (AA). There is an insertion of a single amino acid in KA. Some of the mutations
involve non-conservative substitutions, such as proline to leucine, while others appear to be
conservative, such as glycine to serine (patient MLJ, this may explain the "mild" disease state
in this patient, ref 12). Three of the 9 point mutations occur at the cytosine nucleotide of CpG
doublets, which are susceptible to mutation. The positioning of the mutations in the DHPR
coding region is shown diagrammatically in figure 1.
~ G W T
ins.
PG H G LF R WT
D G LS Y T *c * MUT.
Figure 1. Mutations in the DHPR coding region. The coding region is numbered in nucleotides, and the
wild-type amino acid and the substitutions corresponding to each mutation shown below.
136
The mutations are spread throughout the coding region, albeit with a large gap in which
no mutations are found between nucleotides 100 and 350. As the amino acids corresponding
to the ligand binding sites of DHPR are not definitively known, it is not possible to speculate
that a particular mutation will affect the enzymatic activity of the protein, however after
expression of several mutant proteins some conclusions as to the effects of particular
mutations could be drawn (see below). One mutation, however, did alter a conserved amino
acid in an NADH binding domain. The Gly23-tAsp mutation, found in three individuals,
alters the last of three conserved glycine residues in the dinucleotide binding consensus
sequence Gly-X-Gly-X-X-Gly, which connects the first ~-strand to the a-helix in the ~a~ fold
(14). The glycine residues are required to allow the amino acid backbone to rotate, and
replacement by the larger, charged aspartic acid residue may inhibit this. Thus it would be
expected that NADH binding will be inhibited.
km km PROTEASE
ENZYME ACTIVITY (DMPH4) (NADH) SUSCEPT- INTEGRITY
IBILITY
Wild-type 100% 40 11 - Dimer
Gly23-tAsp 0% NA NA +I- Dimer
Trp108-tGly 41% 25 24 +++ Some monomer
His158-tTyr Low ND ND ++++ Dimer
The results presented in table 2 give some clues as to the effects of the mutations on the
structure and function of the DHPR enzyme. The Gly23-tAsp mutation renders the enzyme
inactive, but does not grossly perturb protein structure as evidenced by the stability to
protease digestion (the enzyme is only slightly digested by chymotryptic treatment). This
result is expected if, as discussed above, the mutation affects the binding of NADH. The
enzyme harbouring the Trp108-tGly mutation, conversely, has substantial enzymatic activity
but is very susceptible to protease digestion. Examination of the gel filtration profile reveals a
substantial amount of monomeric protein, thus it appears that this mutation affects
dimerization. The level of cross reacting material in fibroblasts from this patient is 38%, hence
the protease sensitivity in vitro is reflected in vivo, and may be due to the monomers being
more susceptible to proteolysis than dimerized protein. The inhibition of dimerization is
probably the result of the mutation being in one of the helices (aE) proposed to be involved in
this process (15). As noted by these authors, the Thr123 insert is in the same region, and the
30% CRM observed in fibroblasts of this patient (KA) may indicate a similar phenotype.
The final mutant examined, His158-tTyr, does not suffer an inhibition of dimerization
but is highly susceptible to protease digestion and has little (and unstable) enzymatic activity.
It appears that this mutation causes a disruption of the overall protein structure such that the
enzymatic activity is severely inhibited. An interesting observation is that although the
mutation results in increased susceptibility to proteolysis in vitro, this is not reflected in vivo,
as there is 100% CRM in fibroblasts of this patient.
For some of the other mutations which were found, but not expressed, the effects can be
inferred. Thus, as patient NF has no CRM in fibroblasts, both mutations must result in
degradation of the protein. Similarly, in patient KA, where there is a homozygous insertion of
one amino acid, the 30% CRM level also indicates that there is some proteolysis of the
enzyme. In summary, the spectrum of mutations in DHPR deficiency reveals a heterogeneous
137
spread of mutations throughout the coding region, with a correspondingly heterogeneous
range of effects which the mutations have on the structure and function of the protein.
REFERENCES
I. J.E. Craine, E.S. Hall, and S.Kaufman, J. Bioi Chem. 47,6082 (1972)
2. F.A. Firgaira, R.G.H. Cotton, and D.M. Danks, Clin. Chim. Acta 95,47 (1979)
3. D.W. Howells, S.M. Forrest, H.H-M. Dahl, and R.G.H.Cotton, Am. J. Hum. Genet. 47,277 (1990)
4. S.J. Ramus, S.M. Forrest, and R.G.H. Cotton, Hum. Mut. 1,154 (1992)
5. P.M. Smooker, D.W. Howells, and R.G.H. Cotton, Biochemistry, in press (1993)
6. R.G.H. Cotton, N.R. Rodrigues, and R.D. Campbell, Proc. Natl. Acad. Sci. USA 85,4397 (1988)
7. H.H-M. Dahl, W. Hutchison, W. McAdam, S. Wake, F.T. Morgan, and R.G.H. Cotton, Nucl. Acids
Res. 15,1921 (1987)
8. Y. Matsubara, I. Hiroyuki, H. Endo, and K. Narisawa, Nucl. Acids Res. 20,1998 (1992)
9. I. Dianzani, D.W. Howells, A. Ponzone, J.A. Saleeba, P.M. Smooker, and R.G.H. Cotton, J. Med.
Genet. in press (1992)
10. F.A. Firgaira, K.H. Choo, R.G.H. Cotton, and D.M. Danks, Biochem. J. 198,677 (1981)
11. F.A. Firgaira, R.G.H. Cotton, and D.M. Danks, In: Chemistry and Biology of Pteridines (Blair J.A.
ed.), de Gruyter, Berlin, pp771 (1983)
12. N. Blau, C.W. Heizmann, W. Sperl, G.C. Korenke, G.F. Hoffmann, P.M. Smooker, and R.G.H.
Cotton, Pediat. Res. 32:726 (1992)
13. R.G.H. Cotton, I.G. Jennings, G. Bracco, A. Ponzone, and 0. Guardamagna, J. Inher. Metab. Dis.
9,239 (1986)
14. R.K. Wirenga, P. Terpstra, and W.G.J. Hoi, J. Mol Bioi. 187,101 (1986)
15. K.I. Varughese, M.M. Skinner, J.M. Whitely, D.A. Matthews, and N.H. Xuong, Proc. Nat[. Acad. Sci.
USA 89,6080 (1992)
138
CLONING AND CHARACTERIZATION OF GENES ENCODING
INTRODUCTION
METHODS
Animal Experiments
Male Sprague- Dawley rats (250g) were subjected to intrastriatal injections of kainic
acid (2 f.lg in 1 J.ll) under stereotaxic control as previously described 9 • Mice were treated
with 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (MPTP, 0.17 mM/kg) once each day
for five days and sacrificed 12 days following the last injection. Substantia nigra and
striatum were dissected and homogenized in ice-cold 50 mM Tris HCI, pH 7.4 made up
in DEPC-treated water to prevent RNA degradation and preserve enzyme activity, which
allowed measurement of all parameters in the same tissue sample. Homogenates were
immediately divided so that appropriate stabilizing solutions (e.g. acid, gel electrophoresis
loading buffer, RNA preparation buffer, etc.) could be added in preparation for assay of
tissue mRNA, enzyme amount or activity, and BH 4, catecholamines, and metabolites.
Northern Blots
140
to modified nylon membranes (Nytran). Tyrosine hydroxylase eDNA and sepiapterin
reductase eDNA probes were labelled by the random primer method. Blots were probed
at 42°( in SO% formam ide (high stringency), SX SSPE, SX Denhardt's, 100 1-1g/ml
denatured salmon sperm DNA, and 0.1% SDS. Filters were then washed successively with
2X SSC containing 0.1% SDS, air dried, and subjected to autoradiography. Tyrosine
hydroxylase sepiapterin reductase mRNAs were assayed by densitometric scanning of
autoradiograms using a Bio Image Laser Scanning Densitometer and calibrated with a
standard curve using dilutions of rat brain mRNA. After removal of the 32 P-Iabelled probe,
these same blots were reprobed with a labelled actin probe to use as an index for
normalizing mRNA changes following treatment conditions. Data are expressed as a
percentage of the density in control lanes.
Enzyme assays
Much progress has been made in the cloning of cDNAs encoding BH 4 biosynthetic
enzymes. We initially raised antiserum against purified rat erythrocyte sepiapterin
reductase 12 ; the antiserum was then used to screen a eDNA library from rat liver and
isolate a sepiapterin reductase eDNA (SR cDNA) 13 • Oyama and coworkers 14 also isolated
a eDNA from a rat liver eDNA library and confirmed the sequence of the 5' end of the
open reading frame that we originally predicted 13 • We then used the rat liver SR eDNA
to isolate the human brain SR cDNA15 , which will be discussed below.
The second eDNA to be isolated and sequenced encoded rat GTP
cyclohydrolase 16 ; the eDNA was isolated from a rat liver eDNA library using
oligonucleotides derived from the sequence of purified GTP cyclohydrolase.
Subsequently, Togari and coworkers isolated 3 cDNAs from a human liver eDNA library,
which showed divergence at the 3' ends.
Inoue and coworkers purified rat 6-PPH 4 synthase 17 and used synthetic
oligonucleotides to isolate and then sequence a eDNA from a rat liver eDNA library17 •
Based on the rat sequence, Thony and coworkers 18 isolated a eDNA from human liver,
and demonstrated an 82% homology with the rat eDNA.
141
Following our characterization of rat liver SR eDNA, lchinose and coworkers
isolated and sequenced a human liver SR cDNA19 • We have also isolated and
characterized an SR eDNA by screening a human brain (frontal cortex) eDNA librari 5 with
a 669 bp fragment of the rat SR eDNA according to procedures as previously published 13 •
The human brain SR eDNA contains 1630 bp, as compared to 833 bp for human liver19
and 1157 bp for rat liver13 • The human brain SR eDNA has a larger (260 bp) 5'
untranslated region than the human liver eDNA (22 bp), which contains several potential
regulatory elements; the human brain SR eDNA also has a larger 3' untranslated region
(569 bp compared with 25 bp in human liver). The open reading frame of 783 bp
encodes 261 amino acids comprising a protein of 28,047 M,. There is a 78% nucleotide
and a 68% amino acid homology between the human brain and rat liver SR cDNAs. Two
distinct regions of divergence occur between the two, which may contribute to our
observed poor cross-hybridization of each eDNA with mRNA from the opposite species.
Kainic acid. Kainic acid is a neurotoxin that destroys cell bodies while sparing
nerve terminals of neurons originating in non-lesioned areas; it was originally injected into
rat striatum as a model for Huntington's disease20 • Kainic acid has been shown by several
investigators to activate striatal tyrosine hydroxylase activity21 ' 22 several days after
intrastriatal injection. 7 days after intrastriatal kainic acid injection, GTP cyclohydrolase
activity was increased approximately 70% (p<.05, Student's t-test), and tyrosine
hydroxylase activity was increased 35% (p< .05), while aromatic amino acid decarboxylase
activity was unchanged. Control values (based on supernatant mg protein) were: GTP
cyclohydrolase= .55 ± .04 pmol/min/mg; tyrosine hydroxylase= 1.51 + .05
nmol/min/mg; aromatic amino acid decarboxylase (AAAD)= 1.03 + .08 nmol/min/mg.
Although induction of tyrosine hydroxylase and GTP cyclohydrolase activity has
been shown to occur in the adrenal medulla23 ' 24, these results are the first to demonstrate
induction of any BH 4 biosynthetic enzyme in brain. This paradigm will provide a useful
model for investigating the mechanism(s) underlying coordinate regulation of striatal BH 4
and dopamine synthesis in brain. We are currently investigating the time course and
mechanism by which this elevation in activity occurs.
142
content (1.0 N trichloroacetic acid was added in a 1 :10 dilution of sample), and 5)
dopamine and its major metabolites, homovanillic acid (HVA) and dihydroxyphenylacetic
acid (DO PAC) (1.0 N perchloric acid was added in a 1 :10 dilution of sample).
The success of the MPTP lesion was demonstrated by the greater than 70% loss of
dopamine, DOPAC, and HVA. MPTP decreased the activities of striatal tyrosine
hydroxylase and GTP cyclohydrolase, as well as BH 4 content by approximately SO%. The
loss of tyrosine hydroxylase molecules in the striatum MPTP-treated mice was confirmed
by quantification of Western blots probed with anti-tyrosine hydroxylase serum 25 •
However, striatal 6-PPH 4 synthase and sepiapterin reductase activities were not altered,
suggesting that these enzymes are not predominantly localized in dopaminergic terminals
in striatum. Control values expressed as a function of tissue wet weight are: tyrosine
hydroxylase= 15.9 + 0.8 pmol/min/mg; GTP cyclohydrolase= 7.08 .± 0.75 fmol/min/mg;
BH 4 = 0.43 .± 0.03 pmol/mg; DA= 10.35 + 0.44 }Jg/g; DOPAC= 3.31 + 0.14 }Jg/g;
HVA=2.77 + 0.23 }Jg/g. BH 4, dopamine, and metabolites were measured as described
previousl/ 6 •
Northern blots of RNA from substantia nigra of control and MPTP-treated mice
were probed with labelled tyrosine hydroxylase eDNA, and then probed with sepiapterin
reductase eDNA after the blot was stripped of radioactivity from the previous probe.
Quantitative laser-scanning densitometry of the autoradiograms revealed that MPTP
caused a 34% reduction of tyrosine hydroxylase mRNA in the nigra (control=1 00% +
9.4% SEM, MPTP=66o/o + 8.9%, n=8, p < 0.05, Student's t-test). When the same blot
was probed with the 669 bp labelled fragment of rat sepiapterin reductase eDNA, the
content of sepiapterin reductase mRNA rose by 79% (control=100o/o + 9.6% SEM,
MPTP=179o/o + 8.6%, n=8, p < 0.05). It is currently not known what cells in the
substantia nigra contain the elevated level of sepiapterin reductase mRNA or what causes
this increase; however it is possible that there is a compensatory elevation of sepiapterin
reductase synthesis in the surviving nigrostriatal dopamine neurons, which maintains
striatal sepiapterin reductase activity equivalent to control. We are currently exploring the
mechanism and cellular location of this novel elevation of sepiapterin reductase mRNA
in mouse brain. These types of studies will address the extent to which there is coordinate
regulation of expression of genes encoding tyrosine hydroxylase and the BH 4 biosynthetic
enzymes in brain, and how these systems can be manipulated pharmacologically to
produce favorable therapeutic outcomes in neurological and psychiatric diseases where
BH 4 and catecholamine metabolism is altered.
Acknowledgements
Robert A. Levine is supported by NIH grants AG1 0687-01 and NS28800-01. Panagiotis
Z. Anastasiadis is supported by the Bodosaki Foundation, Athens, Greece.
REFERENCES
143
Specter, and B. Jankovic., Annals of New York Academy of Sciences, pp. 129-139
(1987).
2. Kaufman, S.: The structure of the phenylalanine-hydroxylation cofactor. Proc. Nat/.
Acad. Sci., 50: 1085-1 093 (1963 ).
3. Tayeh, M.A. and Marietta, M.A. Macrophage Oxidation of L-Arginine to Nitric
Oxide, Nitrite, and Nitrate: Tetrahydrobiopterin is Required as a Cofactor. }. Bioi.
Chem., 264: 19654-19658 (1989).
4. T.Ohue, K.Koshimura, Y.Akiyama, Y.Watanabe and S.Miwa: Monoamine-mediated
enhancement of acetylcholine release from rat hippocampus by
6R-L-erythro-5,6,7,8-tetrahydrobiopterin. Brain Res. 570, 173-179 (1992).
5. K.Koshimura, S.Miwa, K.Lee, M.Fujiwara, and Y.Watanabe: Enhancement of in vivo
dopamine release from the rat striatum by dialytic perfusion of
6R-L-erythro-5,6,7,8-tetrahydrobiopterin.}. Neurochem. 54, 1391-1397 (1990).
6. Wolf, W.A., Zaija. E., Arthur, R.A. Jr., Anastasiadis, P.Z., Levine, R.A., and Kuhn, D.M.
Effect of tetrahydrobiopterin on serotonin synthesis, release, and metabolism in
superfused hippocampal slices.}. Neurochem., 57: 1191-1197 (1991 ).
7. Tanaka K., Kaufman S. and Milstien S.: Tetrahydrobiopterin, the cofactor for aromatic
amino acid hydroxylases, is synthesized by and regulates proliferation of erythroid
cells. Proc. Nat/. Acad. Sci. USA 86, 5864-5867 (1989).
8. Milstien, S. and Kaufman, S.: The Biosynthesis of tetrahydrobiopterin in rat brain,
"Chemistry and Biology of Pteridines," B.A. Cooper and V.M. Whitehead, (Eds.),
de Gruyter, Berlin, New York, pp. 169-181 (1986).
9. Levine, R.A., Miller, L.P., and Lovenberg, W.: Tetrahydrobiopterin in striatum:
Localization in dopamine nerve terminals and role in catecholamine synthesis.
Science, 214: 919-921, (1981 ).
10. Biguet, N.F., Buda, M., Lamouroux, A., Samolyk, D., and Mallet, J.: Time course of
the changes of tyrosine hydroxylase mRNA in rat brain and adrenal medulla after
a single injection of reserpine. EMBO }. 5(2): 287-291 (1986).
11. Levine, R.A., Pollard, H.B., and Kuhn, D.M.: A rapid and simplified assay method for
tyrosine hydroxylase. Anal. Biochem., 143: 205-208 (1984).
12. Levine, R.A., Kapatos, G., Kaufman, S., and Milstien, S.: Immunological evidence for
the requirement of sepiapterin reductase for tetrahydrobiopterin biosynthesis in
brain. }. Neurochem., 54: 1218-1224 (1990).
13. Citron, B.A., Milstien, S., Gutierrez, J.C., Levine, R.A., Yanak, B.L., and Kaufman, S.:
Isolation and Expression of Rat Liver Sepiapterin Reductase eDNA. Proc. Nat.
Acad. Sci., 87: 6436-6440 (1990).
15. Levine, R.A., Sol us, J.F., Goustin, A.S., Tait, S., Demetriou, S., Citron, B., and Kaufman,
S.: Isolation of a putative eDNA encoding human brain sepiapterin reductase.
"Pterins and Biogenic Amines in Neurology, Pediatrics, and Immunology", N.Biau,
H.-Ch. Curtius, R.A. Levine, and R.G.H. Cotton (Eds.), Lakeshore Publishing, pp.
81-88 (1991 ).
16. Hatakeyama, K., Inoue, Y., Harada, T., and Kagamiyama, H.: Cloning and sequencing
of eDNA encoding rat GTP cyclohydrolase 1: The first enzyme of the
tetrahydrobiopterin biosynthetic pathway. }. Bioi. Chem., 266, 765-769 (1991 ).
17. Inoue, Y., Kawasaki, Y., Harada, T., Hatakeyama, K., and Kagamiyama, H.: Purification
144
and eDNA cloning of rat 6-pyruvoyl-tetrahydropterin synthase.}. Bioi. Chem., 266,
20791-20796 (1991 ).
18. Thony, B., Leimbacher, W., Burgisser, D., and Heizmann, C.W., Human 6-pyruvoyl
-tetrahydropterin synthase: eDNA cloning and heterologous expression of the
recombinant enzyme, Biochem. Biophys. Res. Comm., 189: 1437-1443 (1992).
19. lchinose, H., Katoh, S., Suoka, T., Titani, K., Fujita, K., and Nagatsu, Biochem. Biophys.
Res. Comm., 179: 183-189 (1991)
20. Coyle, J.T. and Schwarcz, R.: Lesion of striatal neurons with kainic acid provides a
model for Huntington's Chorea, Nature, 263: 244-245 (1976).
21. Baring, M.D., Walters, J.R., and Eng, N., Brain Res., 181: 214-218 (1980).
22. Coyle, J.T. and Schwarcz, R., Lesion of striatal neurons with kainic acid provides a
model for Huntington's Chorea, Nature, 263: 244-245 (1976).
23. Abou-Donia, M.M., Daniels, A.J., Wilson, S.P., Nichol, C.A., and Viveros, O.H.,
"Chemistry and Biology of Pteridines," ed. by J.A. Blair, Berlin, Walter de Gruyter,
pp. 777-781 (1983).
24. Viveros, O.H., Lee, C.-L., Abou-Donia, M.M., Nixon, J.C., and Nichol, C.A.: Science,
213: 349 (1981).
25. Kuhn, D.M. and Billingsley, M.L. Tyrosine hydroxylase: Purification from PC12 cells,
characterization, and production of antibodies, Neurochem. Int. 11: 463-475,
(1987).
26. Levine, R.A., Zoephel, G.P., Niederwieser, A., and Curtius, H.C.: Entrance of
tetrahydropterin derivatives in brain after peripheral administration: Effect on
biogenic amine metabolism,}. Pharmacal. Exp. Ther., 242: 514-522 (1987).
145
DROSOPHILA GTP CYCLOHYRODROLASE: MULTIPLE ISOFORM
PRODUCTS OF A SINGLE GENE DERIVE FROM ALTERNATE
TRANSCRIPTS THAT ARE DEVELOPMENTALLY REGULATED AND
FUNCTIONALLY SPECIFIC
J.
M. O'Donnelll, G. Ranganayakulul, X. Chenl, S.
Krishnakumarl, and W. S. Neckameyer2
INTRODUCTION
148
pteridines in the adult eye. Even though the homozygous mutant has a
severely abnormal eye color as a result of this pteridine deficit, no other
phenotypic consequences of the mutation are observed. Fig. lB compares the
pteridine profile in wild type and PurWE75 mutant ovaries. This mutant has
wild type eye pigmentation and its ability to perform catecholamine functions
appears normal. In the homozygous state, however, it does not express
normal GTP CH in ovaries (8 and Reynolds, Chen, Ranganayakulu and
O'Donnell, submitted). Consequently, early embryonic nuclear divisions
cannot proceed correctly, and development is aborted at an early stage.
The HPLC profiles of wild type ovaries and eyes also suggest complexity at
another level: that of pathway regulation. In the adult eye, neopterin, the
product of GTP CH activity, is invariably at very low concentrations relative
0.03 . . . , - - - - - - - - - - - - - - - - - - - - - - - ,
A
Heads
·------ Wildtype
rl
-Pu
~ 0.02
c
Q)
(.)
en
Q)
I...
0
::J
u_
0.01
0 2 4 6 8 10 12 14
Ovaries B
0.009
·------ Wildtype
_ PuWE75 1\
l: \~
Q)
I\
(.)
c
Q)
(.)
en
!\
I\
Q)
!.....
0
::J
[;::
0.008
J \ji
---
0 2 4 6 8 10 12 14
Time
Figure 1. HPLC profiles of pteridines in wild t)'Ee and mutant Drosophila eyes and ovaries. A.
Wild type and Purl heads. B. Wild type and Pu WE75 ovaries. Pteridines were extracted from
the tissues in O.lN HCl, oxidized by standard methods, eluted from a Waters 11Bondpak C18
column in 5% methanol, and detected by fluorescence at 365 nm excitation and 465 nm emission
wavelengths. Neopterin elutes at 5 min. and biopterin at 8 min. The remaining peaks are an
unresolved mixture of pterin, 6-hydroxylmethylpterin and isoxanthopterin.
149
to other pteridines. In contrast, neopterin levels in ovaries and embryos
represent a larger proportion of total pteridine content. This distinction
between pteridine profiles in two different tissues might have several
explanations; the genetic complexity suggests that the basis for the differences
is likely to lie with GTP CH. In general, genetic data of the type observed
here are taken to indicate that the gene encodes a protein with
multifunctional domains or that it expresses multiple products with distinct
functions. Biochemical and molecular genetic analyses support the latter
interpretation. Pu expresses multiple, differentially regulated and
functionally specific GTP CH isoforms.
150
-15 -10 ·5 0 5 10 15
111•11 ~ I II
L rhd17 t I
t
I~ t~l II! IIU
rH16
r331
r fJ15
• rt rPH30
f
L
rAA4
Figure 2. Molecular Map of the Punch region. Coordinates in the Pu region are indicated in
kilobases on the upper line on the map. Restriction enzyme sites are noted on the second line.
B=Bam Hl; R=Eco Rl; H=Hind III; S=Sal I. The sites of Pu mutations are indicated below the
restriction sites. The small vertical arrows denote sites of chromosomal breaks associated with
rearrangement mutations. Bars indicate deleted segments, and triangles mark transposon
insertion sites. Below the genomic map, exons and introns of alternatively spliced transcripts
are positioned, with filled rectangles indicating shared exons and open, unique exons. Arrows
indicate direction of transcription for these transcripts, which is toward the distal end of the
chromosome. Rectangles containing question marks are exons that have been mapped only by
Northern analysis so that precise positioning is still uncertain. The small arrow in the same
orientation indicates a 1.1 kb transcript for which a eDNA clone is not yet available.
Preliminary evidence suggests that it may also be an alternately spliced product. The two
arrows oriented in the opposite direction indicate two opposite strand transcription units that
are nested within introns.
151
embryos and adults. Antibodies raised against protein expressed by this
transcript in bacteria detect a Pu protein in the cytoplasm of nurse cells (the 15
sister cells of each developing oocyte which support oocyte growth). The
protein is transported into the cytoplasm of the oocyte in stage 11 of oogenesis
during a bulk flow process that empties the nurse cell cytoplasm into the
growing egg. Once this protein is in the oocyte cytoplasm, it is packaged into
spherical granules (Fig. 3A). These have a morphology of the type described
for a yolk granules. The dynamics and possible functions of the granule
protein are discussed below. The expression of Transcript B itself exactly
parallels that of the protein. Surprisingly, however, it is retained in the nurse
cell cytoplasm during the bulk flow period, and as a result, this transcript is
not found in cleavage stage embryos. After zygotic transcription is initiated,
Transcript B is once again expressed, primarily in the developing larval brain
and ventral nerve cord and in a variety of sensory organ primordia.
Mutations that affect catecholamine functions also alter the level or size of
this transcipt. Transcript C (also 1.75 kb is size) is characterized so far only by
the structure of a eDNA isolated from an embryonic library. It is expressed in
embryos and adults, but tissue localizations have not been completed.
Transcript D, 3.4 kb in length, is ubiquitously expressed in oocytes and
throughout embryogenesis. Transcript E is a 5 kb product that is found in
throughout the cytoplasm of cleavage stage embryos, and to some extent in
mesodermal tissue during gastrulation. However, its most intense
expression is throughout the developing embryonic nervous system. Further
localization experiments are in progress, but it is clear from all of the studies
described here that each product of the locus is expressed in a unique pattern.
152
tryptophan hydroxylase activities are expressed in both the central nervous
system and cuticle.
DTPH is present in two forms: a 45 kilodalton (kDa) subunit found in
ovaries and early embryos, which apparently functions exclusively as a
phenylalanine hydroxylase, and a 50 kDa subunit found in later stage embryos
and larval and adult tissue, which hydroxylates both phenylalanine and
tryptophan (4). The precise structural difference between the 45 kDA and 50
kDA species has not yet been identified; however, it is known that the 45 kDa
protein arises from a post-translational modification (or modifications) of the
50 kDa sybunit, and not from alternative splicing of transcripts, as with Pu.
B c
Fig 3 Locahzatwn of Pu protem Isoforms and DTPH transcnpts Unhke Pu, all DTPH
transcnpts co-locahze with the DTPH gene product (m the embryomc stages shown here, only
the 45kDa DTPH protem IS expressed) A Pu protem m an embryo less than one hour old
recogmzed by antibodies raised agamst protem translated from Transcnpt B This pattern IS
mdistingmshable from that of DTPH Pu Transcnpt E (B) and DTPH (C ) mRNA localization
m early gastrula-stage embryos m-mesoderm D Locahzatwn of Pu protem Isoform ansmg
from zygotic expresswn of Transcnpt B durmg late gastrulation n-neurons E DTPH mRNA
expressiOn m late gastrulation a, p-antenor, postenor gut n-neurons, c-cephahc lobe Scale bar
=50~
153
The DTPH mRNA and 45 kDa protein co-localizes with one of the Pu
protein isoforms in the a yolk granules, ubiquitously distributed throughout
the early embryo (Fig. 3). As described above, thePu transcript responsible for
this protein is synthesized in egg chambers, but is not itself found in early
embryos. In early gastrulation, the DTPH transcript and protein co-localizes
with the product of the Pu Transcript E (see Fig. 2) in mesodermal tissue. At
this point, the granules have disappeared. However, later in embryogenesis,
but before the 45 kDa species has been replaced by the 50 kDa protein, the
pattern of expression of DTPH and certainPu protein isoforms no longer
completely overlap (Fig. 3). These intriguing differences in regulation
foreshadow the different roles of the Pu gene products required as the
organism develops and gains complexity.
154
ACKNOWLEDGEMENTS
This work was supported by NIH grant GM26757 and NSF grant DCB
8608696 to J.M.O. and a grant from the Pharmaceutical Manufacturers'
Association toW. S. N. We wish to gratefully acknowledge the asssistance of
Drs Karen Rose and Harriett Smith-Somerville in the acquisition of the HPLC
data and the preparation of the chromatograms.
REFERENCES
155
STUDIES ON GTP CYCLOHYDROLASE I OF ESCHERICHIA COU
Basel, Switzerland
6Max-Planck-Institut ftir Biochemie, D-8033 Martinsried, Federal Republic
of Germany
INTRODUCTION
GTP cyclohydrolase I (EC 3.5.4.16) has been obtained from Escherichia coli wild type
cells by affinity chromatography. 1•2 The gene coding for the enzyme from E. coli has been
cloned and sequenced3 •4 and has been mapped at 2251 kb of the physical map of the E. coli
chromosome. 5 Strains carrying a plasmid with the gene under the control of its own
promoter expressed about 100-fold increased enzyme levels. The protein has been
crystallized from citrate buffer. 6 GTP cyclohydrolase genes of rat, 7 man, 8•9 and Bacillus
subtilis 10 have also been cloned, sequenced and expressed.
RESULTS
The gene coding for GTP cyclohydrolase I of E. coli was expressed under control of
the lac repressor in the plasmid pNC0113. E. coli cells (strain XLl) carrying the
recombinant plasmid produced GTP cyclohydrolase in the range of 30 % of total cell
protein. The enzyme could be obtained in pure form from cell extract by chromatography on
DEAE cellulose. The molecular mass was determined by mass spectrometry yielding a value
AATTTCTTCATCATACCGTTTAATCAATGTGCTGTGAGTAACTTTCACTTCCGTATTTGC 60
ATAACGATGTTTTAACATCTGCTGATGAAAGGCAGCGGCAATTACAATAATTATCGCTGT 120
GAATACTGGATTATGTGCGCCGCCTCACGCACAATAATCAGGCTGTAAATCAGCTTAATA 180
S.D. (M) P S 2
ACTTTGCCCCCACGCAGGGCGGAGGCGTCACACCTGC~AAATCATAAATGCCATCA 240
L S K E A A L V H E A L V A R G L E T P 22
CTCAGTAAAGAAGCGGCCCTGGTTCATGAAGCGTTAGTTGCGCGAGGACTGGAAACACCG 300
L R P P V H E M D N E T R K S L I A G H 42
CTGCGCCCGCCCGTGCATGAAATGGATAACGAAACGCGCAAAAGCCTTATTGCTGGTCAT 360
M T E I M Q L L N L D L A D D S L M E T 62
ATGACCGAAATCATGCAGCTGCTGAATCTCGACCTGGCTGATGACAGTTTGATGGAAACG 420
P H R I A K M Y V D E I F S G L D Y A N 82
CCGCATCGCATCGCTAAAATGTATGTCGATGAAATTTTCTCCGGTCTGGATTACGCCAAT 480
F P K I T L I E N K M K V D E M V T V R 102
TTCCCGAAAATCACCCTCATTGAAAACAAAATGAAGGTCGATGAAATGGTCACCGTGCGC 540
D I T L T S T C E H H F V T I D G K A T 122
GATATCACTCTGACCAGCACCTGTGAACACCATTTTGTTACCATCGATGGCAAAGCGACG 600
V A Y I P K D S V I G L S K I N R I V Q 142
GTGGCCTATATCCCGAAAGATTCGGTGATCGGTCTGTCAAAAATTAACCGCATTGTGCAG 660
F F A Q R P Q V Q E R L T Q Q I L I A L 162
TTCTTTGCCCAGCGTCCGCAGGTGCAGGAACGTCTGACGCAGCAAATTCTTATTGCGCTA 720
Q T L L G T N N V A V S I D A V H Y C V 182
CAAACGCTGCTGGGCACCAATAACGTGGCTGTCTCGATCGACGCGGTGCATTACTGCGTG 780
K A R G I R D A T S A T T T T S L G G L 202
AAGGCGCGTGGCATCCGCGATGCAACCAGTGCCACGACAACGACCTCTCTTGGTGGATTG 840
F K S S Q N T R H E F L R A V R H H N 221
TTCAAATCCAGTCAGAATACGCGCCACGAGTTTCTGCGCGCTGTGCGTCATCACAACTGA 900
TTAAAAGGCAGGAACCATGGAGCGCAACGTCACGCTCGATTTTGTTCGCGGCGTCGCCAT 960
TCTGGGGATCC 971
Figure 1. Nucleotide sequence and deduced amino acid sequence of the gene coding for GTP cyclohydro-
Iase I of Escherichia coli. The putative Shine-Dalgarno region (S.D.) is underlined. The N-terminal
methionine of the deduced amino-acid sequence is posttranslationally removed, and is indicated in
parentheses.
158
Crystallization
Crystallization experiments were carried out by the vapour diffusion method and by
batch procedures. Crystals were formed in solutions adjusted to 0.42 M sodium citrate pH
7.4, 20 mM phosphate, 5 mM EDTA, 0.02 % sodium azide and 6 mg of protein per ml.
They appeared as rectangular platelets or cubes with maximum length of 0.4 mm within two
weeks (figure 2A). The crystals have space group P2 1, with cell constants a= 204.5 A, b =
210.2 A, c = 72.2 A, ~ = 95.8° (Vm = 3.2 A3/Da, assuming 20 GTP cyclohydrolase I
subunits per asymmetric unit). They diffract x-rays to beyond 3 Aresolution.
Another crystal form was obtained from protein solutions adjusted to 0.2 M sodium
acetate pH 6.0, 0.1 M MES, 20 mM phosphate, 5 mM EDTA and 8 mg protein per ml. Thin
plates with a maximum length of 0.4 mm were formed within 3 days (figure 2B). They
belong to space group C222 1 with cell dimensions a= 313.2 A, b = 227.0 A, c = 131.5 A
and diffract to 3.5 A resolution.
Crystals were also obtained from solutions adjusted to 6% PEG 6000 pH 7.0, 0.1 M
ammonium sulfate, 0.1 M MOPS, 20 mM phosphate, 5 mM EDTA, 0.02% sodium azide
and 8 mg of protein per m1 (figure 2C). They diffract x-rays to 3 A resolution.
Figure 2. Crystals of GTP cyclohydrolase I of Escherichia coli grown at 20 °C. A, 0.42 M sodium citrate
pH 7.4, 20 mM phosphate, 5 mM EDTA and 0.02% sodium azide; B, 0.2 M sodium acetate pH 6.0, 20 mM
phosphate, 5 mM EDTA, 0.02% sodium azide, 0.1 M MES; C, 6% PEG 6000 pH 7.0, 0.1 M ammonium
sulfate, 0.1 M MOPS, 20 mM phosphate, 5 mM EDTA and 0.02 % sodium azide.
Electron microscopy
Crystal suspensions were frozen in their mother liquor by immersion in liquid nitrogen
without chemical prefixation. The crystal surfaces were exposed by deep-etching at -100 oc
and were replicated by shadowing with platinum/carbon. Alternatively, they were decorated
with gold or silver. The experimental procedure has been published. 11
Figure 3 shows micrographs of different planes of crystals belonging to space group
P2 1• On the basis of their 2-D lattice constants, the crystal planes were indexed following the
procedure described by Bacher et al. 12 Whereas it was not possible to label the crystal planes
unequivocally, the identification could usually be narrowed to two possibilities as shown in
the legend to Figure 3.
Micrographs were processed by standard correlation averaging techniques. 13 The
averaged image of the shadowed crystal plane in figure 4A, as well as the decoration pattern
of silver and gold in figures 4B and 4C indicates particles with fivefold symmetry, revealed
by the outline of the metal deposit and by the arrangement of individual metal clusters. Since
GTP cyclohydrolase I consists of identical subunits and the decoration images strongly
159
Figure 3. Crystal planes of GTP cyclohydrolase I crystals grown m Citrate buffer (space group P21) with
optical d1ffractograms, crystals were freeze-etched and shadowed w1th Pt/C (45°, 1 3 nm) A, ab-plane (0 0
1) or (1 0 -I) plane, B, ac-plane (0 I 0) or be-plane (I 0 0), C, (I I 0) plane or (1-I 0) plane
Figure 4. CorrelatiOn averages of the crystal ab- or (1 0 -I) plane shadowed with Pt/C (A) and decorated
With Ag (B) or with Au (C) (crystals of space group P21 grown from citrate) The decoration pattern of both
metals and the contour of the molecule m shadowed plane strongly md1cate fivefold symmetry
suggest fivefold symmetry, we conclude that the enzyme complex is a decamer, rather than
an octamer as proposed earlier.2 Decoration also reveals a local fourfold rotation axiS
normal to the observed plane and parallel to the fivefold symmetry a:xts of the molecule. The
electron microscopic observatiOns are well m hne with the results of x-ray crystallography as
descnbed below.
Rotational and translational positions of enzyme molecules can also be observed in
decoration images of crystals grown in acetate (space group C222 1). A detailed electron
mtcroscopic analysis of these crystals ts in progress.
Crystallography
160
Figure 5 shows a plot of the correlation coefficient R1rorr versus rotation angle K in the
rotation axis orientation ('If =90°, cp =84°). Maxima separated by 18° indicate a 20 fold
repeat of the peak pattern, which in tum is indicative of an arrangement with a fourfold
rotation axis parallel to a local fivefold axis. This is in agreement with the above findings
from electron microscopic studies on single crystals of GTP cyclohydrolase I.
Selfrotation functions with K =180° (search for twofold rotation axes) revealed peaks
at ('If, cp = 174°, K = 180°) with 'I'= 9°, 18°, 27°... 90°. This can be interpreted by the
presence of 5 twofold axes in a plane perpendicular to the fivefold axis of one single enzyme
complex (36° repeat) modulated by an additional fourfold axis to give a repeat of 9°
between 20 twofolds. Thus, the enzyme complex is apparently decameric and has 0 5
symmetry.
100
90
...
=
.~
80
u
....
0::
70
C>
u
60
.2=
...
~
. 50
""""C>
u
40
30
20
0 20 40 60 80 100 120 140 160 180
rotation angle K
Figure 5. Crystallographic selfrot:ltion function computed with a Patterson map at 6.0 Aresolution and the
3000 highest Patterson peaks with vector lengths 15 -50 A. Analysis of the dependence of the correlation
coefficient Rm,. from the rotation angle x: with an axis orientation parallel to the crystallographic c-axis
shows a pattern with 18° repeat. This can be explained by the presence of a local fourfold axis parallel to a
fivefold axis (particle symmetry).
DISCUSSION
The gene coding for GTP cyclohydrolase of E. coli could be expressed with high
efficiency under lac promoter control. In the context of this work, it became necessary to
resequence the entire E. coli gene. Minor corrections were introduced.
The protein could be crystallized in several modifications, which appear suitable for x-
ray structure analysis. No satisfactory heavy metal derivatives could be obtained hitherto.
However, the crystal packing of the monoclinic P2 1 crystals obtained from citrate buffer can
be analyzed by freeze-etching electron microscopy. Thus, the translational position of the
protein molecules in the ab crystal plane could be directly observed. Decoration images
indicated that the protein molecules have fivefold symmetry. Moreover, the approximate
orientation of the fivefold molecular axis with respect to the crystal lattice could be
determined. These observations were confirmed by Patterson analysis of x-ray diffraction
data. The combined electron microscopy and x-ray diffraction data suggest that the protein
molecule has D5 symmetry.
161
An attempt is in progress to calculate an initial electron density based on the reported
crystallographic and non-crystallographic symmetry data. If successful, the electron density
could be improved by cyclic symmetry averaging without the use of multiple isomorphous
replacement.
ACKNOWLEDGEMENTS
This work was supported by grants from the Deutsche Forschungsgemeinschaft and the
Fonds der Chemischen Industrie. We thank Prof. R. Huber for help and support.
REFERENCES
162
PARTIAL PURIFICATION AND CHARACTERIZATION OF
GTP CYCLOHYDROLASE I FROM SPINACH LEAVES
INTRODUCTION
RESULTS
Table 2a. Effect of heat treatment temperature Table 2b. Effect of heat treatment time on GTP
on GTP cyclohydrolase I activity. Treatment cyclohydrolase I activity at so·c.
time was for 1 min at all temperature.
Cone. Relative act. Cone. Relative act. Cone. Relative act. Cone. Relative act.
(mH) ( %) (mM) ( %) (11M) ( %) (111M) (%)
164
100
.
80
\
M
....>. 60
:~
....u A
<
/~
Ql
>
~ 40
"'
r-
Ql
a:
A
\
?.0
10~
I v ~ 0
10 ll
pH
25
20
?
....
0e 2.0
,...-....
Q.
15
",_
"'
ii = 2.2 1.5
>j;
+'
Q.
0
1.0 ...__.,
""'
0
0.5
"',_
+'
I0
"' 0 0. 5
lo9 (S)
"0 -0.5
+'
u
"'
"'"'
~1.0
> -1.5
0. 5 I. 0 I ;
GTP ( mM )
165
treatment, and Ultrogel AcA34 column chromatography. The overall
purification is summarized in Table 1. Seventy percent of GTP
cyclohydrolase I activity was found in the fraction precipitated
by 30-50% saturation with ammonium sulfate. Simultaneously about
70% of the protein was precipitated. After fractionation with
ammonium sulfate, to establish the appropriate condition of heat
treatment, several·conditions were applied. Heat treatment for 0
min at 50 ·c resulted in the loss of 12% protein and in 3. 6-fold
specific activity(Table 2). Heat treated fraction was centrifuged
and the supernatant was applied to a column of Ultrogel AcA34. The
activity was eluted as a single peak from the column
chromatography. Active fractions were combined and subjected to
the characterization.
The pH optimum of the enzyme reaction was estimated to be 8.0
under the condition examined(Fig. 1), and the enzyme activity
showed the difference in each buffer.
On the enzyme concentration curve, the pattern of neopterin
produced in the reaction mixture was shown as a sigmoidal curve.
The effect of GTP concentration on the enzyme activity is
shown in Fig 2. A plot of GTP concentration versus velocity
yielded a curve that did not obey the Michaelis-Menten equation.
The Hill coefficient(n) obtained from Hill plot was 2.2.
To study the effect of the end products in the biothynthetic
pathway, various concentrations of tetrahydrobiopterin,
dihydrobiopterin, tetrahydrofolate, and dihydrofolate were
examined. The enzyme activity was not affected in any
concentration and any compound(Table 3).
REFERENCES
166
DETECTION AND QUANTIFICATION OF GTP CYCLOHYDROLASE I m RNA
INTRODUCTION
Tissues preparation, cell culture, RNA purification and Northern blot analysis were
performed as described previously14. For reverse transcriptase-PCR the following primers
were used: primer 1 GCAGCGAGGAGGATAACGAG, primer 2 AACTCCTCC
CGAGTCTTNGG (N= A, C, G and T) primer 3 GAGTGTGAGTGATCCTCGACTTGA.
Pairwise combinations of primers 1 and 2 yealded a 555 bp product, wereas primer 1 and 3
lead to a 578 bp product. Radiolabelling of eDNA probes was performed as described
previously14. Pairwise combination of primers 3 ACGAGATGGTGATTGTGAA(G/A)G
and primer 4 GGTAAGGCGTTCTTGAAC(G/f)TG lead to a PCR roduct of 179 bp that
matched to position 480-658 of the rat sequence12 and to position 448-626 and of the
human sequencell.
Sequence analysis
The amino acid sequences of GTP cyclohydrolase I from rat and E. coli show
considerable homology 13. PCR primers were designed to match the rat eDNA sequence in
areas of maximum homology with the E. coli gene. Mixed oligonucleotides were used in
the 3 '-terminal section of the respective primers. Pairwise combinations of primers were
GCAGCGAGGAGGATAACGAGGI'GAACCTCCCCAAAC'IGGCGGCTGCTI'ACTCGTCCATCC'IGCTCTCGC'IGGGC - 7 4
S E E D N E V N L P K L A A A Y S S I L L S L G
GAGGACCCCCAGCGGCAOOGGCTGCTCAAGACGCCC'IGGAGGGCGGCCACCGCCATGCAGTACTI'CACCAAGGGA - 149
E D P Q R Q G L L K T P W S A A T A M Q Y F T K G
TACCAGGAGACCATCTCAGA'IGTCC'IGAATGATGCTATATI'IGA'IGAAGATCA'IGACGAGA'IGG'IGATI'G'IGAAG - 2 24
Y Q E T I S D V L N D A M F D E D H D E M V I V K
GACATAGACA'IGTTTI'CCA'IG'IG'IGAGCATCACCTTGTI'CCATI'IGTAGGAAGSGTCCATATI'GGCTATCTI'CCT - 299
D M D M F S M C E H H L V P F V G R V H I G Y L P
AACAAGCAAGTCCT'IGGTCTCAGTAAACTTGCCAGGATI'GTAGAAATCTACAGTAGACGACTACAAGTI'CAAGAA - 37 4
N K Q V L G L S K L A S I V E I Y S S R L Q V Q E
CGCCTTACCAAACAGATTGCOOTQ3CCATCACAGAAGCCTIGC.AGCCTGC'IGGCGTIU::AGTAGIGAT'IGAAGCG - 449
R L T K Q I A V A I T E A L Q P A G V G V V I E A
ACACACA'IGTGCA'IGGTAATGCGAGG'IGTG:AGAAAA'IGAACAGCAAGAC'IG'ICACTAGCACCATGC'IGGGCG'IG - 524
T H M C M V M R G V Q K M N S K T V T S T M L G V
TTCCGGGAAGACCCAAAGACTCGGGAOOAGTCCC'ICACACTCATCAGGAGC'IGA - 578
F R E D P K T R E E S L T L I R S *
Figure 1. Patrial eDNA sequence of murine GTP cyclohydrolase I. Marked nucleotides are
different from the human eDNA sequence11.14.
168
used for PCR experiments using rat RNA as template. eDNA was prepared from RNA by
reverse transcription and was subsequently amplified. The lengths and the sequences of the
respective rat PCR products were in agreement with the published eDNA sequence12.
The same primer combinations were used in PCR experiments using human and
murine eDNA as templates. PCR products were purified by gel electrophoresis and HPLC
and were sequenced on both strands. The human and murine eDNA segments encompassed
555 bp and 578 bp respectively. Both PCR products were cloned and used as templates for
radiolabelling of eDNA probes.
The partial sequence of the murine GTP cyclohydrolase I eDNA differed from the
human sequence by 56 nucleotides as shown in Fig. 1. It should be noted that most of the
exchanges are located in the wobble positions of the respective codons so that only 10
different amino acids are coded. The deduced amino acid sequence shows 93 % identity
with the human sequence. Among the 10 amino acid residue exchanges, 6 were
conservative.
Tissue speciflty
Total RNA was obtained from liver, kidney, bone marrow, spleen and brain from rats
and from human peripheral blood lymphocytes. Messenger RNA was prepared from several
rat and human cell lines. Northern blot analysis of rat RNA was performed using the 179 bp
rat eDNA probe. This probe hybridized with two rat mRNA species with approximate sizes
of 1.4 and 3.6 kb. The two different species were detected in all rat RNA preparations
analyzed (Fig. 2A). Studies of hybridization stringency indicated that the probes bound
with comparable efficiency to both mRNA species. This indicates that rats produce two
AI 2 3 4 56 7 8 910 2 3 4
c
t-28 s
t- 28 s
t- 18 s f- 18 s
8
1 o.8 1 2.4 1 o.6 1.2 2.4
Figure 2. (A) Northern blot of total RNA from rat organs. Total mRNA (20 or 40 f.lg) of liver (lanes 1 and 2),
kidney (lanes 3 and 4), bone marrow (lanes 5 and 6), spleen (lanes 7 and 8), and bram (lanes 9 and 10) were
hybridized with the radiolabelled rat eDNA probe; (B) Ratio of G1P eyclohydrolase I mRNA species (3.6 kb
mRNA/1.4 kb mRNA) in different rat tissues. (C) Northern blot of human and rat RNA. Hybridization was
performed with the human eDNA probe. Lane 1, 15 f.lg of total RNA of human peripheral blood lymphocytes
stimulated by PHA for 48 h; lane 2, 2 r.tg of mRNA of human T eellline HUT 102; lane 3, 2r.tg of mRNA of
human liver eellline HuH7; lane 4, 2 Jlg of mRNA of rat liver cell line HTC.
169
different messengers for GTP-cyclohydrolase I. The ratio of the two presumed mRNA
species varied between 0.6 and 2.4 in different rat organs (Fig. 2B). The large mRNA
species was relatively more abundant in brain and kidney. It appears likely that the 1.4 kb
species from rat corresponds to the eDNA of 1024 bp reported by Hatakeyama et aL12. This
mRNA would appear to be sufficient for the formation of the GTP cyclohydrolase I subunit
from rat as studied by Hatakeyama. The larger mRNA species has not been reported by
Hatakeyama et a1.12.
For detection of the human GTP cyclohydrolase I mRNA a radiolabelled human
eDNA probe was used that matched all known isoformsll. The human probe detected both
mRNA species of the rat (Fig. 2C). The observed cross-hybridization between the rat and
human sequences is in line with the high degree of DNA sequence homology. In Northern
blots of RNA from human cell lines and tissue, only one mRNA species was found. The
size of this band is comparable to the large mRNA species of rat. Although multiple forms
of eDNA for GTP cycylohydrolase I could be identified 11, only one band could be detected
on Northern blots of human RNA. It remains unclear if all forms of the mRNA share the
same lengths or if two forms are expressed so scarcely that they were below detection limit.
In light of the various metabolic and regulatory functions of H4biopterin, the occurence of
different mRNAs could have regulatory significance. It should be noted that the ratio of the
two mRNA species shows significant differences in the rat organs studied.The cloned
human and murine eDNA probes provide tools for the study of GTP cyclohydrolase I
regulation at the genetic level in mammalian cell systems.
The cloned eDNA Fragment of the human GTP cyclohydrolase I was used to screen a
eDNA library of human liver. Sequence analysis of isolated clones showed two different
coding regions of 250 and 213 arninoacids.
ACKNOWLEDGMENTS
We thank Dr. Elisabeth H. Weiss from the lnstitut fiir Anthropologie und
Humangenetik at the Ludwig Maximillians University Munich for providing us with the
eDNA library.
REFERENCES
1 I. Ziegler, Med. Res. Rev. 10:95 (1990).
2 I. Ziegler, K. Hamm, and I. Berndt, Cancer Res. 43:5356 (1983).
3 S. Webber, and D.J. Jaye. in: Chemistry and Biology of Pteridines, (B.A. Cooper, V.M. Whitehead, eds), pp.
235-238, Walter de Gruyter & Co., Berlin (1986).
4 R.S. Shen, andY. Zhang, Biochemical Archives 7:21 (1991).
5 K. Tanaka, S. Kaufman, and S. Milstien, Proc. Nat/. Acad. Sci. 86:5864 (1989).
6 F. Kerler, L. Htiltner, I. Ziegler, G. Katzenmeier, and A. Bacher, J Cell. Physiol. 142:268 (1990).
7 I. Ziegler, and U. Schwulera,J. Cell. Biochem. 265:17026 (1989).
8 F. Kerler, I. Ziegler, B. Schwarzkopf, and A. Bacher, FEBS Lett. 250:622 (1989).
9 I. Ziegler, K. Schott, M. Liibbert, F. Herrmann, U. Schwulera, and A. Bacher,]. Bioi. Chem.265:11026 (1990).
lO K. Schott, K. Brand, K. Hatakeyama, H. Kagamiyama, J. Maier, T. Werner, and I. Ziegler, Exp Cell Res.
200:105 (1992).
11 A. Togari, H. Ichinose, S. Matsumoto, K. Fujita, and T. Nagatsu, T. Biochem. Biophys. Res. Comm. 187:359
(1992).
12 K. Hatakeyama, Y. Inoue, T. Harada, and H. Kagamiyama,J. Bioi. Chern. 266:765 (1991).
13 G. Katzenmeier, C. Schmid, J. Kellermann, F. Lottspeich, and A. Bacher, Biochem. Hoppe-Seyler 372:991
(1991).
14 M. Giitlich, K. Schott, T. Werner, A. Bacher, and I. Ziegler, Biochim. Biophys. Acta 1171:133 (1992).
170
LOCALIZATION OF GTP CYCLOHYDROLASE I (GTPCH) mRNA IN THE RAT
BRAIN BY IN SITU HYBRIDIZATION
INTRODUCTION
METHODS
The nomenclature first described by Dahlstrom and Fuxe7 and Hokfelt et. al. 8 was used
to identify catecholamine and 5-hydroxytryptamine containing cell groups. In the
diencephalon, at the level of the optic chiasm, neurons containing GTPCH mRNA
(GTPCH+) were found scattered along the third ventricle and spread laterally above the
optic chiasm (dopaminergic (DA), Al4). Moving caudally, GTPCH+ neurons spread
laterally at the dorsal (DA, Al2 dorsal) and ventral ends of the third ventricle (DA, A12
ventral). GTPCH+ neurons were also located at the ventral surface of the brain as far
lateral as the supraoptic nucleus (DA, Al5 ventral). A group of GTPCH+ neurons emerged
caudal to the paraventricular nucleus, dorsal to the dorsomedial nucleus and within the zona
incerta (DA, A13). Another appeared caudal to Al3 and medial to the mammillothalarnic
tract (DA, All). As seen in Figure 1, the mesencephalon gave rise to GTPCH+ neurons
in the tegmentum that correspond to the well characterized distribution of the DA-neurons
Figure 1. Localization of G1PCH mRNA in the ventral tegmental area (VTA) and the substantia nigra pars
compacta (SNC). After a 4 week exposure period, GTPCH mRNA was found to be localized to cells
throughout the VTA but relatively few cells were labelled in the SNC. Bar= 100 )lm.
of the ventral tegmental area (VTA; AlO) and substantia nigra pars compacta (SNC; A9).
The GTPCH+ neurons within the SNC, however, appeared to express much lower levels
of GTPCH mRNA than did their counterparts of the VTA. Positive cells were also
observed in the substantia nigra pars lateralis (DA, A9 lateral) and pars reticulata (DA, A9
ventral). Another GTPCH+ group was located in the pineal recess of the third ventricle
that continued caudally to form the pineal gland (melatonin-containing). Figure 2a shows
intensely labelled cells distributed throughout the pineal gland at the level of the inferior
172
Figure 2. Localization of GTPCH mRNA in the pineal gland and locus coeruleus.
(a) After a 4 week exposure period, cells were intensely labelled throughout the
pineal gland with a low level of background labelling in the inferior colliculus
(IC). (b) After a 4 week exposure period, GTPCH mRNA was found to be
localized to neurons within the locus coeruleus. Other abbreviations: fourth
ventricle, IV. Bars (a and b)= 100 J.lffi.
colliculus (IC). GTPCH+ neurons were distributed around and within the rostral subnucleus
of the interpeduncular nucleus (serotonergic (5-HT) neurons). Near the caudal extent of A9
began another GTPCH+ group designated supralemniscal cells (DA-neurons; A8). At this
level GTPCH+ neurons ran along the midline (5-HT-neurons of the caudal linear nucleus
raphe, B8; and dorsal raphe, B7) and dorsal to the medial lemniscus (5-HT-neurons; B9).
Figure 3 shows heavily labelled GTPCH+ cells in the dorsal raphe. Another midline
GTPCH+ group (5-HT-neurons of the median raphe nucleus) was located caudal to A8.
Several groups of GTPCH+ neurons were located at the rostral end of the metencephalon.
Two were found in the lateral aspects of the pontine reticular formation, one close to the
lateral lemniscus (noradrenergic (NE) neurons, A7) and another in the ventrolateral pons,
medial to the trigeminal and facial nerves (NE-neurons; A5). GTPCH+ neurons were also
located off the midline below the fourth ventricle (Figure 2b) which corresponded toNE-
neurons of the locus coeruleus (A6) and subcoeruleus nucleus (A6 ventral). A fourth group
lined the midline ventral to the dorsal raphe (5-HT-neurons of the raphe pontis nucleus;
B5). GTPCH+ neurons were situated ventrally in the myelencephalon along the pyramidal
tracts comprising the raphe magnus nucleus (5-HT-neurons; B3). Another GTPCH+ group
was found in the lateral part of the roof of the fourth ventricle which forms a dorsolateral
continuation of the NE-neurons of the A6 complex (NE-neurons; A4). Further caudal,
173
Figure 3. Localization of GTPCH mRNA in the dorsal raphe. After a 4 week
exposure period, cells were heavily labelled throughout the dorsal raphe. Other
abbreviations: cerebral aqueduct, Aq. Bar = 100 pm.
GTPCH+ neurons were located in regions known to correspond to adrenergic neurons along
the midline below the fourth ventricle (C3), lateral to C3 near the nucleus of the solitary
tract (C2), and on the ventral surface lateral to the pyramidal tract (Cl). At this same level,
GTPCH+ neurons were also situated within well defined midline 5-HT neurons of the raphe
pallidus (B2) and raphe obscurus (Bl) nuclei.
GTPCH+ neurons in the rat brain thus correspond to the known monoaminergic cell
groups. The level of GTPCH mRNA expression varied across cell groups with high levels
seen in 5-HT-neurons (Bl-B9) and NE-neurons (A6), moderate levels in DA-neurons (A5,
A7, A8, and AlO), and low levels seen in DA-neurons (A9, A12-A15). Under the
hybridization and autoradiographic conditions used in this study, GTPCH mRNA could not
be unequivocally localized to any cell-type within the olfactory bulb, cerebellum or
hippocampus, brain regions known to contain large numbers of nitric oxide synthase-
positive neurons.
REFERENCES
1. M.A. Tayeh and M.A. Marietta, J. Bioi. Chem. 264:19654-19658 (1989).
2. K. Schmidt, E.R. Werner, B. Mayer, H. Wachter, and W.R. Kukovetz, Biochem. J. 281:297-300 (1992).
3. K. Hirayama, S.I. Lentz, and G. Kapatos, this volume.
4. K. Hatakeyama, Y. Inoue, T. Harada, and H. Kagamiyama, J. Bioi. Chem. 266:765-769 (1991).
5. M.F. Chesselet, L. Weiss, C. Wuenschell, A.J. Tobin, and H.U. Affolter, J. Comp. Neuroi. 262:125-140
(1987).
6. K. Hirayama, S.I. Lentz, and G. Kapatos, J. Neurochem. in press (1993).
7. A. Dahlstrom and K. Fuxe, Acta Physiol. Scand. 62, Suppl. 232:1-55 (1964).
8. T. Hokfelt, K. Fuxe, M. Goldstein, and 0. Johansson, Brain Res. 66:235-251 (1974).
174
EXPRESSION OF GTP CYCLOHYDROLASE I (GTPCH) mRNA IN THE RAT:
TISSUE DISTRffiUTION AND EFFECT OF RESERPINE
INTRODUCTION
METHODS
The following oligonucleotides derived from the rat liver GTPCH eDNA sequence
were used: primer A, 5'(dCCACCGCCATGCAGTTCTTCACCA) identical to the coding
sequence 269-292; primer B, 5'(dAGGCTGCAAGGCTTCTGTGATGGC) complementary
to the coding sequence 547-570 for amplification of GTPCH. EcoR1 and BamH1 site
sequences were included in the 5' ends of primer A and B, respectively. This sequence was
chosen for amplification and cloning because it lacks homology with other proteins known
to bind pteridines, including the enzymes, dihydrofolate reductase, sepiapterin reductase and
6-pyruvoyl-tetrahydropterin synthase7•8•9• For amplification of eDNA, total cellular RNA
extracted from rat adrenal gland (1 pg) was transcribed into a single-stranded eDNA, then
further amplification was performed by PCR. Amplification temperatures were as follows,
denaturation at 94°C for 1 min, annealing at 60°C for 1 min, synthesis at 72°C for 2 min
and extension for annealing at 72°C for 10 second per cycle. The total cycle number was
30. Double stranded rat liver eDNA (1 ng) was also used for PCR amplification. The
PCR-amplified products were run on agarose gel. As shown in Figure 1A, PCR performed
following either RT of RNA from rat adrenal gland or with rat liver eDNA generated single
products of approximately 320 bp. To confirm that the amplified DNAs corresponded to
rat GTPCH, restriction endonuclease digestion were performed at an internal BstX1 site
predicted from the published sequence for rat liver GTPCH. Digestion of either the liver-
or adrenal gland-derived PCR product generated two bands of the predicted sizes (94 and
226 bp, Figure. lB). PCR-amplified DNA was extracted from a agarose gel, and DNA was
cloned into a pGEM-3Z vector on BarnH1 and EcoR1 polylinker sites.
A B
2 3 2 3
bp bp
603-
- 603
310 -
-3 10
118-
-1 lfl
Figure 1. A: PCR products run on a 4.0% low melting agarose gel. Lane 1: PCR
product generated with rat liver eDNA. 2: DNA size markers: 1353, 1078, 872,
603,310, 271,234, 194, 118,72 bp. 3: RT-PCR product generated with 1 pg total
cellular RNA from adrenal gland. B: DNAs run on 1.2% agarose gel. 1: undigested
PCR product; 2: digested PCR product with the restriction enzyme BstX1 at 50°C
for 2 h; 3: DNA size markers.
176
Sequence analysis of insert DNA showed it to be identical to the previously reported
sequence for rat liver GTPCH.
The size and relative abundance of GTP':H mRNA in various rat tissues were
determined by Northern blot analysis. As shown in Figure 2A, hybridization at high
stringency to total cellular RNA from tissues known to contain GTPCH enzyme activity
(pineal gland, liver, adrenal gland and brainstem) detected two species of GTPCH mRNA
at 3.8 and 1.2 kb. No hybridization signal was observed on analysis of RNA from the
cerebellum, a brain region that contains extremely low levels of GTPCH enzyme activity
(Figure 2A, lane 1). The ratio of the 3.8 and 1.2 kb forms varied across tissues, with the
larger species predominating in the pineal gland, adrenal gland and brainstem, and the
smaller prominent in the liver. By Northern analysis, GTPCH mRNA in the pineal gland
was estimated to be tenfold more abundant than in the liver and one hundredfold more
abundant than in the brainstem. A preliminary characterization of the relationship of these
two mRNA transcripts to GTPCH protein was performed on whole adrenal gland RNA
following reserpine administration, a treatment known to increase GTPCH enzyme activity
in both the adrenal cortex and medulla. As shown in Figure 2B, 72 h following treatment
with reserpine, the abundance of both large and small forms of GTPCH mRNA were
increased approximately twofold. Heterogeneity of GTPCH mRNA might be the result of
alternative splicing of pre-mRNA, alternative transcription initiation sites or multiple
polyadenylation signals. In order to confirm and quantitate the occurrence of GTPCH
mRNA in rat tissues containing low levels of GTPCH mRNA, a highly sensitive nuclease
protection assay was developed. In agreement with the preliminary data obtained by
Northern analysis, GTPCH mRNA was found to be most abundant in the pineal gland (102
amoVpg RNA), with liver and spleen containing 14.1 and 3.90 amoVpg RNA, respectively.
PC12 cells, whole adrenal gland and lung were found to contain essentially equal levels of
GTPCH mRNA (1.97 to 2.20 amol/pg RNA). Low but quantifiable levels of expression
were observed in the pituitary, brainstem, kidney and thymus(~ 1 amol/ug RNA). No signal
was detected when 100 pg of striated muscle or heart RNA was assayed.
E
.a
a;
.Q
~
iii
CD a;
iii
c
...
CD
.."'
E
G)
c
~
..
CD
c
'Q.
a;
G) c > "CC 'i c0 "'
CD
(J i:i: ::i c( &a (J a:
28S-
18S-
A
Figure 2. Northern blot analysis of GTPCH mRNA. A: Total cellular RNA from
cerebellum (20 pg), liver (20 pg), pineal gland (0.35 pg), adrenal gland (20 pg) and
brainstem (lower midbrain and upper pons, 20 pg) was analyzed. Exposure time
for the lane containing brainstem RNA was approximately tenfold longer that the
other samples. No signal was detectable in the lane containing cerebellar RNA
even at this longer exposure time. 8: Total cellular RNA (20 pg) from control or
reserpinized adrenal gland 72 h after treatment.
177
300
~ 250 SCG
~
e
...... ----
-
0 200
v
"'<:<$ ~0
0 ()
~ .......
-
;>., 0 150
..= ~
0 ._,
()
;>.,
()
100
A..
G
0 12 24 36 48 60 72
Time (hours)
Figure 3. Time-course of the increase in GTPCH mRNA levels in the rat SCG, LC and SN following
administration of 10 mg/kg reserpine. Total cellular RNA from SCG (12 pg), LC (40 pg) and SN (40 pg)
were analyzed by nuclease protection assay. Data from a single experiment were plotted as a percent of basal
levels. Essentially identical data were obtained from three separate experiments.
In large part, the tissue distribution of GTPCH mRNA determined by this assay appears
to agree with that reported for BH4 and GTPCH enzyme activity. The expression of
relatively high levels of GTPCH mRNA in the spleen, lung, thymus and pituitary, tissues
that do not contain aromatic amino acid hydroxylases, may be related to the role of BH4
in cell proliferation and differentiation or as a cofactor for nitric oxide synthase.
We have also examined by nuclease protection assay the expression of GTPCH mRNA
in CA neurons of the peripheral and central nervous systems following a single reserpine
injection (Figure 3). GTPCH mRNA levels in the SCG were increased over twofold at the
earliest time-point examined (6 hours) and began to decline 72 h following reserpine
treatment. GTPCH mRNA levels in the LC were also increased twofold but this peak was
shifted to 24 h post reserpine. The increase in GTPCH mRNA levels in the SN in response
to reserpine was similar to that found in the LC, with a twofold increase above control
levels at 24 h. The increase of GTPCH mRNA in both LC and SN declined beyond 24 h
but was still elevated 72 h after treatment. In contrast to the reported specificity of the
effect of reserpine on TH mRNA, however, GTPCH mRNA levels were increased in both
NE- and DA-containing neurons in response to this drug. These data suggest that the level
of expression of GTPCH mRNA may be coupled to changes in nerve impulse flow and
accompanying second messenger systems and, that the regulation of GTPCH and TH gene
expression may not be coordinated within DA neurons of the SN.
REFERENCES
178
REGULATION OF TETRAHYDROBIOPTERIN BIOSYNTHESIS IN CULTURED
HYPOTHALAMIC AND MESENCEPHALIC NEURONS BY CYCLIC AMP
DEPENDENT GTP CYCLOHYDROLASE I GENE EXPRESSION
INTRODUCTION
METHODS
HYP and MES neurons were dissociated from day 15 rat embryos, and plated at a
density of 50 k/well in 24- well plates previously coated with a solution of 10 pg/ml of
poly-D-lysine. Cells were cultured in modified N2 medium maintained at 35°C in 10 %
C027• Medium was replaced every other day and contained 10 pM 5-fluoro-2-deoxyuridine
and 100 pM uridine for at least 7 days to suppress the growth of non-neural cells. To
HYP and MES neurons were treated with 0 to 5 mM 8-bromo-cAMP for 24 hours.
Total BH4 content was then determined by HPLC with fluorescence detection. As shown
in Figure 1, BH4levels in HYP and MES cultures were significantly increased in a dose-
dependent manner by 8-bromo-cAMP. The maximum increase of BH4 levels was 1.5 fold
greater in MES than HYP cultures. An analogue of cAMP that penetrates through the cell
membrane thus caused an increase in BH4 levels in both types of neuron. Therefore, to
elevate endogenous levels of cAMP, HYP and MES cultures were incubated with forskolin,
an activator of adenylate cyclase or 3-isobutyl-1-methylxanthine, an inhibitor of
phosphodiesterase. Incubation with 100 pM of forskolin for 24 hours produced an increase
in BH4 levels in HYP but not MES cultures. Treatment with 500 pM 3-isobutyl-1-
methylxanthine for 24 hours increased in BH4 levels 2.2 and 1.8 fold in HYP and MES,
respectively. Elevation of endogenous levels of cAMP therefore also increased the level
of BH4. The time course for the increase in BH4 levels produced by 8-bromo-cAMP (5
mM) is shown in Figure 2.
,....... ~ HYP
.....:1 300
0
~
E-< CJ MES
z
0
u 200
~
0
~
'<:t 100
::I:
~
Figure 1. Effect of 8-bromo-cAMP on BH4 levels in HYP and MES cultures. HYP and MES neurons were
treated with indicated concentrations of 8-bromo-cAMP for 24 hours. BH4 content was then determined by
HPLC with fluorescence detection. Values expressed as a percentage of the appropriate control and represent
the mean± SE of four separate experiments of six wells each. Control values were; Hyp 941 pg/well, Mes
301 pg/well.
180
BH4 levels were increased in a biphasic manner with a maximum increase at 24 hours of
incubation in both cultures. These increases in BH4 levels could be the result of either an
increase in synthesis, a decrease in degradation, or both. For the analysis of the
degradation rate of BH4, both cultures were treated with 2 mM of 2,4-diamino-6-
hydroxyprimidine, the inhibitor of GTPCH. To increase BH4 levels, cultures were first
incubated with 5 mM 8-bromo-cAMP for 24 hours. Medium was then changed to 2 mM
2,4-diamino-6-hydroxyprimidine with or without 8-bromo-cAMP for 0-8 hours. Then BH4
levels were determined. Turnover time of BH4 was not changed by incubation with 8-
bromo-cAMP. This evidence demonstrated that 8-bromo-cAMP increased BH4 levels by
stimulating BH4 synthesis without altering degradation. Therefore, BH4 biosynthesis in
HYP and MES cultures is regulated by a cAMP-dependent mechanism. In order to study
the role of gene expression in regulating BH4 biosynthesis, HYP and MES neurons were
incubated for 24 hours with 5 mM 8-bromo-cAMP with or without 2 pg/rnl of actinomycin
D, an inhibitor of transcription or 0.5 pg/rnl of cycloheximide, an inhibitor of translation.
The increase in BH4 levels produced by 8-bromo-cAMP was completely prevented by
actinomycin D and cycloheximide. These data suggested that the increase of BH4
biosynthesis by cAMP might be due to an increase in GTPCH gene expression. Therefore,
we measured GTPCH mRNA levels by nuclease protection assay. As shown in Figure 3,
GTPCH mRNA levels were increased approximately 4 and 7 fold in HYP and MES,
respectively after 5 hours treatment with 5 mM 8-bromo-cAMP. These data agreed with
the increase in BH4levels produced by 8-bromo-cAMP.
In conclusion, cAMP increases neuronal BH4 levels by increasing BH4 biosynthesis
and this increase appears to be due to an increase in GTPCH gene expression. In addition,
the regulation of BH4 synthesis by cAMP may be different within HYP and MES neurons.
If BH4 is limiting in the synthesis of NO by NOS, as it is for the synthesis of monoamines,
then these data suggest that NOS activity might be stimulated by an increase in BH4
content brought about by a receptor-mediated increase in cAMP.
400
:l ~ HYP
0
~
E-<
300
c=J MES
z
0
CJ
~
0 200
~
'-'
"<t
::X::
t:rl 100
0 2 6 12 24 36 48
TIME (HOURS)
Figure 2. Tune course for the increase of BH4 levels by 8-bromo-cAMP. HYP and MES neurons were
treated with SmM 8-bromo-cAMP for the indicated times. BH4 content was then determined by HPLC with
fluorescence detection. Values are mean± SE of four separate experiments of six wells each. Control values
were; Hyp 810 pg/well, Mes 251 pg/well.
181
;J'
0 1000
~
E-< ~ HYP
z
0
u 800 c=J MES
~
0
~ 600
'-'
<
z
~ 400
E
::t:
u
c.. 200
E-<
Cl
0
Control 5hrs Control 5hrs
Figure 3. Effect of 8-bromo-cAMP on GTPCH mRNA in HYP and MES neurons. HYP and MES neurons
were treated with 5 mM 8-bromo-cAMP for 5 hours. GTPCH mRNA was detected by T1 nuclease protection
assay and quantitated by autoradiography and laser densitometry. Values are mean ± SE of three experiments.
Control Values were; HYP 2.5 amole/pg RNA, MES 2.4 amole/pg RNA.
ACKNOWLEDGEMENT
We thank Mr. Gary M. Bora for his excellent technical assistance. This work was
supported by NIH grant NS 26081.
REFERENCES
1. S. Kaufman, In, Aromatic Amino Acids in the Brain, CIBA Foundation Symposia, Vol. 22, pp. 85-115.
Elsevier, Amsterdam. (1974).
2. N.S. Kwon, C.F. Nathan, and DJ. Stoehr, J. Bioi. Chem. 264, 20496-20501. (1989).
3. M.A. Tayeh, and M.A. Marietta, J. Bioi. Chem. 264, 19654-19658. (1989).
4. K. Schmidt, E.R. Werner, B. Mayer, H. Wachter, and W.R. Kukovetz, Biochem. J. 281, 297-230.
(1992).
5. C.A. Nichol, G.K. Smith and D.S. Duch, Ann. Rev. Biochem. 54, 729-764. (1985).
6. R.A. Levine, G. Kapatos, S. Kaufman, and S.J. Milstein, J. Neurochem. 54, 1218-1224. (1990).
7. G. Kapatos, J. Neurochem. 55, 1995-1201. (1990).
8. T. Fukushima, and J.C. Nixon, Anal. Biochem. 102, 176-188. (1980).
9. K. Hirayama, S.I. Lentz, and G. Kapatos, J. Neurochem. in press. (1993).
10. P. Chomczynski, and N. Sacchi, Anal. Biochem. 162, 156-159. (1987).
182
MYCOPHENOLIC ACID SIMULTANEOUSLY REDUCES INTRACELLULAR
GTP AND TETRAHYDROBIOPTERIN LEVELS IN NEUR0-2A CELLS
INTRODUCTION
The materials used were the same as those described previously 19 • Neuro-2a cells
were obtained from the American Type Culture Collection (Rockville, MD). The cells
were maintained at 37°C in a atmosphere containing 5% C02 and cultured in Eagle's
minimum essential medium containing 10% fetal calf serum, 0.1 mM nonessential amino
acids, and 2 mM glutamine. The culture medium was changed every 2 days and subcultur-
ing was done every 4 days with the use of a trypsin solution. For experimental use, Neuro-
2a cells were plated on 6-well tissue culture plates (Falcon) at a density of 2.5 X 105 cells
per well (9.6 cm 2) and grown for 2 days. The cells were then washed with Hank's bal-
anced salt solution and incubated for 10 h in serum-free defined medium (Eagle's mini-
mum essential medium containing 0.1 mM nonessential amino acids, 2 mM glutamine, 5
,ug!ml bovine insulin, 5 ,ug!ml human transferrin and 30 nM selenium) containing myco-
phenolic acid and/or guanine compounds as indicated in the text. High performance liquid
chromatographic analysis of nucleotides and pteridines, enzyme assay, and protein assay
were performed as described previously 19 •
As shown in Table I, Neuro-2a cells contained all three BH4 biosynthetic enzymes as
well as the recycling enzyme dihydropteridine reductase. GTP cyclohydrolase I was found
to be the rate-limiting enzyme in Neuro-2a cells and the activity of dihydropteridine reduc-
tase appeared sufficient to regenerate all the BH4 in the cells (Table I). Therefore the reac-
tion rate of GTP cyclohydrolase I in Neuro-2a cells should be reflected in the intracellular
BH4 levels.
nmol/h·mg ofprotein
184
tween the GTP and biopterin levels, we plotted the GTP values against the corresponding
biopterin values shown in Fig. 1. As shown in Fig. 1B, the shape of the curve was sigmoi-
dal. Mouse GTP cyclohydrolase I extracted from Neuro-2a cells exhibited sigmoidal
saturation kinetics (Fig. 2A), as do rat and human enzymes 19 • The Hill coefficient of the
enzyme was 2.3 (Fig. 2B), which is similar to those of rat and human enzymes (2.9 and 2.5,
respectively). The similarity between the GTP-biopterin curve (Fig. 1B) and the sub-
strate-velocity curve of GTP cyclohydrolase I (Fig. 2A) implies that the enzyme also be-
haved cooperatively in Neuro-2a cells.
0.25-
c 0.3
6 .:: !0 8
c·a; 'Gi
a.
J
i5
i5
0.20
a. OJ
E
0.2
a. 4 E
OJ
~
OJ 0.15 ...... E
E 0 5 0.1
E
~ .=
E 0.10 5
5 2 .= Gi
15.
0.05 !
0.. 0 0
1-
(!) 0
ii'i 0 2 4 6
ii'i GTP (nmol/mg protein)
0 0
0 0.01 0.03 0.1 0.3 1.0
Mycophenolic acid lpMl
Figure 1. A. Effect of mycophenolic acid on intracellular GTP and biopterin levels in Neuro-2a cells.
Neuro-2a cells were treated with various concentrations of mycophenolic acid for 10 h. GTP (•) and biopter-
in (o) were measured by high performance liquid chromatography. The data shown are from two independent
experiments that yielded similar results. Each point represents the mean from the two experiments; the bars
represent the standard error. B. Relationship between intracellular GTP and biopterin levels in Neuro-2a
cells. The GTP values were plotted against biopterin values shown inA.
The level of intracellular GTP in Neuro-2a cells was 6 nmol/mg protein, which is
nearly equal to the values obtained in PC-12 and IMR-32 cells. Since the level of intracel-
lular GTP in PC-12 and IMR-32 cells has been estimated to be 150 .uM19, the level of
intracellular GTP in Neuro-2a cells would also be 150 .uM. On the other hand, the K05
value of mouse GTP cyclohydrolase I (220 .uM, Fig. 2A) was 3-fold than those of the nit
and human enzymes (60 .uM and 70 .uM, respectively) 19• At 150 .uM, GTP cyclohydrolase I
in Neuro-2a cells should exert only 30% of its Vmax value, as estimated from the data in
Fig. 2A. Consistent with this inference, the GTP-biopterin curve for Neuro-2a cells (Fig.
1B) appeared not to be saturated, unlike the curves for PC-12 and IMR-32 cells, which
were saturated19 • Furthermore, if this inference is correct, an increase in the intracellular
GTP level in Neuro-2a cells would be accompanied by an increase in the intracellular
biopterin level. However, since the addition of guanine, guanosine, or GMP did not result
in a higher GTP level in Neuro-2a cells, probably because there was no functioning sal-
vage pathway from these compounds to GTP, we could not verify our inference.
In conclusion, mycophenolic acid simultaneously reduced the GTP and biopterin
levels in mouse Neuro-2a cells. At this lower level, GTP was capable of altering the
intracellular BH4 concentration. Intracellular mouse GTP cyclohydrolase I appeared to
behave in a cooperative manner. The same observation have been made in rat and human
neuronal celllines 19 •
185
0.4 2 ,---,----,---.
A B
:2
g 0.3 g
E I
)(
>.
"'
~
~ 0.2 0
ti
< ~
OJ
~ 0.1
>.
.3 -1
N
c:
w
0 -2
0.2 0.4 0.6 0.8 1.0 -5 -4 -3 -2
Figure 2. A, Effect of various concentrations of GTP on GTP cyclohydrolase I activity in Neuro-2a cells.
The enzymes were extracted from 108 cells and assayed as described in the text. The data shown are repre-
sentative of two experiments. B, Hill plots. Hill plots were drawn from the data presented inA.
REFERENCES
186
HUMAN LIVER 6-PYRUVOYL-TETRAHYDROPTERIN SYNTHASE:
EXPRESSION OF THE eDNA, PURIFICATION AND PRELIMINARY
CHARACTERIZATION OF THE RECOMBINANT PROTEIN
INTRODUCTION
Tetrahydrobiopterin (BI4) is the coenzyme for several monooxygenases such as the
aromatic amino acid hydroxylases, the glycerol ether monooxygenase, and the nitric oxide
synthases1,2. A lack of BH4leads to hyperphenylalaninemia and a deficiency of biogenic
amine neurotransmitters, which are responsible for severe mental retardation3. The most
common form, where BH4 biosynthesis is impaired, is a deficiency in 6-pyruvoyl-
tetrahydropterin synthase (PTPS). PTPS catalyzes the second step in the BH4 biosynthetic
pathway, the conversion of 7 ,8-dihydroneopterin triphosphate to 6-pyruvoyl
tetrahydropterin. This triphosphate eliminating reaction requires Mg2+ as a cofactor. As a
means to better characterize biochemically the PTPS, we recently cloned the human liver
cDNA4. Expression of the recombinant enzyme in E. coli allowed us to isolate and purify
the active PTPS in large amounts. This article describes the overproduction and
purification, and gives a prelimi.1ary characterization of some physical properties of the
recombinant human enzyme.
6 7 kDa
- 78.0
- 66,3
- 42,7
- 30,0
- 17,0
-12,3
Figure 1. SDS-polyacrylamide gel electrophoresis of fractions from PTPS punfication. Ahquots were
analyzed on a 12% polyacrylamide gel and stamed with Coomassie bnlhant blue. Lane 1, prestamed
molecular mass standards, lane 2, E coil lysate (fraction I, 20 J..tg), lane 3, flow-through followmg loading
onto amylose resm column (20 Jlg); lane 4, eluate from amylose resm column (fraction II, 5 Jlg); lane 5,
fraction II after cleavage by factor Xa (5 Jlg), lane 6, pool of active fractions from gel filtratiOn (fractiOn III,
5 Jlg); lane 7, molecular weight marker (Sigma IV).
188
Table 1. Purification of recombinant human liver PTPS from E. coli TB 1 (pMAL-c2-
PTPS) expressing a MBP-PTPS fusion polypeptide.
ml mg mU mU/mg % -fold
I. Lysate 250 1250 939 0.75 100 1
II. Amylose 6 75 917 12.2 98 16
III. Gel filtration 26 13 746 57.4 79 77
lone unit (U) is defined as the amount of enzyme that catalyzes the production of 1 J..lmo1 Blf4/min6.
10.5 60
'pH 4.8
m
8.5 45 c;·
...
"0
CD
::t ~.
:::J
I• I
Q.
6.5 30 ,....,
:::J
pH • Biopterin
3
0
.:::::::
4.5 15
r
......
2.5,_~~~.-~~~~~-.-.~-r~.-~~~~o
0 2 4 6 8 10 12 14 16 18 20
Fraction number
Figure 2. Determination of the pi value for the active recombinant human PTPS. Isoelectric focusing was
performed using the Rotofor cell (BioRad) and 30 J..lg of purified PTPS (fraction III) in a 40 ml 2%
ampholyte solution (Biolyte, pH gradient from 3 to 10). Subsequently, aliquots from individual chambers
were assayed for activity (Biopterin production). Enzyme activity was detected in a single peak,
corresponding to a pi value of 4.8.
A comparison of the deduced amino acid sequences from the cDNAs between the rat5 and
human liver PTPS revealed an almost identical protein sequence, except for the N-
terminallO amino acids4. TheN-terminal protein sequence of the mature rat liver enzyme
was found to match the residues starting from amino acid 5 when compared to the isolated
rat eDNA Thus, this enzyme appears to be processed and contains 140 residues with a
189
molecular mass of 15,855 Da5. The mature N-terminal end of the human liver enzyme is
not known, however. We expressed and purified also the rat liver eDNA consisting of 140
amino acids, using the same pMAL expression system as described for the human liver
enzyme (unpublished). The calculated isoelectric point of the rat protein was 7.15.
Isoelectric focusing and SDS-polyacrylamide gel revealed two major peaks migrating at pi
values of 7.15 and 7.4, plus several weaker signals migrating at lower pi values (data not
shown). In comparison, the recombinant human liver PTPS had a calculated pi value of
6.67, and upon isoelectric focusing and SDS-polyacrylamide gel showed two major peaks
at 6.7 and 6.9, plus one minor peak at 6.35 (data not shown). Thus, the calculated pi of
both proteins, rat and human, agreed well with the observed values of the unfolded
polypeptides (denatured by urea). In contrast, determination of the pi for the human
recombinant protein under native conditions revealed a value of 4.8 (Fig. 2), resembling a
similar pi value of 4.4 to 4.6 for the native human liver enzyme published earlier?. The
discrepancy for the human PTPS between the unfolded monomeric form (pl=6.7)
compared to the native multimeric protein (pl=4.8) towards a lower pi for the active
enzyme suggests that the native form must be negatively charged, and thus is exposing
more acidic amino acids at the surface.
ACKNOWLEDGMENTS
We thank F. Neuheiser for skillful technical assistance. This work was supported by
a grant from the Swiss National Science Foundation (No. 31-33897.92), and in part by the
Helmut Horten Stiftung, the Stiftung fiir wissenschaftliche Forschung an der Universitat
ZUrich, and the Ciba-Geigy-Jubilaums-Stiftung.
REFERENCES
1. D.S. Ouch and G.K. Smith GK, J. Nutr. Biochem. 2:411 (1991).
2. R.C. Prince and D.E. Gunson, Trends Biochem. Sciences 18:35 (1993).
3. C.R. Scriver, S. Kaufman and S.L.C. Woo, The hyperphenylalaninemias, in: "The Metabolic Basis of
Inherited Disease," C.R. Scriver, A.L. Beaudet, W.S. Sly and D. Valle, eds., McGraw-Hill, New York
(1989).
4. B. ThOny, W. Leimbacher, D. Biirgisser and C.W. Heizmann, Biochem. Biophys. Res. Comm. 189:1437
(1992).
5. Y. Inoue, Y. Kawasaki, T. Harada, K. Hatakeyama and H. Kagamiyama, J. Bioi. Chern. 266:20791
(1991).
6. S.-I. Takikawa, H.-Ch. Curtius, U. Redweik, W. Leimbacher and S. Ghisla, Eur. J. Biochem. 161:295-302
(1986).
7. D. Heintel, W. Leimbacher, U. Redweik, B. Zagalak and H.-Ch. Curtius, Biochem. Biophys. Res. Comm.
127:213 (1985).
190
ENZYMATIC PROPERTIES OF 6-PYRUVOYL TETRAHYDROPTERIN
SYNTHASE PURIFIED FROM FAT BODIES OF SILKWORM LARVAE
Masahiro Masada
INTRODUCTION
RESULTS
PTP synthase activity was measured based on the observation that pterin was quantita-
tively produced from the enzymatic product, PTP, by the chemical degradation under the
acidic condition when the enzyme reaction was terminated9• This method had made
possible to investigate directly the enzymatic properties.
PTP synthase was purified from fat bodies of silkworm larvae by procedures including
heat treatment, ammonium sulfate fractionation and column chromatographies on hydroxy-
lapatite, DEAE-Toyopearl, and Ultrogel AcA44. Finally, the preparation was purified to
homogeneity by a mean of preparative disc electrophoresis. ·
The molecular weight was estimated by three different methods. The molecular weight
of enzyme was calculated to be about 87,000 and 85,000 by the gel filtration using Ultrogel
.E
c
0
u
(lj
~
~
c
~ 0.1
10 20
Mg 2 + concentration (mM)
Figure 1. Effect of Mg2+ concentration on the activity
192
AcA44 and TSKgel G3000SW, respectively. By the method with native PAGE, the molecu-
lar weight was estimated to be about 72,000. The purified enzyme gave a single band on
SDS-PAGE and the molecular weight of the band was estimated to be 18,500. These re-
sults indicate that PTP synthase from fat bodies of silkworm larvae is composed of four
identical subunits.
The absorption spectrum of PTP synthase showed a single peak at 280 nm.
The pH optimum of the enzyme activity was around 8.5, and the activity showed
significant difference in the buffers used (data not shown).
The enzyme activity was inhibited by sulfhydryl reagents such as pCMB, monoiodoac-
etate and N-ethylmaleimide. The enzyme activity had not been affected by other inhibitors
examined.
Effect of Mg2+ concentration on the activity showed a biphasic pattern as shown in
figure. The Km values for Mg2+were calculated to be 2.0 x w- 3 and 2.1 x w-4 M, respec-
tively. On the other hand, the Km values for dihydroneopterin triphosphate in the presence
of 1 or 5 mM of Mg2+ were calculated to be almost the same value, 1.28 x 10-5 and
1.69 x 10-5 M, from each Lineweaver-Burk plot.
Effects of some divalent cations were demonstrated as shown in table. Some divalent
cations such as Ca2+ , Mn 2+ and Ba2+ also stimulated the enzyme activity. However, the
additional effect of Mn2+in the presence of Mg2+ at various concentrations was competitive
and/or inhibitory on the activity. The addition of Ca2+ to the reaction mixture containing of
a low concentration of Mg2+ (1 mM) was revealed to be an additive effect. On the other
hand, when each 5 mM of Ba2+ and Sr2+ was added to the reaction mixture containing the
same low concentration of Mg2+ (1 mM), the activity was greatly accelerated. Those addi-
tions of both Ba2+ and Sr2+ had revealed to be the synergistic effects on the activity in the
presence of Mg2+ .
When each 5 mM of Ca2+ and Ba2+ was, respectively, added to the reaction mixture,
the effect of Mg2+ concentration on the activity showed typical Michaelis-Menten kinet-
ics on the both cases. However, the activity in the presence of Mn 2+ (5 mM) had de-
creased in proportion to the increase of Mg2+ concentration. Under the condition of the
reaction mixture containing a low concentration of Mg2+ (1 mM), effect of Ca2+ concen-
tration showed typical Michaelis-Menten kinetics, while that of Ba2+ concentration on the
activity showed a biphasic pattern.
From these results, the physicochemical properties of this enzyme was almost similar to
those of other enzymes reported. Concerning to the enzymatic properties, the result ob-
tained in this experiment could not be compared with those of other enzymes because the
assay method was completely different. On the properties of silkworm enzyme, the posibili-
ty may be speculated that this enzyme has two binding site for Mg2+ and each site may
independently contribute to the expression of enzymatic activities. One site of them has the
replaceable ability to other divalent cations. However, another binding site for Mg2+ may be
essential for the expression of enzymatic activities.
REFERENCES
193
S.Arashima,and M.Kawaguchi, A defective enzyme in hyperphenylalaninaemia due
to biopterin deficiency, J.Inher.Metab.Dis. 6:127(1983)
4. H.Shintaku,A.Niederwieser,W.Leimbacher,and H.-Ch.Curtius, Tetrahydrobopterin
deficiency:assay for 6-pyruvoyl tetrahydropterin synthase activity in erythrocytes, and
detection of patients and heterozygous carriers, Eur.J.Pediatr. 147:15(1988)
5. S.Takikawa,H.-Ch.Curtius,U.Redweik,W.Leimbacher, and S.Ghisla, Biosynthesis of
tetrahydrobiopterin. Purification and characterization of 6-pyruvoyl tetrahydropterin
synthase from human liver, Eur.J.Biochem. 161:295(1986)
6. T.Hasler,and H.-Ch.Curtius, Purification and characterization of 6-pyruvoyl
tetrahydropterin synthase from salmon liver, Eur.J.Biochem. 180:205(1989)
7. Y.S.Park,J.H.Yim,K.B.Jacobson,and J.J.Yim, Purification and characterization of
6-pyruvoyl tetrahydropterin synthase from Drosophila melanogaster,
Biochim.Biophys.Acta. 1038:186(1990)
8. Y.lnoue,Y.Kawasaki,T.Harada,K.Hatakeyama,and H.Kagamiyama, Purification and
eDNA cloning of rat 6-pyruvoyl tetrahydropterin synthase,
J.Biol.Chem. 266:20791(1991)
9. M.Masada,J .Matsumoto,and M.Akino, Biosynthetic pathway of pteridines and their
association with phenotypic expression in vitro in normal and neoplastic pigment cells
from goldfish, Pigment Cell Research. 3:61(1990)
194
NORTHERN BLOT ANALYSIS OF SEPIAPTERIN
REDUCTASE mRNA IN MAMMALIAN CELL LINES
AND TISSUES
INTRODUCTION
Recent evidence has shown that H4biopterin is synthesized in cells which undergo cy-
tokine-directed proliferation and do not use H4biopterin as a hydroxylation cofactor.
H4biopterin, in turn, enhances the proliferation of erythroleukemic cells and modulates vari-
ous aspects of the interleukin-2-induced clonal expansion ofT cells. 1 In these cells the ac-
tivity of sepiapterin reductase (SR) is in the range of 100 pmol min·l mg-l.Lectin stimulation
of resting T cells causes a slowly progressing increase, starting from levels below detection
and a transient enhancement of SR activity is found after treatment of activated T cells by
interferon-'Y plus interleukin-2.1 The NK-like human cell line YT and the murine erythroleu-
kemic cell line B8/3 lack any SR activity. The molecular basis of SR regulation has not been
explained in any of these cases.
Based on the published sequence of rat SR cDNA2 we constructed eDNA probes
which specifically hybridize with rat, murine, or human SR mRNA, respectively. They were
used for Northern blot analysis of mRNA expression in different cell lines and tissues of
these mammalian species.
PCR amplification of eDNA derived from mRNA, purification, cloning and sequencing
of PCR products were performed as described previously.3A Fragments of eDNA specifi-
rat 614 AG TTG GCC CGG GAA ACC TCC ATG GAC CCA GAG TTG AGG AGC AGA CTG
mouse .. T .A. .. . . . A . . . . . . . A.
man . . . . . . . . . . . . . G . . . . . . G. . . . . . . . . . C A .. C.A .AA G.G .. .
rat 661 CAG AAG TTG AAT TCT GAG GGG GAG CTG GTG GAC TGT GGG ACT TCA GCC
mouse •• G •• G •• T .C.
man ... G.. C . . . . G G.A A . . . . . A . . . . . . . . . . T .. C AA. GTG . . . . . .
rat 715 CAG AAA CTG CTG AGC TTG CTG CAA AGG GAC ACC TTC CAA TCT GGA GC 755
mouse G.. .A. ..G
man . . . . . . . . . . . . . . . . . A ... G . . . A . . . . GAG ... A.G . . . . . . . .
Figure 1. Sequence alignment of the eDNA fragments obtained by PCR primers GGACACCAACATGCA-
GC and TCATAGAAGTCCACGTGG. Identical primary structure is indicated by points. The positions are
indicated according to the published eDNA sequence of rat SR. 2
The low steady state mRNA levels in cells need isolation of poly-A+-mRNA prior to
Northern blot analysis. Probes labeling of PCR products with [a- 32P]dCTP and hybridiza-
tion was performed as described.3,4 Two mRNA species for SR were detectable (Figure 2).
Their sizes were 1.3 and 2.1 kb for rat, 1.3 and 2.3 kb for mouse and 1.6 and 2.1 kb for hu-
man cell lines. Analysis of the rat system showed that the 2.1 kb mRNA species, which was
found in the liver cell line HTC and activated rat thymocytes was absent in kidney, liver,
brain and spleen (Figure 2). The lengths of the 1.3 kb rat mRNA and of the 1.6 kb human
mRNA both agree with the published eDNA clone lengths, respectively.2. 6,7
For further characterization of both murine mRNA species the signal intensity of hy-
bridization obtained under washing conditions of varying stringency was compared. This
shows a more stable interaction of the 1.3 kb mRNA species with the eDNA probe as com-
pared to the 2.3 kb species. This may argue against the hypothesis that both mRNA species
are alternatively spliced forms with identical protein coding regions. The detection of two
SR mRNA could support the existence of SR isozymes. The similarity of eDNA fragments
was higher among both rodents than between the rodents and man. Due to these species-
specific differences cross-hybridization of a rat probe with murine mRNA yielded a mark-
edly stronger signal than equal amounts of mRNA from human sources (Figure 3).
No SR activity had been detected in both the human NK-like cell line YT and in the
murine erythroleukemia cell line B8/3. Northern blot analysis of both cell lines demonstrated
that the absence of enzyme activity correlates with a lack of mRNA expression (Figure 4).
The specific activities of SR vary among different cell types and cell lines of a species. A
196
28 s
28 s
18 s
18 s
man rat
u ..., .... c:
·ac:
>-
.r::
N N N u >-
f- I
I I 2 c.:> f- Q) Q) Q)
f- c:
.,
I ....J ~
~
Q)
I
....J t-
a_ -o 0..
1..
..0
f- rn :y
u I
:J
I
"'
Figure 2. Northern blot analysis of mRNA (5 jlg) specific for SR in rat, murine, and human cell lines and
tissues. The positions of 18 Sand 28 S rRNA are indicated.
A
•
B
rat mouse
- man
>-U N' N N
..r:: I- I I Q<..:l
I- I _J~
_J 3
I - a.
1-[IJ :J Q)
u :r:I
comparison among the cell lines of a species demonstrates that a decrease in specific activity
correlates with a decrease in the steady state mRNA levels.
The data demonstrate a major difference between the regulation of GTP-cyclohydro-
lase I and of SR activity. Previous studies have suggested that a post-translational modifica-
tion essentially contributes to the regulation of GTP cyclohydrolase I. 3,8 In contrast, protein
modification does not appear to contribute to the regulation of SR activity. SR mRNA ex-
pression is absent in human NK-like cell line YT and in the murine erythroleukemia subclone
B8/3 which both lack SR activity. Moreover, the relative mRNA expression correlates with
the enzymatic activities of different cell lines within the same species (Figure 4). This indi-
cates that SR activity is regulated by its steady state mRNA levels.
Acknowledgment
Support by Grant ZI 153/5-2 of the Deutsche Forschungsgemeinschaft is acknowl-
edged.
197
"E>- lO A
N >- 0.8
~~ 0.6
1):;::
> u
:;: 0 0.4
0
...
"ii 0.2
0
< lO B
z
a:: c 0.8
E ·~ (II 0.6
CD
-~ ...Q.
CD
0.4
0 Ill
...
"ii 0.2
0
c
a::
VI
(II
0
:0
.....,c:
=
... .s
z
0
3
D
.&J
~
i
<0..
m en ret mouse
1- N N >- (.) N ..., z ,.,.,
>- ~ <-' ~
1-
1- I I -.t .........
.....
:I:
..,Q.
..J
1- ..J ~ 00
m
~
:I:
1- m
:I: (.)
Figure 4. A: Relative enzymatic activities of SR; B: relative SR mRNA expression; C: Northern blot analy-
sis of SR mRNA with species-specific probes; D: rehybridization with a eDNA probe for ~-tubulin ; the rela-
tive values of the liver cell lines were set to 1.0. 5 11g of poly-A+-enriched mRNA was applied to each lane;
b.d., below detection limit; Thy, thymocytes 48 h after activation.
REFERENCES
198
PURIFICATION AND PROPERTIES OF HUMAN
SEPIAPTERIN REDUCTASE FROM PLACENTA
INTRODUCTION
Recently H4biopterin was found to be synthesized in cells which do not use it as a hy-
droxylation cofactor. This is the case during cytokine-directed proliferation and differentia-
tion of cells which participate in hematopoiesis or immune response.!
Sepiapterin reductase (EC 1.1.1.153) (SR) catalyzes the last step in the biosynthesis of
H4biopterin. The enzyme reduces 6-pyruvoyl-H4pterin in two steps to H4biopterin using
NADPH as source of the hydride equivalents. In the above mentioned cells the activity of
sepiapterin reductase was in the range of 100 pmol min-I mg-1. A similar range was found in
human placenta. This tissue also does not use H4biopterin as a hydroxylation cofactor,
which, in contrast, is the case for liver or brain.
This study describes a method for purification of sepiapterin reductase from human
placenta to a homogeneity of 90 % with a final recovery of 4.7 %. A purification scheme
based on ammonium sulfate fractionation, hydroxyapatite chromatography, QAE-Sephadex
chromatography, isoelectric focusing in granulated gels and gel filtration by HPLC was ap-
plied. A polyclonal rabbit-antiserum was produced. Physicochemical and catalytical proper-
ties of the enzyme were investigated and were compared with those of the rat erythrocyte
enzyme and the human liver enzyme previously reported.2,3
Enzyme Purification
........,
::E
..........
-Protein SR activity ~ ... Gradient f""'
0.6 '[' 3.0 3.0
CJ)
E
L.
....
Q) E
.... I
I
:J 0.5
·ec
/I 2.5
.0
12.5 II
II
Q)
+-
0
0.4 s:: 2.0
0 II 2.0 0
..s:: +: I I E
c
c. 0 I I ..............
Ill
0
0.3 L.
+- 1.5 I I 1.5 ..........
..s:: s:: >-
c. Q) 1.·1" +-
·s;:
....0 0.2 (.)
c 1.0 .·r I 1.0 +:
0 I (.)
(.)
I 0
+-
s:: 0.1 c 0.5 0.5 Q)
Q) ·o; E
'6 +-
>-
0 0 0
L. 0 0 N
c
L.
a..
~
0 25 50 75 100 125 150 175 200 w
Fraction number
Figure 1. Chromatography on hydroxyapatite; elution with a 20-300 mM sodium phosphate buffer (pH 6.0)
gradient; flow rate 0.8 ml min·1; 4-ml fractions.
200
-- Protein
f""'
Gradient SR activity Ol
f""' 0.8 E
1.0 E 'T
4 c
Ol
.E
..sc: 0.6
~
~
(3 0.8 0
-- -
0 0 3 E
z :;:::
-
c
.......
0
0.6 ...0 0.4
c: 2 ·;;:>-
cQ) 0.4 Q)
0 :;:::
c:
'5 0
0.2
0
... 0
-
0 0
(.!) 0.2 c Q)
·a; E
>-
0 ...0
a...
0 0 w
N
c
0 5 10 15 20 25 30 35 40 45 50
Fraction number
Figure 2. Chromatography on QAE-Sephadex; elution with 0-1 M NaCl in buffer B; flow rate 0.9 ml min-I;
5-ml fractions.
with a spatula. The pH of the gel fractions was measured and the proteins were eluted with
buffer C (100 mM sodium phosphate buffer pH 6.8, 100 mM KCl). The pi of the enzyme
was 8.4 (Figure 3).
Gel Filtration. Enzyme solution containing 0.4 mg of protein was applied to a TSK-
3000 HPLC column equilibrated with buffer C. The enzyme showed a retention time as if it
had a molecular weight of 45.3 kDa compared with standard proteins (Figure 4). The results
of the purification procedures are summarized in Table 1.
SDS gel electrophoresis indicated an apparent molecular weight of 28 kDa. From pro-
tein band quantification data the activity of the pure SR of human placenta was estimated to
be about 1 !lmol min-I mg-1. The pi was 8.4. The~ values were 20 11M for sepiapterin and
6 11M for NADPH. A polyclonal rabbit-antiserum was produced. It precipitated the enzy-
matic activity of SR and stained two protein bands of molecular weights 28,000 and 56,000
in a Western blot analysis. The published eDNA of human SR encodes also a 28 kDa pro-
-
0 1? 8 :;:::
- -
s
E 20 Q 0.8 ...0
7 c:
0 Q)
>- 15 0.6 0
c:
·;;: =a.6 0
:;::: 10 0.4 0
-...
0
0 c
Q) 5 5 0.2 ·a;
E 0
>-
N 0 4 0 a...
: :
c
w 0 :s: !10! !15! 20: Fraction No.
Protein print 111 II I 111111111111111 1111111111111111 II II II II II I I I
Figure 3. Isoelectric focusing in a granulated gel of Sephadex G-200. Enzyme solution was applied between
fraction 1 and 5. The protein print was obtained by rolling down a cellulose acetate strip on the gel layer and
staining it with Ponceau S (Serva, Heidelberg, Germany).
201
tein. 5 The data indicated that human SR from placenta resembles the rat enzyme which is an
homodimer of 56 kDa. 2 A second protein band, as described for human liver3 was not found
to be associated with enzyme activity in placenta.
~
-Protein Enzyme activity ~
I
I 0>
E 150 E
:l
0> 1000 'ic:
........ .E
--
c:
.Q 100 0
0 E
-
I.. c:
........
c: 500
Gl
(J >-
c:
0 50 '>
+=
-
(J
(J
c: 0
'i Gl
0 0 0 E
I..
a.. >-
N
20 25 30 35 40 45 50 55 60 c:
L&J
Fraction number
Figure 4. HPLC gel filtration on TSK-3000; flow rate 100 J!l min-1; 0.5 ml fractions.
ACKNOWLEDGEMENTS
REFERENCES
202
STIMULATION OF TETRAHYDROBIOPTERIN SYNTHESIS BY CYTOKINES IN
HUMAN AND IN MURINE CELLS
INTRODUCTION
As a next step, we determined the activities of the three enzymes catalyzing the
pathway from GTP to tetrahydrobiopterin in the cells 21 • We found that only GTP-
cyclohydrolase I is stimulated by interferon-gamma. The long time required for reaching
the maximal activity (about 24 hours) as well as the unchanged Km value suggest that the
mechanism of this stimulation is a de novo synthesis of GTP-cyclohydrolase I protein.
Upon interferon treatment, the activity is stimulated up to 100 fold, as measured at
saturating concentrations of GTP. Compared to this pronounced increase in biosynthetic
activity, the observed up to two-fold increases in intracellular GTP15 might be only of
minor importance for the regulation of pteridine synthesis in interferon treated cells. As
can be deduced from work with neuronal cell lines 22 , a twofold change in intracellular
GTP corresponds to an about 25% change in intracellular pteridine concentrations.
Following treatment with interferon-gamma, however, intracellular pteridine concentrations
increase 10 to 30-fold18 •
Enzyme activities subsequent to GTP-cyclohydrolase I, i.e. 6-pyruvoyl tetrahydropterin
synthase and sepiapterin reductase are constitively present in the cells and remain
unchanged by the interferon-treatment21 • The activity of the induced GTP-cyclohydrolase
I relative to the activity of the constitutive 6-pyruvoyl tetrahydropterin synthase was found
in good agreement with the observed pteridine patterns. Human macrophages, which have
the lowest 6-pyruvoyl tetrahydropterin synthase activity, form 50 times more neopterin
than biopterin derivatives. Nevertheless, biopterin concentrations in macrophages are still
controlled by GTP-<:yclohydrolase I activites. The reason for this is the comparatively high
Km of 6-pyruvoyl tetrahydropterin synthase, which in human liver 3 as well as in cultured
human cells24 was found to be 10 .uM. In human fibroblasts both enzyme activities are of
the same order of magnitude, resulting in about equal concentrations of neopterin and
biopterin in these cells. In T-24 cells, 6-pyruvoyl tetrahydropterin synthase activity is
considerably higher than the induced GTP-cyclohydrolase I, so that 50 times more
204
biopterin than neopterin derivatives are formed21 • The reasons for the varying activities of
6-pyruvoyl tetrahydropterin synthase in human cells are unclear. It will be interesting to
learn whether these cells contain different amounts of 6-pyurvoyl tetrahydropterin synthase
protein. Another possibility is that the human enzyme has become more vulnerable to
damage by the environment than enzymes from other mammalian species. This
environment may be more aggressive in macrophages than in other cells, causing the
extraodinarily low activity of 6-pyruvoyl tetrahydropterin synthase activities of human
macrophages.
Comparing intracellular and extracellular pteridine concentrations 18 , it is evident that
tetrahydrobiopterin is held more efficiently in the cells compared to neopterin derivatives.
7, 8-Dihydroneopterin triphosphate accumulating in the cells is cleaved by phosphatases 21 ,
and the resulting dihydroneopterin and neopterin leak from the cells and give rise to the
increased neopterin concentrations in body fluids of patients with diseases, in which
cytokines are produced due to activation of cell mediated immunity. The retention of
tetrahydrobiopterin in the cells may explain why biopterin levels are only slightly increased
in humans with immunology-associated increase of neopterin concentrations.
Our in vitro investigations clearly demonstrate that the increase of neopterin in humans
due to cytokine action originates from increased tetrahydrobiopterin synthesis due to
stimulation of GTP-cyclohydrolase I. In children with 6-pyruvoyl tetrahydropterin synthase
deficiency, in contrast, the block of the enzyme metabolizing 7 ,8-dihydroneopterin
triphosphate to 6-pyruvoyl tetrahydropterin causes a drop in biopterin concentrations along
with the increase of neopterin25 •
Due to the rapid discovery of new cytokines and the limited availability of many of
these new mediators, no complete survey of activating cytokines is available. In human
cells, interferon-gamma is the most active single agent13 •20•26-29 • Some of the cells like
macrophages 26-28 , human THP-1 myelomoncytoma cells 20 , human umbilical vein endothelial
cells30 also respond to lipopolysaccharide by increase of GTP cyclohydrolase I activities.
In presence of T-lymphocytes, however, lipopolysaccharide acts in an indirect way by
triggering formation of cytokines such as interferon-gamma from T-cells, which then cause
the activation of GTP-cyclohydrolase I in other cells. Tumour necrosis factor-alpha as a
single agent stimulates the activity in fibroblasts 9 and endothelial cells30 , but not in
macrophages27 •28 and not in THP-1 cells 20 • Like many other agents, however, tumour
necrosis factor alpha acts costimulatory to interferon-gamma in these cells. In human
peripheral blood mononuclear cells, interferon-alpha and -beta can stimulate the activity in
an indirect way by triggering the formation of a 15 KDa protein, which then causes
formation of interferon-gamma31 • In T-lymphocytes, the stimulatory action of interleukin-2
was found to be supported by interferon-gamma formed upon the interleukin-2 treatment32 •
205
Guanosine 5'-triphosphate induced by cytokines
C?
(GTP) in human and in
I
murine cells
GTP cyclohydrolase I
0 OH OH
~ 2 3 9
7,8-dihydro
neopterin
phosphatases
N H
H H
7,8-d ihydroneopterin increased in humans
triphosphate with immunological challenge
0
H H
Nt~~CHg
OHOH
~ H H ~.------------------------,
LJ Increased by cytokines in
human and in murine cells
5,6, 7 ,8-tet rahyd robiopteri n
Figure 1. Schematic presentation of impact of cytokines on tetrahydrobiopterin synthesis in human and in
murine cells. Among the cytokines tested so far, interferon-gamma and tumour necrosis factor alpha were
the most active agents in stimulating GTP-cyclohydrolase I activity.
206
a triggering of tetrahydrobiopterin synthesis in murine cells without the additional
accumulation of neopterin derivatives as in the case of the human cells. Other differences
of human versus murine cells relate to the action of stimulatory agents and inhibitors.
Whereas interferon-gamma is the most active agent in the human, it is only marginally
active as single agent in stimulating pteridine synthesis in murine cells. Nevertheless small
doses of interferon-gamma led to a pronouced increase in the expression of major
histocompatibility complex antigens, indicating that the used interferon-gamma preparation
is highly active on the murine cells 33 • The effect of cycloheximide on cytokine induced
pteridine synthesis is also different in human and murine cells, indicating that the cytokine
signal may be processed differently in the two species33 • Dispite all these points, the
overall effect of cytokine treatment is the same for both human and murine cells. These
agents lead to increased intracellular tetrahydrobiopterin due to activation of GTP-
cyclohydrolase I activity.
CONCLUSION
ACKNOWLEDGEMENT
REFERENCES
1. H. Wachter, A. Hausen, and K. Grassmair, Erhohte Ausscheidung von Neopterin im Harn von
Patienten mit malignen Tumoren und mit Viruserkrankungen, Hoppe Seyler's Z. Physiol. Chem.
360:1957 (1979).
2. D. Fuchs, A. Hausen, G. Reibnegger, E.R. Werner, M.P. Dierich, and H. Wachter, Neopterin as
marker for activated cell mediated immunity: Application for HIV infection, lmmunol. Today 9:150
(1988).
3. H. Wachter, D. Fuchs, A. Hausen, G. Reibnegger, and E.R. Werner, Neopterin as marker for the
activation of cellular immunity: Immunological basis and clinical application, Adv. Clin. Chem. 27:81
(1989).
4. M.M. Miiller, H. C. Curtius, M. Herold, and C. Huber, Neopterin in clincal praxis, Clin. Chim.
Acta 201:1 (1991)
207
5. A. Hausen, D. Fuchs, G. Reibnegger, E.R. Werner, and H. Wachter, Neopterin in clinical
medicine, Pteridines 1:3 (1989).
6. H. Wachter, D. Fuchs, A. Hausen, G. Reibnegger, G. Weiss, E.R. Werner, G. Werner-Felmayer
and H. Wachter. Neopterin, Biochemistry, Methods, Clinical Application. Walter de Gruyter,
Berlin-New York (1992).
7. R. Margreiter, D. Fuchs, A. Hausen, C. Huber, G. Reibnegger, M. Spielberger, and H. Wachter,
Neopterin as a new biochemical marker for the diagnosis of allograft rejection, Transplantation
36:650 (1983).
8. D.S. Duch, S.W. Bowers, J.H. Woolf, and C.A. Nichol, GTP-cyclohydrolase, neopterin and
biopterin in tissues and body fluids of mammalian species, Life Sci. 35:1895 (1984).
9. E.R. Werner, G. Werner-Felmayer, and H. Wachter, Tetrahydrobiopterin and cytokines, Proc. Soc.
Exp. Bioi. Med. 203: May, in press (1993).
10. G. Werner-Felmayer, E.R. Werner, G. Weiss, and H. Wachter, Modulationofnitricoxidesynthase
activity in intact cells by tetrahydrobiopterin levels, this volume.
11. D. Fuchs, A. Hausen, C. Huber, R. Margreiter, G. Reibnegger, M. Spielberger, and H. Wachter,
Pteridinausscheidung als Marker fiir Alloantigen-induzierte Lymphocytenproliferation, Hoppe
Seyler's Z. Physiol. Chem. 363:661 (1982).
12. C. Huber, D. Fuchs, A. Hausen, R. Margreiter, G. Reibnegger, M. Spielberger, and H. Wachter,
Pteridines as a new marker to detect human T-cells activated by allogeneic modified self major
histocompatibility complex (MHC) antigens, J. Immunol. 130:1047 (1983).
13. C. Huber, J.R. Batchelor, D. Fuchs, A. Hausen, D. Lang, D. Niederwieser, G. Reibnegger, P.
Swetly, J. Troppmair and H. Wachter, Immune Resonse associated production of neopterin-Release
from macrophages primarily under control of interferon-gamma, J. Exp. Med. 160:310 (1984).
14. G. Schoedon, J. Troppmair, G. Adolf, C. Huber, and A. Niederwieser, Interferon-gamma enhances
biosynthesis in peripheral blood mononuclear cells by induction of GTP-cyclohydrolase I activity,
J. Interferon Res. 6: 697 (1986).
15. G. Schoedon, J. Troppmair, A. Fontana, C. Huber, H.C. Curtius, and A. Niederwieser,
Biosynthesis and metabolism of pteridines in peripheral blood mononuclear cells and leukemia lines
of man and mouse, Eur. J. Biochem.166:303 (1987).
16. I. Ziegler, Synthesis and interferon-gamma controlled release of pteridines during activation of
human peripheral blood mononuclear cells. Biochem. Biophys. Res. Commun. 132:404 (1985).
17. E.R. Werner, D. Fuchs, A. Hausen, G. Reibnegger, and H. Wachter, Simultaneous determination
of neopterin and creatinine in serum with solid phase extraction and on-line elution liquid
chromatography. Clin. Chem. 33:2028 (1987).
18. E.R. Werner, G. Werner-Felmayer, D. Fuchs, A. Hausen, G. Reibnegger, and H. Wachter,
Parallel induction of tetrahydrobiopterin synthesis and indoleamine 2,3-dioxygenase activity in
human cells and cell lines by interferon-gamma, Biochem. J. 262:861 (1989).
19. S. Ogiwara, T. Nagatsu, R. Teradiera, K. Fujita, and T. Sugimoto, Occurence of umanopterin, a
new diastereomer of neopterin, in the urine of cancer patients, Tetrahedron Lett. 33:1341 (1992).
20. G. Werner-Felmayer, E.R. Werner, D. Fuchs, A. Hausen, G. Reibnegger, and H. Wachter.
Neopterin formation and tryptophan degradation by a human myelomonocytic cell line, Cancer Res.
50:2863 (1990).
21. E.R. Werner, G. Werner-Felmayer, D. Fuchs, A. Hausen, G. Reibnegger, J.J. Yim, W. Pfleiderer,
and H. Wachter. Tetrahydrobiopterin biosynthetic activites in human macrophages, fibroblasts,
THP-1 and T 24 cells. GTP-cyclohydrolase I is stimulated by interferon-gamma, 6-pyruvoyl
tetrahydropterin synthase and sepiapterin reductase are constitutively present. J. Bioi. Chem.
265:3189 (1990).
22. K. Hatekeyama, T. Aharada, and H. Kagamiyama, IMP dehydrogenase inhibitors reduce
intracellular tetrahydrobiopterin levels through reduction of intracellular GTP levels, J. Bioi. Chem.
267:20734 (1992).
23. S.l. Takikawa, H.C. Curtius, U. Redweik, W. Leimbacher, and S. Ghisla, Biosynthesis of
tetrahydrobiopterin. Purification and characterization of 6-pyruvoyl tetrahydropterin synthase from
human liver. Eur. J. Biochem.161:295 (1986).
24. E.R. Werner, G. Werner-Felmayer, D. Fuchs, A. Hausen, G. Reibnegger, G. Wels, J.J. Yim, W.
Pfleiderer and H. Wachter, 6-Pyruvoyl tetrahydropterin synthase assay in extracts of cultured human
cells using high performance liquid chromatography with fluorescence detection of biopterin, J.
Chromatogr. 570:43 (1991).
25. J.C. Nixon, C.L. Lee, S. Milstien, S. Kaufman, and K. Bartholome, Neopterin and biopterin levels
in patients with atypical forms of phenylketonuria, J. Neurochem. 35:898 (1980).
26. C.F.Nathan, Peroxide and pteridine: A hypothesis on the regulation of macrophage antimicrobial
208
activity by interferon-gamma. in: "Interferon 7", I. Gresser, J. Vilcek, eds, Academic Press,
London (1986)
27. J. Troppmair, K. Nachbaur, M. Herold, W. Aulitzky, H. Tilg, G. Gastl, P. Bieling, B. Kotlan, R.
Flener, B. Mull, W.O Aulitzky, H. Rokos and C. Huber, In vitro and in vivo studies on the
induction of neopterin biosynthesis by cytokines, alloantigens and lipopolysaccharide (LPS), Clin.
Exp. Irnrnunol. 74: 392 (1988).
28. G. Werner-Felmayer, E.R. Werner, D. Fuchs, A. Hausen, G. Reibnegger, and H. Wachter,
Tumour necrosis factor alpha and lipopolysaccharide enhance interferon-induced tryptophan
degradation and pteridine synthesis in human cells, Bioi. Chern. Hoppe Seyler 370:1063 (1989).
29. B. Hofmann, H. Bass, P. Nishanian, M. Faisal, R.A. Figlin, G.P. Sarna and J.L. Fahey, Different
lymphoid cell population produce varied levels of neopterin, beta-2 microglobulin and interleukin 2
receptor when stimulated with interleukin-2, interferon-gamma or tumour necrosis factor alpha,
Clin. Exp. Irnrnunol. 89:548 (1992)
30. G. Werner-Felmayer, E.R. Werner, D. Fuchs, A. Hausen, G. Reibnegger, G. Weiss, and H.
Wachter, Pteridine biosynthesis in human endothelial cells. Impact on nitric oxide mediated
formation of cyclic GMP, J. Biol. Chern. 268:1842 (1993).
31. M. Recht, E. C. Borden, and E. Knight, A human 15 KDa interferon-induced protein induces the
secretion of interferon-gamma, J. Irnrnunol. 147:2617 (1992).
32. I. Ziegler, K. Schott, M. Lubbert, F. Herrmann, U. Schwulera, and A. Bacher, Control of
tetrahydrobiopterin synthesis by synergistic action of interferon-gamma and interleukin-2, J. Bioi.
Chern. 265:17026 (1990).
33. E.R. Werner, G. Werner-Felmayer, D. Fuchs, A. Hausen, G. Reibnegger, and H. Wachter, Impact
of tumour necrosis factor-alpha and interferon-gamm on tetrahydrobiopterin synthesis in murine
fibroblasts and macrophages, Biochern. J. 280:709 (1991).
209
INTERFERON-y AND KIT LIGAND ARE PRIMARY REGULATORS OF
GTP CYCLOHYDROLASE ACTIVITY: MECHANISMS AND IMPLICATIONS
INTRODUCTION
(6R)-f4biopterin (Bf4) is synthesized from GTP in different types of tissues and in cells of
different lineages. It is the natural and immediate electron donor for aromatic amino acid
monooxygenases. Thus, it serves as a cofactor in tissues committed to degradation of
phenylalanine and the synthesis of the neurotransmitters dopamine, epinephrine, and serotonin
(for review, see ref.l). The activity of GTP cyclohydrolase I (GTP-CH), the first and rate
limiting enzyme of BH4 synthesis, appears to be constitutively expressed in all competent
tissues such as liver, adrenal medulla, and brain2. Changes in its activity may occur in response
to physiological conditions and pharmacological treatrnent3. No specific regulatory factors have
been identified yet.
Recent evidence has shown that BH4 is also synthesized in cells that do not require
involvement of BH4 in its role as a cofactor. Instead, they are rather characterized by cytokine-
directed proliferation and differentiation such as occurs during hematopoiesis4-6 or during the
clonal expansion ofT cells7 (for review, see ref.&). The final product, BH4, functions as a
feedback modulator ofT cell expansion (for review, see ref.&) and positively affects the
multiplication of erythroid cells6.9. In these proliferating cells BH4 synthesis is subject to
stringent regulation. GTP-CH activity in monocytes/macrophages is induced by interferon-y
(IFN-y) and results in the release of neopterin 10. In activated T cells, its effect is further
enhanced by synergistic action with interleukin 2 (IL-2)7.
Bone marrow-derived mast cells (BMMC) also undergo cytokine-directed proliferation and
differentiation dependent on both IL-311 and kit ligand (KL)12. Moreover, rodent BMMC
produce serotonin 13, a function which depends on the presence of BH4 as cofactor. In the
mouse mutant genotypes W/WY and Sl!Sld the expression of functional kit receptorl4 and of
The culture of the HTLV-1-infected human T cell line MT-2 was described in7. The
macrophage-like cell line U937 was maintained in a similar manner. The culture of murine
BMMC was described in17. Recombinant murine KL (hisKL) was expressed in£. coli and
purified by affinity chromatography as described in 18 . Due to the lower specific activities of
hisKL preparations, about 400 ng rnl-1 were required to equal a saturating dose of 100 ng rn1-1
yeast-derived KL in the mast cell cultures. The HPLC determination of biopterin and the
determination of GTP-CH activity were described previously?. Serotonin was determined
according to19. The expression of human and rodent GTP-CH mRNA was determined using a
555 bp eDNA segment generated by polymerase chain reaction after reverse transcription (RT-
PCR)20. The specificity of the eDNA probe was confirmed by direct sequencing. Radiolabeling
was performed by PCR strategy as described21 . Isolation and separation of total RNA, vacuum
blotting onto Nylon membranes and hybridization were also previously described21 . The
signals produced by GTP-CH mRNAs were not only calibrated against the amounts of 28S and
18S ribosomal RNA loaded on the gel, but also against the B-tubulin signal. Both parameters
agreed well. The signals on the autoradiograms were quantitated with the 2D program of the
Ultro Scan XL Laser Densitometer (Pharmacia, Freiburg) .
RESULTS
The cell line U937 synthesizes neopterin upon activation with IFN-y identically to
monocytes/macrophages from peripheral blood22 . The total (cellular plus released) neopterin
production averaged 2.22 pmol/1 06 cells. Treatment with IFN-y increased it approximately 2.8-
fold (Fig. I A). Northern blot analysis with a eDNA probe specific for human GTP-CH detected
a mRNA species consisting of 3.6 kb20. Quantitative analysis of the signals showed that the
induction of neopterin synthesis by IFN-y correlated with a 4-fold increase in GTP-CH mRNA
expression (Fig.lB).
The CD4+ T cell line MT-2 lacks expression of IFN-y and was therefore used as a model
system to study the progress of GTP-CH activation upon IFN-y treatment. This induction was
further enhanced by IL-2 which is ineffective per se. It culminated after 44 h7 (Fig.2A).
Northern blot analysis demonstrated that the steady state levels of GTP-CH mRNA correlate
with the increase in apparent enzyme activity (Fig.2B). Subsequently, the activity declined
rapidly even though the mRNA expression remained nearly constant.
212
A 5 B
-=a
E
5
E: 4
t::
·;::: 3
£
0.
0
~ 2
0
controls IFN-y controls IFN-y
Fig.l Induction of neopterin synthesis in the macrophage-like cell line U937 by IFN-y (500 U ml-1) after
30h. A: neopterin synthesis • released neopterin, !.Cl cellular neopterin; B: relative GTP-CH mRNA
expression.
0 400
:~ A
I
B
u ~
CJ
"'
u .....
0
<C
~::.....,
·~= 300 .9 0
o.o
"'t:
-~::
"'"'
"'"'
o -
'-< 0
0 0 0.'-<
"'u x-o>..
~ .....0 0
0 <:-§]
.a ~ 200
>..~
.c ~~
0 E u
u>.. 0
(.) .:::
d. ~
t-< 100 ~
CJ
0 20 40 60 0 27 44 65
time [h] time [h]
Fig.2 Induction of BH4 synthesis in the CD4+ T cell line MT-2 by IFN-y (500 Uml-1) plus IL-2 (20 U mt1 ).
A: activity of GTP-CH; B: relative GTP-CH mRNA expression. • control; ~ IFN-y plus IL-2
Murine BMMC grown with IL-3 produce 6.1 pmol biopterin/106 cells. Culturing the cells
with KL instead of IL-3 increased the production about 4-fold, but was not further enhanced by
combination with IL-3 (Fig.3A). A panel of cytokines, such as IL-4, IL-9 or NGF, which
synergistically increase the proliferation of IL-3 induced BMMC, could not substitute for KL
with respect to promotion of biopterin synthesis (data not shown). Fig.3B demonstrates that the
KL-mediated increase in Bf4 production is caused by upregulation of GTP-CH activity. The
other enzymes involved in Bf4 synthesis remained unaffected.
Northern blot analysis of rat RNA with a eDNA probe for GTP-CH previously had detected
two mRNA species of approximately 1.4 and 3.6 kb size. Both were present in all rat tissues
investigated. The ratio of the 3.6 kb species to the 1.4 kb species varied between 0.8 in liver and
213
@'"""
u ~ I (<!
~B 1
25 A 0!=:""'
'-' ~0::: B
..... "<tiZl
......., I:: ::r: '-'
"' 20
~
·...-1~"7
S ~-S
u '"7,....; s
s ...
'Cl
OJ) ~
s bn
0
0
15 BS S 8
s ro "7
..c: Oll·c:
;::::
~ ~S B 6
!=: 10 O;...o.,
..c: <!.) 0
·c: .8< ~ :.0 4
~ !:l ~ ('l
:.0 5
"§ 0
O..·p s
*
i=:"Oi:I:
2
~n::
!=: -
o.. 0 _,_,_<..LL..__
IL-3 KL IL-3+KL - 0 SR
~ §,
0..
Fig.3 Production of biopterin in murine BMMC cultured in the presence of IL-3 (20 ng mtl) or KL
(100 ng ml-1) A: biopterin levels, f"&l 6-biopterin, • 7-biopterin; B: activities of Bl4 synthesizing
enzymes, • IL-3, @. KL
Exp.#1 Exp.#2
a b a b
- 288
3.6 kb -
- 188
1.4kb - .
Fig.4 Northern blot analysis of GTP-CH mRNA expression in murine BMMC. a: cells cultured with KL
(100 ng mi-l; b: cells cultured with IL-3 (20 ng mJ-1). The signal intensities of the 1.4 plus 3.6 kb species were
calibrated against the methylene blue staining intensities of blotted RNA (18S plus 28S). The mean values for
the mRNA signals obtained were 1.9 for KL cultured cells and 0.99 (arbitrary units) for IL-3 cultured cells.
2.4 in kidney20. Similarly, both mRNA species were present in murine BMMC at a ratio of0.18
(±0.04 S.D.). No difference in this ratio was found between cells grown in KL or IL-3 (Fig.4).
The level of both GTP-CH mRNA species increased significantly upon KL treatment. Quantitive
estimates are given in the legend of fig.4. They revealed an approximately 2-fold increase in
GTP-CH mRNA whereas the catalytic activity increased approximately 6-fold. Given the
limitations of quantitative Northern blot evaluation a potential contribution by post-translational
modification requires further investigation. On basis of the amino acid sequence deduced from
the cloned rat GTP-CH eDNA, phosphorylation by growth-associated histone Hl kinase or
casein kinase II appears to be possibly involved23.
Assuming a homogenous distribution of BH4 and a cell volume of 8 x 10- l. 0 ml, the
concentration of the BR4 cofactor is approximately 8 j.lM in IL-3 grown cells. KL triggers an
increase to approximately 30 j.lM. In care of non-neuronal tryptophan 5-monooxygenase the
in vitro Km value for BR4 is 22 j.lM24. Thus, the KL-induced increase occurs at the Km value
of tryptophan 5-monooxygenase and results in maximum changes of activity.
214
Furthennore, analysis of the effect of the growth factors on the activity of tryptophan 5-
monooxygenase in murine BMMC demonstrated that the activity of 47.6 (± 7.4) and 50.8
(±13.8) pmol mg-1 rnin-1 in IL-3 or KL grown cells increased about 5-fold when both growth
factors were combined (Fig.5A). No other factors could substitute for KL25. Thus, the
concerted action of IL-3 and KL on the hydroxylation of tryptophan enhances the production of
serotonin approximately 20-fold (Fig.5B). KL selectively causes the release of about half of
total serotonin produced (Fig.5B)25.
We previously found that 7-biopterin in mast cells is only fonned during ongoing
hydroxylation of tryptophan!?. Fig.3A demonstrates that the combination of KL with IL-3 has
no effect on the total amount of BI4 but increases the portion of7-biopterin from 8.0 to 35.6%.
Thus, the upregulation of tryptophan 5-monooxygenase activity by the concerted action ofiL-3
and KL25 fully explains the pattern of 6-biopterin and 7-biopterin.
350
A
e 100
I:: ;::!
E
'6 300 '><<'<l
Co E
E 250 .....
0
0 ~
5.
-
200 c 60
c<'<l .9
<'<l
..c !:l
9' c 40
II)
(.)
s
0.
I
...4
c
0
(.)
c 20
:I:
·a
90
0
,;., ...
II) 0
IL-3 KL IL-3+KL "' ll..,-3 KL ll..,-3+KL
Fig.S Synthesis of serotonin in murine BMMC cultured in the presence of IL-3 (20 ng mt·l), KL (100 ng mt· l)
or both growth factors. A: activity of tryptophan 5-monooxygenase; B: serotonin production,
• cellular serotonin , ~ released serotonin
BH4 Synthesis and Serotonin Production in the Brain of the Mutant Genotypes
W/Wv and Sl/Sld
In tl{e brain and both other tissues investigated (liver, spleen) in the wild type and both the
WJWV and SVSld mutant genotypes only the 6-isomer of biopterin was found. The following
Bl4 concentrations were found in the brain (pmol g·l): 276 (±28) in wild type, 277 (±15) in the
genotype w;wv and 285 (±24) in the genotype SVSld. The values for serotonin (nmol g-1) were
as follows: 3.75 (±0.09), 3.67 (±0.32) and 3.77 (±0.35), respectively. These data demonstrate
that the lack of a functional kit receptor or of KL neither affects the synthesis of the BH4
cofactor, nor the activity of tryptophan 5-monooxygenase. In addition, the Bl4 concentration in
the liver and the capacity for phenylalanine degradation were not significantly different in both
mutant genotypes as compared to the wild type (data not shown). Thus, the GTP-CH activity
in these tissues is independent of the KL.
Together with the IFN-y- induced increase of GTP-CH mRNA expression in the cells of the
immune system, the data obtained with murine BMMC suggest that GTP-CH is subject to a cell
lineage and tissue specific regulation. This is further supported by the existence of multiple
mRNA species and their tissue specific expression20,26. A similar situation is found in the case
of tryptophan 5-monooxygenase which is discussed in more detail in ref.25. The question
whether IFN-y and KL induce the expression of specific isoforms of GTP-CH in cells of the
215
immune system, in BMMC and in tissues such as brain or liver or whether KL post-
translationally activates GTP-CH, awaits further investigation.
ACKNOWLEDGEMENTS
The authors thank Dr. Wolf Endres (Kinderklinik der Universitiit Innsbruck) for
determination of urinary phenylalanine levels, Wolfgang R&ll as well as Hannelore Broszeit for
qualified technical assistance.
REFERENCES
S.Kaufman and D.B.Fisher, in Oxygenases (O.Hayaishi, ed.) pp 285-370, Academic Press New York
(1972)
2. T.Fukushima and I.C.Nixon, Analyt.Biochem.l02: 1767 (1980)
3. O.H.Viveros, M.M.Aboud-Donia, C.L.Lee, S.P.Wi1son, and C.A.Nicho1, in Function and Regulation of
monoamine enzymes: Basic and Clinical Aspects (E.Usdin, N. Weiner, and M.B. Youdim, eds.) pp 241-
259, Mac Millan Publ.Ltd., London (1981)
4. !.Ziegler and St.Thierfelder, Z.fNaturf.42c:461 (1987)
5. F.Kerler, L.Hiiltner, !.Ziegler, G.Katzenmeier, and A.Bacher, J.Cell.Physiol.l42:268 (1990)
6. K.Tanaka, S.Kaufman, and Sh.Milstien, Proc.Natl.Acad.Sci.(USA) 86:5846 (1989)
7. !.Ziegler, K.Schott, M.Liibbert, F.Herrmann, U.Schwulera, and A.Bacher, J.Biol.Chem 265: 17026 ( 19907)
8. I.Ziegle.-, Med.Res.Rev.l0:95 (1990)
9. F.Kerler, !.Ziegler, C. Schmid, and A.Bacher, Exp.Cell Res.l89: 151 (1990)
10. C.Huber, J.R.Batchelor, D.Fuchs, A.Hausen, A.Lang, D.Niederwieser, G.Reibnegger, P.Swetley,
J.Troppmair, and H.Wachter, J.Exp.Med.l60:310
11. J.N.Ihle, J.Keller, S.Oroszlan, L.E.Henderson, T.D.Copeland, F.Fitch, M.B.Prystowsky, E.Goldwasser,
J.W.Schrader, E.Palaszynski, M.Dy, and B.Lebel, J.Immunol.l31:282 (1983)
12. J.G.Flanagan, D.C.Chan, and P.Lever, Cell64: 1025 (1991)
13. L.B.Schwartz and K.F.Asuten, Prog.Allergy 34:271 (1984)
14. K.Nocka, J.C.Tan, E.Chin, T.J.Chu, P.Ray, P.Traktman, and P.Besmer, EMBO 1.9:1805 (1990)
15. K.M.Zsebo, D.A.Williams, E.N.Geissler, V.C.Broudy, F.H.Martin, H.L.Atkins, R.Y.Hsu, N.S.Birkett,
K.H.Okino, D.C.-Murdock, F.W .Jacobsen, K.E.Langley, K.A.Smith, T.Takeishi, B.M.Cattanach,
S.J.Galli, and S.V.Suggs, Cell63:213 (1990)
16. Y.Kitamura, H.Nakayama, J.Fujita in Mast Cell and Basophil Differentiation and Function in Health and
Disease (S.J.Galli and K.F.Austen, eds) pp 15-25, Raven Press New York (1989)
17. !.Ziegler and L.Hiiltner, FEBS Letters 307:147 (1992)
18. G.Reisbach, I.Bartke, B.Kempkes, J.Ellwart, A.Bimer, K.Thalmeier, R.Mailhammer, G.W.Bomkamm,
A. Ullrich, and P.DOrmer, Exp.Hematol. in press (1993)
19. E.Traiffort, P.Hubert, N.Tayeb, and N.Aymard, J.Chromat.571:231 (1991)
20. M.Giitlich, K.Schott, Th.Wemer, A.Bacher, and !.Ziegler, Biochim.Biophys.Acta 1171:133 (1992)
21. K.Schott, M.Giitlich, !.Ziegler, J.Cell.Physiol, in press (1993)
22. K.Rokos, R.O.F.Kunze, M.A.Koch, H.Rokos, and K.Nilsson in Unconjugated Pterins and Related
Biogenic Amines (H.Ch.Curtius, N.Blau, and R.A.Levine eds.) Walter de Gruyter Berlin (1987)
23. K.Hatakeyama, Y.lnoue, T.Harada, and H.Kagamiyama, J.Biol.Chem.266:765 (1991)
24. D.M.Kuhn, M.A.Meyer, and W.Lovenberg, Arch.Biochem.Biophys.l99:355 (1980)
25. !.Ziegler, H.Hiiltner, D.Egger, B.Kempkes, R.Mailhammer, St.Gillis, and W.Rbdl, J.Biol.Chem. (in
press) (1993)
26. A.Togari, H.Jchinose, Sh.Matsumoto, K.Fujita, and T.Nagatsu, Biochem.Biophys.Res.Comm.l87:359
(1992)
216
DIFFERENTIAL METABOLISM OF TETRAHYDROBIOPTERIN IN MONOAMINE
NEURONS: A HYPOTHESIS BASED UPON CLINICAL AND BASIC RESEARCH
Gregory Kapatos, Kei Hirayama, Stephen I. Lentz, Min Zhu and Susan Stegenga
INTRODUCTION
Neurons that synthesize and secrete monoamines have been extensively studied
because of their hypothetical involvement in the symptomology associated with certain
neurological and psychiatric disorders, and, by inference, their possible involvement in the
disease process itself. 5,6,7,8-tetrahydrobiopterin (BH4) is the essential cofactor for the
family of pterin-dependent enzymes that includes tyrosine and tryptophan hydroxylase, the
rate-limiting enzymes in the biosynthesis of catechol and indoleamines1• The family of nitric
oxide synthases, enzymes that convert arginine to nitric oxide, also require BH4 for activity,
although at extremely low concentrations2• While the concentration of BH4 within
monoaminergic neurons is unknown, it appears to be subsaturating with respect to these
enzymes3.4. Increases or decreases in BH4levels might therefore be expected to alter basal
enzyme activity and, in some cases, also modify allosteric regulatory mechanisms. The
capacity of monoaminergic and possibly nitric oxide-producing neurons to synthesize
neurotransmitter and thereby perform their physiological functions is thus highly dependent
upon the intracellular concentration of BH4.
In man, unequivoval evidence exists of deficiences in monoamine neurotransmission
that are the direct result of genetic defects in BH4 biosynthetic or regenerative processes5 •
Individuals afflicted with these genetic diseases are typically detected at birth by the
diagnosis of hyperphenylalanemia. With the exception of the "peripheral" form of BH4
deficiency 6, severe neurological and cognitive dysfunctions typically occur in these patients
later in development despite dietary control of phenylalanine intake. To date, genetic
diseases that increase rather than decrease levels of BH4 have not been observed in the
clinic. Although rarely if ever referred to in the neurology and mental health literature, the
existence of genetic mutations of BH4 metabolism that interfere with normal monoamine
biosynthesis would seem to support theories that hypothesize abnormal monoamine
synthesis as the cause of numerous neuropsychiatric diseases. Because these diseases are
believed to involve specific populations of neurons, however, for any such theory to include
a role for aberrant BH4 metabolism would require that alterations in BH4 metabolism also
be restricted to specific populations of neurons. This requirement would seemingly go
against the typical characterization of BH4 as simply an "interested bystander" in
monoamine neurotransmitter biosynthesis.
CLINICAL EVIDENCE
LABORATORY OBSERVATIONS
218
neurons maintained in primary tissue culture16 • These brain regions were chosen because
they include identified populations of dopamine-containing neurons that are relatively
devoid of other monoamine-containing cell types. In addition, as described above, clinical
studies indicated that there was reason to believe that BH4 metabolism would be different
within hypothalamic and midbrain dopamine neurons.
Kinetic parameters describing BH4 metabolism in hypothalamic and midbrain
cultures were determined by following the decline in steady-state levels of BH4 after
inhibition of BH4 synthesis. In all experiments, we observed that levels of BH4 were
significantly greater in hypothalamic than midbrain cultures. The average fractional rate
constants for the loss of BH4 after synthesis inhibition in these cultures were virtually
identical and demonstrated that approximately 15% of the intracellular pool of BH4 turns
over per hour. The half-life for BH4 determined in either culture system (4.5 hours) was
therefore equal. When combined with the observed difference in steady-state levels, these
fractional rate constants yield a rate of BH4 synthesis in hypothalamic neurons significantly
greater than that observed in midbrain dopamine neurons. Hypothalamic dopamine neurons
maintained in culture thus appear to express higher steady-state levels of BH4 and
synthesize BH4 at a more rapid rate than do their counterparts isolated from the
mesencephalon. In contrast to this difference, BH4 biosynthesis by either population of
neurons was equally sensitive to the inhibitors N-acetyl serotonin (NAS) and 2,4-diamino-6-
hydroxypyrimidine (DAHP) 16•
We have recently reported that there are several notable differences between central
and peripheral nervous system monoaminergic neurons regarding BH4 metabolism and their
response to inhibitors of BH4 biosynthesis. Owing to the heterogeneity of neuronal cell
types present in cultures of CNS, no absolute comparison between central and peripheral
neurons can be made regarding the rate of BH4 biosynthesis. Comparisons can be made,
however, between fractional rate constants for the loss of BH4 following BH4 synthesis
inhibition, because these values are independent of whether BH4 content is expressed on
a per well, protein or cell basis. BH4 metabolism within CNS neurons maintained in culture
exhibited an average half-life of 4.5 hours. The half-life for BH4 with PNS neurons was
almost twice as rapid17• Although the basis for this difference has not been established, it
again illustrates that BH4 metabolism can differ between populations of BH4-containing
cell types and between neurons derived from the central and peripheral nervous systems.
Cellular heterogeneity of BH4 metabolism is also suggested by differences we have
detected in the ability of the compounds N-acetyl-serotonin (NAS) and 2,4-diamino-6-
hydroxypyrimidine (DAHP) to inhibit BH4 biosynthesis. Concentrations of 100 uM NAS
and 5 mM DAHP have previously been shown to produce maximum levels of inhibition
in central neurons 16• In contrast, maximum levels of inhibition of BH4 biosynthesis in
peripheral neurons were obtained at concentrations of 2.5 mM NAS and 1 mM DAHP17 •
BH4 synthesis by peripheral neurons of the superior cervical ganglia was therefore twenty-
five times less sensitive to NAS and 5 times more sensitive to DAHP than in central
neurons. While these differences could reflect an artifact of tissue culture or the differential
metabolism of these compounds, they are also consistant with a possible difference in the
BH4 biosynthetic pathway within central and peripheral neurons. This premise is supported
by the clinical reports mentioned above of a novel form of hyperphenylalanemia,
characterized by a defect in hepatic BH4 biosynthesis that does not involve the central
nervous system6 •
The differential sensitivity to NAS exhibited by central and peripheral
monoaminergic neurons that we have observed may find its biochemical basis in the
seemingly redundant use of the enzymes sepiapterin reductase and 6-pyruvoyl reductase in
the reduction of precursors of BH4 during the last two steps of the BH4 biosynthetic
pathway18 • Based on this hypothesis, cells of the periphery would express equal levels of
both of these reductases and, as a result, BH4 synthesis would be less sensitive to inhibition
219
of sepiapterin reductase by NAS. In contrast, neurons of the CNS would primarily utilize
sepiapterin reductase in the terminal reductions of BH4 intermediates and would thus be
more sensitive than peripheral neurons to NAS. This hypothesis is supported by our
observation reported at the last International Pteridine Symposium that a concentration of
NAS (200 uM) that was completely ineffective in inhibiting endogenous BH4 biosynthesis
by peripheral neurons was at the same time capable of blocking the conversion of
exogenously supplied sepiapterin to BH419• It would therefore appear that in these neurons
BH4 synthesis continues despite inhibition of sepiapterin reductase, perhaps because 6-
pyruvoyl reductase can function in BH4 biosynthesis.
We have also used these culture systems to examine the regulation of BH4
biosynthesis and here too we find differences between hypothalamic and midbrain dopamine
neurons and between central and peripheral neurons. Initial studies have focused on the role
of 3 '5 '-cyclic-adenosine monophosphate (cAMP)-dependent regulatory mechanisms because
previous studies have shown that elevations in cAMP levels are capable of inhibiting BH4
biosynthesis in the pineal gland14 while stimulating BH4 synthesis in the adrenal medulla20 •
In hypothalamic and midbrain cultures cAMP has been found to increase BH4 levels by
stimulating biosynthesis21 • This increase in biosynthesis in response to elevated cAMP is
significantly greater in midbrain than in hypothalamic dopamine neurons and follows an
extended time-course that is indicative of altered gene expression. This possibility is
supported by the observations that levels of mRNA encoding for GTP cyclohydrolase I
were increased by cAMP and inhibition of gene transcription or translation completely
blocked the ability of cAMP to stimulate BH4 biosynthesis. BH4 biosynthesis within central
neurons appears, therefore, to be positively regulated by a cAMP-dependent mechanism in
a manner similar to that observed previously in the adrenal medulla but certainly different
from the pineal gland. The knowledge that the adrenal medulla and sympathetic ganglia are
both derived embryologically from the neural crest led us to investigate whether a cAMP-
dependent mechanism is also involved in the regulation of BH4 biosynthesis in these
peripheral neurons. Elevation of cAMP levels within peripheral neurons maintained in
culture, however, did not significantly alter BH4 levels. In contrast, BH4 levels in these
sympathetic neurons were sensitive to the neurotrophin nerve growth factor and to the
cytokine leukemia inhibitory factor. These observations demonstrate that even cells that are
derived from the same embryonic tissues generate diverse mechanisms for regulating BH4
levels.
The introduction of molecular biology to the field of unconjugated pteridines22 has
also allowed us to investigate the expression of GTP cyclohydrolase I in intact brain and
sympathetic ganglia at the molecular levee3•24 •25 • The results from these studies have done
nothing but reinforce our earlier observations regarding heterogeneity of BH4 metabolism.
In contrast to the original report of a single form of GTP cyclohydrolase I mRNA in rat
liver2, we have detected two mRNA species of 1.2 and 3.8 kilobases in rat liver and other
tissues23 ' 25 • The relative abundance of these mRNAs varied, with the short form predominant
in the liver and the long form the major species in the pineal gland, adrenal gland,
brainstem and hypothalamic neurons maintained in culture. This heterogeneity in GTP
cyclohydrolase I mRNA may reflect alternative splicing of pre-mRNA, alternative
transcription initiation sites or multiple polyadenylation signals and may help to explain the
disparate range of sizes reported for the subunit form of mammalian GTP cyclohydrolase
f 6•27•28•29 • Although these apparent structural differences might suggest otherwise, the
possibility of two distinct GTP cyclohydrolase I genes is unlikely because mutations that
eliminate GTP cyclohydrolase I enzyme activity and BH4 biosynthesis in man30 and
mouse31 would have to involve simultaneous loss of both genes. It remains to be determined
whether these apparent differences in GTP cyclohydrolase I protein are related to the two
forms of mRNA which may have the potential to code for separate translation products with
different catalytic and regulatory capabilities. As demonstrated by in situ hybridization to
220
localize mRNA at the cellular level and quantitative RNA protection experiments23 •24 •25 there
are dramatic differences in the level of GTP cyclohydrolase I mRNA expression within the
dopamine neurons of the midbrain inthat neurons localized to the substantia nigra contain
far less GTP cyclohydrolase I mRNA than do their neighbors in the ventral tegmentum. If
mRNA content is a reflection of the amount of GTP cyclohydrolase I protein, then it is
highly probable that levels of BH4 are also substantially lower in these neurons. Dopamine
synthesis within substantia nigra neurons might therefore be highly sensitive to the further
decline in levels of BH4 that is characteristic of BH4 deficient patients. Perhaps this is the
answer to the mystery of why these patients exhibit movement disorders reminiscent of
Parkinson Disease yet display normal hypothalamic, sympathetic and pineal gland function.
SUMMARY
This chapter has attempted to describe and integrate some of the clinical and basic
research that support our hypothesis that the metabolism of BH4 is normally heterogeneous
across different populations of monoamine-containing neurons. Based upon this hypothesis,
there may now be reason to support the idea that certain neuropsychiatric illnesses, which
are though to be the result (at least in part) of altered monoamine metabolism, might find
their roots in an abnormal metabolism of BH4 within specific monoaminergic cell groups.
Such a specific dysfunction might not be apparent in the rest of the brain or peripheral
nervous system, thereby being difficult to detect. Perhaps the application of molecular
biological techniques to studies of BH4 metabolism in man will shed new light on these
problems.
ACKNOWLEDGEMENT
We thank Mr. Gary M. Bora for his expert technical assistance. We also thank our
colleagues in the Cellular and Clinical Neurobiology Program for their intellectual support.
This work was supported by a grant from the National Institute of Neurological Diseases
and Stroke (NS 26081).
REFERENCES
1. S. Kaufman, In Aromatic Amino Acids in the Brain, CIBA Foundation Symposium, Elsevier,
Amsterdam (1974).
2. M.A. Tayeh and M.A. Marietta, J. Bioi. Chern. 264:19654-19658 (1989).
3. P.M. Iuvone, J.F. Reinhard, M.M. Abou-Donia, O.H. Viveros and C.A. Nichol, Brain Res.
359:392-396 (1985).
4. M. Sawada, T. Sugimoto, S. Matsura, T. Nagatsu, J. Neurochem. 47:1544-1547 (1986).
5. S. Kaufman, N.A. Holtzman, S. Milstien, IJ. Butler and A. Krumholz, N. Engl. J. Med. 293:785-790
(1975).
6. S. Hreidarsson, D. Valle, N. Holtzman, J. Coyle, H. Singer, G. Kapatos, and S. Kaufman Pediatr.
Res 16:192 (1982).
7. A.D. Kay, S. Milstien, S. Kaufman, H. Creasey, J.V. Haxby, N.R. Butler and S.I. Rapoport, Arch.
Neural. 43:996-999 (1986).
8. W. Lovenberg, R.A. Levine, D. Robinson, A.C. Williams and D.B. Ca1ne, Science 204:624-626
(1979).
9. P. LeWitt, L. Miller, R.A. Levine, W. Lovenberg, R. Newman, A. Papavasiliou, A. Rayes, R.
Eldridge and R. Burns, Neurology 36:760-764 (1986).
10. J.C. Garbutt, D.S. Duch, C.A. Nichol and H. Woolf, Psychiatry Res. 16:181-187 (1985).
11. I.J. Butler, S.H. Koslow, A. Krumholz, N.A. Holtzman, and S. Kaufman, Ann. Neurol. 3:224-230
(1978).
221
12. S. Kaufman, G. Kapatos, W.B. Rizzo, J.D. Schulman, L. Tamarkin and G.R. van Loon, Ann.
Neural. 14:318-325 (1983).
13. R.R. Mcinnes, S. Kaufman, JJ. Warsh, G.R. van Loon, S. Milstien, G. Kapatos, S. Soldin, P.
Walsh, D. MacGregor and W.B. Hanley, J. Clin. Invest. 73:458-469 (1984).
14. G. Kapatos, S. Kaufman, JL. Weller and D.C. Klein, Science 213:1129-1131 (1981).
15. J. Axelrod, Science 184:1341-1348 (1974).
16. G. Kapatos, J. Neurochem. 55:129-136 (1990).
17. G. Kapatos, K. Hirayama and H. Hasegawa, J. Neurochem. 59:2048-2055 (1992).
18. R.A. Levine, G. Kapatos, S. Kaufman, and S. Milstien, J. Neurochem 54:1218-1224 (1990).
19. G. Kapatos, H. Hasegawa, K. Hirayama and V. Kemski, in Chemistry and Biology of Pteridines,
H.Ch. Curtius, S. Ghis1a, N. Blau, eds. Walter deGruyter & Co., Berlin (1990).
20. M.M. Abou-Donia S.P. Wilson, T.P. Zimmerman, C.A. Nichol and O.H. Viveros, J. Neurochem.
46:1190-1199 (1986).
21. K. Hirayama, M. Zhu and G. Kapatos, this volume.
22. K. Hatak.eyama, Y. Inoue, T. Harada and H. Kagamiyama, J. Bioi. Chern 266:765-769 (1991).
23. K. Hirayama, S. Lentz and G. Kapatos, this volume.
24. S. Lentz, K. Hirayama and G. Kapatos, this volume.
25. K. Hirayama, S. Lentz and G. Kapatos, J. Neurochem. in press.
26. K.W. Cha, K.B. Jacobson, J.J. Kim, J. Bioi. Chern. 266:12294-12300 (1991).
27. K. Hatak.eyama, T. Harada, S. Suzuki, Y. Watanabe and H. Kagamiyama, J. Bioi. Chern.
264:21660-21664 (1989).
28. G. Schoendon, U. Redweik and H. Ch. Curtius, Eur. J. Biochem. 178:627-634 (1989).
29. R.S. Shen, A. Alam and Y. Zhang, Biochemie. 71:343-349 (1989).
30. A. Niederwieser and H.Ch. Curtius Enzyme 38:302-311 (1987).
31. J.D. McDonald, R.G.H. Cotton, I. Jennings, F.D. Ledley L.S.C. Woo and V.C. Bode, J.
Neurochem. 50:655-657 (1988).
222
TISSUE DISTRIBUTION OF TETRAHYDROBIOPTERIN GENERATING
ENZYMES
INTRODUCTION
Tetrahydrobiopterin (BH 4) is the natural cofactor of phenylalanine, tyrosine and
tryptophan hydroxy lases as well as nitric oxide synthaset-s. BH4 is synthesized from
GTP by successive actions of at least three enzymes2,6, namely, GTP cyclohydrolase I, 6-
pyruvoyltetrahydropterin synthase (PTPS) and sepiapterin reductase (SR)2,6. BH4 is
regenerated by dihydropteridine reductase (DHPR) from quinonoid dihydrobiopterin 2.
The activities of these BH4-generating enzymes have been measured in various tissues7- 10 ,
but the expression of their genes has not been fully elucidated. Herein, we examined the
transcriptional regulation of BH4-generating enzymes in various tissues. Northern blot
analysis was performed with eDNA probes of these enzymes to determine the mRNA
levels of the BH4-generating enzymes. Our purposes are: to examine the spatial spectra
of the mRNA of the BH4-generating enzymes and compare them with their enzyme
activities; 2) to determine whether the mRNA expression of these enzymes differ with the
tissue.
Fig.1 shows the results of Northern blot analysis with each BH4-generating enzyme
eDNA probe. There were two species (1.3 and 3.2 kb) of mRNA that hybridized to the
GTP cyclohydrolase I eDNA probe (Fig. 1a). These two species of GTP
cyclohydrolase I mRNA are probably due to the use of alternative polyadenylation sites,
because no evidence suggesting the existence of the GTP cyclohydrolase I isozyme was
obtained in the purification 16 and because only the 3.2 kb mRNA hybridized to the DNA
probe which contains only the 3' noncoding region from 100 to 660 bp downstream of
the first polyadenylation signal (unpublished observation). Every tissue in which GTP
cyclohydrolase I mRNA was detected contained both mRNA species of large and small
sizes. The ratio of signal intensity (3.2kb/1.3kb) varied in each organ; e.g., 0.6 for
liver, 1.6 for adrenal gland, 1.2 for spleen, 0.6 for bone marrow, 0.8 for small intestine
and 2.0 for cerebellum. Recently, Gutlich et al. reported similar results 17. The
physiological implications of different mRNA species is not clear.
In contrast, Northern blot with PTPS (Fig. lb), SR (Fig. lc) and DHPR (Fig. ld)
revealed that each mRNA of these enzymes consists of a single species in all the tissues
examined. The length of PTPS and SR mRNA, 1.4 and 1,6 kb, respectively, is
similar to that described previouslyt3,t 8 • The length of rat DHPR mRNA, 1.4 kb, is
similar to that of human DHPR mRNA, 1.5 kb19.
The tissue distribution of mRNA expression corresponds with that of each enzyme
activity previously reported 7-to. This finding suggests that steady state levels of
activities of these BH4-generating enzymes are regulated mainly at their transcriptional
level. All four enzymes have already been purified in rat tissuest3,t6,20,2t. The hepatic
contents of these enzymes can be estimated by the use of specific activities of these
enzymes in liver crude extracts and purified preparations; the levels of GTP
cyclohydrolase I, PTPS, SR and DHPR were 0.1, 0.6, 0.3 and 38 pmol/mg of total
protein, respectively. The relative levels of the estimated contents of these enzymes
were consistent with those of the mRNA levels observed in the present study.
There are some differences in tissue distribution of mRNA expression for BH 4-
generating enzymes. In the kidney and thymus, the GTP cyclohydrolase I mRNA level
was much lower than the levels of mRNAs for other three enzymes. GTP
cyclohydrolase I is the committing enzyme from GTP to BH 4 and is induced by
interferon-r22. The mRNA expression of this enzyme in the kidney and thymus is
limited at steady state and may be induced under some conditions_ In comparison of SR
and DHPR mRNAs in tissue ditribution, the hematopoietic and cardiopulmonary tissues
and the testis expressed mainly SR, whereas the brain did mainly DHPR. The reason
why these enzymes are highly expressed in those tissues is not clear.
In conclusion, this study revealed that the spatial spectra of mRNA levels at steady
224
a
~28S rRNA
3.2 kb ~
~18S rRNA
1.3 kb ~
b
~28S rRNA
~18S rRNA
1.4 kb ~
c
~28S rRNA
d
.....C:28S rRNA,
1.4 kb ......
~28SrRNA
-.<18S rRNA
Figure 1. mRNA expression of BH4-generating enzymes in various tissues. Total RNA ( 5 p.g) from rat
16 tissues were hybridized to each eDNA probe of GTP cyclohydrolase I (a), PTPS (b), SR (c) and DHPR
(d) as described in "MATERIAL AND METHODS ". Equal amounts of RNA application in each lane
were estimated by ethidium bromide-stained gel (e).
225
state correlate with those of the enzymatic activity of each BH4-generating enzyme.
Therefore, the steady state levels of these BH4-generating enzymes are suggested to be
regulated mainly at the transcriptional level.
REFERENCES
1. S. Kaufman (1967) Annu. Rev. Biochem. 36, 171-184.
2. C.A. Nichol, G.K. Smith and D.S. Duch (1985) Annu. Rev.Biochem. 54, 729-764.
3. N.S. Kwon, C.F. Nathan and D.J. Stuehr (1989) J. Bioi. Chern. 264, 20496-20501.
4. M.A. Tayeyeh and M.A. Marietta (1989) J. Bioi. Chern. 264, 19654-19658.
5. B. Mayeh, M. John and E. Bohme (1990) FEBS Lett. 277, 215-219.
6. G.M. Brown (1990) in: "Chemistry and Biology of pteridines 1989" H.-Ch. Curtius, S. Ghisla and N.
Blau, ed., Walter de Gruyter, Berlin.
7. D.S. Duch, S.W. Bowers, J.H. Woolf and C.A. Nichol (1984) Life Sci. 35, 1895-1901.
8. S. Yoshioka, M. Masada, T. Yoshida, K. Inoue, T. Mizokami and M. Akino (1983) Biochim. Biophys.
Acta 756, 279-285.
9. G.K. Smith (1987) Arch. Biochem. Biophys. 255, 254-266.
10. J.E. Craine, E.S. Hall and S. Kaufman (1972) J. Bioi. Chern. 247, 6082-6091.
11. J.M. Chirgwin, A.E. Przybyla, R.J. MacDonald and W.J. Rutter (1979) Biochemistry 18, 5294-5299.
12. K. Hatakeyama, Y. Inoue, T. Harada and H. Kagamiyarna (1991) J. Bioi. Chern. 266, 765-769.
13. Y. Inoue, Y. Kawasaki, T. Harada, K. Hatakeyama and H. Kagamiyarna (1991) J. Bioi. Chern. 266,
20791-20796.
14. B.A. Citron, S. Milstien, J.C. Gutierrez, R.A. Levine, B.L. Yanak and S. Kaufman (1990) Proc. Nat!.
Acad. Sci. USA 87, 6436-6440.
15. M. Shahbaz, J.A. Hoch, K.A. Trach, J.A. Hural, S. Webber and J.M. Whitley (1987) J. Bioi. Chern.
262, 16412-16416.
16. K. Hatakeyama, T. Harada, S. Suzuki, Y. Watanabe and H. Kagamiyarna (1989) J. Bioi. Chern. 264,
21660-21664.
17. M. Gutlich, K. Schott, T. Werner, A. Bacher and I. Ziegler (1992) Biochim. Biophys. Acta 1171,
133-140.
18. J. Maier, K. Schott, T. Werner, A. Bacher and I. Ziegler (1993) Exp. Cell Res. 204, in press.
19. H.H.M. Dahl, W. Hutchinson, W. McAdam, S. Wake, F.J. Morgan and R.G.H. Cotton (1987) Nucl.
Acids Res. 15, 1921-1932.
20. T. Sueoka and S. Katoh (1982) Biochim. Biophys. Acta 717, 265-271.
21. S. Webber, T.L. Deits, W.R. Snyder and J.M. Whitley (1978) Anal. Biochem. 84, 491-503.
22. E.R. Werner, G. Werner-Felmayer, D. Fuchs, A. Hausen, G. Reibnegger, J.J. Yim, W. Pfleiderer
and H. Wachter (1990) J. Bioi. Chern. 265, 3189-3192.
226
CO-INDUCTION OF TETRAHYDROBIOPTERIN (BH 4) LEVELS AND
INTRODUCTION
Cell culture
Tissue Homogenization
PC12 cells were cultured in 25 cm 2 flasks (12 X 104 cells/cm 2 ), dislodged with
Versene (Gibco), centrifuged at 900 x g for 15 min, and then the pelleted cells were
homogenized in 50 mM Tris-HCI pH 7.4. The homogenate was split immediately for
preparation of each assay. For determination of BH 4 and CA levels, cells were cultured
in 24-well plates at the same plating density, washed with Dulbecco's Phosphate-Buffered
Saline and homogenized as previously.
TH activity was measured by monitoring the release oflHOH from 3,5-3 H-tyrosine
as previously described 7• Saturating conditions for measuring TH Vmax were 100 JiM
tyrosine and 1 mM BH 4 • GTP-CH activity was measured by monitoring the conversion of
GTP to NH 2 TP 8 • 1 mM GTP was used to saturate GTP-CH. Neopterin was measured by
H PLC with fluorescence detection 9 after oxidation and dephosphorylation of N H2 TP. SR
activity was measured by monitoring the conversion of sepiapterin to dihydrobiopterin 10,
using HPLC with fluorescence detection to measure biopterin, following manganese
dioxide oxidation of dihydrobiopterin. Saturating conditions for measuring SR Vmax were
250 JiM sepiapterin and 100 JiM NADPH.
228
BH 4 and biopterin were purchased from Schirks Labs (Switzerland). NGF (2.5S)
was purchased from Collaborative Res. Inc.. VIP (porcine) was obtained from Bachem
(California). All other chemicals and reagents were of the highest grade available from
commercial suppliers.
Statistical analysis was carried out by one-way analysis of variance. Post hoc
comparisons were made with the Newman-Keuls test.
The inhibitory effect of NAS, and DAHP on BH 4 biosynthesis in PC12 cells was
tested following a 24 hour incubation with varied concentrations of either NAS or DAHP.
Both NAS and DAHP maximally depleted PC12 cells of BH 4 at a concentration of 2 mM.
At this concentration, both compounds caused significant reduction of the cell number
(approximately 60% of control), which could be due either to cellular toxicity or inhibition
of cellular proliferation. NGF caused a 2.5-fold increase in intracellular BH 4 Ievels. DAHP
blocked the NGF-induced increase and depleted endogenous BH 4 • The NGF-induced
BH 4 levels were reduced by NAS but depletion of intracellular BH 4 levels was not
achieved even at high NAS concentrations (2 mM). 94 o/o of total intracellular biopterin
was present as BH 4 • Control biopterin levels were 2.57 ± 0.17 pmoles/1 05 cells.
The effect of BH 4 on PC12 cell CA synthesis was then studied. PC12 cells were
incubated in media containing 300 J.lM BH 4, 1 mM NAS (suboptimal concentration for
inhibition of BH 4 synthesis), or both for 2 hours, and then intracellular and extracellular
CA levels were measured. Significant changes (p< 0.01) were seen only in the
intracellular levels of DOPA and DA (table 1). BH 4 increased both DOPA (not detectable
in control cells) and DA levels. NAS (1 mM) inhibited control CA synthesis in PC12 cells,
and this inhibition was reversed by the addition of BH 4 in the incubation media.
The effects of NGF (50 nglml), or VIP (10 J.lM) on intracellular BH 4 Ievels were also
tested in PC12 cells. As mentioned previously, NGF caused a 2 .5-fold increase in
intracellular BH 4 levels. Treatment of PC12 cells with VIP increased intracellular BH 4
levels 4-fold.
SR, GTP-CH and TH activities were determined in the supernatant of PC12 cell
homogenates following a 24 hour incubation with tested compounds at 37°C. Incubation
of cells with NGF increased both GTP-CH and THin vitro activities 2-fold. VIP increased
229
GTP-CH activity 2-fold and TH activity 3-fold. SR activity was not altered by any
treatment. Control values for SR, GTP-CH, and TH, activities were 12.57 ± 3.3, 1.60 ±
0.26, and 22.1 ± 3.6 pmoles/mg protein/min, respectively.
According to the hypothesis of "coordinate regulation", conditions causing the long-
term activation of TH will also elevate the activity of BH 4 biosynthetic enzymes to provide
more BH 4 when elevated CA synthesis is required. Insufficient evidence exists supporting
the hypothesis of coordinate regulation. The co-induction of TH and BH 4 -related enzyme
activities was tested as a first step in the elucidation of the regulatory mechanisms involved
in the long-term induction of BH 4 - and CA-related enzymes. Our results (table 1) suggest
that TH is subsaturated with BH 4 in PC12 cells and confirmed a previous report by
Brautigam et al. 4 • Regarding the co-induction of TH and BH 4 -related enzymes, our results
suggest that the long-term activation of TH and GTP-CH may be coupled in vivo. Because
GTP-CH is believed to be the rate-limiting enzyme in BH 4 biosynthesis in non-primates,
an induction of GTP-CH should result in increased intracellular BH 4 levels without
requiring the induction of the other BH 4 biosynthetic enzymes. It is possible that a
transient increase in SR activity occurs before or after the time tested (24 hours). Future
studies are needed to determine whether this co-induction is coordinately regulated. It
is also necessary to test whether this co-induction occurs at the level of TH and GTP-CH
gene transcription, or at the post-transcriptional or post-translational levels.
Acknowledgements
REFERENCES
1) Abou-Donia, M.M., Wilson, S.P., Zimmerman, T.P., Nichol, C.A., and Viveros,
O.H.: J. Neurochem., 46: 1190-1199, 1986.
2) Baruchin, A., Weisberg, E.P., Miner, L.L., Ennis, D, Nisenbaum, L.K., Naylor, E.,
Stricker, E.M., Zigmond, M.J., and Kaplan, 8.8.: J. Neurochem., 54: 1769-1775,
1990.
3) Greene L.A. and Tischler A.S.: Proc. Natl. Acad. Sci. USA, 73: 2424-2428, 1976.
4) Brautigam, M., Dreesen, R., and Herken, H.: Journal on Neurochemistry, 42: 390-
396, 1984.
5) Wessels-Reiker, M., Haycock, J.W., Howlett, A.C., and Strong, R.: The Journal of
Biological Chemistry, 266: 9347-9350, 1991.
6) Suzuki H, Nakanishi N, Yamada S: Biochem. Biophys. Res. Comm., 153: 382-387,
1988.
7) Levine, R.A., Pollard, H.B., and Kuhn, D.M.: Anal. Biochem., 143:205-208,1984.
8) Blau, N. and Niederwieser, A.: Anal. Biochem. 128: 446-452, 1982.
9) Levine, R.A., Zoephel, G.P., Niederwieser, A., and Curtius, H.C.: J. Pharmacal.
Exp. Ther., 242: 514-522, 1987.
10) Levine, R.A., Kapatos, G., Kaufman, S., and Milstien, S.: J. Neurochem., 54: 1218-
1224, 1990.
11) Bradford M.M.: Analyt. Biochem. 72, 248-254, 1976.
230
LONG-TERM TREATMENT OF PC12 PHEOCHROMOCYTOMA WITH
DIDUTYRYL CYCLIC AMP INCREASES BIOPTERIN CONTENT IN THE CELLS
BUT DECREASES THAT IN THE MEDIUM
INTRODUCTION
METHODS
PC12 cell culture: PC12 cells were cultured in Dulbecco's modified Eagle's medium
supplemented with 7% fetal bovine serum, 7% horse serum, 100 units/ml penicillin, and
100 J..l.g/ml streptomycin (DMEM(+++)l. For the experiment cells were seeded in 12
*Nakanishi, N., Onozawa, S., Matsumoto, R., Hasegawa, H., and Yamada, S. (manuscript in preparation)
**** ****
300 1200
'2' '2
'Cii
·a;
e
a_
e
a_
Cl
Cl
E 200 E
..... 800
.....
.s
Cl
.s
Cl
E E
l!:l 2c:
c: 0
0 (,)
(,)
<(
a.. 100
Cl
400
co
................
Cant dB
Cell
..............
Cant dB
Medium
. Cant dB
Cell
Cant
Medium
dB
Figure 1. Effect of dBcAMP treatment of PCI2 pheochromocytoma on BP (a) and DA (b) contents in the
cells and medium. PC12 cells in 12 well plates were cultured for 16 hrs in DMEM (+++) (1 ml/well) in the
absence (Cant) or presence of 1 mM dBcAMP (dB). Values are the means±S.E. (n=6). Different from each
control value at ****P<O.OOl and *P<0.05 (Student's t-test).
232
Since dEcAMP treatment of PC12 cells resulted in the great increase in dopamine
(DA) in the medium by more than 40-fold of control level (Fig. 1-b), and furthermore
aromatic amino acid precursors of monoamines were thought to have an effect on the
regulation of EP biosynthesis 13, we examine the effects of Tyr, Trp, Phe, dopa (DO), DA,
norepinephrine (NE), and epinephrine (EP) (100 11M each) on EP levels of PC12 culture.
None of those gave significant change in the cellular EP, while the medium EP level was
lowered by DO and catecholamines. DA was most potent among those and DO was less
effective than catecholamines. In this experiments, DA content in the cells incubated with
DO was far higher than that in the cells incubated with DA itself, suggesting that DA in
the extracellular fluid rather than intracellular one is crucial for inhibiting EP transport out
from the cells. As shown in Fig. 2, DA concentration-dependently decreased the medium
EP content without affecting its cellular content. These results suggest that dEcAMP
effect lowering the medium EP content of PC12 cells is, at least partially, due to its action
to raise the DA (and DO) content in the medium.
However, molar concentrations of DA in the medium of control and dEcAMP-treated
cells in the experiments for Fig. 1 were calculated to be 0.037 11M and 1.5 11M, respectively.
These values seemed to be somewhat smaller to fully explain the dEcAMP effect with the
consideration of the concentration-dependency curve of DA effect (shown in Fig. 2). Thus
there is a possibility that dEcAMP-induced decrease in the medium EP is also caused by
other mechanisms. We examined a presence of EP binding protein(s) which would be
induced by the dEcAMP treatment of PC12 cells and would explain the dEcAMP effect on
the medium EP. We have not obtained yet positive results supporting the presence of such
protein. Alternatively, it is also possible that the decrease in medium EP is caused by
some metabolite(s) derived from catecholamines or DO which may be produced much
more by the dEcAMP-treated culture than the culture incubated with catecholamines.
120
100
~
~
-
E so
Q)
1:
8
a.. 60
CD
Q)
>
'fij 40
Qj
0:
20
0
0 10 100 1000
DA concentration (!lM)
Figure 2. Effect of DA concentration on the cellular and medium BP contents of PC12 cells. PC12 cells
cultured in 12-well plates were washed twice with 0.5 ml of Hanks balanced salt solution (HBS), and then
the cells were incubated with 0.5 ml of HBS containing various concentrations of DA for 60 min in a C02
incubator. Values are the means±S.E. of triplicate experiments, and represented as the percent of each
control value. The cellular and medium BP contents obtained in the absence of DA (control value) were
104±2.68 ng/mg protein and 20.0±0.801 ng/mg protein, respectively.
233
On the other hand, whether catecholamines influence the efflux of BP should also
be proven, since unlike dBcAMP they do not give significant changes in the cellular BP
content. Therefore, it seems unlikely but can not be neglected a possibility that catecholamine
does not affect BP flux but inhibits its synthesis needed to keep the medium BP level
without affecting the cellular content. Contrarily, it is also interesting that the cellular BP
content tends to be maintained in a certain level when the medium content is decreased by
the catecholamine addition to even 20% or less (Fig. 2).
Although mechanism by which dBcAMP lowers the outward flow of BP from the
cells is yet to be elucidated, whatever it is cAMP effect can influence both the intracellular
and extracellular levels of BP. This is important because on the one hand cAMP is one of
the major second messengers for the regulation of cell physiology by various signaling
molecules and on the other hand it has been reported new functions for tetrahydrobiopterin
such as serving as cofactor for nitric oxide synthase14' 15 , stimulating release of various
neurotransmitters in brain16•17 , and stimulating proliferation of erythro-leukemia cells 18' 19,
suggesting the actions of BH4 from the extracellular fluid and that of BH4 in cells not
producing BH4 by themselves.
REFERENCES
1. Greene, L. A. and Tischler, A. S. Adv. Cell. Neurobiol. 3:373 (1982)
2. Suzuki, H., Nakanishi, N. and Yamada, S. Biochern. Biophys. Res. Cornrnun., 153:382
(1988)
3. Nakanishi, N., Onozawa, S., Iwanaga, M., Akatsuka, I., Sawada, E., Asaumi, R.,
Hasegawa, H. and Yamada, S. 1.Meikai Univ.Sch.Dent. 19:197 (1990)
4. Nakanishi, N., Suzuki, H., Aono, K. and Yamada, S. in: "Pterins and Biogenic Amines
in Neurology, Pediatrics and Immunology" N. Blau, H. C. Curtius, R. A. Levine, and
G. R. H. Cotton, eds., Lakeshore Publishing, Grosse Pointe, pp. 101-108 (1991)
5. Nakanishi, N., Aono, K., Suzuki, H. and Yamada, S. in: "Pterins and Biogenic Amines
in Neurology, Pediatrics and Immunology" N. Blau, H. C. Curtius, R. A. Levine, and
G. R. H. Cotton, eds., Lakeshore Publishing, Grosse Pointe, pp. 109-117 (1991)
6. Woolf, J. H., Nichol, C. A., and Duch, D. S. (1986) in "Chemistry and Biology of
Pteridines 1986" B. A. Cooper, and V. M. Whitehead, eds., Walter de Gruyter, Berlin
New York, pp. 283-286 (1986)
7. Nakanishi, N., Onozawa, S., Matsumoto, R., Nakamura, M., Imagawa, S. and Yamada,
S. Pteridines 3:67 (1992)
8. Nakanishi, N., Onozawa, S., Kamei, M., Kawai, K., Hasegawa, H., and Yamada,S.
Pteridines (in press)
9. Nakanishi, N., and Guroff, G. 1. Biol. Chern. 260:7791 (1985)
10. Fukushima, T., and Nixon, J. C. Anal. Biochern. 102:176 (1980)
11. Bradford, M. Anal. Biochern. 72:248-254 (1976)
12. Koshimura, K., Miwa, S., Lee, K., Fujiwara, M., and Watanabe, Y. 1. Neurochern.
54:1391 (1990)
13. Yamaguchi,T., Nagatsu,Y., Sugimotomoto,T., Matsuura,S., Kondo,T., Iizuka,R., and
Narabayashi, H. Science 219:75 (1983)
14. Tayeh, M.A., and Marietta, M.A. 1. Biol. Chern. 264:19654 (1989)
15. Kwon, N. S, Nathan, C. F., and Stuehr, D. J. 1. Biol. Chern. 264:20496 (1989)
16. Koshimura, K., Miwa, S., Lee, K., Fujiwara, M., and Watanabe, Y. 1. Neurochern.
54:1391 (1990)
17. Mataga, N., Imamura, K., & Watanabe, Y. Brain Res. 551:64 (1991)
18. Tanaka, K., Kaufman, S., and Milstein, S. Proc. Natl. Acad. Sci USA 86:5864 (1989)
19. Kerler, F., Ziegler, 1., Schmid, C., and Bacher, A. Exp. Cell Res. 189:151 (1990)
234
NICOTINIC CHOLINERGIC REGULATION OF TETRAHYDROBIOPTERIN
LEVELS IN BOVINE ADRENAL CHROMAFFIN CELLS
INTRODUCTION
Isolated bovine adrenal chromaffin cells were prepared, purified and maintained in
suspension culture as described previously13 • Cells were treated by adding concentrated
solutions of drugs directly to the culture medium. To analyze TH activity cells were lysed
by freeze-thawing in hypotonic phosphate buffer (pH 6.8) containing 0.1% triton X-100,
and an aliquot assayed as previously described14 • To analyze in situ dopamine synthesis
rate, cells were harvested, preincubated in a balanced salt solution for 60 min at 37• C and
assayed for dopamine synthesis rate by assessing the conversion of 14C-carboxyl labeled
!-tyrosine to dopamine and 14C02 as previously described15 • BH4 and biopterin were
measured by lysing the cells in argonated H20 using three freeze-thaw cycles and then
adding an equal volume of argonated 1 M trichloroacetic acid. Following centrifugation
at 12,000 x g for 10 min, aliquots were injected onto an Adsorbosphere C-18 column
equilibrated in 50 mM ammonium formate, pH 3.3, containing 600 mg/L octane sulfonic
acid. BH4 was quantitated by electrochemical detection (0.3V vs Ag/AgC1 2) and biopterin
by fluorescence detection (Ex/Em = 367/450 nm).
We previously reported that chronic treatment of isolated chromaffin cells with the
non-metabolizable cholinergic nicotinic agonist dimethylphenylpiperzinium (DMPP) causes
between 1.5- and 2.5-fold increase in chromaffin cell TH protein and activity'4• This
induction of TH requires a ten fold lower DMPP concentration (1 J.IM) than is required for
stimulating CA secretion (10 J.IM) and is blocked by actinomycin D and cycloheximide.
These studies also demonstrated that in parallel with the increase in TH level, nicotinically
stimulated cells underwent a large increase in their capacity to endogenously hydroxylate
tyrosine to form DA. However the magnitude of the increase in hydroxylation capacity
was much greater than predicted by the magnitude of the change in the TH level'\ implying
that the induction of TH was only one of the mechanisms by which cholinergic stimulation
influences the CA synthesis capacity of the chromaffin cell. As neither the affinity of TH
for BH4 cofactor nor the activity of dopa decarboxylase were changed by the nicotinic
stimulation14 , an alternative explanation for the large increase in dopamine synthesis
capacity was that cholinergic stimulation influences the level of the TH cofactor, BH4•
We conducted a series of experiments to test the hypothesis that nicotinic stimulation
increases chromaffin cell BH4 levels. First we examined whether supplying the cells with
excess cofactor would negate the difference in fold stimulation of in situ dopamine
synthesis rate and in vitro TH level produced by chronic stimulation with 1 J.IM DMPP.
By pre-incubating the cells with the lipophilic analog, 6-cyclohexyltetrahydropterin prior
to assaying DA synthesis, we found that the difference in DA synthesis rates between
control and chronic DMPP-treated cells was reduced to a value close to the change in TH
level (the DMPP-induced fold increase without added pterin is 5.3 ± 0.78, whereas the
DMPP-induced fold increase with pterin present was 1.65 ± 0.13).
To directly test the hypothesis that BH4 level is regulated by cholinergic stimulation
we analyzed the level of biopterin and BH4 in control and cholinergically treated cells and
compared these results with changes in TH activity and dopamine synthesis capacity in
parallel cultures. As shown in Figure 1 A. and B. TH level and DA synthesis rates were
stable over the time in culture and DMPP caused a two fold increase in TH activity and
nearly 7-fold increase in dopamine synthesis as previously reported14•
236
A
c:
] 80
ea. 0 Control
0>
E 60 e 1 f"M OMPP
" 0
a.
0
"0
0
40
o-•~
•----------·
E ----0
8 0 0
20
.P
·;;
:;:;
<t " 0
I 0
f- 2 4 6 8
Days In Culture.
c:
.E
B
"q;
18
!12
0 Control
"c: 15
~!
~ 12
e 1 f"M DMPP
.E
/f _________,
'::::- 9
0
E
8 6
(IJ
'in
Q) 3
:5c:
,._
o-o 0 0
(f)
0
0 4 6
,___,_, ,
<t
2 8
0
Days in Culture
c
!12
q;
u
80
0 Control ___
~
c:
60 • 1 f"M DMPP
.E
'::::- /
Q~~
0
E 40
8
-~o-~------2-9
(IJ
q; 20
>
Q)
...
_J
I
([)
0
0 2 4 6 8
Days in Culture
Figure 1. Time course analysis of the effect of nicotinic stimulation of bovine chromaffin cells on A. TH
activity, B. DA synthesis capacity and C. BH4 level. DMPP at a final concentration of 1 pM was added
to chromaffin cells at day 2 in culture. Data are mean ± S.D. of four cell culture samples
237
With respect to BH4, two important observations were made. First, as shown in Figure
1 C. in the absence of 1 J.lM DMPP, the level of BH4 gradually decreased with time in
culture. Second, upon addition of DMPP, not only did BH4 fail to decrease, but BH4
content underwent a marked rise so that by day 5 of treatment the level was 2.5 fold
greater than when cells were placed in culture and 7-fold greater than non treated cells at
the same time point. Pre-treating the cells with cycloheximide abolished this effect (data
not shown), indicating that the mechanism involves ongoing protein synthesis. Further
analysis of basal BH4 levels showed that in freshly isolated cells levels are 30-50 pmol/106
cells and by day 9 this level falls to less than 5 pmol/106 cells. This decline was not
associated with a rise in either biopterin or BH2•
These results show that BH4 levels are regulated by nicotinic stimulation of chromaffin
cells and that the nicotinic influence on cofactor content could be responsible for the
marked increase in the rate of dopamine production in response to prolonged DMPP
stimulation. The observation that isolated chromaffin cells maintain a constant
concentration of TH, but not BH4, raises the possibility that basal levels of TH protein and
its cofactor are differentially regulated in vivo and that the maintenance of BH4 is highly
dependent on synaptic activity. The observation that dopamine synthesis in the cultured
chromaffin cells is constant with time in culture even though BH4 level drops is an
unexpected finding in these studies that remains to be explained.
ACKNOWLEDGMENTS
REFERENCES
1. U. S. von Euler, R. Luft, and T. Sundin, Acta Physiol. Scand. 34, 169 (1955).
2. T. Nagatsu, M. Levitt, and S. Udenfriend, J. Bioi. Chem. 239, 2910 (1964).
3. S. Spector, R. Gordon, A. Sjoerdsma, and S.Udenfriend, Mol. Pharmocol. 3, 549 (1967).
4. J. W. Haycock, J. Bioi. Chern. 265, 11682 (1990).
5. R. A. Mueller, H. Thoenen, and J. Axelrod, J. Pharmacol. Exp. Ther. 196, 74 (1969).
6. R. A. Levine, L. P. Miller, and W. Lovenberg, Science 214, 919 (1981).
7. R. Kettler, G. Bartholini, and A. Pletscher, Nature (Lond. ) 249, 476 (1974).
8. S. Miwa, Y. Watanabe, and 0. Hayaishi, Arch. Biochem. Biophys. 239, 234 (1985).
9. N. Mataga, K. Imamura, andY. Watanabe, Brain Res. 551, 64 (1991).
10. M. Boadle-Biber, and R. H. Roth, Br. J. Pharmacal. 46, 696 (1972).
11. M. B. Abou-Donia, S. P Wilson, T. P. Zimmerman, C. A. Nichol, and 0. H. Viveros, J.
Neurochem. 46, 1190 (1986).
12. 0. H. Viveros, C. -L. Lee, M. M. Abou-Donia, J. C. Nixon, and C. A. Nichol, Science 213, 349
(1981).
13. J. C. Waymire, W. F. Bennett, R. Boehme, L. Hankins, K. Gilmer-Waymire, and J.W. Haycock, J.
Neurosci. Meth. 7, 329 (1983).
14. G. L. Craviso, V. B. Hemelt, and J. C. Waymire, J. Neurochem. 59, 2285 (1992).
15. J. C. Waymire, J.P. Johnston, K Hummer-Lickteig, A. Lloyd, A. Vigny, and G.L. Craviso, J. Bioi.
Chem. 263, 12439 (1988).
238
INTER-RELATIONSHIPS BETWEEN PTERINS AND CYTOKINES PRODUCED
DURING ALLOGENEIC IMMUNE REACTIONS AND POSSmLE USE AS EARLY
MARKERS OF IMMUNE ACTIVATION
ABSTRACT
The pterins neopterin and xanthopterin have been measured together with the
cytokines IFN-y, TNF-a and TNF-~ in the supernatants of 20 allogeneic mixed lymphocyte
reactions. We have calculated rank correlation coefficients between these analytes and the
immune response. Our fmdings confirm that neopterin is a sensitive early marker of
immune activation and show that another pterin, xanthopterin could be used likewise.
Cytokine production was also proportional to immune activation but none could be used
consistently as early markers of immune activation.
INTRODUCTION
The pterin D-neopterin has proved to be a useful marker of immune activation, both
clinically and experimentally1• In vitro, monocytes have been identified as the principal
source, secreting D-neopterin in response to stimulation with the cytokine interferon-y
(IFN-y) 2•3• D-neopterin is a pterin metabolite of guanosine triphosphate in the synthetic
pathway of biopterin which is an essential cofactor in neurotransmitter synthesis4• D-
neopterin has been measured routinely by radioimmunoassay, however this method does
not permit the measurement of other pterins. To investigate the production of pterins during
immune activation we have developed a High Performance Liquid Chromatography (HPLC)
method for the measurement of pterins, including neopterin in serum and cell-culture
supernatants. We have used the in vitro, allogeneic mixed lymphocyte response (MLR) as
our model of immune activation. Cytokines are known to be intimately involved in the
initiation, development and augmentation of allogeneic immune responses5•6• IFN-y may
be involved in augmenting the allogeneic response through cell recruitment, activation and
proliferation, particularly macrophages, cytolytic T cells and natural killer (NK) cells, and
through the up-regulation of HLA class II expression7•8 • TNF is a major cytokine involved
in tissue damage, and appears to be involved in cell recruitment and activation.
In this study we have investigated neopterin and xanthopterin produced during in vitro
allogeneic immune reactions together with the production of IFN-y, TNF-a and TNF-b.
PBMC preparation
Heparinized human blood from healthy volunteers was centrifuged to obtain plasma
and the cells resuspended to their original volume in RPMI 1640 (Flow Laboratories).
PBMC were obtained by centrifuging the cells over lymphoprep (Nycomed, Birmingham,
UK) at 200g for 35 minutes at room temperature. The PBMC recovered were washed three
times in RPMI 1640 and resuspended in TCM at 5 x 106 viable cells/ml. Viability was
assessed by dye exclusion.
Four groups of five one-way MLR were performed by mixing equal numbers of
PBMC from one volunteer (responder) with X-irradiated (30 Gy) PBMC from a second
volunteer (stimulator) in 10 m1 cultures in TCM. Each group contained a control of a
mixture of the responder cells and the responder's own irradiated cells. The MLR's were
confirmed by thymidine incorporation (0.5 J!Ci added for final 18 hours in culture) in
parallel 200 J!l volume cultures in 96-well plates at 6 days. 2 m1 alliquots of the supernatant
of each MLR (including controls) were taken at 0, 2, 3, 4 and 5 days after culture,
centrifuged at 2500 rpm and supernantants removed and stored at -70°C. Alliquots were
later analysed for IFN-y, TNF-a, TNF-~ and pterin profile.
Cytokine assays
IFN-y ,TNF-a and TNF-~ were measured by ELISA using paired monoclonal and
polyclonal antibodies and standards kindly donated by Dr A Meager, NIBSC, Herts, UK.
RESULTS
MLR: Thymidine incorporatation at 6 days showed that positive MLR were obtained
between all four responders and each stimulator combination. For members of each group,
an MLR stimulation index (si) was derived using the formula:
Cytokine production: Cytokine levels showed a progressive increase over the culture
period with MLR levels exceeding that of their controls.
Pterin production: Neopterin production mirrored that of xanthopterin in the the MLR
with levels consistently greater than that of the the controls.
240
'Analyte indices' (AI) were calculated for each analyte at time points 3, 4 and 5 days
where:
Mean levels and one standard deviation of all AI's were derived for each MLR at each
time point, and are shown in Table 2. Spearman's rank correlation were calculated for each
analyte at 120 hours against the corresponding stimulation index (Table 3). All statistics
were calculated using SPSSx version 4.0 (SPSS inc.) run on a SUN 4/670.
Table 2: Mean AI and one standard deviation for each analyte at all time points of MLR.
Analyte vs si R p
INF-y vs si 0.3196 0.085
241
DISCUSSION
Cytokines are powerful immunomodulatory peptides, mostly acting at the cell to cell
level and have short half lives in the circulation (minutes). Cytokine levels in the MLR
culture supernatants represent a complex dynamic equilibrium between the level of
production and consumption by increased levels of cell-membrane associated and soluble
receptors. This could account for the poor correlation between cytokine levels and MLR
si, and for the lack of consistent differentiation from group controls.
Conversely neopterin and xanthopterin are stable molecules which accumulate as non-
biogenic analytes in an in vitro closed system such as an MLR. Pterin levels consistently
differentiated from their group controls relatively early in the MLR, (xanthopterin 3 days
and neopterin 4 days) compared with the cytokines although the AI for xanthopterin at 3
days did not show a significant rank correlation with immune activation (si) on day 6 (r
= 0.26, P = 0.012). Xanthopterin levels could thus only give a qualatative value for
immune activation in the MLR at this time. Pterin levels at 5 days gave a more significant
rank correlation with stimulation index thus reflecting more accurately, levels of immune
activation. 7,8 dihydropterin derivatives are converted to 7,8 dihydroxanthopterin10 which
in turn is oxidised to xanthopterin under our assay conditions. Our results show a greater
yield of xanthopterin over neopterin, which appeared to follow neopterin levels
stoichiometrically.
Our results confirm that neopterin is an early in vitro marker of immune activation
and indicate that xanthopterin which is produced in greater quantities could be more
sensitive.
REFERENCES
242
AN EXAMPLE OF THE DETECTION OF AN ESOPHAGEAL CARCINOMA
IN ITS VERY EARLY STAGE BY URINARY XANTHOPTERIN
DETERMINATION.
Teruhiko Iinol, Hiroe Watanabe\ W.L.Gyure2 , Toshio Mazda 3 , Hiroyoshi Mieno4 and
Motoo Tsusue5
INTRODUCTION
Neopterin (NP) has been used as a biochemical marker of the activated state of
cell-mediated immunity and to monitor and screen for some clinical disorders1 - 4• In previ9us
papers s- 6 , we reported that xanthopterin (XP) also reflects the same type of immune status as
well as various types of liver disease. In the course of our study on the determination of
urinary pteridines, one of the authors (M. T.) happened to find that his urinary XP level was
higher than the normal range. Although his other tumor indicators such as CEA, SCC and
CA19-9 showed normal values, an abnormality was found in the squamous cells of his
esophagus after endoscopic inspection. In the present paper we compare longitudinal
changes in his urinary excretion levels of XP and NP for a period of eleven months before
and after surgery.
Collection ofurines.
Urine samples were collected from healthy individuals and the patient at early morning
hours and kept frozen at -4o·c until analyzed.
Blood sample analysis.
Blood samples were taken from the patient at the time of urine collection. Serum tests
for liver disease and tumor markers were performed for the following; r -GT, AST, ALP,
CA 19-9 17.4 10 7 5
Fig. I Resected specimen of esophagus carcinoma (Lugol's stain) with uneven surface measured 1.5 x 1.2
em (left). Microscopic appearance with clear nucleolus (indicated with arrow) in squamous cell carcinoma of
the esophagus ( HE stain. x 125, right).
244
Although tumor markers showed normal levels ( except for the CEA value in Oct. Table
I ), an abnormality was found in the squamous cells of the patient's esophagus after endoscopic
inspection. A biopsy revealed the presence of well-differentiated squamous cell carcinoma.
After surgery (28 Jan.), we found that the squamous cell carcinoma measured 1.5 x 1.2
em and was unstainable by Lugol's solution ( Fig.lleft ). On histomorphological observation,
the nucleolus was sufficiently clear ( Fig. I right )
Urinary excretion levels ofXP and NP.
In the control group ( 54 healthy individuals ), the urinary excretion levels of NP and
XP were 435 ±71 JJ.mole/mole creatinine (Mean ± S.D.) and 661 ±119, respectively.
Although the usual liver disease markers mentioned above and tumor markers showed normal
levels, the urinary excretion levels of NP and XP for this patient were 789 and 1121,
respectively, two months before surgery. In order to determine whether excretion levels
of pterins could be used tQ follow the course of the disease, a longitudinal study was
conducted on the patient with the esophageal carcinoma. Urines were coHected for a period of
eleven months from this patient and analyzed for their pterin content.
3000
Normal value
(Mean +2SD)
2500
a.: • XP 899 11mol/mol Cr.
u 0 NP 577 11mol/mol Cr.
0 2000
e
-
~
~
1500
0
e::1. 1000
500
0
,....
c"
"'
...,
Date
Fig. 2 Change in the urinary excretion levels of XP and NP in patient as a function of time
Fig. 2 shows the change in the excretion levels of XP and NP as a function of time for
this patient with esophageal carcinorma. In spite of the fact that tumor markers such as CEA,
CA19-9 and SCC showed normal levels throughout the observation, the high levels of
urinary pteridines of the patient led to the finding of the abnormality in his esophagus by
endoscopic inspection. Urinary excretion levels of pteridines rose to high values and were
2-3 times higher than the normal level just before surgery. In February, we did not collect
245
a urine sample from this patient, because of the complication of acute pneumonia just after
surgery, which took place in January. The slight increase in the XP and NP levels observed
in the 2 months after the operation may be due to this disease. However, the nine weeks
after surgery, XP and NP levels gradually decreased and reached normal levels within two
months.
The elevation in excretion levels of XP and NP in cancer patients is not easily explained.
Several researchers have reported that in general, increased urinary excretion of pterins could
result from an increase in folate catabolism by cancer cells and/or an increase in
tetrahydroneopterin and tetrahydrobiopterin catabolism 9' 10 • Recently, we reported that the
XP concentration was found to be 1.3-1.8 times the basal concentration when solutions of
dihydro-XP, dihydro-NP or BH 4 were mixed with urine and assayed using this method6 •
Zeitler et al . reported that 20-40% of reduced forms of NP, BP and other reduced pterin
derivatives present in urine are decomposed to XP during activated charcoal treatment 11 •
Clarification of the these points will require further research.
The present data shows results for only one patient, however, the higher excretion
levels of urinary pteridines alone revealed the carcinoma cells in their very early stage while
the usual tumor markers were all normal. The present paper suggests that the determination
of urinary pteridines levels might possibly be a useful marker for the early detection of
cancerous malignancies.
REFERENCES
1. Wachter, H., Hausen, A., and Grassmayr, K., Hoppe-Seyler's Z. Physiol. Chern., 360, 1957-1960,
( 1979 ).
2. Huber, C., Batchelor, J.R., Fuchs, D., Hausen, A., Lang, A., Niederwieser, D., Reibnegger, G., Swetly,
P., Troppmair, J., and Wachter, H., J. Exp. Med., 160, 310-316, ( 1984 ).
3. Fuchs, D., Hausen, A., Reibnegger, G., Werner, E.R., Dierich, M. P., and Wachter, H., Immunol.
Today, 9, 150-155, ( 1988 ).
4. Hausen, A., Fuchs, D., Reibnegger, G., Werner, E.R., and Wachter, H., Pteridines, 1, 3-10, ( 1989 ).
5. Mazda, T., Ogasawara, K., Fukuda, A., Gyure, W.L., and Tsusue, M., in: Chemistry and Biology of
Pteridines 1989 ( Eds. Curtius, H.C., Ghisla, S. and Blau, N. ) pp. 579-582, Walter de Gruyter,
Berlin-New York, ( 1990 ).
6. Fukuda, A., Mazda, T., Gyure, W.L., Iino, T., Harada, H., Yakura, M., Kamitsukasa, H., Ohbayashi, A.,
Oka, T., and Tsusue, M., Eur. J. Clin. Chern. Clin. Biochem., 31 in press, ( 1993 ).
7. Plesner, P., and Kalckar, H.M., Meth. Biochem. Analysis, 3, 97-110, ( 1956 ).
8. Nakagoshi, M., Tak1kawa, S., Negishi, S., and Tsusue, M., Bioi. Chern. Hoppe- Seyler, 373, 1249-1254,
( 1992 ).
9. Stea, B., Backlund, P.S., Jr., Berkey, P.B., Cho, A.K., Halpern, B. C., Halpern, R. M., and Smith, R.
A., Cancer Res., 38, 2378-2384, ( 1978 ).
10. Rokos, H., Rokos, K., Frisius, H., and Kirstaedter, H.J., Clin. Chim. Acta, 105, 275-286, ( 1980 ).
11. Zeilter, H.J., and Andodonskaja-Renz, B., Bioi. Chern. Hoppe-Seyler, 373, 972-973, ( 1992 ).
246
NEOPTERIN IN SUBACUTE SCLEROSING PANENCEPHALITIS
INTRODUCTION
Subacute sclerosing panencephalitis (SSPE) has a very poor prognosis. In recent
years, the introduction of various treatments including inosiplex and interferon has somewhat
improved the survival rate1.2• However, there are large variations in the response of patients.
It is difficult to forecast the response and prognosis on the basis of clinical symptoms
alone, but sequential recordings by computed tomography (CT) and magnetic resonance
imaging (MRI) can be used to identify the lesions and severity of the disease, providing
information that may be correlated with changes in the neurological symptoms3 • A number
of laboratory tests have been used to define the clinical stage of patients with SSPE. Here,
we report that sequential monitoring of neopterin, ferritin, and creatine kinase (CK) in the
cerebrospinal fluid (CSF) of two patients with SSPE was useful as an index of the progress
of the disease.
PATIENTS
Case 1 was an 11-year-old boy. At the end of March 1988, his achievement at
school decreased, loss of memory developed and he experienced recurrent falls. By the
middle of May, he became less attentive and indifferent to his surroundings; personality
changes, a speech disorder, and myoclonus followed. An EEG showed typical periodic
slow-wave complexes. Measles antibody titers in the serum and CSF were 1:1024 and 1:16,
respectively, by complement fixation (CF). Based on these findings, the diagnosis was of
SSPE. Treatment with inosiplex and antiepileptic drugs improved the patient's condition
enough so that he could have simple conversations, but in the middle of July he began to
suffer from tremor and uncontrollable restlessness; at the beginning of August, right
hemiparesis developed and he was unable to walk. In the middle of August, generalized
tonic seizures appeared, followed by deterioration of consciousness. At the end of August,
administration of interferon a (INF- a ) intrathecally was started in addition to inosiplex,
but the only result was the development of spasticity, which worsened during September.
The patient also received intravenous interleukin 2, but his level of consciousness further
decreased, leading to dysphagia, so that nutrition by a nasal tube became necessary. Thereafter,
the progression of symptoms was arrested at stage IV according to Jabbour's classification.4
Case 2 was a previously healthy girl who began to have myoclonic seizures,
cerebral dysfunction, slow speech and parkinsonian gait at the age of 17, in 1985. Measles
antibody titers in the serum and CSF were 1:512 and 1:128, respectively, by hemagglutination
inhibition (HI), and there were typical periodic slow-wave complexes on the EEG, confirming
the diagnosis of SSPE. Inosiplex and anticonvulsants were given and the patient recovered
METHODS
The diagnosis of SSPE was based on the clinical manifestations, EEG findings, and
elevated serum and CSF measles antibodies. Patients were assessed by a neurological
disability index (NDI) score. 1
The MR images were obtained with a 0.5 Tesla superconducting magnet (Picker-
International Co).
CSF collected from the two patients was frozen and preserved until the various
markers listed below were measured. Protein, glucose, numbers of cells, measles antibody
titers by HI or by CF, and measles IgG by enzyme immunoassay (EIA) in the CSF were
measured on the day when the CSF was collected.
Ferritin, CK, and neopterin in the CSF were studied. Ferritin were measured by
radioimmunoassay, and neopterin were measured by reverse-phase high-pressure liquid
chromatography 6•
RESULTS
In case 1, the protein, glucose and number of cells in the CSF remained within
normal ranges throughout the course of treatment between May 1988 and February 1989.
The normal level of neopterin is 18.5 ± 10.4 pmol/ml. When first measured, neopterin
was 111.5 pmol/ml. Neopterin remained at high levels in the CSF throughout the course of
treatment. Immediately before the time when ferritin and CK increased to abnormal levels,
neopterin was particularly high: 180.8 pmol/ml.
Ferritin was at the level of 2.1 ng/ml when first measured, but it increased as the
neurological symptoms worsened, eventually exceeding the upper limit of normal, 6.0
ng/ml. When the NDI became constant with the stabilization of symptoms, ferritin decreased
again to 2.4 ng/ml, which was comparable to the level in May. CK showed a similar pattern
of changes; it exceeded the normal upper limit of 3.8 IU/L in September and October,
reached the level of 8 IU/L, and then returned to normal. Changes in ferritin and CK
roughly corresponded with changes in the extent of the high-intensity areas in the white
and gray matter observed by MRI. Fig 1 shows changes in neopterin, ferritin, CK, NDI and
the high-intensity areas of the white and gray matter together with details of treatment.
Changes in the MRI are shown based not on measurements but on an overall impression.
In case 2, the CK and ferritin values were in normal ranges at all points of measurement.
248
pmoVml
Neopterin & Biopterin
200
100
Neopterin
Biopterin
NOI
80
60
40
20
3 4 5 6 7 8 9 10 11 12 1 2 3 4
1988 1989
INOSIPLEX r-=:-=---:372oo:-:'."44
':'~oo::-m------
g
~ l!!f -
I
INTERFERON IT 150·900x 10'units
IV 1200 X 10'uniiS m
INTERLEUKIN2 aB I 75-500 units
MRI
Fig 1. Changes in CSF levels of neopterin and ferritin, the NDI, and the high-intensity areas of the white and
gray matter by MRI, together with details of treatment. Antiepileptic drugs given are not listed.
On the other hand, although neopterin levels were in normal ranges when measured in
May, neopterin was high (87.8 pmol/ml) in December 1991.
MR images in case 1 were taken sequentially. At the end of May, high-intensity
areas in T2-weighted images were detectable, but barely so, in the white and gray matter.
From August to October, high-intensity areas appeared over an extensive region, including
the white matter and cortex of the posterior lobe and the white matter around the ventricles.
Afterwards, the area of the T2-weighted images in the lesions grew smaller, making the
dilatation of the ventricles more conspicuous, indicating the progression of cerebral atrophy.
MR images in case 2 obtained in 1985 showed prolonged T1 and T2 relaxation
times in both lentiform nuclei and the white matter adjacent to the lateral ventricles. In the
autumn of 1986, the lesions in the lentiform nuclei had almost disappeared, but in 1991,
MR revealed severe atrophic changes. In that year, there was little further change.
DISCUSSION
We reported for the first time an association between neopterin levels in the CSF of
patients with SSPE and the clinical stage. Neopterin are synthesized from guanosine
249
triphosphate (GTP) in the synthetic pathway of tetrahydrobiopterin, which act as a cofactor
in neurotransmitter synthesis. GTP cyclohydrolase I is present in macrophages, and neopterin
is formed as a metabolite of dihydroneopterin triphosphate produced from GTP by GTP
cyclohydrolase I. The general assumption has been that there is no enzyme synthesizing
biopterin in macropha.pes and that only neopterin is produced there, but the enzyme does
exist in macrophages . GTP cyclohydrolase I in macrophages is activated by INF- y .
Neopterin is a sensitive marker of activation of the cellular immune system, and it is
released from macrophages stimulated by INF- y produced by activated T lymphocytes8•
Elevated levels of neopterin are correlated with and mark previous or ongoing stimulation
of macrophages by INF- y. Neopterin in the CSF is elevated in various infections 9,
malignancies and immune-mediated diseases 10• An increased amount of neopterin is present
in the CSF during direct viral infection of the central nervous system and during exacerbations
of multiple sclerosis 11 • In addition, neopterin is increased in the CSF during postmeasles
encephalomyelitis 11 • The encephalomyelitis that occurs as a complication of measles is an
autoimmune demyelinating disease triggered by the measles virus.
Intracerebral inflammation and subsequent nerve tissue damage seemed to be
progressing rapidly in case 1, to judge from the expansion of high-signal areas in T2-weighted
images on MRI and their relation to biochemical parameters. On the other hand, that
neopterin levels rose slightly earlier than the changes in CK and ferritin levels may be
because of stimulation by INF- y derived from T cells in the acute exacerbation stage of
inflammation and consequent acceleration of macrophage metabolism and neopterin release.
Three courses of INF- a intrathecally or intravenously were used in case 1. The neopterin
level did not rise with the second and third INF- a administrations, so INF- y production
seems not to rise with INF- a administration. Thus, it does not lead macrophage activation
and neopterin production.In case 2, there was a relatively mild course for 6 years, with
gradual clinical exacerbation in 1991. Neopterin levels in CSF were in the normal range
when the patient was in Jabbour's stage I and stable except for disturbance of intellectual
function. The level rose at the end of December 1991 when gait disturbance developed.
These results suggest that assay of the neopterin level in CSF would provide an
index of the intensity of inflammation and possibly an index of the progress of intracerebral
lesions before they can be detected by imaging or by changes in other biochemical parameters.
In our cases, an increase in neopterin excretion in the CSF preceded changes in the clinical
condition and was correlated with the findings of MRI. If this index is used, treatment
could be started earlier when neopterin begins to increase.
REFERENCES
1. P.R. Dyken, A. Swift, R.H. DuRant, Long-term follow-up of patients with subacute sclerosing panencephalitis
treated with inosiplex, Ann Neural. 11:359 (1982).
2. K. Yalaz, B. Anlar, F. Oktem, eta!., Intraventricular interferon and oral inosiplex in the treatment of
subacute sclerosing panencephalitis, Neurology. 42: 488 (1992).
3. G.B. Lum, J.P. Williams, P.R. Dyken, eta!., Magnetic resonance and CT imaging correlated with clinical
status in SSPE, Pediatr Neural, 2: 75 (1986).
4. J.T. Jabbour, J.H. Garcia, H. Lemmi, J. Ragland, D.A. Duenas, J.L. Sever, SSPE: a multidisciplinary
study of eight cases, JAMA, 207:2248 (1969).
5. R. Murata, 0. Matsuoka, S. Nakajima, eta!., Serial magnetic resonance imaging in subacute sclerosing
panencephalitis, Jpn J Psychiatr Neural, 41:277 (1987).
6. T. Fukushima, J.C. Nixon, Analysis of reduced forms of biopterin in biological tissues and fluids, Anal
Biochem, 102: 176 (1980).
7. J. Guzman, N. Blau, 6-Pyruvoyl tetrahydropterin synthase in human tissues and cell lines, Pteridines 3: 43
(1992).
8. S. Huber, J.R. Batchelor, D. Fuchs, et a!., Immune response-associated production of neopterin: release
from macrophages primarily under control of interferon-gamma, J Exp Med, 160: 310 (1984 ).
9. H. Shintaku, A. Nishimura, R. Murata, Neopterin and biopterin levels in cerebrospinal fluid in children
with meningitis, Bioi. Chern. Hoppe-Seyler, 369:542 (1988).
10. D.E. Griffin, J.C. McArthur, D.R. Cornblath, Neopterin and interferon-gamma in serum and cerebrospinal
fluid of patients with HIV-associated neurologic disease, Neurology 41:69 (1991).
11. S. Fredrikson, P. Eneroth, H. Link, Intrathecal production of neopterin in aseptic meningo-encephalitis
and multiple sclerosis, Clin Exp Immunol, 67:76 (1987).
250
THE 7-DEAZAGUANINE DERIVATIVE, QUEUINE,
REGULATES MAMMALIAN CELL PROLIFERATION
DEPENDING ON THE METABOLIC STATE
INTRODUCTION
HeLa-S3 cells were grown in medium supplemented with q-free horse serum and
subsequently lacked the modified nucleoside Q in tRNAs (Q-deficient cells). Addition of
chemically synthesized q-base (0.3 J.!M) to these cells resulted in a significant stimulation
of their proliferation (table 1). When similar experiments were performed under conditions
of hypoxic stress, i.e. 7% oxygen instead of 21% for aerobic conditions, the addition of q
to the culture medium resulted in an inhibition of proliferation (table 1). A detailed analysis
revealed that oxygen limitation in the case of HeLa-S3 cells caused an induction of the ldh a
252
Table 1. Modulation of mammalian cell proliferation by queuine.
AV-3 1.2 - 1.5 24-48 3 human, normal amnion cells, epithelial like
Chang Liver 1.3- 2.0 48 4 human, normal lung cells, epithelial like '
Swiss-3T3 1.8- 2.9 24-48 4 mouse, normal embryonic tissue, fibroblast-like
NIH-3T3 1.4- 2.0 24-48 5 mouse, normal embryonic tissue, fibroblast-like
Wi-38 2.8- 3.7 24-48 3 human, normal embryonic lung, fibroblast-like
Ha-ras-3T3 0.7- 0.4 24 3 NIH-3T3 cells transformed by the activated human Ha-ras gene
raf-3T3 0.9- 1.6 24 3 NIH-3T3 cells transformed by the activated rqf gene
1All cells were maintained in medium supplemented with q-free horse serum. Q-deficient cells were precultivated for 2 - 3 days followed by addition of chemically synthesized q to the
culture medium. The increase in cell number after addition of q was determined and is expressed as fold increas in the cell number of q-free cultures within the same period (relative
increase). The point of maximal response to q was chosen from each experiment The minimal and maximal values found in repeated experiments are listed.
2For cultivation under hypoxic conditions, HeLa cells were grown in an incubator in which the atmosphere was replaced with nitrogen to reduce the oxygen content to 7%.
~
w
The molecular basis for the growth modulating activity of q remains to be
elucidated. However, we have gained substantial evidence that both the free q-base and Q-
tRNAs are involved in this process. The free base probably interacts with specific
phosphoproteins involved in growth control, and thereby influences mitogenic signalling
by growth factor receptors 10. On the other hand, q and Q-tRNAs might be necessary for a
proper adaptation of the cell metabolism to the enviromental oxygen tension6. Both of these
queuine-mediated events may finally contribute to an altered growth behaviour of
mammalian cells in culture. The modulating effect of q may be of significance for rapidly
proliferating tumor cells, which are characterized by a deranged growth control and an
altered metabolic state. Increased levels of pteridines may be connected with Q-deficiency
of tRNAs and accumulation of the free q-base in tumor tissues. Fluctuations in the amount
of free q and of Q-deficient tRNAs may influence the proliferative capability of
neoplastically transformed cells and may contribute to the malignant phenotype of tumor
cells in vivo. A detailed analysis of the state of modification of tRNAs in the various cell
lines is currently in progress.
ACKNOWLEDGEMENTS
Queuine was a kind gift from Dr. S. Nishimura and was chemically synthesized by Drs.
H. Akimoto and N. Nomura of the Central Research Laboratories, Takada Chemical Ind.
Ltd., Osaka, Japan. We are greateful to Drs. Th. Dingermann and A. Ogilvie at our
institute for providing various cell lines, and to Dr. Sakiya and Dr. Nagao of the National
Cancer Center Research Institute, Tokyo, Japan for providing the ras -and raj-
transformed fibroblasts respectively. This work was supported by the Johannes and Frieda
Marohn Foundation, Germany.
REFERENCES
254
TETRAHYDROBIOPTERIN DEFICIENCY AND AN INTERNATIONAL
DATABASE OF PATIENTS
INTRODUCTION
SR + +- t SRorAR
'\ 6
Tetrahydrobiopterin ~02
Phenylalanine
4a-Peroxy-tetrahydrobiopterin
~ DHPR PAH\ ~
··""""""''"""'-"'""''":;:j~'·"'''"'
q-Dihydrobiopterin ..-.;( ~
The following investigations should be performed in all newborns with even slight
hyperphenylalaninernia6:
The first two tests are essential and enable to differentiate between all variants of
BH4 deficiency. The BR4 loading test is an additional useful diagnostic tool for the fast
discrimination between the classic phenylketonuria (PKU) and BH4 variants.
256
Loading test. The loading test with BH4 allows the detection of all variants w'l.th a
defect in B~ biosynthesis, even if the defect is only partial. A decrease of the plasma
phenylalanine occurs within 4 to 8 hours after administration of B~. The original test at a
dose of 7.5 mg/kg bw was modified by increasing the loading dose to 20 mg BR4fkg bw.
However, one patient was described as a non-responder even at this high dose of BH4 and
died despite an early diagnosis and treatrnent12.
Clinical manifestation
Typical forms. The clinical course of the illness in untreated patients is similar in
typical PTPS, DHPR and GTPCH deficiencies14. The median age at which clinical signs
become evident is 4-5 months, but symptoms do not necessarily correlate with age of
diagnosis, even in the same family. However, when information on the neonatal period is
available, abnormal signs (poor sucking, decreased spontaneous movements, floppy baby)
can be noticed during the neonatal periodS.
The most common symptoms are mental retardation, convulsions (grand mal or
myoclonic attacks), disturbances of tone and posture, drowsiness, irritability, abnormal
movements, recurrent hyperthermia without infection, hypersalivation, swallowing
difficulties. Microcephaly is observed in both diseases but with a higher incidence in PTPS
deficiency (52%) than in DHPR deficiency (33 %). However, in 13 of 25 DHPR deficient
patients for whom repeated measurement with increasing age were available, decrease of
head circumference to progressive microcephaly was observed, whether patients were
treated or not.
Atypical Forms. Atypical PTPS deficiency: The absence of clinical signs theoretically
defines atypical forms. However, in 2 cases neonatal hypotonia was noticed, 2 were
mentally retarded, 1 had focal signs on EEG at 9 years of age and 1 presented with acute
but transient symptoms (behaviour problems, neurovegetative signs, sleeping difficulties).
Atypical DHPR deficiency: Some authors have suggested that partial deficiency of
DHPR activity may also exist. That may explain a few reports on patients who were
unusual in some aspects.
Primapterinuria: Although this form seems to have no serious consequences, minor
signs can be observed. In the first easelS, slight tremors of upper limbs after stimulation
and a moderate tendency to hypertonia were noticed during the neonatal period. With
dietary control of blood phenylalanine, neurological development normalized. In the case
reported by Blaskovics and Giudici16, transient hypotonia and motor delay were also
noticed.
257
Treatment
a
R•0 .31
10 Q
0 0 a
1000~~~~~~~~~;;~==~
i tM-~·-:i?·tf-~1~1;'-F
"'
:. H%~H~:f+··i¥~~t.%i;
.. 100 6 ail 0 : ""
0
• • ' .'
..
0
10 10
I
• on nKrott.ann'IIIIH + THB
I
~ 6 on THB
• on IWU'otranmit
10 100 1000 AGE Cda~~S)IOOOO 10 100 1000 AGE Cdays>10000
Figure 2. CSF levels of 5IDAA and HVA in patients with typical (severe) PTPS
deficiency without treatment (upper) and under different treatment protocols; 0 on
neurotransmitters; A on BH4; • on neurotransmitter+ BH4, (lower).
258
10 F\o 0.8C 10
• on n-l9 • on 1MB
@SFHIA)
~
I I
10 100 1000 AGE fda~ 10000 10 100 1000 AGE fdllysl 10000
Figure 3. CSF levels of 5HIAA and HVA in patients with atypical (peripheral, mild) PTPS
deficiency without treatment llSl and on BH4 treatment •.
1000
""~
c:
100
10 10
R-038
00
1 +---~--~~--~----~--~--~
10 100 1000 AGE Cdaysl 10000
...
•
10 10
• on ne-urouta~nmitl:tr • oni\IPurOtr.antri'l!'r
1+----------r--------~--------~
10 100 ' 10
+-------~-r--------~--------~
1000 AGE <o:laysl 10000 100 1000 10000
AGE fda~
Figure 4. CSF levels of 5HIAA and HVA in patients with DHPR deficiency without
treatment (upper) and on treatment with neurotransmitter • (lower).
259
BIODEF: An international database
PCD (9) 4%
GTPCH (8) 3%
? (10)
33%
DHPR (86)
Figure S. Summary of the patients registered in the international database of
tetrahydrobiopterin deficiencies.
The database we are establishing is an informative resource and retrieval system that
includes biochemical and clinical information on variants of hyperphenylalaninemia as
well as a physicians' and researchers' directory. A complete bibliography on BH4
deficiency (over 370 entries) will also be included. BIODEF will run both under MS-DOS
and as an Windows application on 100% IBM compatible media. Both interfaces will be
linked to the same data stored in dBASE format. It will be copyright-free and it will store
the patients' records (no patients' names) and will allow via network the possibility to
browse, edit, append, query, export, and print such data. A hard copy in a booklet form will
also be available.
So far 263 patients with BI4 deficiency have been registered. Of these 263 patients
150 suffer from PTPS deficiency, 86 from DHPR deficiency, 9 from PCD deficiency, 8
from GTPCH deficiency, and 10 are still not classified (Figure 5).
260
ACKNOWLEDGEMENTS
This work was supported by the Swiss National Science Foundation, project No.
31.33897.92 and by the Helmut Horten Research Foundation.
REFERENCES
1. N. Blau, Inborn errors ofpterin metabolism. Ann Rev Nutr. 8:185 (1988).
2. J.L. Dhondt, Strategy for the screening of tetrahydrobiopterin deficiency among
hyperphenylalaninemic patients: 15-years experience. J Inherit Metab Dis. 14:117
(1991).
3. N. Blau, H.C. Curtius, T. Kuster, A. Matasovic, G. Schoedon, J.L. Dhondt, P.
Guibaud, T. Giudici and M. Blaskovics, Primapterinuria: a new variant of atypical
phenylketonuria. J Inherit Metab Dis. 12/2:335 (1989).
4. J.L. Dhondt, Tetrahydrobiopterin deficiency. Lessons from the analysis of 90 patients
collected in the international register. Arch Fr Pediatr. 12:655 (1987).
5. J.L. Dhondt, Tetrahydrobiopterin deficiencies. Lessons from the compilation of 200
patients. Developmental Brain Dysfunction. 6:139 (1993).
6. N. Blau, Guidelines for the screening for hyperphenylalaninemia due to
tetrahydrobiopterin deficiency. Cro Med J. 33:17 (1992).
7. J.L. Dhondt, C. Largilliere, P. Ardouin, J.P. Farriaux and M. Dautrevaux, Diagnosis of
variants of hyperphenylalaninemia by determination of pterins in urine. Clin Chim
Acta. 110:205 (1981).
8. A. Niederwieser, W. Staudenmann and E. Wetzel, High-performance liquid
chromatography with column switching for the analysis of biogenic amine metabolites
and pterins. J Chromtogr. 290:237 (1984).
9. N. Arai, K. Narisawa, H. Hayakawa and K. Tada, Hyperphenylalaninemia due to
dihydropteridine reductase deficiency: diagnosis by enzyme assays on dried blood
spots. Pediatrics. 70:426 (1982).
10. A. Ponzone, 0. Guardamagna, S. Ferraris, G.B. Ferrero, I. Dianzani and R.G.H.
Cotton, Tetrahydrobiopterin loading test in hyperphenylalaninemia. Pediatr Res.
30:435 (1991).
11. N. Blau, L. Kierat, C.W. Heizmann, W. Endres, T. Giudici and M. Wang, Screening
for tetrahydrobiopterin deficiency in newborns using dried urine on filter paper. J
Inherit Metab Dis. 15:402 (1992).
12. W. Endres, H. lbel, L. Kierat, N. Blau and H. C. Curtius, Tetrahydrobiopterin and
"non-responsive" dihydropteridine reductase deficiency. Lancet. 2:223 (1987).
13. A. Ponzone, 0. Guardamagna, M. Spada, S. Ferraris, R. Ponzone, L. Kierat and
N. Blau, Differential diagnosis of hyperphenylalaninemia by a combined
phenylalanine-tetrahydrobiopterin loading test. Eur J Pediatr. in press (1993).
14. J.L. Dhondt, Tetrahydrobiopterin deficiencies: preliminary analysis from an
international survey. J Pediatr. 104:501 (1984).
15. J.L. Dhondt, P. Guibaud, M.O. Rolland, C. Dorche, S. Andre, G. Forzy and
J.M. Hayte, Neonatal hyperphenylalaninaemia presumably caused by a new variant of
biopterin synthetase deficiency. Eur J Pediatr. 147:153 (1988).
16. M. Blaskovics, and T.A. Giudici, A new variant ofbiopterin deficiency.
N EnglJ Med. 319:1611 (1988).
261
TETRAHYDROBIOPTERIN DEFICIENCY IN PORTUGAL: RESULTS OF THE
SCREENING FOR HYPERPHENYLALANINEMIA
INTRODUCTION
CASE REPORTS
Patients: A total of 41 patients with different forms ofHPA have been investigated, 27
of them were hypetphenylalaninemic newborns detected by neonatal screening (Group A),
11 were PKU children between 3-14 years old (Group B) and the others (Patient 1 and 2)
presented moderate hyperphenylalaninemia and were revealed to be BH4 deficient.
METHODS
Analysis of pterins in urine and CSF, after oxidation with Mn02, was performed by
HPLC3. The neurotransmitter metabolites - 5-hydroxyindoleacetic acid (5-HIAA) and
homovanillic acid (HVA)- were extracted from CSF and urine samples using Sep-pak C18
cartridges (Waters Assoc., Mildford, MA, USA), as previously described4. These
metabolites were then determined by reversed-phase HPLC in 10 mM acetate buffer :
methanol (90:10), pH adjusted to 3.3 with glacial acetic acid and fluorimetric detection
0.-ex= 280 nm; "-em= 320 nm). Plasma amino acids were determined as o-phtalaldehyde
(OPA)-derivatives by reversed phase HPLC, according to established methodology5.
DHPR activity was measured in erythrocytes obtained from dried blood spots of Guthrie
cards, using the method of Arai et a1.6.
264
No difference in DHPR activity between controls (2 - 5 mU/mg Hb) and HPA patients
(Group A and B: 4.2 ± 1.1 mU/mg Hb; N= 39) and no variation of enzyme activity versus
blood Phe levels were observed.
The clinical presentation of patients H.S. and A.L. suggested that the patients had a
deficiency of BH4. This was confirmed in both cases and shown to be due to a defect in
DHPR, the enzyme that converts quinonoid dihydrobiopterin to B~, the active form of
the coenzyme.
On admission pterin analysis of urine samples from both patients showed increased
biopterin levels and the percentage of biopterin (%B) with respect to the sum of biopterin
and neopterin was higher or equal to 80% (Table 1).
Table 1. Urinary pterins in the studied population and excretion of pterins and
neurotransmitter metabolites before and during therapy with L-Dopa/Carbidopa, 5-
hydroxytryptophan, and folinic acid in the two patients with DHPR deficiency.
Only in patient H.S., with a %B of 89, an increased level of neopterin was observed
(2.71 rnmol/mol creatinine) when compared with the values of aged-matched controls,
probably due to the lack of feedback inhibition of GTP cyclohydrolase. The DHPR
deficiency was confirmed through measurement of the enzyme activity in both patients. The
DHPR activity was also determined in the parents of A.L.. The samples from the father and
the mother showed 51 and 55%, respectively, of the mean enzyme activity of controls. The
adequate control of pterins and neurotransmitter metabolites was performed systematically
after therapy had been initiated in patient A.L.. At the onset, the monoamine metabolites
HVA and 5-HlAA were not detectable in CSF. The urinary excretion of the same
metabolites was very low (Table 1). After 2 months of therapy, HVA and 5-HlAA in CSF
increased to the normal range and an increased excretion in urine was also observed (Table
1). Although, the initial condition of the patient had improved, the severe developmental
delay remains. The late detection of the patient could account for the lack of better
improvement.
Nevertheless, these two case reports demonstrate, once more, the need for a careful
evaluation of tetrahydrobiopterin metabolism in all infants with neonatal
hyperphenylalaninemia, whether mild or transient.
265
ACKNOWLEDGEMENTS
We are grateful to Dr. L. Vilarinho (Instituto de Genetica Medica, Porto) for sending
the samples. This work was supported in part by the Swiss National Science Foundation,
project No. 31.33897.92 and by the Helmut Horten Research Foundation (both to NB).
REFERENCES
266
A MICROTITRE PLATE METHOD FOR
MEASURING BIOPTERIN WITH
CRYOPRESERVED CRITHIDIA FASCICULATA
Robert J Leeming, SKate Hall, Helen Friday, Philip Hurley and Anne Green
SUMMARY
The assay of biopterin derivatives in dried blood spots is used by us in initial screening
for inherited defects in tetrahydrobiopterin synthesis. The previously described method (1)
required aseptic technique and microbiological facilities. The modification detailed here has
the advantages of antibiotic cover, which overcomes these needs and microtitre plate
technology allowing the incubation time to be halved with precision and accuracy retained.
Data reduction facilities may be applied.
MATERIALS
Vitamin Mix
Folic Acid
Folic acid 400ug/L (400mg/L folic acid in 25% ethanol diluted 1/1000 in distilled water)
Maintenance Medium
5% Cycloheximide
ASSAY PROTOCOL
268
50, I 00, 150, 200, 250, 300, 400, 500, 700 and! OOOul of the intermediate standard to I 0 ml
with phosphate buffer
Samples were prepared by punching 8.0mm discs from blood spots into 2.0 ml of
phosphate buffer (calculated 1/120 of blood), 0.1 ml of plasma was added to 2.9 ml of
phosphate buffer (1/30) and 0.1 ml of whole blood added to 3.9 ml buffer ( 1/40) in glass test
tubes. The tubes were placed in a steamer for 10 minutes and the contents centrifuged and
filtered through 0.4 micron syringe filters into glass test tubes. Further dilutions were made if
necessary.
50 ul of standards and samples were placed in quadruplicate in flat bottomed wells in
microtitre plates followed by 200ul of culture medium. One well of each quadruplicate set
was used as a blank by adding 10 ul of 5% cycloheximide which inhibited growth without
altering the optical density significantly. A sterile lid was placed on each plate which was then
left in a humidity chamber at 290C for 48 hours. After mixing optical density was read at
595nm in a microtitre plate reader . Readings from samples were corrected for dilutions. A
typical standard curve is shown in figure 1.
400
300
0
0
0
X
200
0
0
100
0
0 100 200
Biopterin ng/litre
Figure 1 A Typical Standard Curve
SENSITIVITY
The lowest standard contained 0.2pg/50ul which was equivalent to 0.48ug/L in blood
spots or 0.12ug/L in plasma at the dilutions given above. Lower concentrations could be
measured by decreasing the dilutions of samples.
PRECISION
Multiple blood spots on Guthrie cards were spotted with blood from 6 normal adult
volunteers and from one phenylalanine hydroxylase deficient patient on a relaxed diet. 8mm
discs were punched out and divided between two assay runs.
The within batch coefficient of variation for normals was 8.8% and between batch
13.2% (range 1.4- 5.0 ug/L biopterin). The within batch coefficient of variation for the
phenylalanine hydroxylase deficient patient was 8.5% and between batch 12.7% (range 7.2-
10.6ug/l). The values were influenced by variability in the quality of the dried blood spots,
this was shown clearly when 7 preparations from whole blood and plasma samples were
divided into 57 aliquots and the measured biopterin concentrations gave a 4.8% coefficient of
variation.
269
COMPARISON OF MICROTITRE PLATE WITH TUBE METHOD
50 dried blood spot samples had biopterin measured by the tube method (1) and by
microtitre plate modification. Regression analysis gave a good correlation (R = 0.96) and
microtitre values were, on average, 15% higher than by the tube method. The blood spot
phenylalanine concentrations (available from requesting laboratories) showed only a modest
correlation (R =0.58) with biopterin, this was anticipated as red cell biopterin reflects chronic
hyperphenylalaninaemia, unlike plasma biopterin (R= 0.86) which reaches a peak 2.0 hours
after oral phenylalanine (3) and is therefore more closely related to the phenylalanine
concentration at the time of sampling. The blood spot biopterin concentrations grouped
according to phenylalanine concentrations are shown in figure 2 which includes specimens
from patients with tetrahydrobiopterin synthesis deficiency.
40
I
-
~
Q)
.....
~
30
•
• •
c •
-~
a.0 20 • •
I
I
iD I I
Q)
I • I
~
*".....0 I I
10
•
~
0
I
••
•
I •
X
0
2 3 4 5 6
Phenylalanine
1 = Normal Subjects, 2 = PKU<1 00, 3 = 100-200, 4 = 200-800, 5=800-1600, 6 = >1600 llmol/1
DISCUSSION
The microtitre plate method for measuring biopterin with Crithidia fasciculata is
economical in time and materials. As medium, culture and standard are accessible from cold
storage, the response time is minimal and results can be available in 48 hours.
Reproducibility is satisfactory for screening dried blood spots as there is such a clear
differentiation of biopterin synthesis deficiency from phenylalanine hydroxylase deficiency.
This modification is now used in conjunction with measurement of dihydropteridine
reductase (4) as the first line screening procedure for inherited tetrahydrobiopterin deficiency.
REFERENCES
l. R.J.Leeming, P.A.Barford,J.A.Blair and I.Smith .
Arch. Dis. Childhood 59: 58-61 (1984)
270
ORAL ADMINISTRATION OF LIPOSOMALLY ENTRAPPED
TETRAHYDROBIOPTERIN
INTRODUCTION
Tetrahydrobiopterin (BH4) has been used for the therapy of BH4-deficient patients.
However, BH4 is poorly absorbed from the intestine. The plasma level of biopterin that was
reached after oral administration of BH4 to a BH4-deficient patient was reported to be 1-2%
of the levels reached after either intravenous or subcutaneous administration1 • This poor
absorption from the intestine needs a large amount of BH4 for the oral therapy, leading to
high costs.
Recently, liposomes have been widely used as a drug delivery system. A substance
such as factor VIII is absorbed into the circulation when administered orally in a liposomally
entrapped form 2• To facilitate absorption of BH4 from the intestine, we used a liposome for
the first time.
The plasma biopterin level reached a maximum one hour after administration of both
liposomally entrapped BH4 and free BH4. The plasma biopterin level at peak was significantly
higher in the liposomally entrapped BH4 than that in the free BH4. Moreover, a plasma
biopterin level four hours after administration was also significantly higher in liposomally
entrapped BH4 than that in the free BH4 (Fig 1) .
300 -
240
210
180
150
120
90
60
30
0 I
0 2 3 4
Time (hr)
Figure 1. Comparison of changes in plasma biopterin levels after oral administration of liposomal BH4 and
free BH4. (e:liposomal BH4, D :free BH4)
REFERENCES
272
EXPERIMENTAL RESEARCH ON A FETAL TREATMENT FOR
TETRAHYDROBIOPTERIN DEFICIENCY
INTRODUCTION
Tetrahydrobiopterin (BH4) synthase deficiency has a high incidence of low birth
weight, 1 and some of them had a mild mental retardation in spite of their early treatmene.
In this study we performed an intravenous loading of 2,4-diamino-6-hydroxypyrimidine
(DAHP) with a small amount of BH4, and successfully made a model of fetal BH4 deficiency.
We investigated the possibility of the fetal therapy of BH4 deficiency in this model by
measurements of phenylalanine(Phe ), tyrosine(Tyr), BH4, dopamine and catecholamines.
RESULTS
Basal values of plasma BH4 were 56 nM in the mothers and 150 nM in their fetuses.
In DAHP group, plasma BH4 levels were 66 nM in the mothers and 11 nM in their fetuses.
While in DAHP+BH4 group, BH4levels were 1500nM in the mothers and 250 nM in their
fetuses. Basal values of plasma Phe and Tyr were 0.75 mg/dl and 0.87 mg/dl in the
mothers, and 1.31 mg/dl and 1.48 mg/dl in their fetuses, respectively. In DAHP group, Phe
and Tyr levels were 0.85 mg/dl and 0.54 mg/dl in the mothers, and 4.61 mg/dl and 1.75
mg/dl in their fetuses, respectively. While in DAHP+BH4 group Phe and Tyr levels were
0.77 mg/dl and 0.86 mg/dl in mothers, and 1.00 mg/dl and 1.66 mg/dl in their fetuses,
respectively. (Table 1.)
Basal values of BH4 in liver were 2.3 nmol/g tissue in the mothers and 1.0 nmol/g
tissue in their fetuses. In DAHP group, BH4 levels were 1.4 nmol/g tissue in the mothers
and 0.07 nmol/g tissue in their fetuses. While in DAHP+BH4 group, BH4 levels were 22.1
nmol/g tissue in the mothers and 0.7 nmol/g tissue in their fetuses. Basal values of liver Phe
and Tyr were 8.0 J.lg/g tissue and 10.5 J.lg/g tissue in the mothers, and 11.7 J.lg/g tissue and
18.0 J.lg/g tissue in their fetuses, respectively. In DAHP group, Phe and Tyr levels were
12.5 J.tg/g tissue and 11.5 J.tg/g tissue in the mothers, and 29.7 J.lg/g tissue and 16.6 J.lg/g
tissue in their fetuses, respectively. While in DAHP+BH4 group Phe and Tyr levels were
7.8 J.lg/g tissue and 14.5 J.lg/g tissue in mothers, and 12.8 J.lg/g tissue and 21.4 J.lg/g tissue in
their fetuses, respectively. (Table 2.)
Basal values of BH4 in adrenal glands were 610 nmol/g tissue in the mothers and
3000 nmol/g tissue in their fetuses. In DAHP group, BH4 levels were 590 nmol/g tissue in
the mothers and 860 nmol/g tissue in their fetuses. While in DAHP+BH4 group, BH4 levels
were 790 nmol/g tissue in the mothers and 1500 nmol/g tissue in their fetuses. Basal values
274
of dopamine, norepinephrine, and epinephrine were 0.4 !lg/g tissue, 3.5 llglg tissue and
53.2!lg/g tissue in the mothers, and 1.9!lg/g tissue, 17.9!lg/g tissue and 61.0 !lg/g tissue in
their fetuses, respectively. In DAHP group, dopamine, norepinephrine, and epinephrine
were 0.3 11g!g tissue, 2.4 !lg/g tissue and 19.5 !lg/g tissue in the mothers, and 0.4 !lg/g
tissue, 0.4!lg/g tissue and 16.6!lg/g tissue in their fetuses, respectively. While in DAHP+BH4
group dopamine, norepinephrine, and epinephrine were 0.4!lg/g tissue, 3.7 llglg tissue and
50.7 !lg/g tissue in the mothers, and 1.3!lg/g tissue, 7.2!lg/g tissue and 47.6!lg/g tissue in
their fetuses, respectively. (Table 3.)
Basal values of striatum BH4 in the brain were 510 pmol/g tissue in the mothers and
440 pmol/g tissue in their fetuses. In DAHP group, BH4 levels were 400 pmol/g tissue in
the mothers and 220 pmol/g tissue in their fetuses. While in DAHP+BH4 group, BH4 levels
were 470 pmol/g tissue in the mothers and 480 pmol/g tissue in their fetuses. Basal values
of striatum dopamine were 1.3 11g/g tissue in the mothers, and 0.8 !lg/g tissue in their
fetuses, respectively. In DAHP group, dopamine levels were 1.0 !lg/g tissue in the mothers
and 0.5!lg/g tissue in their fetuses. While in DAHP+BH4 group, dopamine levels were 1.2
!lg/g tissue and 0.9 !lg/g tissue in their fetuses. (Table 4.)
These results suggest that the R-BH4 administered to the mothers passed through
the placenta and increased the BH4levels in their fetuses.
DISCUSSION
For the experimental research on a fetal treatment of BH4 deficiency, we made a
model of fetal guinea-pigs with BH4 deficiency. We have reported previously a model of
fetal guinea-pigs with BH4 deficiency by an oral administration of DAHP to their mothers 4•5•
In this study we performed an intravenous loading of DAHP with a small amount of BH4
continuously by a syringe pump, and successfully made a model of fetal BH4 deficiency,
which keep mother's biopterin levels normal.
In the DAHP group, total biopterin levels in fetal plasma, liver, adrenal and striatum
decreased approximately to 7, 7, 29 and 49% of the control group, respectively. While
275
plasma and liver phenylalanine levels elevated to 3.5, 2.5 times, adrenal and striatum
dopamine levels decreased to 21, 57%, and adrenal norepinephrine and epinephrine levels
decreased to 2, 27% of the control group, respectively. In the DAHP+BH4 group, these
changes mentioned above were almost reduced to the control group levels.
In this study BH4 administered to the mothers passed through their placenta and
stimulated the aromatic amino acid hydroxylases in their fetuses' organs. These results
indicate that the R-BH4 administration to the mother should be effective to the fetal treatment
for BH4 deficiency.
REFERENCES
1. I. Smith, J.L. Dhondt, Birth weight in patients with defective biopterin metabolism, Lancet, i:818(1985).
2. Y. Hase, Y. Okano, Y. Sawada, et al., Early treatment of inborn errors of biopterin metabolism, Acta
Paediatri. Jpn., 30:390(1988).
3. Y. Tani, T. Ishihara, Simultaneous measurement of tetrahydrobiopterin (THBP) and biogenic amines by
liquid chromatography with electrochemical detection, Life Sci., 46:373(1990).
4. M. Fujioka, H. Shintaku, G. Isshiki, eta!., Fetal, in:"Chemistry and Biology of Pteridines," H-CH. Curti us,
eta!., ed., Walter de Gruyter, Berlin (1990).
5. T. Nakajima, H. Shintaku, Y. Sawada, et al., Fetal guinea-pig model of tetrahydrobiopterin deficiency,
Pteridines, 3:35(1992).
276
EXPERIMENTAL RESEARCH ON A NEW TREATMENT FOR MATERNAL
PHENYLKETONURIA(PKU)
1Dept. of Pediatrics, Osaka City University Medical School, Osaka 545, Japan
2Dept. of Pediatrics, Juso Citizens' Hospital, Osaka 532, Japan
30saka Municipal Rehabilitation Center for the Disabled, Osaka 547, Japan
INTRODUCTION
More girls with phenylketonuria (PKU) enter childbearing ages, and most such women
are mentally normal, having been born since newborn screening was initiated in the 1970s
and treated from early infancy with a low phenylalanine (Phe) diet. Women with PKU not
treated prior to conception can have a pregnancy that results in serious fetal damage 1•
Maternal PKU as a cause of mental retardation and birth defects is a new phenomenon.
There will be an increased need for specific therapies in maternal PKU. Low Phe diet is
essential for the treatment of maternal PKU. It should be started before pregnancy and it
is necessary to maintain their plasma Phe levels around 5 mg/dl throughout their
pregnancy2• However they are usually controlled around 10 mg/dl because of the difficulty
of the diet therapy. We made an animal model of maternal PKU by the intravenous
injection of Phe to pregnant guinea-pigs, and examined plasma, liver and brain Phe levels
in their fetuses after an intravenous administration of 6R-5,6,7,8-tetrahydrobiopterin (R-
BH4) to the mothers.
Guinea-pigs (Hertley strain) in the third trimester of pregnancy were anesthetized with
20mg/kg of 5% nembutal. A silicon catheter (inner diameter 0.5mm) was placed in the
carotid artery for a blood collection and another one was in the carotid vein for infusion
of Phe. The intravenous loading of Phe (80mg/kg/hour) were performed in one group (Phe
group) of the animals for 18 hours and in an another group (Phe+BH4 group) for 22 hours
continuously by the injection pump. The Phe+BH4 group were loaded with both Phe and
R-BH4 (2mg/kg/hour) simultaneously for the last 4 hours. The blood samples of the
mothers were obtained from arterial catheter and fetal blood was obtained by the umbilical
cord puncture or cardiopuncture. Plasma, liver and brain levels of BH4, Phe and Tyr were
measured by a high-performance liquid chromatography.
40 10000
Mother • Fetus
•
~ • Phe
..
30 1000 ~
.§. 0 Tyr .s
"'
o; o;
>
~ Q)
...J
~ .!:
20 100 Q;
"""c:::
"0 a0
"' iii
"
.<=
0.. "'
E
"'
E
iQ 10 10 £
c::
0
Control Phe Phe+BH4 Control Phe Phe+BH4
group group group group group group
Fig 1. Plasma concentrations of BH4, Phe and Tyr in mothers and fetuses after administration of Phe or
Phe+BH4•
400 20
•
., Mother Fetus
.,
~"' 300
• Phe "'
$
!!!
CJ Tyr
• Blopterln
·~
g
0
E
.,>
Q)
.s
...J
200 10 "'>
o;
~ .3
"0
c::: ...
"'
Q)
.<=
:X:
IXl
0.. Q;
>
Q; 100 ::;
>
::;
0 0
Control Phe Phe+BH4 Control Phe Phe+BH4
group group group group group group
Fig 2. Liver concentrations of BH4 , Phe and Tyr in mothers and fetuses after administration of Phe or
Phe+BH4•
278
Basal values of liver BH4 were 2.3 nmol/g tissue in the mothers and 0.8 nmol/g tissue
in their fetuses. In Phe group, BH4 levels were 6.0 nmol/g tissue in the mothers and 1.0
nmol/g tissue in their fetuses. While in Phe+BH4 group, BH4 levels were 19.5 nmol/g tissue
in the mothers and 1.3 nmol/g tissue in their fetuses. Basal values of liver Phe and Tyr
were 8.0 pg/g tissue 10.5 pg/g tissue in the mothers, and 17.9 pg/g tissue and 35.0 pg/g
tissue in their fetuses, respectively.ln Phe group, Phe and Tyr levels were 45.0 pg/g tissue
and 60.0 pg/g tissue in the mothers, and 150 pg/g tissue and 107 pg/g tissue in their
fetuses, respectively. While in Phe+BH4 group Phe and Tyr levels were 33.2 pg/g tissue
and 120 pg/g tissue in mothers, and 74.4 pg/g tissue and 337 pg/g tissue in their fetuses,
respectively.(Fig 2.)
Basal values of brain BH4 were 190 pmol/g tissue in the mothers and 205 pmol/g
tissue in their fetuses. In Phe group, BH4 levels were 223 pmol/g tissue in the mothers and
353 pmol/g tissue in their fetuses. While in Phe+BH4 group, BH4 levels were 410 pmol/g
tissue in the mothers and 411 pmol/g tissue in their fetuses. Basal values of brain Phe and
Tyr were 5.0 pg/g tissue and 7.0 pg/g tissue in the mothers, and 19 pg/g tissue and 37 pg/g
tissue in their fetuses, respectively. In Phe group, Phe and Tyr levels were 49 pg/g tissue
and 59 pg/g tissue in the mothers, and 120 pg/g tissue and 85 pg/g tissue in their fetuses,
respectively. While in Phe+BH4 group, Phe and Tyr levels were 35 pg/g tissue and 120 pg/g
tissue in mothers, and 63 pg/g tissue and 220 pg/g tissue in their fetuses, respectively.(Fig
3.)
3 0 0 r - - -- - - - - - . -- - - - - - - - 1000
Mother Fetus
• • •
Qj
.ii!". • • • Qj
Fig 3. Brain concentrations of BH4, Phe and Tyr in mothers and fetuses after administration of Phe or
Phe+BH4 •
This results suggests that the R-BH4 administered to the mothers passed through the
placenta and increased the BH4 levels in their fetuses. Phe levels were lower and Tyr levels
were higher in Phe+BH4 group than in Phe group of plasma, liver and brain . This results
suggests that the BH4 passed through the placenta stimulated Phenylalanine hydroxylase
activity in their fetal liver so that Phe decreased and Tyr increased in the fetal plasma, liver
and brain.
279
DISCUSSION
Low Phe diet is essential for the treatment of maternal PKU. It should be started
before pregnancy and it is necessary to maintain their plasma Phe levels around 5 mg/dl
throughout their pregnancy. However they are usually controlled around 10 mg/dl because
of the difficulty of the diet therapy. We made an animal model of maternal PKU by the
intravenous injection of Phe to pregnant guinea-pigs, and examined plasma Phe levels in
their fetuses after an intravenous administration of BH4 to the mothers. In the pregnant
guinea-pigs with hyperphenylalaninemia their fetuses had very high levels of plasma Phe,
but after an administration of BH4 to the mothers with hyperphenylalaninemia their fetuses
had much lower plasma Phe levels than without a BH4 administration. These results
suggests that BH4 administered to the mothers passed through their placenta and stimulated
the phenylalanine hydroxylase in their fetuses' live~. It had been reported that human liver
phenylalanine hydroxylase activity in vitro are the same in fetuses after 8 gestational weeks
as in adults4• Therefore we think that the BH4 administration is effective for the therapy for
maternal PKU even in human if it combines with a mild low Phe diet.
REFERENCES
1. E.Drogari, !.Smith, M.Beaseley, and J.K.Lloyd, Timing of strict diet in relation to fetal damage in
maternal phenylketonuria, Lancet ii: 927-930 (1987)
2. W.B.Hanley, J.T.R. Clarke, and W. Schoonheyt, Maternal phenylketonuria(PKU)-a review. Clin.
Biochem. 20: 149-156 (1987)
3. P.A. Friedman, and S. Kaufman, A study of the development of phenylalanine hydroxylase in
fetuses of several mammalian species. Arch. Biochem. 146: 321-326 (1971)
4. N.C.R. Riiihil, Phenylalanine hydroxylase in human liver during development. Pediat. Res. 7: 1-4
(1973)
280
NITRIC OXIDE SYNTHASE: FUNCTION AND MECHANISM
Michael A. Marietta
INTRODUCTION
The family of NOS isoforms thus far characterized generally fall into two categories:
(i) a constitutive form regulated by Ca2+ and calmodulin, and ~ii) a cytokine-inducible form
that is not known to be regulated post-transcriptionally 1 . All of the NOSs require
NADPH and 02 as co-substrates in the reaction yielding citrulline as the amino acid
product of the reaction along with •NO. Cytosolic and membrane-bound NOSs have been
isolated. Constitutive NOSs isolated from rat 12•13 and porcine cerebellum14 are cytosolic
=
proteins (Mr 150 - 160 kDa). The inducible NOS purified from LPSIIFN-y treated
murine macrophages is also a cytosolic protein that has a Mr = 130 kDa and is a dimer
under native conditions 15 ·16 . However, a constitutive endothelial NOS isoform purified
from bovine aortic endothelial cells is membrane bound with a Mr = 135 kDa17 . A number
of additional NOSs have been described, however, this short review will focus only on
those best characterized. The mechanistic results described have, for the most part, been
obtained from studies with the inducible macrophage NOS.
The amino acid sequences derived from the isolated cDNAs for the constitutive
NOSs from rat cerebellum, and bovine aortic endothelial cells have now been re~orted 18 -20
as well as the corresponding data for the murine macrophage inducible NOS 1-23 . The
derived sequence from rat brain showed significant homology to NADPH cytochrome P-
450 reductase 18 . The sequences associated with NADPH, FAD, and FMN were all highly
conserved. The cloni¥§ and functional expression of a human endothelial NOS has also
recently been reported . It shows 52% amino acid identity when compared to the rat brain
NOS and a predicted molecular weight of 144 kDa The sequence of the particulate bovine
aortic endothelial cell NOS contains a myristoylation consensus sequence at the N-
terminus which is absent in the macrophage and rat cerebellar NOS isoforms 19 . All the
constitutive NOSs show, as expected, a consensus sequence for calmodulin recof3nition.
Surprisingly, the macrophage eDNA also has a calmodulin recognition sequence21 - .
The NOSs are complicated proteins. The constitutive forms show an absolute
requirement for Ca2+ and calmodulin. Although a requirement was not observed, the
inducible macrophage isoform has been shown to have a tightly bound calmodulin that is
apparently activated by very low levels of Ca2+25 , suggesting a novel type of regulation.
All NOSs require NADPH for activity 5. As predicted by the eDNA sequence, the
macrophage NOS has been shown to contain 1 equivalent each of FAD and FMN per
subunit15 . Subsequent reports have also verified that the other NOSs contain these same
flavins, however, the reported stoichiometries differ from that of the macrophage26-28 . The
eDNA sequences predict that all NOSs should contain 1 equivalent each ofFAD and FMN.
Differences from this stoichiometry probably reflect loss of flavin during the purification.
The macrophage NOS has been shown to contain a cytochrome P-450 type iron-
protopo~hyrin IX (Fe-PPIX) prosthetic group that functions in the turnover of L-
arginine . CO inhibition of the reaction supports a catalytic role for this heme29 . Similar
results were subsequently reported for the cerebellar NOS isoform 30•31 . Participation of
the cofactor (6R)-tetrahydro-L-biopterin (H4B) was reported, first in the macrophage32•33 ,
and subsequently in the constitutive NOS isoform from porcine brain26. Investigations
from a number of laboratories have continued to support a role for the reduced pterin in the
reaction, however a clear function has yet to emerge from the studies carried out thus far.
282
implicates the heme moiety in overall conversion. A scheme consistent with all the results
reported to date involves a P-450-type hydroxylation of L-arginine to yield the
intermediate NHA followed by oxidation of NHA by the ferrous-oxy heme complex. This
NHA radical is then nucleophilically attacked at the guanido carbon by the ferric peroxy
anion. Subsequent decomposition of this complex leads to •NO and citrulline5.
The first report of the involvement of I4B preceded the finding of Fe-herne cofactor
and hence it was reasonable to propose that this pterin was involved in the hydroxylation
chemist~ that was known to take place. The results described above plus additional
studies3 •37 suggest a nontraditional role for this reduced pterin. Reported elsewhere in
this volume (Hevel and Marietta) are studies that show that NOS isolated in a pterin-
deficient state is relatively uncoupled with respect to NADPH utilization and product
formed. The enzyme can be made more coupled by the addition of exogenous I4B to a
pterin-deficient preparation. The is due specifically to the reduced pterin as other reducing
agents such as DTT and ascorbate acid do not effectively substitute. This effect of l4B is
observed at very low concentrations. The mechanism of this coupling effect is currently
under study.
ACKNOWLEDGMENTS
The author is grateful to Dr. Joanie Hevel, Robert Pufahl, and Kimberly White for the
studies summarized in this report. In addition, generous support from the Nlli (CA50414),
and the Burroughs Wellcome Fund is gratefully acknowledged.
REFERENCES
283
21. C.R. Lyons, G.J. Orloff and J.M. Cunningham, J. Biol. Chem. 267:6370 (1992).
22. C.J. Lowenstein, C.S. Glatt, D.S. Bredt and S.H. Snyder, Proc. Natl. Acad. Sci. USA. 89:6711 (1992).
23. Q.-W. Xie, H.J. Cho, J. Calaycay, R.A. Mumford, K.M. Swiderek, T.D. Lee, A. Ding, T. Troso and C.
Nathan, Science. 256:225 (1992).
24. S.P. Janssens, A. Shimouchi, T. Quertennous, D.B. Bloch and K.D. Bloch, J. Biol. Chem. 267:14519
(1992).
25. H.J. Cho, Q.-W. Xie, J. Calaycay, R.A. Mumford, K.M. Swiderek, T.D. Lee and C. Nathan, J. Exp. Med.
176:599 (1992).
26. B. Mayer, M. John, B. Heinzel, E.R. Werner, H. Wachter, G. Schultz and E. Bohme, FEBS Lett. 288:187
(1991).
27. H.H.H.W. Schmidt, R.M. Smith, M. Nakane and F. Murad, Biochemistry. 31:3243 (1992).
28. D.S. Bredt, C.D. Ferris and S.H. Snyder, J. Biol. Chem. 267:10976 (1992).
29. K.A. White and M.A. Marietta, Biochem. 31:6627 (1992).
30. D.J. Stuehr and M. Ikeda-Saito, J. Biol. Chem. 267:20547 (1992).
31. K. McMillan, D.S. Bredt, D.J. Hirsch, S.H. Snyder, J.E. Clark and B.S.S. Masters, Proc. Natl. Acad. Sci.
USA. 89:11141 (1992).
32. M.A. Tayeh and M.A. Marietta, J. Biol. Chem. 264:19654 (1989).
33. N.S. Kwon, C.F. Nathan and D.J. Stuehr, J. Biol. Chem. 264:20496 (1989).
34. D.J. Stuehr, N.S. Kwon, C.F. Nathan, O.W. Griffith, P.L. Feldman and J. Wiseman, J. Biol. Chem.
266:6259 (1991).
35. R.A. Pufahl, P.G. Nanjappan, R.W. Woodard and M.A. Marietta, Biochemistry. 31:1992 (1992).
36. J.M. Hevel and M.A. Marietta, Biochem. 31:7160 (1992).
37. J. Giovanelli, K.L. Campos and S. Kaufman, Proc. Natl. Acad. Sci. USA. 88:7091 (1991).
284
MACROPHAGE NITRIC OXIDE SYNTHASE: TETRAHYDROBIOPTERIN
DECREASES THE NADPH STOICHIOMETRY
lCollege of Pharmacy
2Department of Biological Chemistry, School of Medicine
University of Michigan
Ann Arbor, MI USA 48109-1065
INTRODUCTION
Purification of NOS
Cell culture procedures, induction of murine macrophage NOS activity and the
preparation of lOO,OOOg supernatant were carried out as described previously 15 .
Purification of NOS was carried out as described previously12 using 2'5'-ADP Sepharose
4B and DEAE Bio-Gel A columns and a concentration step in an Amicon uXtrafiltration
system: A) inclusion of 5 j..tM I4B in only the purification buffers for the affinity column
resulted in pterin-deficient NOS. Previous studies12 have demonstrated that NOS purified
in this manner contains sub-stoichiometric quantites of pterin (approximately 0.2-0.5 mols
pterin : subunit), and demonstrates activity that is dependent upon the addition of H4B for
maximum velocity. B) On the other hand, inclusion of 5j..tM I4B in all buffers during the
purification and the concentration step resulted in NOS that contained approximately
1 mole pterin per subunit (as per Bevel & Marietta 12).
End-point analysis was employed to determine the NADPH stoichiometry with NOS
that had been purified in the presence and absence of pterin using varying concentrations of
limiting NADPH (typically 0-20 j..tM) and allowing the reaction to proceed until all the
NADPH was consumed. Product formation was followed using the [14C]arginine assay as
previously described 12. Experiments were done at 37° C and were set up under conditions
in which the NADPH was consumed within 5-7 minutes to avoid complications that could
arise due to NOS instability. Control experiments demonstrated that the rate of citrulline
formation was linear over this time period. Plots of citrulline formed vs. NADPH
concentration were made where the inverse of the slope of the line equaled the NADPH
stoichiometry (moles NADPH required to form one mole citrulline). The NADPH
stoichiometry was also determined under initial rate conditions by following NADPH
consumption at 339 nm on a Cary 3E UV-VIS spectrophotometer equipped with a Neslab
RTE-100 temperature controller set at 37° C. After approximately 4-5 minutes the
reactions were terminated with TCA and placed on ice. The reaction mixture was
neutralized and chromatographed later to quantitate citrulline formation 12.
Peroxide formation was measured using the iron I KSCN assay as described
previously 16. Briefly, 25 j..tL of 6N TCA was added to 475 j..tL of sample, followed by
75 j..tL of 130 mM ferrous ammonium sulfate and 75 j..tL of 2.1 M KSCN. The samples
were allowed to stand for at least 5 minutes before reading the absorbance at 474 nm.
RESULTS
NADPH Stoichiometry
286
in the H4B solution (DTT), both ascorbate and DTT were examined for their ability to
mimic the effect of H4B on the stoichiometry. At concentrations equivalent to that in the
H4B solution, ascorbate did not effect the NADPH stoichiometry (data not shown). When
the same experiment was done using DTI as the non-specific reducing agent, the results
varied. In some instances DTT had no effect on the stoichiometry (data not shown). In
other experiments the stoichiometry was decreased by DTI; e.g., from 2.22 to 2.14. In this
particular example, the NADPH stoichiometry was decreased even further (1.95) in the
presence of 50 11M H4B. Subsequent studies demonstrated that as little as 1 j..tM H4B was
able to substantially decrease the NADPH stoichiometry (from 2.48 to 2.11).
Pterin-Saturated NOS. It is known from previous studies that NOS purified in the
absence of H4B contains a sub-stoichiometric concentration of bound pterin, the amount of
which can be correlated to enzyme activity 12 . The amount of bound pterin can be
increased by incubating the NOS with a large excess of H4B, followed by gel filtration.
However, a stoichiometry of 1 mol pterin : 1 mol subunit can not be reached by this
reconstitution method. Therefore, although the NADPH stoichiometry had been
determined in the presence of H4B with pterin-deficient NOS, it was necessary to also
determine the stoichiometry with NOS that was fully active; that is, enzyme containing a
1 : 1 pterin: subunit stoichiometry. Pterin-saturated NOS can be prepared as described in
the Methods section. Under these conditions the NADPH stoichiometry was 2.00 ± 0.07
(n = 9). This value was not affected by changing the buffer concentration, by increasing
the concentration of L-arginine from 100 JlM to 200 JlM, or by varying the concentration of
NOS used in the assay (data not shown). In addition, NOS that had been applied to a gel
filtration column to remove DTT and unbound H4B demonstrated NADPH stoichiometry
values of 1.91, 1.97, and 2.09. Finally, as an independent measure of product formation,
NOz- I N03- levels were measured. In all cases the NADPH stoichiometry was 2.
The NADPH stoichiometry of the NOS reaction was also examined under initial rate
conditions. NADPH consumption was followed at 339 nm using NOS that had been
purified in the presence of H4B. After the reaction was terminated, the amount of NADPH
oxidized was calculated and the amount of [14C]citrulline formed was measured as
described in the Methods section. The rate of substrate-independent NADPH oxidation was
not subtracted from tl).e arginine-dependent rate. In the presence of L-arginine, the NADPH
stoichiometry was 1.91 ± 0.05 (n = 5).
Peroxide Formation
Initial rate experiments showed that in the absence of substrate, NOS oxidizes
NADPH at approximately 25% the rate of NADPH oxidation when L-arginine is present
(data not shown). Presumably the reducing equivalents are being used to reduce molecular
oxygen to produce HzOz (or Oz-, that will dismutate to HzOz) in the absence of substrate.
In the presence of substrate and fully active enzyme, we have assumed that all of the
NADPH consumption is coupled to citrulline formation. However, it is possible that some
uncoupled NADPH oxidation occurs during arginine turnover. In addition, uncoupled
NADPH oxidation may explain the need for more NADPH in the absence of H4B with
pterin-deficient NOS. The amount of peroxide formed during the oxidation of L-arginine
to •NO and citrulline was measured in assays employing end-point analysis. SOD was
included in these and subsequent assays to help prevent the reaction of Oz- with •N017 •
Formation of peroxide under these conditions was dependent upon the concentration of
NADPH (data not shown). When pterin-deficient NOS (demonstrated approximately 50-
60% maximum activity in the absence of exogenous H4B) was used in these assays, the
observed NADPH stoichiometry of 2.09 ± 0.02 (n=3) dropped to 1.62 ± 0.10 (n=3) when
corrected for uncoupled NADPH oxidation. When pterin-saturated NOS was used, the
observed stoichiometry of 1.93 ± 0.04 (n=3) also decreased to 1.63 ± 0.04 when uncoupled
NADPH oxidation was taken into account.
287
DISCUSSION
ENDNOTES
REFERENCES
288
ROLE OF TETRAHYDROBIOPTERIN IN CYTOKINE-STIMULATED
METABOLISM OF TRYPTOPHAN AND HYDROXYLATION OF ARGININE
INTRODUCTION
,L-KYN
-
IDO _,-
L-TRP --~-KYN --> intermediates --> quinolinic acid
GTPCH
- -?-
--
GTP --> NH2TP --> intermediates --> BH4
- -
·······~NEO
Figure 1. Possible link between tryptophan metabolism and pterin synthesis. Cytokines
stimulate the rate-limiting enzymes in each pathway, 100 and GTPCH, and BH4 can
function as cofactor in the 100 reaction. The solid lines refer to extracellular transport of
the products which are determined as measures of activities of the respective pathways.
It has been reported that macrophages are the primary source of the increased
neopterin levels found in serum of patients in which the immune system is
activated.8 In addition, Heyes et al have recently shown that cytokine-stimulated
human macrophages can metabolize L-tryptophan to quinolinic acid.9 As shown in
Fig. 2A, we found that interferon-gamma (IFN-y) induced a dose-dependent
stimulation of pterin synthesis and L-tryptophan metabolism, as measured by
neopterin and KYN production, respectively. However, when pterin synthesis was
inhibited by the addition of 2,4-diamino-6-hydroxypyrimidine (DAHP), a
competitive inhibitor of GTP cyclohydrolase (GTPCH), there was no significant
inhibition of KYN production (Fig. 2B). Since activated human macrophages
produce little (or no) BH4,8 it was not entirely surprising that inhibition of GTPCH
had no effect on KYN production. Furthermore, increasing intracellular BH4levels
by treatment with sepiapterin (SP), which is converted to BH4 by the salvage
pathway, also has no detectable effect on the rate of L-tryptophan metabolism.
These results strongly suggest that, at least in human macrophages, the metabolism
of L-tryptophan is independent of either pterin synthesis or intracellular neopterin
and biopterin levels.
290
KYN was also unaffected by inhibition of pterin synthesis with DAHP.l 0 In
addition, the rate of production of KYN by primary human skin fibroblasts after
stimulation with IFN-y and TNF-a was the same in fibroblasts from Blf4-deficient
children as from normals. tO
A. 48 HOURS B. 24HOURS
8360
10 D Neo
B1o
KYN
IFN-y (Units/ml)
291
that synthesis of BH4 by macrophages was absolutely essential for cytokine-
stimulated production of nitric oxide. In fact, as shown in Fig. 3, inhibition of
pterin synthesis by more than 95% by treatment of macrophages with DAHP only
has a small effect on nitric oxide production. This is likely due to the constitutive
synthesis of BH4 by these cells and the high affinity of nitric oxide synthase for BH4
since pretreatment of the cells with a combination of pterin synthesis inhibitors
(DAHP + N-acetylserotonin), reduced BH4 to nearly undetectable levels and
significantly inhibited nitric oxide synthesis. Furthermore, this effect was shown to
be specifically due to the loss of BH4, since repletion of BH4 levels by addition of
BH2 essentially normalized the nitric oxide production. Therefore, cytokine-
induced production of nitric oxide also appears to be absolutely dependent upon
BH4 synthesis. A more detailed study of BH4 and nitric oxide production by
murine macrophages has recently been published.13
A B 275+2.5
100
ill
';:J
...J
<
>
(f)
75
ll..
...J
........
;:-
~
......
50
>I..
0
zUlE-< 25
u~
Ul
ll..
0
DAHP DAHP+NAS DAHP+NAS+BH2
292
induced cytotoxicity in primary dissociated cortical cell cultures was mediated
through nitric oxide produced by the action of nitric oxide synthase on L-
arginine.14 Constitutive neuronal nitric oxide synthase is the likely source,
although recent studies have demonstrated that reactive nitrogen intermediates
produced from L-arginine by cytokine-activated microglia can mediate neuronal
cell injury and death.15 In addition, quinolinic acid is a potent NMDA receptor
agonist.16 Taken together, these facts and our data have led us to propose the
model below (Fig. 4) for the interaction of three metabolic pathways which are
activated in parallel by cytokines, pterin synthesis, L-tryptophan degradation, and
nitric oxide synthesis. This interaction could be responsible for some of the
pathological consequences of inflammatory neurological diseases. In this model,
we have shown a number of pathways for which there is some evidence, although
it is unlikely that they all occur within the same cell. Space limitations preclude a
detailed description (see references). Finally, this model highlights the different
potential pharmacological targets, including BH4 biosynthesis, which could be the
focus for the development of a multi-faceted approach for the treatment of some
devastating neurological diseases.
CYTOKINES
L-TRP
L·AAG f/00
~Nos..____ ....... L-~N ~ KYN
+ NO
interme.ates
QUIN
ARG .......
G~P
eve se
/
,
NO--
\
./
-
,-
--
1neurodegenerallon
1
NEURON
cGMP
293
ACKNOWLEDGMENTS
Dr. Naoki Sakai was supported by the NIH Intramural AIDS Targeted Antiviral
Program.
REFERENCES
294
TETRAHYDROBIOPTERIN SYN1HESIS IS INDUCED BY LPS IN VASCULAR
SMOOm MUSCLE AND IS RATE-LIMITING FOR NITRIC OXIDE
PRODUCTION
*Department of Pharmacology
Cornell University Medical College
New York, NY 10021, USA
tThe William Harvey Research lnstitiute
St. Bartholomew's Medical College
London EC1M 6BQ, UK
INTRODUCTION
cGMP/Gr
®
/ ' Dihydroneopterin
'f
/ triphosphate
// I 6-pyruvoyl tetrahydropterin
'
NO• +citrulline ARG ~~~
~ f Sepiapterin reductase
Q-BH2 BH4
~ 'Dihydrofolate reductase
Dihydropteridine BH2
reductase '
Sepiapterin
Figure 1. Enzymatic pathways for the synthesis of tetrahydrobiopterin (BH4) in eukaryotic cells and the
proposed relationship to nitric oxide synthase. GTP is indicated to play a dual role in the biology of NO;
it is both precursor to BH4 (a required cofactor of NOS) and precursor to cGMP (the mediator of vascular
actions of NO). The dashed arrow indicates that L-arginine(ARG)-derived NO activates soluble guanylyl
cyclase, thereby triggering the conversion of GTP to cGMP. [Reprinted with permission from ref. 16]
296
INDUCI'ION BY LPS OF BH4 SYNTHESIS AND GTPCHl mRNA IN VSM
As shown in Fig. 2, BH4 is undetectable in the cytosol of untreated rat aortic VSM
in culture. However, BH4 appears after treatment with LPS. While IFN alone does not
induce BH4 synthesis, it markedly potentiates the action of LPS. This increase in
intracellular BH4 is abolished by the GTPCHl inhibitor DAHP, indicating that BH4
elevation arises from de novo synthesis via GTPCHI. Confirmation that GTPCHI is
induced in VSM is provided by our finding that GTPCHI mRNA is markedly enhanced
by LPSIIFN (Fig. 3). Reverse transcription-PeR was used to amplify a predicted 372 bp
nucleotide sequence corresponding to nucleotides 295-666 of the constitutive GTPCHI
from rat liver22. To confirm that the PCR fragment was indeed GTPCHI, it was
subcloned and sequenced. The nucleotide sequence was found to be 100% identical to
rat liver GTPCH 122, suggesting that constitutive and inducible GTPCHI are the same
protein. Although GTPCHI mRNA was clearly induced by LPSIIFN, low levels of
mRNA were also expressed constitutively, in control cells. The constitutive expression
of mRNA in the absence of detectable protein activity, suggests that additional factors
could be involved in regulation of GTPCHl protein translation and/or activity.
Interestingly, preliminary results suggest that DAHP may attenuate GTPCHl mRNA
induction by LPSIIFN. Further experiments will be required to confirm this possibiity.
In any event, our findings demonstrate that LPSIIFN, which we have shown to be a potent
inducer of NOS in VSM16, simultaneously induces GTPCHI mRNA and protein.
Figure 2. Int1uence of inununostimulants on total biopterin content (oxidized plus reduced forms) of rat
aortic smooth muscle cells. Biopterin was assayed by HPLC after acidic oxidation6 in cytosol from cells
that were either untreated (basal), or treated for 12 h with LPS (30 !lg/m), IFN (50 ng/m1), the combination
of LPS and IFN, or the combination of LPS, IFN and DAHP (3 mM). Assays Bars indicate mean values
± SE of 3-4 replicate treatments, expressed as a function of protein concentration. "n.d." denotes no
detectable biopterin [reprinted with permission from ref. 16)
Figure 3. LPS induces GTPCHl mRNA in rat aortic smooth muscle cells. Total RNA was prepared by
guinidinium isothiocyanate extraction from intreated cells (lane I) or after a 4-hour treatment with a
combination ofLPS (30 !lg/ml) and IFN (50 ng/ml) alone (lane 2), or with DAHP (3 mM; Jane 3)). RNA
(l!lg) was amplified by RT -PCR using primers for GTPCHl (left panel) or the house-keeping gene,
glyceraldehyde-3-phosphate dehydrogenase (right panel). Both primer sets gave the predicted amplification
products.
297
in Fig. 4, DAHP caused a concentration-dependent and complete inhibition of the
accumulation of nitrite in cell culture medium. This effect of DAHP was not associated
with a cytostatic effect ofDAHP; indeed, DAHP attenuated the inhibition of mitochondrial
respiration observed with LPS alone16 . Prevention of respiratory depression by DAHP is
consistent with the knowledge that large quantities of NO inhibit respiration by binding
to iron-sulfur centers in mitochondrial complexes I and II 13 . DAHP inhibits LPSIIFN-
induced NO synthesis by specific inhibition of GTPCHl and subsequent reduction of
intracellular BH4, since this effect is prevented by administration of the BH4 precursor
sepiapterin (Fig. 4). Importantly, the ability of sepiapterin to prevent NO synthesis
inhibition does not occur in the presence of 10 !JM methotrexate 16, a selective inhibitor
of DHFR which catalyzes the final step of sepiapterin conversion to BH4.
To further confirm that DAHP inhibits NO synthesis by selective inhibition of
GTPCHl, we investigated whether inhibition of NO synthesis could be reduced by
elevated intracellular GTP. Intracellular GTP was increased in VSM by administering
guanosine; guanosine is converted within the cells to GTP by the purine salvage
pathway 23 . As predicted, guanosine caused a rightward-shift in the concentration response
relationship for inhibition of NO synthesis by DAHP. In additional studies we found that
LPS-induced NOS activity could also be inhibited by N-acetylserotonin 16, an inhibitor of
the enzyme sepiapterin reductase which catalyzes the final 2 steps in de novo BH4
synthesis 24 . Taken together, our findings establish that induction of GTPCHl and de novo
synthesis of BH4 are necessary events for LPS-induced NO synthesis in VSM.
DAHP INHIBITS THE INDUCTION OF NO SYNTHESIS BY LPS/IFN INHIBITION OF LPS/IFN-INDUCED NO SYNTHESIS BY DAHP
IN RAT AORTIC SMOOTH MUSCLE CELLS BY A MECHANISM IN RAT AORTIC SMOOTH MUSCLE CELLS
WHICH IS PREVENTED BY SEPIAPTERIN IS COMPETITIVELY REDUCED BY GUANOSINE ADMINISTRATION
100
wc-
t:e
~§ 80
Zo
o-
tj ~ 60
::::>~
Oz
,::0 40
IF
zu
;;;.g
"-::::>
a. a::
20
...JO..
0
.01 .03 0.1 0.3 .01 .03 0.1 0.3 3
[DAHP] (mM) [DAHP] (mM)
298
EFFECf OF GTPCHl INHffiiDON ON LPS-INDUCED NO SYNTHESIS IN VIVO
Our studies of VSM in culture raise the possibility that BH4 synthesis inhibitors
could have utility in vivo for treatment of conditions arising from vascular NO
overproduction, e.g., septic- and cytokine-induced shock. To test this possibility we have
investigated whether BH4 synthesis inhibitors diminish LPS-induced NO synthesis and
NO-mediated vascular dysfunctions in the rat. LPS (15 mg/kg, i.p., 6 h pretreatment)
caused an 80% increase in total plasma biopterin (BH4 and more oxidized species); this
efffect was abolished by prior treatment of animals with DAHP and MTX (I g/kg, i.p. and
1 mg/kg, i.v., 1 h prior to LPS). Under these conditions, DAHP/MTX diminished by
>60%, the 20-fold elevation in arginine-derived plasma nitrate obtained when LPS was
administered alone. This finding suggests that NO synthesis in vivo can be attenuated by
GTPCHI inhibition.
One important pathophysiological manifestation of NO overproduction within the
blood vessel is a blunted responsivity to vasoconstrictors. Indeed, diminished sensitivity
to pressor agents may be the major impediment to therapy of septic patients. A primary
role of NO in this phenomenon is indicated by the finding that the LPS-induced
impairment of vasoconstrictor responses can be overcome by the selective NOS inhibitor
N"'-methyl-L-arginine 25 '26 . Therefore it is significant that DAHP/MTX pretreatment also
causes a near-complete prevention of the LPS-induced hyporesponsivity to the
vasonstrictory effect of phenylephrine in rat aorta, ex vivo (Gross et al., manuscript in
preparation).
Acknowledgements
The work was funded by NIH grants HL46403 (S.S.G.), HL34215 (R.L.) and a
grant from Strohtech.
REFERENCES
1. Nichol, C., Smith G. and Duch, D. (1985) Biosynthesis and metabolism of tetrahydropterin and
molybdopterin. Ann Rev Biochem 54: 729-764.
2. Ballahene, Z., Dhondt, J.-L. and Farriaux (1984) Guanosine triphosphate cyclohydrolase activity in
rat tissues. Biochem J. 217:59-65.
3. Shen, R.-S., Alam, A. and Zhang, Y.X. (1988) Inhibition of GTP cyclohydrolase I by pterins.
Biochem Biophys Acta 965: 9-15.
4. Gal., E.M., Nelson, J.M., and Sherman, A.D. (1978) Biopterin III. Purification and characterization
of enzymes involved in the cerebral synthesis of 7,8-dihydroneopterin. Neurochem. Res. 3: 69-88.
299
5 Kabasbi, T Hasegawa, H, Kaneko, E and Isbiyama, A (1991) Gastromtestmal serotorun depletiOn
due to tetrahydrobwptenn defiCiency J Pharmacal Exp Therap 256: 773-779
6 Fukushima T and Nixon, I C (1980) Analysis of reduced forms of bwptenn m bwlogiCa! tissues
and flmds Anal Bzochern 102: 176-188
7 Werner, E, Werner-Felmeyer, G , Fuchs D, Hausen, A, Ziebnegger, G, and Wachter, H (1989)
Parallel mductwn of tetrahydrobwptenn bwsynthesis and mdoleamme 2,3-dwxygenase activity m
human cells and cell hnes by mterferon-y Bzochern J 262 861-866
8 Ziegler I , Schott, K , Lubbert, M , Schwulera, U, and Bacher, A (1990) Control of
tetrahydrobwptenn synthesis m T lymphocytes by synergistic actwn of mterferon-y and
mterlukm-2 J Bzol Chern 265: 17026-17030
9 Werner, E R, Werner-Felmeyer, G, Fuchs, D, Hausen, A, Reibnegger, G, Yrm, J J, Pfleiderer, W,
and Wachter, H (1990) Tetrahydrobwptenn bwsynthetJc activitles m human macrophages,
fibroblasts, THP-1, and T 24 cellls J Bzol Chern 25: 3189-3192
10 Zeigler, I (1990) ProductiOn of ptendmes dunng hematopoiesis and T-lymphocyte prohferatwn
partial partiCipation m the control of cytokme signal transmissiOn Med Res Rev 10: 95-114
11 Kwon, N, C Nathan, and Stuehr, D (1989) Reduced bwptenn as a cofactor m the generatwn of
mtrogen oxides by munne macrophages J Bwl Chern 264 20496-20501
12 Tayeh, M A and M A Marietta (1989) Macrophage oxidatiOn of L-argmme to mtric oxide, mtnte
and mtrate Tetrahydrobwptenn IS reqmred as a cofactor J Bwl Chern 264 19654-19658
13 Nathan, C (1992) Nitric oxide as a secretory product ofmammahan cells FASEB J 6: 3051-
3064
14 Werner-Felmayer, G, Werner, E R, Fuch>, D, Hausen, A, Reibnegger, G and Wachter, H (1990)
Tetrahydrobwpterm-dependent formatwn of mtnte and mtrate m murme fibroblasts J Exp M ed
172 1599-1607
15 Gross, S , Stuehr, D , Aisaka, K , Jaffe, E A , Levi, R and Gnffith, 0 (1991) Cytokme-activated
endothehal cells express an Isoform of mtnc ox1de synthase wh1ch IS tetrahydrobwptenn-
dependent, calmodulm-mdependent, and resembles the macrophage Isoform m Its profile of
mhibition by W-substituted argmme analogs Bwchern Bwphys Res Comrnun 178 823--829
16 Gross, S S, and Lev1, R (1992) Tetrahydrobwptenn synthe>Is An absolute reqmrement for
cytokme-mduced mtnc ox1de generation by vascular smooth muscle J Bzol Chern , 267: 25722-
25729
17 Furchgott, R F and Zawadski, J V (1980) The obihgatory role of endothehal cells m the relaxatwn
of artenal smooth muscle by acetylcholme Nature 288:373-376
18 BusseR and Mulsch, A (1990) Inductwn ofmtnc oxide synthase by cytokmes m vascular ~mooth
muscle cells FEBS Lett 275: 87-90
19 Beasley, D, Schwartz, JH, and Brenner, B M (1991) Interlukm-1 mduces prolonged L-argmme
dependent cychc guanosme monophosphate and mtrite productwn m rat vascular smooth muscle
cells J Clm Invest 87 602-608
20 Schim, VB, Junquero, DC, Scott-Burden, T and Vanhoutte, PM (1991) Interleukm-1~ mduces
the productiOn of an L-argmme-denved relaxmg factor from cultured smooth muscle cells from rat
aorta Bwchern Bwphys Res Cornmun 176: 114-121
21 Parnllo, J E (1989) Textbook of CntJcal Care, 2"d edition (Shoemaker, W C , Ayers, S, Grenvik et
a!, eds) W B Saunders Pub!, Philadephia, p1006
22 Hatakeyama, K, Inoue, Y, Harada, T, and Kagamiyama, H (1991) Clonmg and sequencmg of
eDNA encodmg rat GTP cyclohydrolase I The firSt enzyme of the tetrahydrobwptenn bwsynthetJc
pathway J Bwl Chern 266 65-769
23 Hatakeyama, K , Harada, T and Kagam1yama, H (1992) IMP dehydrogenase Inhibitors reduce
mtracellular tetrahydrobwptenn levels through reductiOn of mtracellular GTP J Bwl Chern 267
20743-20739
24 Gal , EM , Nelson, J M, and Sherman, AD (1978) Bwptenn III Punficatwn and charactenzatwn
of enzymes mvolved m the cerebral synthesis of 7,8-dihydroneoptenn Neurochem Res 3: 69-88
25 Gross, S S , Madera, AM , Gr1ffith, 0 W , and Levi, R (1991) Endotoxm Impaus vasoconstnctwn
by mducmg m aortic smooth muscle cells a mtric oxide synthase Isoform d1stmct from that m
endothehal cells FASEB J 5: Al728
26 Jolou-Schaeffer, G, Gray, G A, Schott, C, Paratt, JR and Stoclet, J -C (1990) Loss of cellular
responsiveness mduced by endotoxm mvolves L-argmme pathway Am J Physwl 259 Hl038-
Hl043
300
6R-[3H]TETRAHYDROBIOPTERIN BINDING ACTIVITIES IN RAT
BRAIN
INTRODUCTION
6R-L-Erythro-5,6,7 ,8-Tetrahydrobiopterin (R-THBP) is a common cofactor for
phenylalanine, tyrosine, and tryptophan hydroxylases, the latter two of which are the rate-
limiting enzymes of catecholamines and serotonin biosyntheses, respectively. In an attempt
to answer the puzzle from the clinical evaluation that R-THBP and L-DOPA or 5-HTP
possess the additive effect on the treatment of atypical phenylketonuria, Parkinsonian
disease, and infantile autism, we recently found a novel role of R-THBP in the central
nervous system; R-THBP functions as a release-promotor of dopamine, serotonin, and
norepinephrine from the striatal and cortical nerve terminals 1 ,2. Amino acid
neurotransmitters in the extracellular space also increased by R-THBP treatment, but in this
case, the destruction of catecholaminergic components by 6-hydroxydopamine pretreatment
resulted in a complete blockade of amino acid release evoked by R-THBP2. Namely, the
effect of R-THBP on amino acid neurotransmitters is via monoaminergic stimulation. R-
THBP also evokes acetylcholine release possibly through serotonergic stimulation3. On the
contrary, when we reduce R-THBP content in the tissues including the brain by use of a
potent inhibitor of R-THBP biosynthesis, the tissue content of dopamine and its metabolites
very slightly decreased at around 10%, but such a treatment lowering R-THBP level resulted
in a severe decrease of dopamine release; the dopamine output from the striatum was reduced
to less than 50% of the control level. This result and other experimental data indicate that the
endogenous level of R-THBP can regulate dopamine release. The molecular mechanisms
underlying the R-THBP-induced neurotransmitter amine release have been studied in terms
of second messenger system and modification of autoreceptor system for presynaptic
dopamine terminals4. In the course of the study, the high-affinity binding protein specific
for [3H]R-THBP has been found in the crude membrane fraction of rat brain. However, the
binding activity was also found in the cytosol fraction. Here, we describe several lines of
evidence showing that the binding protein in the cytosol is almost entirely due to nitric oxide
synthase.
Materials.
[3H]6RS-L-Erythro-5,6,7,8-tetrahydrobiopterin was prepared by hydrating 7,8-
dihydrobiopterin with tritiated sodium borohydride. Then, [3H]6R-tetrahydrobiopterin (R-
THBP) was purified using HPLC (Whatman Partisil10 SCX, 4.6 x 250 mm, mobile phase:
30 mM ammonium acetate, pH 3.5/0.1 mM ascorbic acid/ 0.1 mM cysteine). Ascorbic acid
and cysteine were included for the protection of product from oxidation. The sample fraction
coincides with the retention time of authentic R-THBP, clearly distinguishable from the 6S-
form. The radiochemical purity is better than 98%. Purified [3H]R-THBP was stored in 0.1
N HCl containing 1 mM ascorbic acid and 3 mM cysteine at -20°C until use. Unlabeled
pteridines were generous gifts from Suntory Ltd.
Preparations.
Male Wistar rats weighing 200-250 g (Nihon SLC) were anesthetized with
diethylether and decapitated. Brain tissues were homogenized using a Potter-Elvehjem glass
homogenizer with a Teflon pestle in 10 volumes of 0.32 M sucrose containing 5 mM Tris-
HCl (pH 7.4), 1 mM DTT and 1 mM EDTA. After centrifugation at 1,000 x g for 12 min,
the supernatant was further centrifuged at 17,000 x g for 30 min. The pellet was suspended
in a volume of 50 mM Tris-HCl (pH 7.4) equal to the original homogenizing buffer, washed
by recentrifugation at 17,000 g for 10 min, and the suspension was referred to as the P2
fraction. The 17,000 x g-supernatant from was further centrifuged at 103,000 x g for 60
min, and the resulting supernatant was taken and referred to as the cytosol fraction.
Binding Assay.
[3H]R-THBP binding was measured as described by Yumoto et a1.5. The standard
reaction mixture contained 50 mM Tris/HCl (pH7.4), 100 mM NaCl, 10 mM MgCl2, 2 mM
ascorbic acid, and 6 mM cysteine in a total volume of 0.4 ml. Incubation was performed at
37°C for 10 min.
Nitric Oxide Synthase Activity.
Nitric oxide synthase (NOS) activity was measured by monitoring the conversion of
[3H]arginine to [3H]citrulline as described6.
Subcellular fractionation and regional distribution oUlHlR-THBP binding in the rat brain
In the rat cerebellum, [3H]R-THBP binding activity was measured after subcellular
fractionation. The binding activity was mostly located in the cytosol fraction (83% of total
activity in the homogenate), and less activity was detected in the P2 fraction (22%) and
washed P2 fraction (still 11% ). When NOS activity was compared using the same samples,
most (86%) of the activity existed in the cytosol fraction and 22% appeared in the P2
fraction.
Then, the regional distribution of [3H]R-THBP binding activity and NOS activity in
the cytosol fraction was studied. Both activities showed a similar pattern (Table 1); highest
in the cerebellum followed by midbrain and olfactory bulb, then both activities showed rather
diffuse pattern in the cerebral cortex, brain stem, hypothalamus/thalamus, striatum and
hippocampus. Such a pattern was similar to that reported for NOS and to that of [3H]R-
THBP binding activity observed in the P2 fraction of rat brain regions.
Kinetic rroperties ofR-THBP binding in cytosol fraction
By Scatchard plot analysis of [3H]R-THBP binding activity in the cytosol fraction of
rat cerebellum, Kd value was calculated to be 39 nM and Bmax value is 2645 fmoVmg
protein. The binding is highly specific for 6R-form; 6S-form has 3-orders of magnitude less
affinity. The specificity among the biopterin analogues was similar to that obtained in the P2
fraction of rat brain.
302
Table 1. Distribution of [3H]R-THBP binding activity and nitric oxide synthase
activity in various brain regions of rat
Mean SD Mean SD
hippocampus 162 43 97 6
Each value was obtained from 4 rat brains with every three determinations for [3H]R-
THBP binding activity and duplicate determinations for NOS activity. SD represents the
standard deviation of the mean of the values from 4 animals.
303
properties to those of NOS. These results taken together indicate that most of high affmity
R-THBP binding sites in the rat brain may be due to NOS and that a certain action ofR-
THBP may be evoked initially by NOS activation.
References
1. K. Koshimura, S. Miwa, K. Lee, M. Fujiwara, andY. Watanabe, J. Neurochem.,
54: 1391-1397' 1990.
2. N. Mataga, K. Imamura, andY. Watanabe, Brain Res., 551:64-71, 1991.
3. T. Ohue, K. Koshimura, Y. Akiyama, Y.Watanabe, and S. Miwa, Brain Res., 570:
173-179, 1992.
4. Yu. Watanabe, N. Mataga, T. Hayashi, T. Ishihara, T. Kanai, T. Noguchi, S. Miwa,
andY. Watanabe, Pteridines, 3:63-64, 1992.
5. N. Yumoto, Y. Watanabe, K. Watanabe, Yu. Watanabe, and 0. Hayaishi,
J. Neurochem., 46:125-132, 1986.
6. D.S. Bredt, and S.H. Snyder, Proc. Natl. Acad. Sci. USA, 87:682-685, 1990.
7. B. Mayer, M. John, B. Heinzel, E.R. Werner, H. Wachter, G. Schultz, and E. Bohme,
FEBS Lett., 288:187-191, 1991.
304
INDUCIBLE NITRIC OXIDE SYNTHASE ACTMTY IN HEPATOCYTES IS
DEPENDENT ON THE COINDUCTION OF TETRAHYDROBIOPTERIN
SYNTHESIS
University of Pittsburgh
Department of Surgery
Pittsburgh, PA 15261
The William Harvey Institute
London, UK
Nitric oxide (NO) is a short-lived radical derived from the oxidation of one
of the two chemically equivalent quanido nitrogens of L-arginine 1• Three isoforms
of the enzyme which produces NO, NO synthase (NOS), have been identified thus
far. Two NOS isoforms, endothelial and neuronal are expressed constitutively
(eNOS) and release relatively small amounts of NO immediately upon stimulation.
A third isoform has been termed inducible NOS (iNOS) because it is not present in
resting cells but is expressed if cells are exposed to inflammatory stimuli, such as
bacterial lipopolysaccharide (LPS) and/or cytokines. Upon purification all three
isoforms are known to be dependent on tetrahydrobiopterin (BH4) for maximal
activity2-5• This observation adds to the list of four enzymes previously known to be
dependent on BH4 • Although the precise role of BH4 in the five-electron oxidation
ofL-arginine to NO and citrulline remains uncertain, recent reports using intact cells
in culture indicate that both endothelial cNOS6 and smooth muscle celf isoforms are
dependent on BH4 availability.
Tissues which express eNOS continuously (e.g. brain, endothelium) also
possess the BH4 synthesizing pathway. In contrast, most cells which express iNOS
upon stimulation, such as murine macrophages, fibroblasts, and vascular smooth
muscle cells probably do not produce BH4, or at least adequate amounts of BH4 in
the resting state. Upon stimulation these cells can be induced to produce BH4• For
example, interferon-g (IFN-g) is known to stimulate BH4 synthesis in both
macrophages 8 and fibroblast9 while LPS-induced BH4 synthesis in smooth muscle cells
306
TABLE I. Supernatant N0-2 + N0-3 levels and cellular total biopterin levels in
hepatocytes 24 hours after exposure to the cytokine mix (CM: LPS,
TNF, IL-l, IFN-g).
No-2 + No-3 Biopterin ng/mg
nmoles/106 cells protein
Control 10 ± 1 0.45 ± .04
CM 328 ± 56 0.70 ± .07
CM + NMA ±2
16 0.6± .05
CM + DAHP (7mM) 248 ± 43 0.36 ± .07
CM + MTX 396 ± 84 0.61 ± .11
CM + DAHP + MTX 28 ± 9 Not detected
that biopterin levels can be reduced to undetectable levels if both de novo and
salvage pathways are blocked. Using a eDNA probe generated by RT polymerase
chain reaction (PCR) for GTP-cyclohydrolase I Northern blots were performed on
HC 8 hours after CM addition. A 2-3 fold increase in GTP-cyclohydrase I mRNA
was seen simultaneous to the known peak for iNOS expression. iNOS mRNA was
not detectable in control HC but was strongly induced by the 8 hour time point in
CM-treated HC. Taken together these data indicate that under CM stimulation BH4
synthesis is increased in HC. It is likely that this increase takes place to support
induced NO synthesis in HC. Whether constitutive levels of BH4 are adequate to
support lower levels of NO synthesis remain to be determined. In other experiments,
we have shown that the addition of BH4 to HC stimulated to express iNOS increases
total NO synthesis (not shown). It is possible that NO synthesis is limited by BH4
availability. How BH4 synthesis is regulated in cells expressing iNOS and how iNOS
expression influences other enzymes which utilize B~ is unknown.
TABLE II. mRNA levels for GTP-cyclohydrolase I and inducible nitric oxide
synthase (iNOS) in hepatocytes exposed to cytokine mix (CM).
Densitometry Units
GTP-cyclohydrolase I iNOS
307
REFERENCES
308
MODULATION OF NITRIC OXIDE SYNTHASE ACTIVITY IN INTACT CELLS
BY INTRACELLULAR TETRAHYDROBIOPTERIN LEVELS
INTRODUCTION
310
increased intracellular tetrahydrobiopterin levels rather than to increased NO synthase
protein21 •
CONCLUSIONS
cytokines
de novo j+ _
GTP-CH I - DAHP
+
/ I
neopterin
(in humans) 1 methotrexate
l -
tetrahydrobiopterin - DHFR - sepiapterin
~ salvage
inducible constitutive
NO synthase NO synthase
1 + 1 calcium
NO NO
1
nitrite + nitrate cGMP
long-term short-term
murine fibroblasts 10 HUVEC, ME-180 19 •21
REFERENCES
1. E. R. Werner, G. Werner-Felmayer, and H. Wachter, Tetrahydrobiopterin and Cytokines,
Proc.Soc.Exp.Biol.Med. 203, in press (1993).
2. E.R. Werner, G. Werner-Felmayer, G. Weiss, and H. Wachter, Stimulation of tetrahydro-biopterin
synthesis by cytokines in human and in murine cells, in: "Chemistry and Biology of Pteridines and
Folates", J.E. Ayling, M.G. Nair, and C.M. Baugh, eds., Plenum Press, New York, this volume (1993).
311
3. S. Kaufman, The metabolic role of tetrahydrobiopterin, in:"Chemistry and Biology of Pteridines",
B.A. Cooper and V.M. Whitehead, eds., Walter De Gruyter, Berlin, New York (1986).
4. C. Nathan, Nitric oxide as a secretory product of mammalian cells, FASEB J. 6: 3051(1992).
5. H.J. Cho, Q. Xie, J. Calaycay, R.A. Mumford, K.M. Swiderek, T.D. Lee, and C. Nathan, Calmodulin
is a subunit of nitric oxide synthase from macrophages, J. Exp. Med.l76:599(1992).
6. B. Mayer, M. John, B. Heinzel, E.R. Werner, H. Wachter, G. Schultz, and E. Bohme, Brain nitric
oxide synthase is a biopterin- and flavin-containing multi-functional oxido-reductase, FEBS Lett.
288:187(1991).
7. H.H. Schmidt, R.M. Smith, M. Nakane, and F. Murad, Ca2•/calmodulin-dependent NO synthase type
I: A bioptero-flavoprotein with Ca2•/calmodulin-independent diaphoraseandreductase activities,
Biochemistry 31:3243(1992).
8. P. Klatt, B. Heinzel, B. Mayer, E. Ambach, G. Werner-Felmayer, H. Wachter, and E.R. Werner,
Stimulation of human nitric oxide synthase by tetrahydrobiopterin and selective binding of the
cofactor, FEBS Lett. 305:160(1992).
9. J.M. Revel and M.A. Marietta, Macrophage nitric oxide synthase: relationship between enzyme-bound
tetrahydro-biopterin and synthase activity, Biochemistry 31:7160(1992).
10. G. Werner-Felmayer, E.R. Werner, D. Fuchs, A. Hausen, G. Reibnegger, and H. Wachter,
Tetrahydrobiopterin-dependent formation of nitrite and nitrate in murine fibroblasts, J. Exp. Med.
172: 1599(1990).
11. E.R. Werner, G. Werner-Felmayer, D. Fuchs, A. Hausen, G. Reibnegger, J.J. Yim, and H. Wachter,
Impact of tumour necrosis factor-alpha and interferon-gamma on tetrahydrobiopterin synthesis in
murine fibroblasts and macrophages, Biochem. J. 280:709(1991).
12. E.M. GM, J.M. Nelson, and A.D. Sherman, Biopterin Ill. Purification and characterization of enzymes
involved in the cerebral synthesis of 7,8-dihydrobiopterin, Neurochem. Res. 3:69(1978).
13. C.A. Nichol, G.K. Smith, and D.S. Duch, Biosynthesis and metabolism of tetrahydrobiopterin and
molybdopterin, Annu. Rev. Biochem. 54:729(1985).
14. S.S. Gross, B.A. Jaffe, R. Levi, and R.G. Kilbourn, Cytokine-activated endothelial cells express an
isotype of nitric oxide synthase which is tetrahydrobiopterin-dependent, calmodulin-independent and
inhibited by arginine analogs with a rank-order of potency characteristic of activated macrophages,
Biochem. Biophys. Res. Commun. 178:823(1991)
15. S.S. Gross and R. Levi, Tetrahydrobiopterin Synthesis, an absolute requirement for cytokine-induced
nitric oxide generation by vascular smooth muscle, J. Biol. Chem. 267:25722(1992).
16. S. Katoh, T. Sueoka, and S. Yamada. Direct inhibition of brain sepiapterin reductase by a
catecholamine and an indoleamine, Biochem. Biophys. Res. Commun. 105:75(1982).
17. N. Sakai, S. Kaufman, and S. Milstien, Tetrahydrobiopterin is required for cytokine-induced nitric
oxide production in a murine macrophage cell line (RAW 264), Mol. Pharmacal. 43:6(1993).
18. B. Mayer, K. Schmidt, P. Humbert, and E. Bohme, Biosynthesis of endothelium-derived relaxing
factor: a cytosolic enzyme in porcine aortic endothelial cells Ca2• -dependently converts L-arginine
into an activator of soluble guanylyl cyclase, Biochem. Biophys. Res. Commun. 164:678(1989).
19. G. Werner-Felmayer, E.R. Werner, D. Fuchs, A. Hausen, G. Reibnegger, K. Schmidt, G. Weiss, and
H. Wachter, Pteridine biosynthesis in human endothelial cells- impact on nitric oxide-mediated
formation of cyclic GMP, J. Biol. Chem. 268:1842(1993).
20. K. Schmidt, E.R. Werner, B.Mayer, H. Wachter, and W.R. Kukovetz, Tetrahydro-biopterin-dependent
formation of endothelium-derived relaxing factor (nitric oxide) in aortic endothelial cells, Biochem. J.
281:297(1992).
21. G. Werner-Felmayer, E.R. Werner, D. Fuchs, A. Hausen, B. Mayer, G. Reibnegger, G. Weiss, and H.
Wachter, Ca2•/calmodulin-dependent nitric oxide synthase activity in the human cervix carcinoma cell
line ME-180, Biochem. J. 289: 357(1993).
22. W. Strohmaier, H. Redl, G. Schlag, and D. Inthorn, D-erythro-neopterin plasma levels in intensive
care patients with and without septic complications, Crit. Care Med. 15:757(1987).
23. R.G. Kilbourn and O.W. Griffith, Over-production of nitric oxide in cytokine-mediated and septic
shock, J. Natl. Cancer lnst. 84:827(1992).
24. G. Werner-Felmayer, E.R. Werner, G. Weiss, and H. Wachter, Tetrahydrobiopterin biosynthesis
inhibition for diminishing nitric oxide production in cytokine-mediated septic shock, J. Natl. Cancer
lnst. 84:1671(1992).
25. R.G. Kilbourn and O.W. Griffith, Inhibition of inducible nitric oxide synthase with inhibitors of
tetrahydrobiopterin biosynthesis, J. Natl. Cancer lnst. 84:1672(1992).
312
SR-L-erythro-5,6,7,8-TETRAHYDROBIOPTERIN: A REGULATOR OF
NEUROTRANSMITTER RELEASE
INTRODUCTION
6R-L-erythro-Tetrahydrobiopterin (6R-BH 4 ) is a common
natural cofactor for hydroxylases of phenylalanine, tyrosine
and tryptophan, and is thought to play an important role in
the regulation of monoamine neurotransmitter biosynthesis 1 .
In fact, it is well known that in atypical phenylketonuria,
6R-BH 4 deficiency results in severe neurological problems as a
result of decreased biosynthesis of brain catecholamines and
5-hydroxytryptamine (5-HT) 2 • 3 Furthermore, it is reported
that the content of 6R-BH 4 is reduced in the brain and/or
cerebrospinal fluid of several neuropsychiatric diseases such
as Parkinson's disease 4 • 5 • 6 , Alzheimer's disease 7 , depression 8
and dystonia 9 . In some clinical trials, administration of
6R-BH 4 is reported to improve clinical signs and symptoms of
these diseases 3 • 6 • B-lO. These clinical findings imply that
the therapeutic efficacy of 6R-BH 4 are mainly due to enhance-
ment of neurotransmitter release. Therefore, we began to
examine the effects of 6R-BH 4 on release of neurotransmitters
such as dopamine (DA) and acetylcholine (ACh) in the brain
using in vivo brain microdialysis.
2.0
c
·e 1.5
0
~
0
E
.s
G)
1.0
c
·e
CIS 0.5
c.
0
c
120 240 120 240
Time (min) Time (min)
Figure 1. Effects of infusion of 6R-BH 4 on the extracellular DA levels in
rat striatum monitored by in vivo brain microdialysis. A) 6R-BH4 was added
to the perfusion fluid (indicated by a bar) at the concentrations of 0.25
(.&), 0.5 (.). 1.0 (.)and 5.0 mM (~). Q; control. B) 6S-BH 4 (.)or
biopterin (.A) was added at 1 mM.
314
3.0
c
·e
Q
2.0
N
~
E
.s-
GI
·ec:as 1.0
a.
0
c
Control 6R 6S Sepia.
50
c 40
·e
Q
~
0 30
E
.s-
<
a. 20 1-1-
0 ::2::2
c 6 6
6R 6S Sepia.
315
These data taken together suggest that 6R-BH 4 stimulates
exocytotic DA release. However, since 6R-BH 4 is a cofactor
for tyrosine hydroxylase, there are two possibilities for
enhancement of DA release by 6R-BH 4 . One possibility is that
the enhancement is secondary to an increase in DA biosynthesis
resulting from increased availability of the cofactor. The
other possibility is that the enhancement is due to direct
stimulation of DA release, which is independent of cofactor
activity. To test these two possibilities, we examined the
effects of 6R-BH 4 and other pteridines after inhibition of DA
biosynthesis using an inhibitor of tyrosine hydroxylase, a-
methyl-p-tyrosine (a-MT).
After intraperitoneal injection of 250 mg/kg of a -MT,
the basal DA levels in dialysates markedly decreased (Fig. 2),
suggesting that DA biosynthesis was inhibited. When 6R-BH 4
was administered after a -MT, it can still stimulate DA re-
lease (more than 70% of the release persisted). In contrast,
the increase in DA release induced by 6S-BH 4 and sepiapterin
was completely abolished by pretreatment with a-MT (Fig. 2).
As shown in Fig. 3, the effects of 6R-BH 4 and other
pter idines on tyrosine hydroxylase activity in vivo were
determined using the same microdialysis system. That is, the
enzyme activity was indexed by extracellular DOPA levels
during continuous infusion of a DOPA decarboxylase inhibitor
(NSD 1015, 0.5 mM) as described previously 14 . The DOPA level
as an index of in vivo tyrosine hydroxylase activity was
increased (from the control value of 6.4 + 1.2 pmol/20 min) to
21 ~ 2.8 pmol/20 min following infusion of 6R-BH 4 (1 mM).
Following administration of 6S-BH 4 and sepiapterin, the DOPA
levels increased to 13.9 + 1. 8 pmol/20 min and 45.1 + 7. 2
pmol/20 min, respectively.-
When rats were pretreated with an intraperitoneal injec-
tion of a-MT (250 mg/kg), the DOPA level in a control group
gradually decreased to 1.2 ~ 0.2 pmol/20 min. After pretreat-
ment with a-MT, neither 6R-BH 4 nor other pteridines could
induce an increase in the DOPA levels. These results show
that tyrosine hydroxylase activity in vivo is completely
inhibited by a-MT, before or even after administration of 6R-
BH4 or other pteridines.
These results taken together strongly indicate that most
of the 6R-BH 4 -induced DA release is independent of DA biosyn-
thesis. In contrast, the increase in DA release induced by
6S-BH 4 or sepiapterin is secondary to an increase in DA bio-
synthesis. Thus, we conclude that 6R-BH 4 has a direct DA
releasing action, which is independent of its cofactor activi-
ty, whereas 6S-BH 4 or sepiapterin has only cofactor activity.
316
30
.......
s::
.E
0
~
0
E
sIll
Qj
>
~
..r:::
0
<C
317
These results taken together demonstrate that 6R-BH 4 indirect-
ly enhances ACh release mainly by activating the 5-HTergic
system.
Glutamate Release Mataga et a1. 15 showed that glutamate
release in rat striatum in vivo was enhanced by infusion of
6R-BH 4 through the dialysis probe. However, 6R-BH 4 had little
effect on glutamine levels in dialysates. Furthermore, the
enhancement of glutamate release was abolished after destruc-
tion of dopaminergic nerve terminals by continuous infusion of
a catecholamine neurotoxin, 6-hydroxydopamine. These results
show that enhancement of glutamate release is mediated by the
dopaminergic system.
Insights into Mechanism of Action
REFERENCES
1. S. Miwa, Y. Watanabe, and 0. Hayaishi, Arch. Biochem. Biophys.
239:234 (1985).
2. S. Kaufman, S. Berlow, G.K. Summer, S. Milstien, J.D. Schulman,
318
s. Orloff, S. Spielberg, and S. Pueschel, New Eng. J. Med.
299:673 (1978).
3. H.-c. Curtius, A. Niederwieser, M. Viscontini, A. Otten, J.S. Schaub,
S. Scheibenreiter, and H. Schmidt, Clin. Chim. Acta 93:251 (1979).
4. W. Lovenberg, R.A. Levine, D.S. Robinson, M. Ebert, A.C. Williams,
and D.B.Calne, Science 204;624 (1979).
5. T. Nagatsu, T. Yamaguchi, T. Kato, T. Sugimoto, S. Matsuura, M. Akino,
I. Nagatsu, R. Iizuka, and H. Narabayashi, Clin. Chim. Acta 109:305
(1981).
6. T. Nagatsu, T. Yamaguchi, M.K. Rahman, J. Trocewicz, K. Oka,
Y. Hirata, I. Nagatsu, H. Narabayashi, T. Kondo, and R. Iizuka,
Adv. Neurol. 40:467 (1981).
7. A.D. Kay, S. Milstien, S. Kaufman, H. Creasey, J.V. Haxby,
N.R. Cutler, and S. Rapoport, Arch. Neurol. 43:996 (1986).
8. H.-c. Curtius, A. Niederwieser, R.A. Levine, W. Lovenberg, B. Woggon,
and J. Angst, Lancet 1:657 (1983).
9. P. LeWitt, L. Miller, R.A. Levine, W. Lovenberg, R.P. Newman,
A. Papavasiliou, A. Rayes, R. Eldridge, and R.S. Burns, Neurology
36:760 (1986).
10. S. Kaufman, G. Kapatos, R. Mcinnes, D. Schulman, and W. Rizzo,
Pediatrics 70:376 (1982).
11. K. Koshimura, S. Miwa, K. Lee, M. Fujiwara, and Y. Watanabe,
J. Neurochem. 54:1391 (1990).
12. K. Koshimura, S. Miwa, K. Lee, Y. Hayashi, H. Hasegawa, K. Hamahata,
M. Fujiwara, M. Kimura, andY. Itokawa, J. Neurochem. 54:533 (1990).
13. T. Ohue, K. Koshimura, Y. Akiyama, Y. Watanabe, and S. Miwa,
Brain Res. 570:173 (1992).
14. B.H.C. Westerink, J.B. De Vries, and R. Duram, J. Neurochem. 54:381
(1990).
15. N. Mataga, K. Imamura, andY. Watanabe, Brain Res. 551:64 (1991).
16. A. Ajima, Y. Yamaguchi, and T. Kato, Brain Res. 518:193 (1990).
17. D. Jackson, M.K. Stachowiak, J.P. Bruno, and M.J. Zigmond,
Brain Res. 457:259 (1988).
18. T. Ohue, K. Koshimura, Y. Takagi, Y. Watanabe, S. Miwa and T. Masaki,
Brain Res., in press.
19. J. Collier and P. Vallance, Trends Pharmacol. Sci. 10:427 (1989).
319
POSITRON EMISSION TOMOGRAPHY STUDIES ON SOME
NEUROTRANSMITTER RECEPTOR SYSTEMS WITH 6R-
TETRAHYDROBIOPTERIN PRETREATMENT
INTRODUCTION
EXPERIMENTAL PROCEDURES
322
regions (Table II), the effect on N-[llC]methyl-piperidylbenzilate
binding was more marked than that in the striatum, while the
effects on N-[llC]methyl-benztropine and [llC]nicotine bindings are
somehow larger in the striatum than those in the cortical regions.
There are several subtypes of muscarinic cholinergic receptors in
the brain, which could explain the discrepancy of these data if both
100
·-.....""
c 0
•D.
APA204
QJ APA201
·--.5 ...
Q.
0 APA174
,Q
APA191
.....0 10 RA2=0.978
=
sc
fils
.!;;:;
Q.O
eo..S
oc
·-.........=
C'-'
0
1
c""QJ
Col
c
0
Col
.1 ~----._----~----._----~----~--~
323
Table 1. Pharmacological profile of R-THBP as evaluated
by PET in the striatum
N -[IIC]methyl-benztropine
(S)(- )[ 11 C]nicotine
mACh
nACh
(-)
(-)
t l
(-)
~
[ 11 C}SCH23390 D1 (-) (-) (-)
N -[ uq methyl-spiperone
(+)(11C]UH232
Dz
D3 t (t) t
!
L-[IICJDOPA DA
turnover
(-)
t t
N -[llCJmethyl- mACh (-)
piperid ylbenzilate
All PET studies were perfomed in three rhesus monkeys except for
(llC}SCH23390.
324
Table 2. Pharmacological profile of R-THBP as evaluated
by PET in the cortex
N- [! IC]methyl-benztropine
(S )(- )[llC) nicotine
mACh (-)
(-)
~
(-)
nACh
Receptor ---:-:---R....-_T_H-:-:B_P_,_(i_.v....:..)---::-:---::--
Ligand (Function) 2mg/kg 7mg/kg 20mg/kg
N-(11C)methyl- mACh
piperidylbenzilate
All PET studies were perfomed in three rhesus monkeys except for
[ttC]SCH23390.
325
REFERENCES
326
POSITRON EMISSION TOMOGRAPHY (PET) STUDY: THE EFFECTS OF 6R-L-
ERYTHR0-5,6,7,8-TETRAHYDROBIOPTERIN (R-THBP, SUN 0588) ON THE CENTRAL
DOPAMINE D1, D2 AND D3 RECEPTORS IN RHESUS MONKEY
Introduction
Among the brain imaging techniques, X-ray computed tomography (CT) and magnetic
resonance imaging (MRI) give morphological images, but positron emission tomography
(PET), which gives functional images, allows monitoring non-invasively of energy metabolism,
local blood flow, some enzyme reactions and several types of receptor bindingsl. The
developments of PET technique and the selective radioligands has potentiated to improve our
knowledge of the physiology of neurotransmitter systems and to monitor drug action by directly
measuring changes in energy metabolism and receptor occupancy as results of altered storage
pool of neurotransmitter, neurotransmitter release, re-uptake, etc. in human and non human
primates2. Especially, the dopaminergic system has been well studied by PET, since the
dopaminergic terminals are highly concentrated in the striatum and the size of the striatum is
suitable for spatial resolution of PET. Within the components of dopaminergic system,
measurable postsynaptic components by PET are D1 and D2 receptors,3 and measurable
presynaptic components are turnover of dopamine4 and dopamine re-uptake site.5
Furthermore, in this paper, we attempt to analyse the dopamine D3 receptor by PET using the
selective ligand (+)[11C]UH232 (cis-(+ )-5-methoxy-1-methyl-2-(di-n-propylamino)tetralin),
which was characterized as an acting dopamine autoreceptor antagonist with the biochemical and
behavioral profile. 6 The aim of the present study is to clarify the effects of peripherally
administered R-THBP (SUN 0588, the chemically synthesized dihydrochlorides salt of R-
THBP, Suntory Limited) on the dopamine D1, D2 and D3 receptor systems in the living rhesus
monkey brain using PET technique.
Radiochemistry
Procedure
Normal rhesus monkeys (Macaca mulatta) weighing 6.0-11.5 kg from the Primate
Laboratory, UUPC, were used after an overnight starvation. Anesthesia was induced with
ketamine (Ketalar® Parke-Davis, 100 mg i.m.) which was repeated as required. Catheters
were inserted into both sides of femoral vein, one for the injection of radioligand orR-THBP,
and the other for venous blood sampling. Venous blood samples (0.5 ml each) were collected
at 1, 2, 5, 10,30 and 60 min afterinjection ofradioligand and total radioactivity was counted in
well-counter. PET camera started immediately following intravenous administration of
radio ligand (radioactivity was 100-400 MBq) and the distribution of radioactivity was recorded.
The following frame sequence was used: 0-3 min, every 15 sec (12 frames); 3-15 min, every 3
min (4 frames); 15-60 min, every 5 min (9 frames), total25 frames. PET scan was performed
using PET cameras (GE PC4096-15WB and PC2048-15B which were equipped with 8 detector
rings giving 15 transaxial slices of the head interspaced 6 mm, a spatial resolution of 4-5 mm).
The position of the head of monkey was determined with reference to a map of horizontal
cryosections of rhesus monkey head (UUPC). Two consecutive PET scans were performed.
The first one was the baseline study and the second was R-THBP (SUN 0588) pretreatment
study. These studies were performed at least 2 hrs apart on the same day in the same rhesus
monkey. Animals recovered for at least 8 weeks prior to their second study according to the
Ethical Committees at the Medical Faculty of Uppsala University. After reconstruction of the
images, the regions of interest (ROis ; the striatum, hippocampus, thalamus, frontal, temporal,
occipital cortex, cerebellum and white matter) were delineated. The kinetics in different brain
regions were estimated after correction of the radioactivity for physical decay and being given a
dimensionless value by correcting for the injected dose per gram body weight. The
concentration of plasma total biopterin, pterin and neopterin were measured by HPLC with
fluorescence detector (FD) according to the methods of Fukushima & Nixon 7 with some
modifications. R-THBP (SUN 0588) was dissolved immediately before use in 0.1 M
phosphate buffer (pH 7 .15) containing 6 mM ascorbic acid and 3 mM L-cysteine and passed
through a filter (pore size, 0.22J.Lm). The intravenous injection of R-THBP was performed 1
hr before the radioligand injection, according to our previous results2.
Dopamine Dl : [llC]SCH23390
After injection of [11C]SCH23390, the uptake rapidly increased with time and followed by a
gradual decrease. The highest accumulation of radioactivity was found in the striatum. The
regional distribution of [11C]SCH23390 in the normal rhesus monkey was consistent with that
obtained in human brain3. Any dose (3, 10 and 30 mg/kg i.v., n=l each) of R-TIIBP showed
little effect on [11C]SCH23390 binding in comparison with control baseline study (n=2). By in
vitro experiments, it was also reported that R-THBP showed no effect on the [3H]SCH23390
binding to the rat striatal membrane fractionS. Accordingly, these results suggest that R-THBP
has little effect on the central dopamine Dl receptor.
Dopamine D2 : N-[IIC]methyl-spiperone
N-[llC]methyl-spiperone was taken up in the striatum rapidly and reached its maximum at
approximately 30 min and thereafter remained the same level, but in the cortex its radioactivity
328
reached the peak at around 10 min and gradually decreased. The three compartment model
could be applied for the calculation of receptor kinetics. In this case, the cerebellum with a
negligible amount of dopaminergic terminal was used as the reference brain region. A typical
result for calculation of k3 value in striatum and frontal cortex are shown in Fig.1.
sr---------------------~~ 3~-----------------------,
Striatum Frontal cortex
4
Q,l
,Q
y
3
~u 2 R-TIIBP: k3=0.0073
0 Baseline 0 Baseline
e R-THBP 10 mglkg e R- TIIHP 30 mg/kg
o~~-L~--~~~~~~~~ 0~~-L~--~~~~~~~~
0 20 40 60 80 100 0 w ~ w w ~
JCcbe(t)dt/Ccbe JCcbe(t)dt/Ccbe
Fig. 1 Example of k3 value determination and the effect of R-THBP pretreatment on k3 values in
the striatum and frontal cortex. The k3 values, the association rate x Bmax values, was calculated
by using three compartment model after reconstraction of the images and calculation of time-curve
of the decay-corrected radioactivites.
The k3 value showed a tendency to decrease with administration of a comparatively low dose
(3 mg/kg i.v.) of R-THBP in the striatum. The administration of R-THBP (10 mg/kg)
significantly decreased the k3 value in the striatium, whereas the k3 value in the frontal cortex
was not significantly altered even by large dose of R-THBP (up to 30 mg/kg i.v., n=3). N-
[IIC]methyl-spiperone has been evaluated as in vivo ligand for the dopamine D2 receptor in
receptor-rich brain region such as the striatum. However, it is well recognized that this ligand
has been characterized as binding to the serotonin 5-HT2 receptor approximately 90 % in the
frontal cortex9. Therefore, present PET results indicate that R-THBP exerts the action not on
the serotonin 5-HT2 receptor but on the dopamine D2 receptor.
k3 values
n Striatum Frontal cortex
Baseline 7 0.0232±0.0027 0.0098±0.0012
R-TiffiP 3 mg/kg 3 0.0145±0.0029 0.0085±0.0019
R-THBP 10 mg/kg 3 0.0057±0.0018* 0.0066±0.0008
R-TiffiP 30 mglkg 3 0.0133±0.0057 0.0070±o.0009
Each value represents the mean±SEM. Statistically significant difference
(Dunnet two-tailed test, Super ANOVATM) from control baseline study is
indicated:* p<0.05.
329
Dopamine D3: (+)[11C]UH232
(+)UH232 has been demonstrated as the most selective dopamine D3 autoreceptor antagonist
from the biochemical and behavioral studies6. The regional distribution of (+)[11C]UH232
uptake in the rhesus monkey brain showed a relatively high level in the striatum, thalamus and
frontal cortex, but low in cerebellum and white matter, whereas the striatal-cerebellar uptake
ratio of (+)[11C]UH232 was apparently lower than those of [11C]SCH23390 and N-
[11C]methyl-spiperone. These results suggest that the dopamine D3 autoreceptor is differently
distributed among the cerebral neurons, as reported by Socoloff et al.lO The pretreatment with
low dose (3 mg/kg i.v.) of R-Tl-IBP significantly decreased the binding potential (k3/k4
value,which represents Bmax/Kd value for dopamine D3 autoreceptor) in the frontal cortex, and
tended to decrease it in the striatum and hippocampus. However, R-Tl-IBP lOmg/kg i.v.
showed little effect on the k3/k4 values, and large dose (30 mg/kg i. v.) of R-Tl-IBP significantly
decreased k3/k4 value in the frontal cortex and thalamus. Although further experiments will be
required to explain these findings, these in vivo PET results indicate that systemically
administered R-THBP may influence on the dopamine presynaptic D3 autoreceptor.
REFERENCES
1. MJ.Phelps, H.Mazziotta and H.Schelbert, ed., in: Positron Emission Tomography and Autoradiography:
Principles and Applications for Brain and Heart, Raven Press, New York, (1986).
2. Y.Tani, T.Ishihara, T.Kanai,T.Ohno, Y.Watanabe, J.Andersson, A.Lilija, G. Westerberg, P.Hartvig and
B.Ungstrom• see another chapter in this book.
3.L.Farde, C.Halldin, S.Stone-Elander and G.Sedvall, Psychopharmacology, 92:278-284 (1987).
4.Y.Watanade, P.Hartvig, J.Tedroff, P.Bjurling, S.Miwa, T.Hayashi, T.Noguchi, and B.Ungstrom, in: Pterins
and Biogenic Amines in Neurology, Pediatrics and Immunology, N.Blau, H.-Ch.Curtius, R.A.Levine and
R.G.H.Cotton, eds., Lakeshore Publishing Company, Grosse Pointe, Michigan, pp.353-362 (1991).
5. J.Tedroff, S.-M.Aquilonins, A.Laihinen, U.Rinne, P.Hartvig, J.Andersson, H.Lundqvist, M.Haaparanta,
O.Solin, G.Antoni, A.D.Gee, J.Ulin and B.Ungstrom, Acta Neurol. Scand., 81:24-30 (1990).
6. K.Svensson, A.M.Johansson, T.Magnusson and A. Carlsson, Naunyn-Schmiedeberg's Arch. Pharmacal.,
334:234-245 (1986).
7. T.Fukushima and J.C.Nixon, Anal. Biochem., 102:176-188 (1980).
8. Y.Watanade, N.Mataga, T.Hayashi, T.Ishihara, T.Kanai, T.Noguchi, S.Miwa and Y.Watanabe, Pteridine, 3:63
(1992).
9. JJ.Frost, A.C.Smith, M.J.Kuhar, R.F.Dannals and H.N.Wagner Jr., Life Sci., 40:987-995 (1987).
10. P.Sokoloff, B.Giros, M.-P.Martres, M.-L.Bouthenet and J.-C.Schwartz, Nature, 347:146-151 (1990).
330
6R-L-ERYTHR0-5,6,7,8-TE1RAHYDROBIOP1ERIN (R-THBP, SUN 0588) ACTS ON THE
BRAIN MUSCARINIC AND NICOTINIC CHOLINERGIC RECEPTORS AS EVALUATED
BY POSITRON EMISSION TOMOGRAPHY (PET) IN RHESUS MONKEY
Introduction
Radiochemistry
Radionuclides (llC, 150 and 18f) were produced by 14N(p, a)liC, 14N(d,n)150 and
20Ne(d, a)18p nuclear reactions, respectively, using a cyclotron (Scanditronix MC-17) at
Uppsala University PET Centre (UUPC). N-[llC]methyl-benztropine, (S)(-)[llC]nicotine,
Procedure
Normal rhesus monkeys (Macaca mulatta) weighing 6.1-11.0 kg from the Primate
Laboratory, UUPC, were used after an overnight starvation. Anesthesia was induced with
ketamine (Ketalar® Parke-Davis, 100 mg i.m.) which was repeated as required. Catheters
were inserted into both sides of femoral vein, one for the injection of radio ligand orR-THBP,
and the other for venous blood sampling. Arterial catheterization was performed in the case
of the regional cerebral blood flow (rCBF) and the regional cerebral glucose metabolism
(rCMRglc) studies. Venous blood samples (0.5 ml each) were collected at 1, 2, 5, 10, 30
and 60 min after injection of radio ligand and total radioactivity was counted in well-counter.
PET camera started immediately following intravenous administration of radioligand
(radioactivity was 100-400 MBq) and the distribution of radioactivity was recorded. In
receptor studies,the following protocol for PET was used: 0-3 min, every 15 sec (12 frames);
3-15 min, every 3 min (4 frames); 15-60 min, every 5 min (9 frames), total25 frames. In
the case of rCBF study, continuous arterial blood sampling (3 ml/min) was performed by an
automated device for 145 sec. Images were recorded: 0-85 sec, every 5 sec (17 frames) and
85-125 sec, every 20 sec (2 frames), total 19 frames, after intravenous injection of sterilized
H2 15 0 (25-75 MBq/kg). In rCMRglc study,the following frame sequence was used: 0-5
min, every 60 sec (5 frames); 5-20 min, every 3 min (5 frames); 20-50 min, every 5 min (6
frames), total16 frames after intravenous injection of sterilized 18 FDG (8-20 MBq/kg). PET
scans were performed using PET cameras (GE PC4096-15WB and PC2048-15B which were
equipped with 8 detector rings giving 15 transaxial slices of the head interspaced 6 mm, a
spatial resolution of 4-5 mm). The position of the head of monkey was determined with
reference to a map of horizontal cryosections of rhesus monkey head (UUPC). Two
consecutive PET scan was performed in the [llC]ligand studies. The first one was the
baseline study and the second was R-THBP (SUN 0588) pretreatment study. These studies
were performed at least 2 hrs apart on the same day in the same rhesus monkey. Animals
recovered at least for 8 weeks prior to the next study according to the Ethical Committees at
the Medical Faculty of Uppsala University. After reconstruction of the images, the regions of
interest (ROis ; the striatum, hippocampus, thalamus, frontal, temporal, occipital cortex,
cerebellum and white matter) were delineated. The kinetics in the different regions were
estimated after correction of the radioactivity for physical decay and being given a
dimensionless value by correcting for the injected dose per gram body weight. In rCBF and
rCMRglc studies, the blood pC02 value, pH and plasma glucose concentration in the
beginning and end of each study were measured by blood gas system (ABL520,
©Radiometer, Copenhagen) and biochemistry analyzer (2700 select, YSI), respectively. The
concentration of plasma total biopterin, pterin and neopterin were measured by HPLC with
fluorescence detector (FD) according to the methods of Fukushima & Nixon6 with some
modifications. R-THBP (SUN 0588) was dissolved immediately before use in 0.1 M
phosphate buffer (pH 7.15) containing 6 mM ascorbic acid and 3 mM L-cysteine and then
passed through a filter (pore size, 0.22 j.Lm).
332
[llC]methyl-benztropine was observed in cerebral cortices (frontal, temporal and occipital
cortex), striatum and thalamus. In these brain regions, the uptake continued to increase until
60 min experimental period in rhesus monkey. First, we studied on pretreatment time of R-
THBP. When intravenous pretreatment with 10 mg/kg of R-THBP was performed 5, 20,
30, 60 and 180 min prior to the injection of N-[llC]methyl-benztropine, the most marked
decrease of the uptake ratio of N-[llC]methyl-benztropine into striatum, hippocampus,
thalamus and cerebral cortices against cerebellum or white matter was observed in the case of
60-min pretreatment. This result was consistent with our previous microdialysis study8 that
striatal dopamine output was significantly elevated 1-2 hr after intraperitoneal injection of R-
THBP (50 mg/kg). Therefore, the pretreatment time of R-THBP was decided to be 1 hr
before the radioligand injection.
Table 1. Effect of R-THBP on the uptake ratio of N-[11 C]methyl-benztropine into the
striatum, hippocampus, thalamus and cerebral cortices to that of cerebellum.
As shown in Table 1, the effect of R-THBP on muscarinic cholinergic system was dose-
dependent: while 3 mg/kg of R-THBP did not alter the uptake ratio from the baseline level, 10
and 30 mg/kg reduced the uptake ratio significantly in the thalamus, frontal and temporal
cortices and tended to decrease in the striatum and hippocampus. Although the mechanisms
underlying the fact that R-THBP reduced the uptake ratio of N -[llC]methyl-benztropine into
the various brain regions is not clear, this result may be interpreted to be due to ACh releasing
action of R-THBP, inasmuch as intracerebroventricular injection and infusion of R-THBP
produced dose-dependent increases in Ach level in the rat hippocampal dialysates3.4.
(S)(-)[llC]nicotine uptake was highly distributed in the thalamus, striatum and cerebral
cortex, but low in the cerebellum and white matter. Intravenous injection of 10 mg/kg of R-
THBP significantly decreased (S)(-)[llC]nicotine uptake (about 10-20%) in the striatum, but
3 and 30 mg!kg exerted little effect. Although further experiments are needed to clarify the
effect of R-THBP on the nicotinic cholinergic system, these results suggest a possibility that
R-THBP may act also on the central nicotinic cholinergic receptor which may lead to new
avenues of investigation in regards to cognitive disorders9. The changes of plasma total
biopterin, pterin and neopterin concentrations in rhesus monkey were also measured. Both
333
plasma total biopterin and pterin levels were markedly increased with i.v. injection of R-
THBP and gradually decreased with time, while plasma total neopterin level did not change at
all.
The rCBF and rCMRglc were monitored by PET in normal rhesus monkey brain which
were assessed by use of Raichle's H215Q method and the graphical 18FDG method,
respectively. The values of rCBF and rCMRglc showed high levels in cortical and
subcortical regions, but relatively low in the cerebellum and white matter. Any dose of R-
THBP did not significantly affect rCBF and rCMRglc, without influencing the blood pC02
and pH values. Consequently, the changes in muscarinic and nicotinic cholinergic receptors
in vivo is not due to a change in rCBF.
REFERENCES
1. K.Koshimura, S.Miwa, K.Lee, M.Fujiwara and Y.Watanabe, J. Neurochem., 54:1391-1397 (1990).
2. N.Mataga, K.Imamura and Y.Watanabe, Brain Res., 551:64-71 (1991).
3. T.Ohue, K.Koshimura, K.Lee, Y.Watanabe and S.Miwa, Neurosci. Lett., 128:93-96 (1991).
4. T.Ohue, K.Koshimura, Y.Akiyama, Y.Watanabe and S.Miwa, Brain Res., 570:173-179 (1992).
5. M.J.Phelps, H.Mazziotta and H.Schelbert, ed., in: Positron Emission Tomography and Autoradiography:
Principles and Applications for Brain and Heart, Raven Press, New York, (1986).
6. T.Fukushima and J.C.Nixon, Anal. Biochem., 102:176-188 (1980).
7. S.L.Dewey, R.R.Macgregor, J.D.Brodie, B.Bendriem, P.T.King, N.D.Volkow, D.J.Schlyer, J.S.Fowler,
A.P.Wolf, S.J.Gatley and R.Hitzemann, Synapse, 5:213-223 (1990).
8 Y.Tani, N.Mataga, T.Ishihara, T.Kanai, Y.Watanabe and T.Noguchi, in: Neurobioloogy of Infantile
Autism, H.Naruse and E.M.Omitz, ed., Elsevier Science Publishers B.V., Amsterdam, pp.335-336. (1992).
9. E.D.Levin, Psychopharmacology, 108:417-431 (1992).
334
EFFECT OF 6R-TETRAHYDROBIOPTERIN ON THE CENTRAL
MUSCARINIC CHOLINERGIC RECEPTOR AS EVALUATED BY
POSITRON EMISSION TOMOGRAPHY STUDIES USING
RHESUS MONKEY
INTRODUCTION
336
cerebellum as a reference. We therefore applied three
compartment model for quantitation of the receptor kinetics. In
this case, K3 value could be easily calculated by Patlak plot. The
results obtained from 3 rhesus monkeys were shown in Table 1.
Significant effect of R-THBP on the K3 value was seen in the part
of temporal and front-temporal cortices and thalamus. Not
statistically significant but considerable effect was observed in the
part of frontal cortical areas in PET slice numbers 5 and 6. These
areas may be related to dopaminergic and/or serotonergic
projection, and it might be possible that R-THBP is primarily
effective on such monoaminergic systems and then secondarily
affects on muscarinic cholinergic system as like our previous
results by microdialysis3. These results confirmed that R-THBP
could affect the mAChergic system and this implies that the
clinical efficacy of R-THBP could be mentioned even in the case of
demented patients with cholinergic defect as one of the clinical
features.
[ 11 C]Benztropine
eC]1RB
1
337
Table 1. Effects ofR-THBP (20 mglkg i.v.) on the k3 value of
in vivo muscarinic cholinergic receptor binding
in three rhesus monkeys as evaluated by PET
REFERENCES
338
INCREASE OF TETRAHYDROPTERINS IN CELL-FREE RETINAL EXTRACTS
IN RESPONSE TO LIGHT EXPOSURE
INTRODUCTION
Bovine eyes were prepared within two hours after slaughter. All animals were killed
in the early morning. Retina and pigment epithelium were homogenized (2 g in 1 ml
Ringer solution) and centrifuged with 45000 rpm for 30 minutes (Beckman L50). The
pooled supernatants were brought into 4 tubes. 100 - 500 ug triamterene (2,4,7-
triamino-6-phenyl-pteridine) per ml supernatant was added to 2 sets. Incubation at 37 C
was performed in Warburg apparatus with transparent walls for 30 minutes. Two sets were
exposed to about 40000 lx and two sets protected from light (0.01 lx). After incubation
dithioerythrol and perchloric acid was added as described by Brautigam et a1. 4• References
were obtained from Schircks, Jona Switzerland. The tetrahydropterins were determined after
HPLC separation by electrochemical detection: 0.4 V polarization voltage, detection
sensibility 0.5 rnA, methanol 5-10% of elution buffer. Light exposure varied seasonal:
winter approx. 25000 lx, summer approx. 50000 lx, fall approx. 35000 lx.
Fig. 1. A standards 25 ng/ml MH4 (1) and 25 ng/ml BH4 (2); B retmal supernatant mcubated with tnamterene
m the dark; elution buffer 7.5 %methanol.
f\ : :. 1
I , I I I
p;·~~\
'- . :'1
. . t"'
. '····. \ \.:;:.~:-:-.::r.:-"
Fig. 2. A retmal supernatant mcubated wtth tnarnteren B control no tnarnterene added (1) MH4 (2} BH4
elution buffer 10% methanol.
340
pmol BH4/g RETINA
120r-----~--------------------,
100
p<0.02
n•9
80
60
40
20
[%)
200r-----------------------------.
P<0.01
n•8
150
100
50
341
pmol BH4/g RETINA
2sor-----~-----------------.
pc0.01
n-13
200
150 pc0.05
n•8
pc0.05
n•22
100
50
l
OLL~~LL~~LWU-~UU~~~
DISCUSSION
REFERENCES
342
EFFECT OF TRIAMTERENE ON THE ELECTRORETINOGRAM OF LONG
EVANS RATS
INTRODUCTION
Long Evans rats (n=15) received triamterene with tap water (approx. 5 mg
triamterene/day). Animals were kept under constant light conditions (LD 12h/12h; O.oi
lx/2.0 lx). After 8 hours of dark adaptation ERG were recorded under Ketanest anaesthesia
excluding diurnal variations of ERG amplitudes. A scotopic ERG recording was followed
by a 2 minute Ganzfeld illumination. ERG recordings were made every 2 minutes during
the subsequent readaptation phase using a Nicolet Compaq unit. The following parameter
were used: background illumination 17.0 cd/qm; flash illuminance 0.81 cd/qms.
Triamterene was dissolved in tap water with a final concentration of lg/1. Triamterene
uptake was controlled by urinary excretion of hydroxytriamterene by HPLC (fluorescence
detector). ERG recordings were done in three series. First before triamterene administration,
a second series after 11 days of triamterene uptake, a final third one 10 weeks after
cessation of triamterene.
1 4 7 10 13 16 19 22
Time (min)
b-Wave (JN)
700,------------------------------------,
1 4 7 10 13
Time (min)
Fig.!. a- and b-wave amplitudes in dependence of readaptation time:
* before triamterene administration (n=15);
+ after 11 days of triamterene uptake (n = 8);
"' 10 weeks after cessation of triamterene (n = 8).
Dark adapted rats were illuminated (17 cd/sqm) in the interval (1 min, 3 min). At t = 22
min rats under triamterene differed significantly (p = 0.025) from untreated animals.
344
RESULTS
DISCUSSION
REFERENCES
345
IMMUNOENZYMATIC LABELING OF BIOPTERIN AND NEOPTERIN IN
THE PIGMENT EPITHELIUM OF BOVINE RETINA
'Dept. of Ophthalmology
2Dept. of Pathology
University of Munster
Domagkstr. 15, W-4400 Munster, Germany
3Fa. Henning, 1000 Berlin, Germany
INTRODUCTION
Retinal pigment epithelium was isolated from bovine eyes within 1-2 hours after death
using the preparative methods as reported by Glocklin and Potts (10). Quantitative analysis
of pterins was performed according to our previous method (9) after acidic oxidation and
ion exchange chromatography (DOWEX H+, 50 WX 8). For quantitative analysis HPLC
with fluorescence detection was used. DNA-concentration was determined by the Burton
method (3). Labeling of biopterin and neopterin in bovine pigment epithelium was achieved
with the APAAP (Alkaline Phosphatase/Anti-Alkaline Phosphatase)-complex technique of
Cordell et al. (4). For primary labeling the recently available biopterin (sheep) antibody was
used (11). Further antibodies for the labeling procedure were: second GAS (goat-antisheep),
third RAG (rabbit-anti-goat). Tissue used for the labeling procedure was not subjected to
oxidative steps. For control staining hematoxylin was applied according to Mayer.
Results of the quantitative analysis of bovine retinal pigment epithelium (RPE) are
listed in table 2. Biopterin in RPE revealed to be the major of analyzed pterin derivatives
at this location. The ratio between biopterin and neopterin was 1:36. The concentration of
monapterin in RPE was nearly by a factor of 7. 7 higher than neopterin. Compared to
neuroretinal concentrations (9) biopterin is nearly 12-fold higher in RPE. On the basis of
approximate comparison biopterin concentration in RPE is ranking in the upper range of
reported tissue analyses (5,7).
Immunenzymatic labeling of biopterin and neopterin in RPE-cells is demonstrated on
figure 1. Specific positivity occurs as a red/brown stain on the original histological
photographs. Generally staining of neopterin was less intensive when using similar antibody
dilutions (1: 10-1 00). Staining of neopterin and biopterin was mainly found in the cytoplasm
and seems to be bound to subcellular microsomal particles smaller than 1 pm.
348
Table 2. Quantitative results of pterin analysis in RPE of bovine eyes (ng/mg DNA).
Figure I. Positive biopterin label of bovine retinal pigment epithelium. Specific staining occurs originally as
a red/brown coloration of subcellular particles of the cytoplasm and demonstrates on the photographs as a
fine dark granulation. Additionally melanin granules can be seen on the photograph. Original magnification
was lOOOx.
REFERENCES
1. Bagnara, J.T., Matsumoto, Ferries, W., et al., 1979, Common origin of pigment cells. Science
203:410
2. Bagnara, J.T., and Hadley, M.E., 1973, "Chromatophores and Color Change". Prentice Hall,
Englewood Cliffs
3. Burton, K., 1955, A study on the conditions and mechanism of the diphenylamine reaction for the
colorimetric estimation of desoxyribonucleic acid. Biochemistry 62:315
4. Cordell, J.L., Falini, B., Erber et al., 1984, Immunenzymatic labeling of monoclonal antibodies using
immune complexes of alkaline phosphatase and monoclonal anti-alkaline phosphatase (APAAP
complexes). J Histochem Cytochem 32:219
349
5. Duch, D.S., Bowers, S., Woolf, J.H., and Nichol, C.A., 1984, Biopterin cofactor biosynthesis: GTP
cyclohydrolase, neopterin and biopterin in tissues and body fluids of mammalian species. Life
Sciences 35:1895
6. Frost, S.K., Borchert, M., Carson, M.K., 1989, Drug induced and genetic hypermelanism: effect on
pigment cell differentiation. Pig Cell Res 2:182
7. Fukushima & Nixon (1980) Analysis of reduced forms of biopterin in biological tissues and fluids.
Anal Biochem 102:176
8. Cremer-Bartels & Gerding, 1987, Pterins in bovine, rat, quail and human retina. In: Pfleiderer eta!.
(eds.) Biochemical and Clinical Aspects of Pteridines. De Gruyter, Berlin
9. Gerding, H., Krause, K., Cremer-Bartels, G. and Hanneken, L., 1990, Pterins in bovine, rat, quail
and human retina. In: Curtius eta!., (eds.) Chemistry and Biology of Pteridines 1989, De
Gruyter, Berlin
10. Glocklin & Potts (1962) The metabolism of the retinal pigment cell epithelium. Invest Ophthalmol
1:111
11. Rokos & Hey (1990) New immunoassays for determination of biopterin and neopterin in body
fluids. In: Curtius eta!. (eds.) Chemistry and Biology of Pteridines 1989, De Gruyter, Berlin
350
REDUCED PTERINS AS SCAVENGERS FOR REACTIVE OXYGEN SPECIES
INTRODUCTION
Pterins are widely distributed in nature in three forms: tetrahydro, dihydro, and
oxidized. The most studied pterin is L-erythro-5,6,7,8-tetrahydrobiopterin (BH4), the
electron donor for mixed function oxidases, such as Phe hydroxylase during the
conversion of Phe to Tyr, and Tyr and Trp hydroxylases during biogenic amine
synthesis. 1 BH4 also serves as the cofactor for nitric oxide synthase which produces
nitric oxide from the vascular endothelium, platelets, neutrophils, and neurons. 2 Upon
oxidation to the quinonoid dihydrobiopterin (qBH2), BH4 is regenerated by
dihydropteridine reductase (NAD[P]H:6, 7-dihydropteridine oxidoreductase, EC
1.6.99.7;DHPR) using NADH as cofactor. 3 BH4 and DHPR are ubiquitous.4 Their
parallel distribution in some organs and blood cells which apparently do not synthesize
catecholamine neurotransmitters and/or nitric oxide, implies that BH4 and DHPR may
involve in other physiological functions.
Heales et al. 5 suggested that BH4 may serve as free radical scavenger. We were
the first to confirm this antioxidant role for BH4 by showing that BH4 inhibits
dopamine autoxidation. 6 We then proposed and tested the BH4 /DHPR antioxidant
system in rat pheochromocytoma (PC 12) cells, and found that it protected the host
against oxidative damage. 7 Recently, Kojima et al. 8 demonstrated that 5,6,7,8-
tetrahydroneopterin acts as a scavenger for superoxide radicals (Ot) generated in
mouse splenic cells by xanthine oxidase/xanthine (XO/X) reactions. These findings
strongly indicate that reduced pterins, tetrahydropterins in particular, play an important
role as a physiological antioxidant in mammalian cells.
The purpose of this study was to evaluate the antioxidant property of reduced
pterins in an in vitro 0 2·- and H 20 2-generating system, and in two mammalian cell
culture models.
Chemicals And Enzymes. All pterins were purchased from Dr. B. Schircks Labs. (Jona,
Switzerland). Sheep liver DHPR, horseradish peroxidase (HPO), buttermilk XO,
bovine liver catalase, Dulbecco's phosphate buffered saline (DPBS), 5-amino-2,3-
dihydro-1,4-phthalazindione (luminol), and 3-[4,5-dimethylthiazol-2-yl]-2,5-diphenyl-
tetrazolium bromide (MTI) were obtained from Sigma (St. Louis, MO).
Cell Culture Conditions. All cells were grown in medium (RPMI 1640 for rat PC 12
cells; Dulbecco's modified Eagle for mouse macrophages J774A.1) supplemented with
5% fetal calf serum and 5% heat-inactivated horse serum (hereafter called the
complete medium), and were maintained at 36.5 °C in a humidified atmosphere of 5%
C02 in air? Murine J774A.1 cells were supplemented with L-glutamine (2.05 mM).
Before the experiment, cells were harvested and incubated in complete medium in 96-
well flat-bottomed plates (0.2 mL/well; 5 x 104 cells/mL for PC 12 and 2 x10S cells/mL
for J774A.1) for 24 h. The complete medium was then replaced with DPBS (9.6 g/L,
pH 7.4) or medium that was not supplemented with serum (hereafter called the serum-
free medium) but contained test substances. The BH4/DHPR antioxidant system
included 0.1 mM BH4, 3 U /mL HPO, 0.2 mM NADH, and 0.1 U /mL DHPR. The
cells were further incubated for a certain period and then assessed for injury by the
[ 3H]-thymidine incorporation, expressed in %incorporation, and MTI assay, expressed
in absorbance at 600 nm?
352
100 A B
Q)
c
:u ~ 80
1-
:5 5
..!-, :g 60
I ._
L-Je-0
I"')
~ 8 40
:g .5
Qi
a:: 20
'-
0 ~~ -~-.---.-.-.___:;ec___J
0 20 40 60 80 100 0.0 0.1 0.2 0.3 0.4 0.5
Xanthine oxidase,..uU/ml o
H2 2 concentration, mM
Figure 1. Use ofBH4/DHPR antioxidant system to reduce oxidative damage in two mammalian cell lines.
Panel A: Rat PC 12 cells stressed with XO/X reactions in serum-free medium for 2 h. Xanthine
concentration was held at 0.5 mM. Control(O); Ascorbic acid, 1 mM(•); Catalase, 1,250 U/mL(.o.); The
BH4/DHPR antioxidant system(•). Panel B: Murine J774A.1 cells exposed to H 20 2 for 2 h in DPBS.
Control(o); HPO, 3 UjmL(+); Catalase, 1,250 UjmL(.o.); The BH4/DHPR antioxidant system(•).
120~--------------------------~----------------;
,.....
~c: 100
0
0
~
0
~
Q)
0
cQ)
0
~
.Ec:
:3
.E
Q)
..c:
(,)
353
The MIT-oxidizable substances, which measure the number and mitochondrial
activity of living cells, in mouse macrophages were reduced to about half of the control
value when cells were exposed to UV light for 5 h, but recovered to about 75% of the
control when cells were pretreated with the BH4 /DHPR antioxidant system (Table 1).
NADH and BH4 alone was equally effective as compared to the BH4/DHPR
antioxidant system, whereas HPO and catalase were ineffective, indicating UV light
damage to the cells may not be just oxidative in nature.
REFERENCES
354
CHEMISTRY AND BIOLOGY OF THE
MOLYBDENUM COFACTORS
Department of Biochemistry
Duke University Medical Center
Durham, NC 27710
INTRODUCTION
All molybdenum-containing enzymes other than nitrogenase carry out either oxidative
hydroxylation or reductive dehydroxylation of their substrates as exemplified by the reactions
catalyzed by sulfite oxidase and nitrate reductase respectively, shown below. The results of
X-ray absorbance fine structure studies on sulfite oxidase, xanthine dehydrofenase and other
enzymes showed ligation of Mo to two to three thiolate ligands in all cases. In addition, the
ligand field of the metal contained either 2 Mo=O or 1 Mo=O and 1 Mo=S bonds. Because of
this, the term oxomolybdenum enzyme has been used to describe these proteins.
Studies in our laboratory on the nature of association of Mo with the protein of sulfite
oxidase led to the identification and structural characterization of the molybdenum cofactor, a
complex of the metal with a unique organic molecule termed molybdopterin (MPT). 2 The
proposed structure of the cofactor (Figure 1) features a dithiolene group coordinated to Mo
through its sulfur atoms. The 4-carbon alkyl side chain also distinguishes molybdopterin
from other metabolically functional pterins. The tetrahydro state of the pterin ring was an
empirical assignment based on the susceptibility of the cofactor to oxidative loss of function.
355
The cofactor itself has not yet been isolated due to its extreme lability when released
from its protective protein environment. Elucidation of the cofactor structure devolved on its
conversion to stable oxidized derivatives termed Form A and Form B3 and on the discovery
that urothione, a long known thienopterin, is the metabolic degradation product of the
cofactor. 4 Definitive proof of the structure of molybdopterin was derived by conversion to
the dicarboxamidomethyl derivative (camMPT) and structural characterization of the latter
(Figure 2).5
SULFITE OXIDASE
ANAEROBIC DENATURATION
IN THE PRESENCE OF IODOACETAMIDE
CHROMATOGRAPHY ON QAE-SEPHADEX
ELUTION WITH 10 mM HCI
AIR OXIDATION
HN~N'r-~=~-CHOH-CH,OPO, =
HN~NAN)
2
I
CH2 CH2
I
I I
H2NC CNH 2
II II
0 0
Figure 2. Formation of dicarboxamidomethyl molybdopterin from the molybdenum cofactor of sulfite
oxidase.
The molybdenum cofactor of DMSO reductase can exist with the metal in three different
valence states, Mo(VI), Mo(V) and Mo(IV). The absorption spectra of the Mo(VI) and
Mo(IV) forms of the enzyme contain bands that make them well suited for resonance Raman
spectroscopy.? In the C=C stretching region of the spectrum, bands at 1575 cm-1 for the
oxidized and at 1568 cm-1 for the reduced DMSO reductase have been assigned to C=C
356
stretching of the dithiolene. The shift in the position of the band upon reduction of the Mo
has been adduced as evidence for the proposed dithiolene-Mo coordination.
Data from the Mo-ligand stretching regions of the spectra are summarized in Table 1.
Mo-S stretching frequencies in the range of 350-390 cm-1 have been observed for several
dithiolene-Mo complexes. The two major bands seen at 350 cm-1 and 370 cm-1 in the
oxidized enzyme are shifted to 352 cm-1 and 383 cm-1 respectively in the reduced enzyme.
More importantly, all of these bands occur at lower frequencies in DMSO reductase isolated
from cells grown in the presence of [34S]sulfate in the medium. These data showing the
presence of C=C stretching and Mo-S stretching bands that are sensitive to the oxidation
state of Mo in R. sphaeroides DMSO reductase provide evidence for the existence of a
dithiolene chelate structure in the molybdenum cofactor of the enzyme. 7
Sample 32s
357
(MOD). Soon thereafter the cofactor of another prokaryotic enzyme, CO dehydrogenase
from Pseudomonas carboxydoflava, was shown to contain molybdopterin cytosine
dinucleotide (MCD). 10 More recently dinucleotide variants containing adenine (MAD) and
hypoxanthine (MHO) have also been discovered. 11 The dinucleotide structure is shown in
Figure 4.
,.. 10 I
I
E 8
I
I
,..u
I
6 I
\..... - ...
' ' ..... ___
I
:i 4 ''
w
E
2 ------ -----
0
400
e
,.. 200
u
,.. 0~~~--~r---~~~
:a:
~ -200
-400
OH OH
X VARIANT
Cytosine MCD
Adenine MAD
Hypoxanthine MHD
Figure 4. The molybdopterin dinucleotides. The pterin ring is shown in the tetrahydro form.
358
The distribution of the molybdopterin variants in a number of molybdoenzymes is
shown in Table 2. All of the eukaryotic enzymes analyzed so far contain only molybdopterin.
The dinucleotides have been found only in eubacteria and methanogens. It is noteworthy that
nitrate reductase and CO dehydrogenase from the same organism, P. carboxydoflava, contain
exclusively different dinucleotides. Among those listed in Table 2, xanthine dehydrogenase is
the only enzyme present in both eukaryotes and prokaryotes. Interestingly it is also the only
eubacterial enzyme not to have a dinucleotide in its cofactor.
Tungsten-containing Enzymes
Mukund and Adams have recently discovered and purified four tungsten-containing
enzymes from hyperthermophilic archaea. 12 These enzymes catalyze reactions similar to
those of molybdoenzymes from mesophilic organisms. Structural characterization of the
alkylated pterins from the tungsten cofactors of these enzymes showed that all four contain
molybdopterin rather than any of the molybdopterin dinucleotides. 13 These findings under-
score the fact that the molybdopterin structure has remained immutable throughout the course
of evolution and document the occurrence of molybdopterin in tungsten- as well as in
molybdenum-containing cofactors.
359
MOLYBDENUM COFACTOR BIOSYNTHESIS
The chlA locus in E. coli has been cloned and shown to encode five proteins. Earlier
studies showed that loss of function of chlA4 or chlA5 leads to accumulation of a precursor
that was initially visualized through its oxidation product, compound Z. Recent studies on
the structure of precursor Z have shown that it is identical to compound Z except that the
pterin ring in the precursor is in the dihydro state. 14 These structures are shown in Figure 5.
ChiN
"S" + ATP + ChiA4 ChiA4-S + ADP + Pi
ChiA4-S + ChiA5 Converting Factor-S
Converting Factor-s + Precursor Z Converting Factor-MPT
Figure 6. Formation of MPT from precursor Z. The Chi designation refers to the peptide encoded by the
corresponding chl gene. The exact oligomeric form of the converting factor has not been determined. The
MPT formed in the reaction remains bound to the converting factor.l 6
Molybdenum Insertion
Mutants in chiD and chlG display the pleiotropic phenotype when grown at low
concentrations of molybdate but contain active molybdoenzymes when grown on high
molybdate. These loci appear to be involved in the uptake and processing of molybdate, but
the proteins encoded by these loci have not yet been identified. 18
360
Biosynthesis of Precursor Z
Precursor Z is produced in large amounts by E. coli chlA5 and chiN mutants. The
oxidized product, compound Z, can easily be purified to homogeneity from whole cultures of
these mutants. To test the possibility that the carbon atoms of precursor Z are derived from
those of both the guanine and the ribose components of guanosine, chiN cells were grown in
the presence of uniformly labeled [14C]guanosine. The presence of 14C in compound Z
purified from the culture demonstrated that guanosine had indeed served as a precursor. To
examine the fractional distribution of label in the pterin ring vs. the side chain, a two step
procedure for the separation of the side chain carbons from the pterin ring was designed.
Alkaline permanganate treatment caused elimination of three side chain carbons and generated
pterin-6-carboxylate. The latter was purified by HPLC and its specific radioactivity was
measured. UV irradiation of the sample caused elimination of C02 and yielded unsubstituted
pterin. After HPLC purification, the specific radioactivity of the pterin could also be
measured. The fact that the specific radioactivity of the pterin compound decreased at each
step showed that at least two, and possibly all four, of the side chain carbons were derived
from the guanosine. These data suggested that an enzyme similar to GTP cyclohydrolase I
may be involved in the conversion of guanosine or one of its phosphorylated forms into
precursor Z (M. M. Wuebbens and K. V. Rajagopalan, unpublished).
In the reactions catalyzed by both cyclohydrolase I and cyclohydrolase II, the C-8 of the
guanine ring is eliminated as formate. Thus, neither biopterin in animals nor folates or
riboflavin in plants and microorganisms will be labeled when [8-14C]guanosine is used as the
precursor. To examine whether the same holds true for molybdopterin biosynthesis, chiN
cells were grown in the presence of [8-14C]guanosine. Unexpectedly significant radioactivity
was present in the compound Z. Degradation of compound Z to pterin-6-carboxylate and then
to pterin showed that all of the 14C was associated with the C-1' carbon of the side chain. In
contrast very little radioactivity was present in the bulk pterin-6-carboxylate obtained by
permanganate treatment of the whole cell culture. These findings showed that in the
conversion of guanosine to precursor Z, the C-8 of guanosine is retained to generate C-1' of
the side chain and suggested that the ten carbons of precursor Z could all be derived from the
10 carbons of guanosine. Since the label from the ribose of guanosine is incorporated into
some or all of the 2' to 4' carbons of the side chain, these data imply that the C-8 of the
guanine ring is inserted between C-2' and C-3' of the ribose in the process of generating
precursor Z. The mechanism of this intriguing reaction remains to be explored.
The chlB mutants of E. coli had been known for some time to produce MPT capable of
reconstituting nit-1 nitrate reductase, yet displayed the pleiotropic absence of molybdo-
enzymes characteristic of the entire class of chl mutants. 18 The nit-1 nitrate reductase
reconstitution was shown to be the result of cofactor transfer from the chlB extract to the apo
nitrate reductase and not due to activation of a nit-1 precursor. 19 Moreover, upon treatment
with 12/KI at pH 2.5 and 100 °C, chlB cells yielded much higher levels of the fluorescent
cofactor derivative Form A than did wild type cells. These results showed that chlB mutant
cells contain MPT, but did not indicate whether they also contain MGD since the conditions
used for generation of Form A lead to cleavage of the pyrophosphate bond. In order to
address this question, conditions were established for the conversion of MGD to a new
derivative, Form A-GMP. 19 Indeed, the results indicated that while significant levels of
MGD were present in wild type cells, extracts of chlB cells were devoid of this material.
Thus it was concluded that the product of the chlB gene locus is essential for the conversion
of MPT to MGD.
361
CLONING OF RAT LIVER SULFITE OXIDASE
The amino acid sequences of sulfite oxidase from rat liver and chicken liver have been
determined20,21 and found to contain two invariant cysteines which are also present in the
deduced amino acid sequences of several plant nitrate reductases. The eDNA of rat liver
sulfite oxidase has been cloned and expressed in E. coli to yield active enzyme (R. M. Garrett
and K. V. Rajagopalan, unpublished). Despite the presence of both MPT and MGD in the
host cells, the purified expressed protein was found to contain only MPT. The basis for this
selectivity remains to be explored. This expression system should facilitate detailed structure-
function studies on the enzyme, especially in relation to the interactions of the molybdenum
cofactor with the protein.
CONCLUSIONS
REFERENCES
1. C.D. Garner and S. Bristow, in: "Molybdenum Enzymes," T.G. Spiro, ed., Wiley-Interscience, New
York (1985).
2. K.V. Rajagopalan, in: "Advances in Enzymology and Related Areas of Molecular Biology," A. Meister,
ed., John Wiley & Sons, New York (1991).
3. J.L. Johnson, B.E. Hainline, K.V. Rajagopalan, and B.H. Arison, J. Biol. Chern. 259:5414 (1984).
4. J.L. Johnson and K.V. Rajagopalan, Proc. Natl. Acad. Sci. USA 79:6856 (1982).
5. S.P. Kramer, J.L. Johnson, A.A. Ribeiro, D.S. Millington, and K.V. Rajagopalan, J. Biol. Chern.
262:16357 (1987).
6. N.R. Bastian, C.J. Kay, M.J. Barber, and K.V. Rajagopalan, J. Biol. Chern. 266:45 (1991).
7. S. Gruber, L. Kilpatrick, N.R. Bastian, K.V. Rajagopalan, and T.G. Spiro, J. Am. Chern. Soc.
112:8179 (1990).
8. M.G. Finnegan, J. Hilton, K.V. Rajagopalan, and M.K. Johnson, J. Inorg. Chern. (1993), in press.
9. J.L. Johnson, N.R. Bastian, and K.V. Rajagopalan, Proc. Natl. Acad. Sci. USA 87:3190 (1990).
10. J.L. Johnson, K.V. Rajagopalan, and 0. Meyer, Arch. Biochem. Biophys. 283:542 (1990).
11. G. Borner, M. Karrasch, and R.K. Thauer, FEBS Lett. 290:31 (1991).
12. S. Mukund and M.W.W. Adams, J. Biol. Chern. 265:11508 (1990).
13. J.L. Johnson, K.V. Rajagopalan, S. Mukund, and M.W.W. Adams, J. Biol. Chern. 268:4848 (1993).
14. M.M. Wuebbens and K.V. Rajagopalan, J. Bioi. Chern. (1993), in press.
15. D.M. Pitterle and K.V. Rajagopalan, J. Bioi. Chern. (1993), in press.
16. D.M. Pitterle, J.L. Johnson, and K.V. Rajagopalan, J. Bioi. Chern. (1993), in press.
17. T. Nohno, Y. Kasai, and T. Saito, J. Bacterial. 170:4097 (1988).
18. V. Stewart, Microbial. Rev. 52:190 (1988).
19. J.L. Johnson, L.W. lndermaur, and K.V. Rajagopalan, J. Biol. Chern. 266:12140 (1991).
20. M.J. Barber and P.J. Neame, J. Bioi. Chern. 265:20912 (1990).
21. P.J. Neame and M.J. Barber, J. Biol. Chern. 264:20894 (1989).
362
STUDIES ON THE MOLYBDENUM COACTOR. SYNTHESIS OF
(±)-FORM B (DEPHOSPHO)
HN:.rN~X
H2N,h.N N~sYoPo3-
0H
Form B, X=H
Urothione, X=SMe
Figure 1
The synthetic route which eventually proved successful is outlined in Figs. 3 and 4.
The chloromethyl substituent in the key pyrazine intermediate 1 was transformed into a
formyl group by the Krohnke method, which involves initial conversion to the pyridinium
salt 8, followed by condensation with 4-dimethylaminonitrosobenzene in the presence of
excess potassium carbonate to give a nitrone (9) which is then hydrolyzed to 10 at 0 °C with
364
NC'r!N~X
N''ll N~ Cl
+ RCHO
H2
1, X= Cl 3, R = CH 2 CH3
oxo
2, X = PPh3+ Cl" 4,R=-r'.
thiourea !
DDQ
NC)N:('C I
pyridine
Figure 2
NC
)
N
:c+N~ II
D
H2N N Cl (98%) H2N N'" Cl Cl-
1 8
K2 co, j ON-o-NM e 2
ONMe,
6 N HCI
I N~
NC)NXCH O NC
"
H 2NlN~ 6'
N
H2N N Cl 0 oc Cl
10 9
Figure 3
365
HCl. Condensation of this Q-chloroaldehyde with 1-acetoxy-3-mercapto-2-propanone in the
presence of triethylamine led directly to the fused thieno[2,3-.h]pyrazine 11, which now
contains the elements of the proposed Form B sidechain correctly positioned on the fused
(aromatic) thiophene ring. Conversion of this acetoxyketone to the glycol 12 was
accomplished with sodium borohydride in a mixture of ethanol and THF; the basic reaction
conditions proved sufficient for removal of the acetoxy grouping as well. Protection of this
diol as its acetonide 13 was then readily accomplished with 2,2-dimethoxypropane and p_-
toluenesulfonic acid in refluxing benzene.
NC~J(~
Et3N
10 + HslfoAc
I ~ I
0 H2N N S OAc
11 0
MeO OMe
NaBH 1 4
)(.
NC:(~
I ~ I NC)(~
. -: I
H2N N S 0 p-TsOH H2N N S OH
13
guanidine ! 0~ 4A
12
OH
H2N,4N
N:S:N~
I ~
N
~
S
I
0
1 N NaOH
I!.
JcN
H,NAN N~0
HN "'
14 0~ 15 0~
(±)-Form B (dephospho)
Figure 4
The remainder of the synthesis was straightforward. Ring closure with guanidine in
methanol yielded 14 in excellent yield. The 4-amino group on the pyrimidine ring was
hydrolyzed with 1 N sodium hydroxide to give a homogeneous solution of the resulting
thienopterin 15 as its mono-sodium salt. Final removal of the acetonide protecting group
with aqueous acetic acid then provided (±)-Form B (dephospho), which was identical in
every respect except optical rotation with an authentic sample of Form B (dephospho)
obtained by degradation of Moco-containing molybdoenzymes. 1
366
References
1. K. V. Rajagopalan, Abstr. 204th National ACS Meeting, Washington, D.C. August
(1992), Inorg. Chern.# 173.
2. J. L. Johnson, K. V. Rajagopalan, and 0. Meyer, Arch. Biochem. Biophys. 283:542
(1990).
3. J. L. Johnson, N. R. Bastian, and K. V. Rajagopalan, Proc. Nat!. Acad. Sci. U.S A.
87:3190 (1990).
4. G. N. George, R. C. Prince, S. Mukund, and M. W. W. Adams, J. Am. Chern. Soc.
114:3521 (1992).
5. J. L. Johnson, B. E. Hainline, K. V. Rajagopalan, and B. H. Arison, J. Bioi. Chern.
259:5414 (1984).
6. E. C. Taylor, P. S. Ray, I. S. Darwish, J. L. Johnson, and K. V. Rajagopalan, J. Am.
Chern. Soc. 111:7664 (1989).
7. K. V. Rajagopalan, Biochem. Soc. Trans. 13:401 (1985).
8. E. C. Taylor and L.A. Reiter, J. Am. Chern. Soc. 111:285 (1989).
9. E. C. Taylor and P. S. Ray, J. Org. Chern. 52:3997 (1987).
10. E. C. Taylor and A. L. Sabb, J. Org. Chern. 53:5839 (1988).
11. A brief report of an alternate approach to Form B (dephospho) from 7-acetylthieno[3,2-
gJpterin has appeared: K. Ushio, M. Ishizuka, M. Kogushi, S. Fukui, and T. Toraya,
Biochem. Biophys. Res. Commun. 135:256 (1986). Desulfurization of urothione as a route to
Form B has also been reported, although this procedure is neither of synthetic significance,
nor an acceptable proof of structure; see Ref. 5 and M. Goto, A. Sakurai, K. Ohta, and H.
Yamakami, J. Biochem. (Tokyo) 65:611 (1969).
367
MOLYBDENUM-PTERIN COMPLEXES: A FUNCTIONAL AND STRUC-
TURAL MODEL FOR THE BINDING SITE IN THE ENZYME DIMETHYL
SULFOXIDE REDUCTASE
Berthold Fischer 1 , Helmut Schmalle1 , Erich Dubler 1 , Max Viscontini 2
INTRODUCTION
RESULTS
The first coordination sphere around the molybdenum atom in 1 is identical with
that in 2; only in the second coordination sphere of 1 a weak interaction in solution
between a Mo-coordinated chlorine atom and an OH-group from the BHTsidechain can
be discussed. But the properties of the two complexes are quite different.
The complex Mo0Ch(H+-q-PH 2 ) (2) is able to reduce the substrate dimethyl sulfoxide
[DMSO] to dimethyl sulfide [DMS] under very mild conditions, as can be shown by
13 C- NMR and mass spectrometry. In figure 3 a the spectrum displays the expected six
13 C-NMR signals of MoOCh(H+ -q-PH 2 ) (2) which are appearing in practically exact
the same range as in Mo0Cl 3 (H+-q-BH 2 ) (1). In contrast to 1, during seven hours there
is almost no change in the spectrum of 2 besides a very small amount of PH 4 formed.
Then the signals of deuterated DMS and of fully oxidized pterin begin to rise and after
about 20 h the spectrum in figure 3 b is obtained.
Control experiments with the pure substances PH 4 , q-PH 2 and Mo(IV)Cl 4 in DMSO in
no case yielded DMS. The deuterated DMS was additionally identified by mass spec-
trome_try. A quantitative determination of the produced DMS revealed a 1:2 ratio of 2 :
DMS. This means that not only the oxidation of the quinonoid dihydropterin to pterin
370
f ..
uJ
C4 C 2
. .L
j I
C8a
..
C4a
.l •• ; . a
t '' I
.. ,
d
C6 I
DMS
b
has caused the reduction of DMSO to DMS, but also the oxidation of Mo(IV) to
Mo(VI). In natural enzyme systems involving quinonoid dihydropterins, these will nor-
mally not be oxidized to pterins but reduced again to tetrahydropterins by the enzyme
dihydropteridine reductase. The effective electron transfer will be carried out by t he
Mo(IV)/Mo(VI) shuttle. On the basis of these two structures and supported by spec-
troscopical data, we propose a participation of the pterin nucleus in the enzyme reaction
of molybdenum dependent oxidoreductases and a new structure of t he Molybdenum Co-
factor in its reduced form (Figure 4).
~ ~o
-
/I
- Mo - - S
"c-CHOH
I! \
)C's
0 N
HN: x
I
CH2
H~N/ ~
2-
N OP0 3
H
X = H, CH 3 , PROTEIN
Figure 4 . Proposal of an extendend Molybdenum Cofactor in its reduced form.
371
In a further experiment we tried to "regenerate" the enzyme model, a crucial de-
mand for a functional model. In figure 5 are displayed in addition to the 13 C-NMR
spectra of PH 4 a and Mo0Cb(H+-q-PH 2 ) (2) b the spectrum of fully oxidized complex
2 after 14 days c. This spectrum exhibits only the six signals of the fully oxidized pterin
and presumably contains Mo(VI). After addition of PH 4 under argon, no PH4 signals
could be detected but only the "regenerated" complex 2 additionally to the still present
pterin signals d.
l
C 4a
Ill
PH~ a
jL_
,M
.oHL
MoOCb (W q- P1!2)
l!
C4a
C6
·~ I
• IIIII • • lllf
'
' '
2 week.~ later
200
rulditiou of PH,
The crystallographic and all other experimental data will be published in Helvetica
Chimica Acta.
REFERENCES
1. "Molybdenum Enzymes" , T.G . Spiro, ed., J . Wiley, New York, Met. Ions Bioi. 7 (1985).
2. N.R. Bastian, C.J. Kay, M.J. Barber, and K.V. Rajagopalan, J. Bioi. Chem. 266:45 (1991).
3. J.L. Johnson, B.E. Hainline, and K.V. Rajagopalan, J. Bioi. Chem. 255:1783 (1980) .
4. B. Fischer, J. Strahle, and M. Viscontini Helv. Chim. Acta 74:1544 (1991).
372
HUMAN MOLYBDENUM COFACTOR DEFICIENCY
1Department of Biochemistry
Duke University Medical Center
Durham, NC 27710
2University Children's Hospital
Het Wilhelmina Kinderziekenhuis
Utrecht, The Netherlands
INTRODUCTION
The molybdenum cofactor is required in animals for the activities of sulfite oxidase,
xanthine dehydrogenase and aldehyde oxidase, and the metabolic pathways involving these
enzymes are disturbed in patients with molybdenum cofactor deficiency. Sulfite oxidase
functions in the degradative pathway of sulfur amino acids as indicated in Figure 1. In the
absence of sulfite oxidase activity, patients accumulate and excrete elevated levels of sulfite,
thiosulfate, S-sulfocysteine and taurine. The absence of xanthine dehydrogenase leads to an
increase in xanthine and hypoxanthine with decreased uric acid levels as in classic
xanthinuria. The consequences of the absence of aldehyde oxidase are less well-defined,
although the enzyme is known to catalyze the hydroxylation of a variety of heterocyclic
substrates and may function as a part of the body's general detoxification system.
Of the several metabolic blocks imposed by the absence of these molybdoenzyme
activities, the one responsible for the severe clinical ramifications appears to be that resulting
from a deficiency in sulfite oxidase. At least twelve cases of isolated deficiency of sulfite
oxidase have been identified, with clinical symptoms, metabolite patterns (other than
oxypurine profiles), and neuropathology all very similar to those observed in molybdenum
cofactor deficiency. 2 In addition, the recent identification of two classes of xanthinuric
patients, those with isolated xanthinuria and those with a combined deficiency of xanthine
dehydrogenase and aldehyde oxidase, has revealed that even a combined deficiency of the
latter two enzymes is a benign clinical syndrome with none of the devastating sequelae
associated with sulfite oxidase or molybdenum cofactor deficiencies. 3
374
coo- coo-
COO- Aminotransferase + I + I
I .___ H3N-CH H3N-CH
O=C I I
CH 2 CH 2
I I
CH 2 I -
SH S203
I
SH
1
CYSTEINE S-8ULFOCYSTEINE
!
B-MERCAPTOPYRUVATE
02 Cysteine Dioxygenase
Transsulfurase
coo- coo-
l + I +
H2S + O=C H3N-CH C02 H N-CH H3N -CH 2
I I 3 I 2
I
I
CH 3 CH 2 ~ CH 2 - CH 2
I - I - I -
PYRUVATE so2 so2 so3
s2o3=
!
CYSTEINE SULFINATE HYPOTAURINE TAURINE
THIOSULFATE
Aminotransferase
coo-
l
O=C
I
CH 2
I -
so2
B-SULFINYL PYRUVATE
f'- PYRUVATE
!
so3 =
Sulfite Oxidase
so4=
Figure 1. Pathway of degradation of sulfur amino acids showing involvement of sulfite oxidase.
Metabolites that are elevated in molybdenum cofactor deficiency are indicated in bold type.
Structural studies of the molybdenum cofactor and its stable degradation products have
shown that it consists of the metal ligated to a unique pterin species termed molybdopterin
(Figure 2). 4 Although the molybdenum cofactor bound to molybdoenzymes is extremely
stable within its protective environment, it decays rapidly upon release, first by metal
dissociation to molybdopterin, and then to numerous nonfunctional pterin degradation
products. The instability of the free cofactor precludes its use as a therapeutic agent for
molybdenum cofactor deficient patients and suggests that a rational approach to therapy can
evolve only after gaining a more thorough understanding of cofactor biosynthesis and the
specific defects in cofactor deficient patients.
The first indication that molybdopterin biosynthesis in man proceeds by a multistep
pathway and that cofactor deficient patients segregate into groups with defects at different
enzymatic steps came from fibroblast complementation studies. 5 Co-culture of binary
combinations of cells from various patients produced active molybdenum cofactor, as
indicated by the presence of sulfite oxidase activity. Complementation occurred with or
375
without heterokaryon formation, suggesting that a diffusible intermediate produced by one
cell line was being taken up and activated to molybdopterin by the complementing cell line.
Experiments using conditioned medium from which the donor cells had been physically
removed further established that cells from group B patients were the source of the diffusible
material which was utilized by cells from group A patients.
An evaluation of the levels of molybdoenzymes and molybdenum cofactor in cultured
fibroblasts indicated that characterization of the diffusible intermediate produced by group B
cells and of the processes in group A cells required to activate it to molybdopterin would be
very difficult to accomplish. An alternative and very successful approach was to turn to
related studies, carried out in this laboratory, of molybdopterin biosynthesis in micro-
organisms.4 The identification of a late precursor of molybdopterin, termed precursor Z
(Figure 2), and characterization of a protein that converts precursor Z to molybdopterin,
termed converting factor, in molybdopterin mutants of E. coli made it possible to assay for
their presence in group A and group B cofactor deficient patients. 5 As indicated in Figure 2,
these studies revealed that a molybdopterin precursor indistinguishable from the microbial
precursor Z does accumulate in group B patients. Precursor Z was identified in urine samples
from several patients using a functional assay that measured the generation of molybdopterin
in the presence of exogenously added E. coli converting factor and by quantitation of a
fluorescent degradation product of precursor Z produced by iodine oxidation. Also
summarized in Figure 2 is the observation that tissues from group A patients contain a
converting factor activity that recognizes exogenously added precursor Z, producing
molybdopterin. This activity was initially identified in fibroblasts from group A patients, and
has more recently been partially purified and characterized from liver tissue.
PRECURSORZ
0
Converting Factor
H
l Defective in E. coli ch/A4 and ch/A5 mutants
and in group B molybdenum cofactor deficient patients
HNAyNrr=r-CHOH-CH20P03=
H2N
~ N. A)
N
SH SH
MOLYBDOPTERIN
0 l
HN~NT-t=\-CHOH
:
CH,OPO,=
376
DIAGNOSIS: QUANTITATION OF PTERIN METABOLITES
377
80 20 Ill
g
G)
60 15
G)
::J u
~ 40 f 10
0
:I
20 u:: 5
5 10 15 20
60r-------------------~
IV
40
::J
oct
E
20
5
Elution Time {min) Elution Time {min)
Figure 4. HPLC elution chromatograms showing quantitation of urothione (13.5 min peak) from a control
(I) and molybdenum cofactor deficient patient em
and of compound Z (6 min peak) from a group B (lll) and
group A (IV) patient. Urothione was chromatographed on a C-18 column in 15% methanol with absorbance
monitored at 380 nm. Compound Z was chromatographed on a C-18 column in 5% methanol, pH 2.
CONCLUSIONS
The biochemical studies summarized above indicate that the late steps in molybdopterin
biosynthesis are the same in man and microorganisms. Indeed, the identification of functional
converting factor in group A patients, who are unable to synthesize the molybdenum cofactor
due to a block early in the pathway, raises the possibility that exogenously supplied precursor
Z could be of some therapeutic value to these patients. The increased stability of this pterin
relative to that of molybdopterin and the demonstrated ability of this cyclic phosphate
derivative to pass through the cell membrane in vitro strengthen the hypothesis. However,
additional study will be required to establish more effective stabilization conditions, to further
evaluate the precise isomeric configuration of the natural product, and to establish a synthetic
route for production of the necessary quantities of pure material.
Further investigations into early steps in the pathway will be needed to establish whether
group A patients exhibit defects at the same or at different enzymatic steps and whether the
cofactor pterin is synthesized de novo or elaborated from a preformed dietary intermediate.
REFERENCES
1. J.L. Johnson, W.R. Wand, K.V. &yagopalan, M. Duran, F.A. Beemer, and S.K. Wadman, Proc. Natl.
Acad. Sci. U. S. A. 77:3715 (1980).
2. J.L. Johnson and S.K. Wadman, in: "The Metabolic Basis of Inherited Disease," 6th edition, C.R. Scriver,
A.L. Baudet, W.S. Sly, and D. Valle, eds., McGraw-Hill Book Co., New York (1989).
3. S. Reiter, H.A. Simmonds, N. ZOllner, S.L. Braun, and M. Knedel, Clin. Chirn. Acta 187:221 (1990).
4. K.V. Rajagopa1an and J.L. Johnson, J. Bioi. Chern. 267:10199 (1992).
5. J.L. Johnson, M.M. Wuebbens, R. Mandell, and V.E. Shih, J. Clin. Invest. 83:897 (1989).
6. V.E. Shih, I.F. Abroms, J.L. Johnson, M. Carney, R. Mandell, R.M. Robb, J.P. Cloherty, and K.V.
Rajagopalan, New Engl. J. Med. 297:1022 (1977).
7. J.L. Johnson and K.V. Rajagopalan, Proc. Natl. Acad. Sci. U. S. A. 79:6856 (1982).
8. J.L. Johnson, M.M. Wuebbens, and K.V. Rajagopalan, 1. Biol. Chern. 264:13440 (1989).
9. J.L. Johnson, K.V. Rajagopalan, J.T. Lanman, R.B.H. Schutgens, A.H. van Gennip, P. Sorensen, and
D.A. Applegarth, J. Inherited Metab. Dis. 14:932 (1991).
378
MOLYBDOPTERIN BIOSYNTHESIS IN MAN.
PROPERTIES OF THE CONVERTING FACTOR IN
LIVER TISSUE FROM A MOLYBDENUM
COFACTOR DEFICIENT PATIENT
Department of Biochemistry
Duke University Medical Center
Durham, NC 27710
INTRODUCTION
l .~
H2N N
~N
N
H
m ° OH
'-p/
o.p; 'o-
Converting Factor
defective in group B patients
H
2
o H
HN~Nry=y-CHOH-CH,OPo,=
N~ ..N)l ~ ) SH SH
MOL YBDOPTERIN
PRECURSOR Z /
not made in group A patients
0 H
H(XN)jC=\-CHOH-CH20PO,=
H2N N N S"-. /S
H .1' Mo'\. MOLYBDENUM COFACTOR
0 0
Figure 1. Structures of precursor Z, molybdopterin and the molybdenum cofactor. The reaction catalyzed
by the converting factor is indicated.
METHODS
Liver tissue was obtained post mortem from a patient with molybdenum cofactor
deficiency and stored at -70 °C. The classification of this patient as group A was based on the
absence of urothione, the metabolic degradation product of molybdopterin,4 and precursor Z
in the urine.
Converting factor was assayed as outlined in Figure 2. The Neurospora crassa nit-1
mutant was grown and harvested as described previously.5 A crude extract of the mycelia,
prepared by homogenizing 1 g in 2 ml nit-1 buffer (1 00 mM potassium phosphate, pH 7.4,
with 5 mM EDTA and 1 mM dithiothreitol) with 20 J.ll of 100 mM phenylmethylsulfonyl
fluoride, was centrifuged for 5 min at 14,000 rpm using an Eppendorf 5415 centrifuge. The
supernatant fraction served as the source of precursor Z and of apo nitrate reductase.
Incubation mixtures of 100 J.ll total volume were prepared using 10 J.ll of 0.5 M sodium
molybdate, 30 J.ll nit-1 extract, and up to 60 J.ll of a converting factor source. After incubation
at 4 oc for 3 hr, the substrates for nitrate reductase (NADPH, FAD, and nitrate) were added
and the amount of nitrite generated in a 30 min room temperature incubation was quantitated
by a colorimetric procedure. 5 The assay was shown to be linear with respect to the amount of
liver converting factor sample added. In addition, the nit-1 reconstituting activity in the liver
tissue sample was shown to be dependent on the presence of precursor Z in the nit-llow
molecular weight fraction, demonstrating that the activity observed was due to converting
factor and not attributable to low levels of residual molybdopterin in the liver extract.
nit-1 EXTRACT:
PrecursorZ
Apo Nitrate Reductase
Figure 2. Assay of converting factor activity. The Neurospora crassa nit-1 extract, containing precursor Z
and apo nitrate reductase, is incubated with a source of converting factor. During this incubation period,
precursor Z is converted to molybdopterin, and the molybdopterin, in tum, reconstitutes the apo nitrate
reductase. A subsequent incubation in the presence of nitrate reductase substrates generates nitrite which is
quantitated by a colorimetric assay.
380
RESULTS AND DISCUSSION
Liver tissue (2.6 g) was homogenized in 5 ml of nit- I buffer and 45 ml H20 using a
motor driven ground glass homogenizer. The homogenate was centrifuged at 30,000 g for 20
min, and the supernatant fraction was treated with 43 g ammonium sulfate per 100 ml. After
stirring on ice for 10 min, the mixture was centrifuged as before, and the pellet was
resuspended in 50 mM potassium phosphate, pH 7.4, with 1 mM dithiothreitol. The sample
was freed of excess ammonium sulfate by passage through a calibrated column of Sephadex
G-25 equilibrated with the same buffer and then applied to an 8 ml column of DEAE-
cellulose (Whatman DE52) in the same buffer. The activity was eluted from the column using
the phosphate, dithiothreitol buffer with 0.15 M NaCl (see Figure 3).
Gl 4
u
:; 3
J:l
0
Ill
2
J:l
<
2 4 6 8 10 12 14
Fraction
Figure 3. Elution profile of human liver converting factor chromatographed on
DEAE-cellulose. Fractions of 6 ml were collected and monitored for activity using a
60 f!l aliquot in the nit-1 assay and measuring the nitrite complex color formation at
540 mn (e) and for protein at 280 mn (o).
The material in fraction 6 from the DEAE-cellulose column was concentrated 3-fold
using an Amicon Centricon 10 unit, and 1 ml was applied to a Superose 12 gel filtration
column (Pharmacia) equilibrated in the phosphate, dithiothreitol buffer. The column was
eluted with the same buffer, and fractions of 1 ml were collected and assayed for converting
factor activity. The elution profile is shown in Figure 4 and compared to an equivalent profile
obtained using converting factor partially purified from the E. coli chlAJ mutant. In contrast
to the E. coli converting factor activity, which eluted as a sharp, symmetrical peak, the liver
converting factor profile was broad with a distinct trailing shoulder, suggestive of a
dimer/monomer equilibrium. Estimation of the apparent molecular masses of the two liver
converting factor forms using molecular mass standards (Figure 4) suggests a molecular
mass of 52 kDa for the dimer and 26 kDa for the monomer. The E. coli converting factor
runs with an apparent molecular mass of 42,000-43,000 as reported earlier.6 A second run of
human liver converting factor on Superose 12 using a slightly more dilute sample confirmed
the apparent dimer/monomer equilibrium with a somewhat more defined peak of the
monomeric species, as expected.
Earlier studies on the E. coli converting factor have established that it exists as a loosely
associated complex of 16 kDa and 10 kDa subunits.? The subunit stoichiometry of the
complex as present during gel filtration chromatography has not been established. However,
the apparent monomeric molecular weight of the human liver converting factor at 26 kDa is
interesting in that it could reflect the sum of the masses of the two E. coli subunits.
381
E II)
100
1: II)
0 1.0 ftJ
"'
10
_(ig....
::iio
Gl
CJ 10
1: 0.5 ~ )(
ftJ 6.5 kDa
...
Gl
.a 0
0 :iii
II)
.a 0.0 1
< 15 20 25 30 35 40 1.3 1 .5 1 .7 1.9
Fract io n Ve I Vo
Figure 4. Left: Elution profiles of human liver (e) and E. coli ch!Al (o) converting factors
chromatographed on Superose 12. Right: Estimation of the molecular mass of the human liver converting
factor dimeric and monomeric forms by gel filtration using a calibrated column of Superose 12.
The converting factor from E. coli has been shown to be sensitive to sulfhydryl reagents
including N-ethylmaleimide, N-bromobimane, and iodoacetamide.6 The human liver enzyme
was inactivated by incubation with N-ethylmaleimide as shown in Figure 5. Incubation with
10 mM reagent for 15 min led to 93% inhibition of activity. The human liver enzyme was
also sensitive to iodoacetamide treatment (data not shown). These results provide strong
evidence for the role of a reactive sulfur on the human liver converting factor in the formation
of the molybdopterin dithiolene function and support the conclusion that the converting factor
protein serves as the direct sulfur donor for molybdopterin biosynthesis.
E 1.2
1: 0 10!11
0 • 20).11
"'
10 0.8 l!lil 40!11
Gl
(.1
1:
ftJ 0.4
.a
0
II)
.a 0.0
< Buffer NEM+DTT NEM/DTT
REFERENC ES
1. J .L. Johnson and S.K. Wadman, in: "The Metabolic Basis of Inherited Disease," 6th edition, C.R. Scriver,
A.L. Baudet, W.S. Sly, and D. Valle, eds., McGraw-Hill Book Co., New York (1989).
2. J.L. Johnson, M.M. Wuebbens, R. Mandell, and V.E. Shih, J. Clin. Invest. 83:897 (1989).
3. K.V. Rajagopalan and J.L. Johnson, J. Bioi. Chern. 267:10199 (1992).
4. J.L. Johnson and K.V. Rajagopalan, Proc. Nat/. Acad. Sci. U. S. A. 79:6856 (1982).
5. M.E. Johnson and K.V. Rajagopalan, J. Bacterial. 169:117 (1987).
6. M.E. Johnson and K.V. Rajagopalan, J. Bacterial. 169:110 (1987).
7. D.M. Pitterle and K.V. Rajagopalan, J. Bacterial. 171:3373 (1989).
382
CLONING OF A EUKARYOTIC MOLYBDENUM
COFACTOR GENE
Department of Biology
Emory University
Atlanta, GA 30322
INTRODUCTION
Molybdenum requiring enzymes have been identified in virtually every species. All
molybdoenzymes, with the single exception of nitrogenase, require a molybdopterin cofactor
for catalytic activity. Mutations leading to a simultaneous loss of all molybdoenzyme
activities have been identified in organisms including, E.coli (1), higher plants such as
Nicotiana and Arabidopsis (2,3), as well as Drosophila (4,5), and humans (6). Such
mutations identify genes involved in the synthesis and/or activiation of the cofactor. Much
of the current interest in MoCF genes stems from the crucial roles of the molybdoenzymes.
One example is nitrate reductase, which is the key enzyme in nitrogen assimilation by plants.
At least 90% of the total nitrogen assimilated by plants is from the mineral nitrogen, mostly in
the form of nitrate (7). A mitochondrial molybdoenzyme, sulfite oxidase (SO) catalyzes the
terminal step in the oxidative degradation of sulfur containing amino acids and is
responsible for the detoxification of sulfite (8). Complete lack of sulfite oxidase activity
leads to a buildup of toxic sulfites which (perhaps combined with a deficiency in sulphates)
results in a severely debilitating human genetic defect involving abnormal neurological
development.
Although cofactor mutations have been identified in many eukaryotic organisms, there
is no information about their molecular structure or patterns of expression. The major
difficulty in studying the eukaryotic cofactor genes has been the lack of a reasonable strategy
for obtaining molecular clones. However, Drosophila provides an excellent model to
investigate the structure and function of the eukaryotic genes. There are four
molybdoenzymes activities in the fly: xanthine dehydrogenase, aldehyde oxidase, pyridoxal
oxidase, and sulfite oxidase (7). In Drosophila, three loci, maroon-like, low xanthine
dehydrogenase, and cinnamon have been identified as cofactor genes because these mutants
display a loss of two or more of the molybdoenzyme activities. The present study focuses on
the structure and pattern of expression of the cinnamon (cin) gene. Evidence that portions of
the cin gene may be conserved in eukaryotes will also be discussed.
cin n:l
Distal Proximal
R R
I I
R
I
D/05•22•1 ~
I I I I I I I I
s H B s B H BH s B = llamiD
H = Hind III
R = EcoRI
••• TG 11··· S=SaJI
cDNAs
cM19B cM3SA cM17A cM2B
In order to focus on a possible cin coding region, EcoR 1 restriction fragments from MES-1
were used to select embryonic eDNA clones. The approximate location of 4 of these clones
based upon sequence data is depicted on the diagram. One mutant, cinill, carries a 400 bp
insertion as indicated. A deletion Df(l) 05-22-1, which does not complement cin, has its
proximal breakpoint within the cloned region, in the vicinity of the ciniTI insertion.
Therefore the illustrated genomic region is in or very near to cin.
When the cM17a eDNA is used as a probe on northern blots, the mutant ciniTl shows
a message approximately 400 bp larger than the 2.5 KB wild type mRNA. Another
mutant, cinC44, shows an apparent lack of that 2.5 KB message. These mutants thus served
to demonstrate that cM17a must represent at least part of the cin coding sequence.
To obtain a better understanding of the cin expression pattern, the cM17a eDNA was used to
probe a developmental northern blot of wild type mRNA. The results show a
developmentally regulated pattern of transcription for the 2.5 KB message, where
transcriptional activity is highest early in development. Transcription decreases in the later
embryonic stages and remains constant through the larval and pupal stages. There is
evidence of an additional, slightly smaller maternal message as expected for a gene which
functions during the ftrst few hours of embryonic development.
The cM17a eDNA was sequenced in order to obtain some clues concerning structural
features and possible function from its predicted amino acid sequence. The GenBank
database revealed homology with chlE, one of the E. coli MoCF genes (11 ). The region of
interest includes 117 contiguous residues. The homology is found in two regions.
Cin cM17a
.. ...... ...
RIHCGRVNIKPGKPMTFASRKDKYFFGLPGNPVSAFVTFH
.... .... . ...
.. ...........
E. coli chlE EIAFWKLAIKPGKPFA FGKLSNSWFCGLPGNPVSATLTF-
384
Region 1 is 77 amino acids, 24 identities and 19 conservative substitutions, totaling 55%
homology. Region 2 is 40 amino acids containing 20 identities and 6 conservative
substitutions, totaling 65% homology. Region 1 has two significantly hydrophobic regions,
while region 2 is strongly hydrophilic. Region 2 has 4 proline residues which are frequently
found in flexible regions and are important in stablizing the 3D conformation of proteins
(12). Such features lead us to speculate that this portion of the peptide may represent a
conserved binding site, possibly for a precursor of the molybdenum cofactor. Although the
homology does not necessarily imply that both genes carry out the same function, their
similar biochemical phenotype and lack of MoCF activity suggests that this may prove to be
the case (13).
Interestingly, cM17a is also homologous to a rat protein, gephyrin, which associates
with the mammalian inhibitory glycinergic receptor (GlyR) and binds tubulin (14). Gephyrin
apparently acts to cluster and anchor glycinergic receptors to the postsynaptic membrane.
The carboxy terminal region of homology between cin and gephyrin involves the same
residues as does the homology between cin and chlE.
Cin cM17a
Gephyrin
........... ..... .. .... .. .. ... ..... .. .... .. ..... ....... .. .. .......
VICSGGVSMGDKDFVKSVLE---DLQFRIHCGRVN IKPGKPMTFASRK-------DKYFFGLPGNPVSAFVTFH LFA LPAIR
This region is 77 amino acids, 44 identities and 9 conservative substitutions, totaling 68%
homology. The underlined region is a putative membrane associated helix predicted by the
algorithm of Eisenberg et al (15). In the amino terminal region there is a second area of
homology which does not include homologies previously seen with the prokaryotic chlE,
suggesting that this could be a region important for the eukaryotic function.
Gephyrin
... .. . . . . . .. .... ................. .. .. . .
Cin cM17a ~~~KDI;QQ~~~~T!'~!?!'~~:::~~!RQu:'"!'<?QLSMYITI.E
This region is 111 amino acids, 61 identities and 13 conservative substitutions, totaling 66%
homology. There are 6 conserved proline residues in this region, and it is possible that the
homology represents a structural conservation rather than a functional one.
Since the MoCF structure appears to be identical among eukaryotes it is reasonable to
expect that portions of those enzymes which bind the MoCF might also be conserved
(16,17). In order to explore this idea, the cM17a eDNA was used to probe southern blots
containing DNA from a variety of organisms (Figure 1). This "zooblot" analysis reveals
conservation at the DNA level in phylogenetically unrelated species such as yeast and
arabidopsis. This evidence, combined with the homology to chlE and gephyrin, suggests
that functionally important portions of the MoCF genes may be conserved. This indicates that
there may be future possibilities for using the information derivied from Drosophila to
understand the MoCF genes in other eukaryotic organisms.
385
23.1-
9.4-
6.6 -
4.4-
2.3 -
2.0 -
Figure 1: Southern blot probed with cM17a. The filter was washed under high stringency conditions, i.e.,
wash in 2xSSC, 0.1% SDS at room temperature for 15 minutes, followed with a wash in 0.1xSSC, 0.1%
SDS at 65 C for 45 minutes. Yeast DNA restricted with BamHl. All other DNA was cut with EcoRl.
Acknowledgements
This research was supported by NSF grant MCB 8916915.
References
1. Johnson ME and RAjagopalan KV (1987) J Bacterial 169:117-125.
2. Mendel RR and Muller SJ (1979) Mol Gen Genet 117: 145-153.
3. Brassksma FJ and Feenstra WJ (1982) Physiol Plant 54: 351-360.
4. Warner CK, and Finnerty V (1981) Mol Gen Genet 184: 92-96.
5. Bentley MM and Williamson JH (1979) Can J Genet Cytol21: 457-471.
6. Johnson JL and Wadman SK (1989) In: Inherited Basis of Metabolic Disease. Ed. JB
Stanbury and JB Wyngaarden. New York, McGraw/Hill.
7. Warner RL and Kleinhofs A. (1992) Physiol Plant 85:245-252.
8. Rajagopalan KV and Johnson JL (1992) J Bioi Chern 267: 10199-10202.
9. Lefevre G (1981) Genetics 99:461-480.
10. Fleming RJ, DeSimone SM and White K (1989) Mol Cel Bioi 9: 719-25.
11. Nohno T, Kasai Y, Saito T (1988) J Bact 170:4097-4102.
12. Branden C and Tooze J (1991) Introduction to Protein Structure. Garland Publishing
Co., NY.
13. Stivaletta LA, Warner CK, Langley Sand Finnery V (1988) Mol Gen Genet 213: 505-
512.
14. Prior P, Schmitt B, Grenningloh G, Pribilla I, Multhaup G, Beyreuther K, Maulet Y,
WemerP,LangoschD,KirschJandBetzH (1992) Neuron 8:1161-1170.
15. Eisenberg D, SchwarzE, Komaraomy M and Wall R (1984) J Mol Bioi 179: 125-142.
16. Nason A, Lee KY, PanS, Ketchum PA, Lamberti A and DeVries J (1971) PNAS 68:
3242-3246.
17. Johnson Jl, Bastian NR, Rajagopalan KV (1990) PNAS 87: 3190-3194.
386
DESIGN AND SYNTHESIS OF INHffiiTORS OF FOLATE-DEPENDENT
ENZYMES AS ANTITUMOR AGENTS
Edward C. Taylor
0
~OOH ~NHCHO
I
0
HN:J:~
I y"
NNH
ACONH-t-H
C~CH2COOHPO
~NH
FGAR
H2 N~N N) HO OH
H
Purines
Fig.l
The focus of my lecture today is not, however, the antitumor profile of DDATHF,
but rather some of the chemistry involved in its initial and subsequent syntheses, our
explorations of structure-activity relationships which have led to some fascinating new
heterocyclic chemistry, and the preparation, as a consquence of these SAR studies, of a
new and promising inhibitor of thymidylate synthase which is now in Phase I clinical
trials.
388
~OOH
oNH-f-H
CH2CH 2COOH
Fig. 2
Since much of our early synthetic work has already been summarized
elsewhere,7' 15 I will mention here only one of our much improved DDATHF
syntheses,16 since it will serve to introduce a methodology based on palladium chemistry
which has proven to be exceptionally versatile in solving a host of diverse synthetic
problems. Thus, the key feature in this new and much shorter synthesis of DDATHF
(Fig. 3) is a palladium-catalyzed C-C bond coupling reaction - a kind of modified "Heck"
reaction 17 - which we used to form both the C6-C9 bond and the C10-aryl bond. We
started with malondialdehyde tetramethylacetal, which was first hydrolyzed with HCl to
the dialdehyde, and then brominated to give bromomalondialdehyde, which was
condensed directly with 2,4-diamino-6(1H)-pyrimidinone. The resulting very insoluble
product was then pivaloylated. This was a critically important step, for the pivaloyl
protecting/acylating group confers remarkable solubility upon an otherwise almost totally
intractable, rock-like substance.l8 Palladium-catalyzed coupling of this 6-bromo-2-
pivaloyl-5-deazapterin with trimethylsilylacetylene was followed by a second palladium-
catalyzed coupling, this time with diethyl 4-iodobenzoylglutamate. The triple bond and
the pyridine ring were then reduced in a single step, and the protecting groups were
removed to give DDATHF. The subsequent resolution of DDATHF into its 6R- and 6S
diastereomers, and the selection of the former for clinical trials, have been fully described
elsewhere.11
We have now prepared and evaluated a great many analogs of DDATHF, with
variations in Rings A and B, in the bridge region joining the tetrahydro-5-deazapterin and
benzoyl moieties, and in the benzoyl aromatic ring itself. Today I have selected from
these many analogs only a few which, from the point of view of a synthetic organic
chemist and long-time pteridinologist, are of particular interest because of the synthetic
methodologies developed for their synthesis.
389
A New Synthesis of DDATHF
The Palladium-mediated C-C Coupling Approach
H,Nl)J
pivalic anhydride I
pyridine f
0
TMS-acetylene HN~ Br
PdC)z[Ph3Ph
Cui, then KF M~CCONH
h...NJl.)
N
0 _ ~OOEt
HN~c=cQ-coNH .. ~·H
h...Jl.) CH CH C00Et 2 1
Me 3CCONH N N
CH1CH1COOEt
390
the natural cofactor. We have outlined in Fig. 4 a synthesis of the 10-hydroxymethyl
analog of DDATHF, 19 and it is noteworthy because of the two Pd-
+
HC:CCH:z()THP
/
COOEt
ONH~H
CH2CH:zCOOEt
COOEt
ONH~H
CH2CH 2COOEt
COOH
ONH- ~ •H
CHzCHzCOOH
catalyzed C-C coupling reactions utilized in its preparation. Thus, the ubiquitous 6-
bromo-2-pivaloyl-5-deazapterin 18a was condensed with the tetrahydropyranyl-protected
derivative of propargyl alcohol, using palladium chloride/triethylamine/triphenyl-
391
phosphine/cuprous iodide in acetonitrile as solvent. Propargyl alcohol itself failed to
undergo this coupling reaction using a variety of palladium catalysts, bases and
phosphorus ligands. Reduction of the alkyne to the ill-alkene was carried out
satisfactorily with hydrogen in the presence of palladium/barium sulfate using freshly
distilled synthetic quinoline as the catalyst poison. These conditions were not our first
choice, but it turned out that other poisoned catalysts, normally used for the controlled
reduction of alkynes, were totally ineffective. The resulting cis-olefin was then coupled
with diethyl 4-iodobenzoylglutamate in the presence of palladium acetate, and the
coupled product was subjected to catalytic reduction, without significant allylic
hydrogenolysis, using platinum oxide as the catalyst and glacial acetic acid as the solvent.
Acidic removal of the THP protecting group and base removal of the pivaloyl and ester
groupings then gave 10-hydroxymethyl-DDATHF.
Although we have not pursued this compound any further, it is worth noting that
the mixture of four diastereomers produced in the above process was an extremely potent
cytotoxic agent, with an IC50 of 0.005 11g/ml. In earlier work we had prepared 10-
methyl-DDATHF, again as a mixture of four diastereomers, and although it was about
10-fold less reactive than the above 10-hydroxymethyl derivative, all of its cytotoxic
activity was apparently due to only one of the four diastereomers.20 This may also be the
case for 10-hydroxymethyl-DDATHF, which would make it the most active analog we
have thus far prepared. At this point, however, we have not attempted a separation of the
four diastereomers.
Homo-DDATHF, in which the bridge has been extended by one methylene group,
presented a different synthetic challenge. Our first synthesis of this analog, which proved
to be fully as active as DDATHF itself, is outlined in Fig. 5.21 We started with a
palladium-catalyzed C-C coupling between 1-butyn-4-ol and methyl4-bromobenzoate.
Reduction of the triple bond and pyridinium chlorochromate (PCC) oxidation of the
primary alcohol gave the 4-arylbutyraldehyde derivative shown. This was converted to
its Knoevenagel condensation product with malononitrile. In contrast to the starting
aldehyde, which could not be formylated under a wide range of reaction conditions, this
1,1-dicyanomethylene aldol product now possesses a much more acidic a-methylene
group, and can readily be formylated with triethyl orthoformate. Condensation of this
intriguing intermediate, which is in effect an activated malondialdehyde equivalent, with
2,4-diamino-6(1H)-pyrimidinone led directly and in excellent yield to the 5-deazapterin
derivative shown here. This ring-annulation product was then converted by a series of
standard operations to homo-DDATHF.
The course of this perhaps unexpectedly facile ring annulation deserves special
comment. A suggested mechanism is shown in Fig. 6. The concept involved is one
which we termed "carbonyl group activation". The first step is Michael addition by the
nucleophilic 5-position of the pyrimidine ring (as a primary enamine) to the
malondialdehyde equivalent, and it should be noted that replacement of -CH=O by
-CH=C(CN)z certainly enhances the electrophilic activity of the former aldehyde carbon.
Elimination of ethanol then leads to a substrate for another Michael addition, this time by
the pyrimidine-4-amino group to the a,P-unsaturated dinitrile. Once again, replacement
of -CH=O by a -CH=C(CN)z unit has facilitated the second Michael addition. Aroma-
tization then results from loss of malononitrile, which therefore, at least in principle,
could be viewed as a catalyst for this remarkably facile ring annulation process.
392
Synthesis of HomoDDATHF (HDDATHF)
Route 1
_
HO(CH2hC: CH + Br
-o--.:::
""""
C02Me
___...
HO(CH:i) 3C :c
- o - C 02Me
-'7
COOH
CONii• : .. H
CH2CH2COOH
HDDATHF
PhiUip M. Harrington
Fig.S
393
dimethyloxazoline and allyl bromide.22 This readily available intermediate was
subjected to acidic hydrolysis to reveal the corresponding benzoic acid, which was then
converted to the peptide with diethyl L-glutamate via its acid chloride, using
DMAP!Et3N. Carbon-carbon coupling with 6-bromo-2-pivaloyl-5-deazapterin, using (Q-
tolyl)3P, Pd(OAc)2, Cui and Et3N in acetonitrile, gave a mixture of cis- and trans-olefins
which was converted to homo-DDATHF by reduction and subsequent hydrolysis.23
COOEt
CONH. . ~•H
.f.
CH2CH2COOEt
COOH
CONH~H
~H2 CH~OOH
HDDATHF
394
Synthesis ofNor-DDATHF
0
)Jr
HN
~
I
MejXONH :o..N
o H},to
HN~
e~CONH~NJlNJ
H
0 + 0
HN~I
~--Jl __ ) Me~CONH
~~
HNj(ro_l ~ CON~H
~OOEt
Me3CCONH N N N N .& .:
H H CH2 CH2COOEt
0 t
HN~ COOEt
Me~CONH
~,.)l""'~
N N U-coN~H
.:
CH 2CH 2COOEt
t
Nor-DDATHF
Since the addition of a methylene group to the bridge region of DDATHF had not
altered its biochemical profile, what would be the consequence of removing a methylene
group? Fig. 8 outlines our synthesis of what we have termed "nor-DDATIIF".23 Once
again, the synthesis starts with 6-bromo-2-pivaloyl-5-deazapterin. Palladium-catalyzed
395
coupling with styrene led to the styryl derivative shown, which was subjected to
ozonolysis to give the corresponding 6-carboxaldehyde18a (our intermediate for an
earlier synthesis of 5-deaza-5,6,7,8-tetrahydrofolic acid, 5-DATHF18c). This compound
was converted in a single step to the novel exocyclic olefin shown here by treatment with
sodium cyanoborohydride in a 1: 1 mixture of acetic acid and ethanol. We assume that
this exocyclic olefin was formed through a reductive elimination process involving a
[3.3]-sigmatropic rearrangement of a presumed alkoxyborohydride intermediate.
Palladium-mediated coupling with diethyl 4-iodobenzoylglutamate gave the fully
aromatized nor-DDA THF precursor shown, and this was reduced and deprotected to give
our target compound. This modification in the DDA THF skeleton was disastrous for
biological activity, for this one-carbon bridged analog proved to be at least 4-5 fold less
potent than DDATHF, both in enzymatic inhibition and in whole-cell cytotoxicity.
As we have pointed out before, the asymmetric center at C-6 in DDATHF, which
had been introduced by catalytic reduction of the pyridine ring, posed a special problem
when DDATHF was initially synthesized and developed. The two diastereomers had to
be separated by a novel fractional crystallization process through a crystalline d-1 0-
camphorsulfonate diethyl ester salt intermediate.24 The disadvantages of this process are
obvious in that the resolution could be undertaken only at a late stage of the synthesis,
and it was also relatively inefficient. It therefore seemed attractive to try to bypass the
problems associated with the introduction of this C-6 chiral center by eliminating it
completely, and our initial approach was to delete either the 5- or the ?-methylene
grouping to give a series of what we have termed "open-chain" DDATHF analogs (see
Fig. 9).
"C-5 desmethylene"
COOH
CONH--+-H
=
CH2 CH 2COOH
"C-7 -desmethylene"
Fig. 9
396
earlier, gave the alkyne shown, and this was reduced, mesylated, and the latter derivative
then used to alkyl ethyl cyanoacetate. Condensation of this a-substituted cyanoacetate
with guanidine in DMF at room temperature resulted in formation of a 5-substituted
pyrimidine which could be easily converted on to our "open-chain" DDATHF analog.
This intriguing simplified DDATHF analog, which is clearly much less rigid than
DDATHF itself, was a surprisingly good inhibitor of GAR FTase as shown by reversal
studies, although it was some 8-fold less inhibitory against CCRF-CEM leukemic cells
than DDATHF. Its inhibitory activity against GAR FTase, taken together with previous
work which showed that replacement of the -NH grouping of DDATHF with a methylene
group resulted in a 100-fold increase in Ki, certainly emphasizes the importance of a
hydrogen bond between the N-8 hydrogen ofDDATHF, or the almost equivalent amino
group in the 4-position of this "open-chain" analog, with an active site residue on GAR
FTase.
COOH
CON~H
i.
CH2CH2COOH
Phillip M. Harrington
Fig.lO
397
thus stand in remarkable contrast to the highly active isomeric 7-desmethylene "open-
chain" series.
Although we did not realize it at the time, we had reached an unexpected turning
point in our investigations of potential antifolates. It has already been emphasized that
the penultimate step in the majority of our DDATHF syntheses involved reduction of the
aromatic pyridine ring of our synthetic intermediates. This ring reduction results in the
formation of a mixture of two diastereomers which differ in chirality at C-6. Both the 6-S
and 6-R diastereomers (the latter was selected for clinical trial) were potent and nearly
equiactive inhibitors of de novo purine biosynthesis, 12 althou~h they possessed slightly
different activities towards different neoplasms in vivo. 0 It was, of course, of
considerable interest that the above enantiomerically homogeneous "open-chain"
DDATHF analogs, in which the C-6 chiral center had been removed by excision of the C-
7 methylene group, were almost as active as DDATHF itself in vitro. Since studies of
model compounds had previously revealed that an -NH grouping attached to the
pyrimidine C-4 position was mandatory for activity against GAR FTase, 11 we were
particularly interested in examining analogs possessing the following characteristics: (1) a
left-hand heterocyclic moiety which would simulate the rigidity of the bicyclic 6-6 ring
system of DDATHF, (2) the hydrogen-bonding -NH grouping corresponding to the
pyrimidine 4-amino group or the 8-NH of DDATHF, but (3) no chiral center at the
position joining the A/B rings to the ethano bridge. Since the DDATHF precursor with
an aromatic pyridine ring was completely inactive as a cytotoxic agent (it does not
possess an NH grouping at position 8), we were left with consideration of possible 6-5
ring systems.
Results obtained from our first choice of a purine ring system were not
encouraging. The guanine analog ofDDATHF was prepared31 as shown in Fig. 11 from
dimethyl 4-ethynylbenzoylglutamate (an intermediate utilized by us earlier in one of our
DDATHF syntheses16), and 2-pivaloyl-8-bromoguanine, which was available by
bromination of 2-pivaloylguanine with bromine in acetic acid. Although only
dimerization of the acetylene was observed under the usual coupling conditions utilizing
palladium chloride/cuprous iodide/triphenylphosphine and triethylamine, we found that
smooth coupling could be achieved using palladium acetate rather than the chloride, and
1.9 equivalents of the acetylene. The coupling product was then reduced catalytically,
and the protecting groups were removed under basic conditions. This guanine analog of
DDATHF turned out to be essentially inactive as a cell growth inhibitor. In passing, it
should be noted that nrnr studies on the penultimate pivaloylated dimethyl ester showed it
to exist as a 2:1 ratio of the 9-NH and the 7-NH tautomers.
Our next attempt to satisfy the criteria defined above for a DDATHF analog
lacking a chiral center at the point of attachment of the ethano bridge, but preserving both
the rigidity of the bicyclic ring system of DDATHF, and the critically important ring B
-NH grouping, turned out to be a striking and very surprising success which has since
dominated our research directions.32 Our objective this time was the pyrrolo[2,3-
!;!Jpyrimidine analog shown in Fig. 12.
398
Contraction of Ring B to an Imidazole - A Guanine
Analogue of DDATHF
~OOMe COOMe
• ~CONH-1-H CONH_l_H
HC2CSiMl!:J +~ CHzCH2C~OMe ~ ~HzCHzCOOMe
1 Hc:c~
HNCN
k __ jl __ .!l
Me~CONH N N C2C-0 COOMe
~
IH
CONH-+-H
11
HN\!-N l:u,cu,cooMe
HNkNJlN~
2 H llA ~OOH
CONH-:-H
!
Dr. Zen-yu Chang CH 2CHzCOOH
Dr. Dietmar Kuhnt
Fig.ll
Structure ofLY231514
~OOH
CONH- A•H
CH2CH2COOH
Fig.12
399
Contraction of Ring B to a Pyrrole - Synthesis
ofLY231514
0 +
HN~CH2CH(OEth
H2N
h_Jl
N NH2
COOH
CONH-+-H
!
CH2CH2COOH
LY231514
Fig.13
400
cyanoacetate with bromoacetaldehyde diethyl acetal in the presence of potassium
carbonate (Fig. 13).33 The resulting a-alkylated cyanoacetate was cyclized with
guanidine/sodium ethoxide to a 2,4-diamino-6(1H)-pyrimidinone, which was then treated
with 0.5 N hydrochloric acid to effect hydrolysis of the acetal protecting group, and acid-
catalyzed cyclization of the resulting aldehyde with the pyrimidine 4-amino group.
Pivaloylation was then followed by treatment with 2.2 equivalents ofN-iodosuccinimide,
which gave the 5,6-diiodo derivative. This could be regioselectively monodeiodinated
with zinc in acetic acid to the desired 2-pivaloylamino-5-iodo-4(3H)-oxo-7H-pyrrolo[2,3-
.d]pyrimidine (more conveniently referred to as 2-pivaloyl-7-iodo-7-deazaguanine). This
compound was then coupled, under the usual conditions of palladium catalysis, with
dimethyl4-ethynylbenzoyl-L-glutamate. Selective hydrogenation of the triple bond was
achieved with hydrogen and 3% palladium-on-charcoal catalyst in a mixture of
methylene chloride and methanol. The target pyrrolopyrimidine was obtained in the
usual way by sodium hydroxide deprotection and saponification.
100
80
c
.2
:e
.J:
60
E
c;;d
E
Q)
40
~
Q)
c..
20
0
i i0 iOO
Dose (mg/kg/day)
Fig.14
401
It may be worth speculating at this point about the reasons for this remarkable
turn of events, whereby a simple change in structure of ring B of DDATHF has switched
the target of inhibition almost completely from GAR FTase to TS. The well-known
reaction pathway for the conversion of dUMP to dTMP is mediated by thymidylate
synthase, which requires the folate coenzyme 5,10-methylene-5,6,7,8-tetrahydrofolate as
the one-carbon donor and the reducing agent. Modeling studies suggest a surprising and
non-obvious structural similarity between our new pyrrolopyrimidine inhibitor and the
natural cofactor, although an alternative working hypothesis is that LY231514 is binding
to TS as a structural analog of dihydrofolate, thus preventing recycling of the cofactor
through eventual reduction by DHFR.
~OOH
CONH-t-H
Dr. Rajendra Chaudhari
CH2 CH2COOH
Dr. Hemantkumar H., Patel
Wendy B. Young
Fig.15
402
sp2 carbon, but in which two atoms now separate the bridge from the pyrimidine ring, as
in dihydrofolate itself. This isomeric pyrrolopyrimidine derivative was prepared from 4-
carbomethoxycinnamic acid as shown in Fig. 15. Catalytic reduction to the P-
arylpropionic acid, conversion to its acid chloride, and treatment with diazomethane
followed by hydrochloric acid gave the chloroketone shown. This was condensed with
2,4-diamino-6(1H)-pyrimidinone in a mixture of sodium acetate and methanol. The
resulting 6-substituted 2-amino-4(3B.)-oxo-7B.-pyrrolo[2,3-d]pyrimidine (8-substituted 7-
deazaguanine) was then converted by hydrolysis to the carboxylic acid, followed by
peptide formation and eventual saponification, to the 6-isomer of LY23154. Despite its
(perhaps far-fetched) structural resemblance to dihydrofolate, this compound turned out
to be an extremely poor inhibitor of cell growth, and to be essentially inactive both
towards TS and GAR FTase.
CH2 CH:zCOOEt
0
COOH
CONH• I·H
Dr. Carsten Spanka CHzCH:zCOOH
Wendy B. Young Fig.16
However, suppose the pyrrole ring in this inactive isomer were now reduced? In
this case, a formerly inactive compound would now be converted into an analog of
DDA THF in which the 7-methylene group of the latter had been excised, and C-6 joined
403
to N-8. This new potential DDATHF analog was successfully prepared as shown in Fig.
16. 2-Pivaloylamino-4(3H)-oxo-7H-pyrrolo[2,3-.d]pyrimidine (2-pivaloyl-7 -deazaguan-
ine) was converted to its 7-ethoxycarbonyl derivative with three equivalents of sodium
hydride and one equivalent of ethyl chloroformate. In contrast to 2-pivaloylamino-4(3H.)-
7!!-pyrrolo[2,3-d.]pyrimidine itself, this ?-protected derivative underwent smooth
monobromination with N-bromosuccinimide at 0 °C in methylene chloride to give
exclusively the 6-bromo derivative. Subsequent coupling, reduction of both the triple
bond and the pyrrole ring, and final deprotection completed this synthesis of the 5,6-
dihydro derivative of the 6-isomer ofLY231514.
Biological evaluation now showed that we once again had in hand an active
antitumor agent, and reversal studies revealed that the target of inhibition was once again
GAR FTase. In other words, this compound is indeed a DDATHF analog, as predicted.
On the other hand, the dihydro derivative of LY231514, which was also an active
cytotoxic agent, was shown to be targeted against TS, since reversal studies indicated that
its cytotoxicity was reversed by thymidine. 35 It can thus be seen that very minor changes
in structure can determine whether the target of inhibition is TS or GAR FTase.
404
Attempted Synthesis of the Furan Analog of LY231514
A Remarkable Ring Transformation/Annulation Sequence
C02Et
+ ~OH
I
CH 2(CN)z
base
EtO~anidine
C02Et
Fig.17
405
a NC R
H2 NC(=NH)NHz~ H N O
~
a
~2
b
guanidine
...
Fig.l8
In closing, I would like to pay a sincere and grateful tribute to my many dedicated
and talented students and collaborators whose work I have summarized today. The
names of those who have carried out the synthetic work are given in the Figures; a listing
of all those whose earlier efforts contributed so much to the development of DDATHF is
given in ref. 7. The important contributions of Prof. G. Peter Beardsley to the very early
stages of this project are also gratefully acknowledged. I cannot emphasize too strongly
the many vital contributions from my associates at Eli Lilly & Company, and in particular
Drs. Joe Shih and Charles J. Barnett in the area of organic chemistry, and Dr. Gerald B.
Grindey, who has been responsible for all of the pharmacology and pre-clinical
evaluation of our synthetic antifolates. All of the FPGS evaluations and many related
biochemical studies on these new antifolates were carried in collaboration with Prof.
Richard G. Moran of USC.
References
406
6. For extensive reviews of the chemistry of folic acid, aminopterin, methotrexate and
analogs as antitumor agents, see: (a) D. C. Palmer, J. S. Skoticki, and E. C. Taylor,
"Progress in Medicinal Chemistry," G. P. Ellis and G. B. West, Eds; Elsevier Science
Publishers; Holland (1988); Vol. 25, p. 85. (b) Rosowsky, A. "Progress in Medicinal
Chemistry," G. P. Ellis and G. B. West, Eds; Elsevier Science Publishers; Holland
(1989); Vol. 26, p. 1.
7. For leading references and a full discussion of the background and development of
DDATHF, see E. C. Taylor, J. Heterocyclic Chem. 27:1 (1990).
8. R. G. Moran, E. C. Taylor, and G. P. Beardsley, Proc. Amer. Assoc. Cancer Res.
26:231 (1985).
9. G. P. Beardsley, E. C. Taylor, C. Shih, G. A. Poore, G. B. Grindey, and R. G. Moran,
Proc. Amer. Assoc. Cancer Res. 27:259 (1986).
10. G. P. Beardsley, B. A. Moroson, E. C. Taylor, and R. G. Moran, J. Bioi. Chem.
264:328 (1989).
11. S. W. Baldwin, A. Tse, L. S. Gossett, E. C. Taylor, A. Rosowsky, C. Shih, and R. G.
Moran, Biochemistry 30:1997 (1991).
12. R. G. Moran, S. W. Baldwin, E. C. Taylor, and C. Shih, J. Bioi. Chem. 264:21047
(1989).
13. G. Pizzomo, B. A. Moroson, A. R. Cashmore, E. C. Taylor, and G. P. Beardsley,
Proc. Amer. Assoc. Cancer Res. 29:281 (1988).
14. (a) C. Young, V. Currie, L. Balder, B. Trochanowski, 0. Eton, R. Dyke, and R.
Bowsher, Proc. Amer. Assoc. Cancer Res. 31:177 (1990). (b) R. Nelson, F. Butler, W.
Dugan, Jr., C. Davis-lung, M. Stone, and R. Dyke, Proc. Amer. Soc. Clin. Oncol. 9:293
(1990). (c) 0. Pagani, C. Sessa, J. deJong, H. Kern, S. Hatty, H. Schmitt, and F. Cavalli,
Proc. Amer. Assoc. Clin. Oncol. 11:109 (1992).
15. E. C. Taylor, P. J. Harrington, S. R. Fletcher, G. P. Bearsley, and R. G. Moran, J.
Med. Chem. 28:914 (1985).
16. E. C. Taylor and G. S. K. Wong, J. Org. Chem. 54:3618 (1989).
17. R. F. Heck, "Palladium Reagents in Organic Syntheses," Academic Press, Orlando,
FL (1985).
18. See, for example, (a) E. C. Taylor and C.-m. Yoon, Synth. Commun. 18:1187 (1988).
(b) E. C. Taylor and P. S. Ray, J. Org. Chem. 52: 3997 (1987). (c) E. C. Taylor, J. M.
Hamby, C. Shih, G. B. Grindey, S.M. Rinzel, G. P. Beardsley, and R. G. Moran, J. Med.
Chem. 32:1517 (1989).
19. C.-m. Yoon, Ph.D. Thesis, Princeton University (1989).
20. E. C. Taylor, G. S. K. Wong, S. R. Fletcher, P. J. Harrington, G. P. Beardsley, and C.
J. Shih, "Chemistry and Biology of Pteridines," B. A. Cooper and V. M. Whitehead, Eds.;
de Gruyter, Berlin (1986), pp. 61-64.
21. E. C. Taylor and P.M. Harrington, J. Org. Chem. 55:3222 (1990).
22. A. I. Meyers, Ace. Chem. Res. 11:375 (1978).
23. C. Shih, G. B. Grindey, E. C. Taylor, and P.M. Harrington, Biorg. Med. Chem. Lett.
2:339 (1992).
24. This separation, the first of its kind in folate chemistry, was developed by Dr. C. J.
Shih of Eli Lilly & Company; see ref. 1.
25. E. C. Taylor, P.M. Harrington, and C. Shih, Heterocycles 28:1169 (1989).
26. C. Shih, L. S. Gossett, J. F. Worzalla, S.M. Rinzel, G. B. Grindey, P.M. Harrington,
and E. C. Taylor, J. Med. Chem. 35:1109 (1992).
27. E. C. Taylor, T. H. Schrader, and L. D. Walensky, Tetrahedron 48:19 (1992).
28. (a) E. C. Bigham, S. J. Hodson, W. R. Mallory, D. Wilson, D. S. Duch, G. K. Smith,
and R. Perone, J. Med. Chem. 35:1399 (1992). (b) J. L. Kelley, E. W. McLean, N. K.
Cohn, M. P. Edelstein, D. S. Duch, G. K. Smith, M. H. Hanlon, and R. Perone, J. Med.
Chem. 33:561 (1990). (c) G. K. Smith, S. D. Banks, E. C. Bigham, N. K. Cohn, D. S.
Duch, M.P. Edelstein, R. Perone, M. H. Hanlon, L. S. Heath, J. Humphreys, J. L. Kelley,
V. Knick, E. W. McLean, R. J. Mullin, S. Singer, H. R. Wilson, and J. Houghton,
407
"Chemistry and Biology of Pteridines, 1989," H.-Ch. Curtius, S. Ghisla, and N. Blau,
Eds.; de Gruyter, Berlin (1990), pp. 1015-1022.
29. E. C. Taylor, P. Gillespie, and M. Patel, J. Org. Chern. 57:3218 (1992).
30. C. Shih, G. B. Grindey, P. J. Houghton, and J. A. Houghton, Proc. Arner. Assoc.
Cancer Res. 29:283 (1988).
31. E. C. Taylor, D. Kuhnt, and Z.-y. Chang, J. Org. Chern. 56:6937 (1991).
32. E. C. Taylor, D. Kuhnt, C. Shih, S. M. Rinzel, G. B. Grindey, J. Barreda, M.
Jannatipour, and R. G. Moran, J. Med. Chern. 35:4450 (1992).
33. (a) J. Davoli, J. Chern. Soc. 131 (1960). (b) U. Liipke, and F. Seela, Chern. Ber.
110:1462 (1977).
34. E. C. Taylor, and A. McKillop, "The Chemistry of Cyclic Enaminonitriles and .Q.-
Aminonitriles," Wiley-Interscience, New York (1970).
35. C. J. Barnett, T. M. Wilson and G. B. Grindey, "Synthesis and Antitumor Activity of
LY288601, the 5,6-Dihydro Analog of LY231514", Poster presented at the lOth
International Symposium, Chemistry and Biology of Pteridines and Folates, Orange
Beach, Alabama, March 21-26, 1993. These workers prepared the 5,6-dihydro derivative
of L Y231514 by a different route .
36. T. Miwa, T. Hitaka, H. Akimoto and H. Nomura, J. Med. Chern. 34:555 (1991).
408
SYNTHESIS AND ANTITUMOR ACTIVITY OF LY288601,
THE 5,6-DIHYDRO ANALOG OF LY231514
The series of deaza analogs of folic acid has been a rich source of compounds of in-
terest as potential antitumor drugs.! The mode of action of these compounds is, however,
related to structure in ways not yet fully understood. For example, DDATHF2 is a specific
inhibitor of glycinamide ribonucleotide formyl transferase (GARFT)3 while the related
pyrrolo[2,3-d]fyrimidine-based analog, LY231514, has been found to inhibit thymidylate
synthase (TS). Both (6R)-DDATHF (lometrexol)5 and LY2315I46 have shown promising
in vivo antitumor activity against a variety of murine and human tumor cell lines and are
currently undergoing clinical evaluation. LY28860 I may be viewed as a hybrid structure
which possesses both the ring saturation ofDDATHF and the 6,5-heterocyclic ring system
of the pyrrolo[2,3-d]pyrimidine-based LY231514. LY288601 was first described by
Akimoto and coworkers7 (as Takeda T-41440) but only limited cytotoxicity data has been
reported. 8 We report here a convenient alternate synthesis of LY28860 1, the results of cell
culture cytotoxicity and reversal experiments, and in vivo antitumor evaluation of this
compound in comparison with DDATHF and LY231514.
DDATHF LV231514
LV288601
(T-41440)
!
~OH
diethyl malonate
TiCI 4/Py, THF
EtO~~ CQzBut
2 I
DBU Et02C ~ ~
72% (3 steps)
3
1. TFA
...
2. guanidine
!
(64%)
7
H2N-L-Giu(OEt}2
chlorodimethoxytriazine
NMM, DMF (52%)
0 yO:zR
~lCOR 2
NaOH, r - 8 R = Et
HCI ~ LY288601 R = H
(85%)
Scheme 1. Synthesis of LY288601.
Synthesis
410
pyrrolo[2,3-dJpyrimidine by cyclization of an a.-carboalkoxythiolactam with guanidine.
Condensation of 7 with diethyl-L-glutamate (chlorodimethoxytriazine 12 method) followed
by basic hydrolysis afforded the target structure. LY28860 1 was obtained from the syn-
thesis as a mixture of diastereomers epimeric at C-5. All biological results reported are
based on studies of the diastereomeric mixture.
Biological Evaluation
Compound LY288601 was screened for cytotoxic activity against CCRF-CEM cells
in culture and found to have ICso = 0.09 Jlg/ml, as compared to 0.009 Jlg/ml for
LY2315144 and 0.004Jlg/ml for (6-RS)-DDATHF.13 The cytotoxic activity ofLY288601
was reversed (Figure) by addition of thymidine, whereas hypoxanthine had no effect, sug-
gesting that this compound is an inhibitor of thymidylate synthase. In contrast to
DDATHF, it does not appear to have any effect on de novo purine biosynthesis in this
model.
100
-e-
\ .' --- •
l Y2BB601
20
0
0.003 0.01 0.1 1 10 100
Cone. of LY288601 (119fml)
References
411
3. R. G. Moran, S. W. Baldwin, E. C. Taylor, and C. Shih, J. Bioi. Chem. 264:21047
(1989).
4. E. C. Taylor, D. Kuhnt, C. Shih, S.M. Rinzel, G. B. Grindey, J. Barredo, M.
Jannatipour, and R. G. Moran, J. Med Chem. 35:4450 (1992).
5. C. Shih, G. B. Grindey, P. J. Houghton, and J. A. Houghton, Proc. Am. Assn. for
Cancer Research, 29:abstr. 1125 (1988).
6. G. B. Grindey, C. Shih, C. J. Barnett, H. L. Pearce, J. A. Engelhardt, G. C. Todd, S.
M. Rinzel, J. F. Worzalla, L. S. Gossett, T. P. Everson, T. M. Wilson, M. E.
Kobierski, M.A. Winter, J. R. Bewley, D. Kuhnt, E. C. Taylor, and R. G. Moran,
Proc. Am. Assn. for Cancer Research, 33:abstr. 2451 (1992).
7. H. Akimoto, H. Takenori, and T. Miwa, European Patent Appl. 334 636 A2 (1989).
8. ICso 0.32j.!.g/ml vs KB cells. H. Akimoto, T. Hitaka, T. Miwa, K. Yukishige, T.
Kusanagi, and K. Ootsu, Proc. Am. Assn. for Cancer Research 32:abstr. 1938
(1991).
9. Full experimental details of the synthetic work presented here will be published
separately. C. J. Barnett and T. M. Wilson, Heterocycles, in press.
10. E. C. Taylor, P. Gillespie, and M. Patel, J. Org. Chern. 57:3218 (1992).
11. W. Lehnert, Tetrahedron Lett. 4723 (1970).
12. Z. J. Kaminski, Tetrahedron Lett. 26:2901 (1985).
13. G. P. Beardsley, B. Moroson, E. C. Taylor, and R. G. Moran, J. Bioi. Chem.
264:328 (1989).
14. R. G. Moran, personal communication. We thank Professor Moran for the TS
inhibition measurement on LY28860 1.
412
SYNTHESIS AND PRELIMINARY BIOWGICAL EVALUATION OF ANAWGUES
OF 5,8-DIDEAZAISOFOLIC ACID AND ITS 2-DESAMIN0-2-METHYL
DERIVATIVE CONTAINING FLUORINE AT POSITION FIVE
Toledo, OR 43699
INTRODUCTION
The folate analogue 5,8-dideazaisofolic acid (IAHQ), la, has demonstrated antitumor
activity against a variety of mammalian tumor cells both in vitro and in vivo. 1-5 Its
derivative, 2-desamino-2-methyl-5,8-dideazaisofolic acid, lb, was found to be 20- and 44-
fold more cytotoxic toward MCF-7 and L1210 cells in culture, respectively. 6 In order to
evaluate the effects of other substituents located at position five of the quinazoline nucleus
upon antitumor activity, we have prepared 5-fluoro-5,8-dideazaisofolic acid, 2a, and
desamino-2-methyl-5-fluoro-5,8-dideazaisofolic acid, 2c, together with their 9-methyl
derivatives, 2b and 2d. This report describes the chemistry and preliminary biological
evaluation of these new compounds.
METHODOLOGY
No. R X .Y lso.I!M
1a NH 2 H H 3.21
2a NH2 F H 3.0
2b NH2 F CH3 17.7
1b CH3 H H 0.073 1
2c CH3 F H 0.83
1c CH3 H CH3 0.060
2d CH3 F CH3 1.3
MTX 0.004
Reported previously, reference 6.
414
DISCUSSION
Each of the newly synthesized 5-fluoro analogues was evaluated for cytotoxicity against
L1210 leukemia cells in culture and the results are presented in Table 1. It will be seen
that 2a has the same level of antitumor activity as IAHQ. However, the introduction of
a 9-methyl substituent into 2a cause a 6-fold decrease in cytotoxicity. For the 2-desamino-
2-methyl analogues, it will be noted that the presence of a 5-fluoro substituent has a highly
detrimental effect on activity, since 2b and 2d are 11- and 22-fold less cytotoxic than their
unfluorinated counterparts, 1b and 1c.
The kinetic constants obtained for the 5-fluoro analogues, 2a-2d, using hog liver FPGS
are compared with their 5-unsubstituted counterparts in Table 2. While 5-fluoro-5,8-
dideazaisofolic acid, 2a, is a 2-fold more efficient substrate than IAHQ, methylation at
position 9 causes a large decrease in Vmax/K.n making 2b a much poorer substrate than
IAHQ. For the 2-desamino-2-methyl analogue, 1b, the introduction of a 5-fluorine, 2c,
improves substrate activity as measured by K,... However, when a 9-methyl substitutent
is present, the introduction of a 5-fluorine has a markedly negative effect upon substrate
activity as measured by either ~11 or VmaJI<o,.
REFERENCES
1. J.B. Hynes, Y.C.S. Yang, J.E. McGill, S.J. Harmon, and W.L. Washtien, J. Med.
Chern. 27:232 (1984).
2. D.J. Fernandes, J.R. Bertino, and J.B. Hynes, Cancer Res. 43:1117 (1983).
3. J.B. Hynes, A.B. Smith, and G.R. Gale, Cancer Chemother. Pharmacal. 18:231
(1986).
4. K.-Y. Tsang, J. B. Hynes, and H.H. Fudenberg, Chemother. 28:276 (1982).
5. J.J. McGuire, A.F. Sobrero, J.B. Hynes, and J.R. Bertino, Cancer Res. 47:5975.
6. R.L. Hagan, D.S. Duch, G.K. Smith, M.H. Hanlon, B. Shane, J.H. Freisheim,
and J.B. Hynes, Biochem. Pharmacal. 41:781 (1991).
7. D.J. Cichowicz and B. Shane, Biochemistry 27:504 (1987).
8. D.J. Cichowicz, J.B. Hynes, and B. Shane, Biochem. Biophys. Acta 957:363
(1988).
9. J.I. McCormick, S.S. Susten, and J.H. Freisheim, Arch. Biochem. Biophys.
212:311 (1981).
10. J.B. Hynes, S.K. Singh, O.Fetzer, and B. Shane, J. Med. Chern. 35:4078 (1992).
11. J.B. Hynes, A. Tomazic, C.A. Parrish, and O.S. Fetzer, J. Heterocyclic Chern.
28: 1357(1991).
415
SYNTHESIS AND BIOLOGICAL EVALUATION OF ANALOGUES OF 5,8-
DIDEAZAISOFOLIC ACID (IAHQ) MODIFIED AT POSITIONS 2, 4 AND 9
Toledo, OH 43699
INTRODUCTION
The compound 5,8-dideazaisofolic acid (IAHQ), 1a, was found to posses modest
antitumor activity against a variety of human and murine tumor cells both in vitro and in
vivo. J-s Its lack of potency was attributed to slow influx into target cells as demonstrated
with eH] IAHQ in the presence of HCT-8 human colon adenocarcinoma cells in culture. 6
The analogues 2-desamino-5,8-dideazaisofolic acid, 1b, and 2-desamino-2-methyl-5,8-
dideazaisofolic acid, 1c, were prepared subsequently and found to be 6-and 44-fold more
cytotoxic toward L1210 cells than 1a7•8 This activity enhancement correlated well with
increased affinity for the reduced folate transporter as measured by competition for the
uptake of [3H] MTX into MOLT-4 cells. 8
This paper represents a logical extension of the earlier work and includes the
preparation of the 9-CH3 and 9-CHO derivatives of 1b and 1c. In addition, the 4-amino
modifications of 1b and 1c, 2b and 2c were synthesized for the first time. These two
analogues of 5,8-dideazaisoaminopterin, 2a, were also modified by the introduction of a
methyl or formyl group at position 9.
Each of the newly synthesized compounds was evaluated for antitumor effects against
the growth of L1210 leukemia cells in vitro and the results are presented in Table 1
together with values obtained earlier for 1b, 1c, and MTX. In addition, these analogues
were evaluated as substrates for hog liver folylpolyglutamate synthetase (FPGS) and the
kinetic constants are shown in Table 2.
METHODOLOGY
Hog liver FPGS was purified to homogeneity as described previously. 9 The specific
activity of the purified enzyme with (6S)-fftPteGlu as the substrate was 123 units/mg of
-o-
Table 1. Cytotoxic effects of analogues of 5,8-dideazaisofolic acid and 5,8-
dideazaisoaminopterin modified at positions 2 and 9 toward L1210 leukemia cells.
O y COOH la R NH 2 , Y H
HN~~CH2 ~ ' gNHCH lb R H, Y H
Ri.,)~~
lc R CH 2 , Y H
(bH2hCOOH
H H 0.53 1
H CH3 0.21
H CHO >100
CH3 H 0.073 1
CH3 CH3 0.060
CH3 CHO 18.1
N~L,-o'\ gNH~~oH 2a
2b
2c
R
R
NH 2 , Y
H,
R == CH3, Y
Y
Rl.,NA/ - (CH2l2COOH
H 4.3
CH3 0.044
CHO 8.3
H 1.5
CH3 0.18
CHO >100
0.004
Reported prevwusly; reference 8.
418
Table 2. Kinetic constants of analogues of 5,8-dideazaisofolic acid and 5,8-
dideazaisoaminopterin modified a positions 2 and 9 for hog liver folylpolyglutamate
synthetase. 1
y Ym.x.mol/h/mg
H 21 3 923 283
H 124 624 31 4
CH3 2.1 63 187
CHO 63 59 5.9
H 8.64 1044 764
CH3 3.2 67 130
CHO 131 116 5.5
DISCUSSION
Ten new analogues of IAHQ have been synthesized and fully characterized. Each
compound was evaluated for cytoxicity toward L1210 cells in culture. As will be seen in
Table 1, methylation at position 9 of either lb or lc results in only modest increases in
cytoxicity, while 9-formylation causes dramatic decreases in antitumor potency. The 4-
amino derivatives, 2b, and 2c, are 8- and 20-fold less potent than their 4-oxo counterparts.
However, 9-methylation of 2b and 2c enhances activity by approximately 100-fold and 10-
419
fold, respectively. Thus, 2-desamino-9-methyl-5,8-dideazaisoaminopterin is the most
cytotoxic of the IAHQ analogues studied (150 = 0.044 ~tM).
All of the compounds were evaluated as substrates for FPGS and the results are
presented in Table 2. It will be seen that methylation at position 9 of 1b and 1c causes
substantial increases in substrate activity as measured by Vmax/Km, with 2-desamino-9-
methyl-5, 8-dideazaisofolic acid being the most efficient substrate of the compounds studied.
Both of the 9-formyl modifications were significantly less efficient substrates than their
parent compounds.
REFERENCES
1. J.B. Hynes, Y.C.S. Yang, J.E. McGill, S.J. Harmon, and W.L. Washtien, J. Med.
Chern. 27:232 (1984).
2. D.J. Fernandes, J.R. Bertino, and J.B. Hynes, Cancer Res. 43:1117 (1983).
3. J.B. Hynes, A.B. Smith, and G.R. Gale, Cancer Chemother. Pharmacal. 18:231
(1986).
4. K.-Y. Tsang, J.B. Hynes, and H.H. Fudenberg, Chemother. 28:276 (1982).
5. J.J. McGuire, A.F. Sobrero, J.B. Hynes, and J.R. Bertino, Cancer Res. 47:5975
(1987).
6. A.F. Sobrero, J.J. McGuire, and J.R. Bertino, Biochem. Pharmacal. 37:997 (1988).
7. J.B. Hynes, S.A. Patil, R.L. Hagan, A. Cole, W. Kohler, and J.H. Freisheim, J.
Med. Chern. 32:852 (1989).
8. R. L. Hagan, D.S. Duch, G.K. Smith, M.H. Hanlon, B. Shane, J.H. Freisheim, and
J.B. Hynes, Biochem. Pharmacal. 41:781 (1991).
9. D.J. Cichowicz and B. Shane, Biochemistry 27:504(1987).
10. D.J. Cichowicz, J. B. Hynes, and B. Shane, Biochem. Biophys. Acta 957:363 (1988).
11. J.I. McCormick, S.S. Susten, and J.H. Freisheim, Arch. Biochem. Biophys. 212:311
(1981).
420
NEW THIOPHENE SUBSTITUTED 10-DEAZAAMINOPTERINS: SYNTHESIS
AND BIOLOGICAL EVALUATION
ABSTRACT
INTRODUCTION
Methotrexate (MTX) which is one of the most potent inhibitors of human dihydrofolate
reductase (DHFR) continues to be the most widely used classical antifolate drug for the
chemotherapy of cancer. As part of a continuing program aimed at the development of
potentially more specific and less toxic antifolate drugs we reported the synthesis and
preliminary biological evaluation of certain non-polyglutamylatable inhibitors of DHFR.
Two of the most potent non-polyglutamylatable analogues in this series were 'Y-methylene-
10-deazaaminopterin (MDAM) and 'Y-methylene-1 0-ethyl-1 0-deazaaminopterin
(MEDAM). 1•2 Both MDAM and MEDAM exhibited superior activity relative to MTX
in inhibiting a number of human tumor cell lines in culture under identical conditions.
These results were some what surprising in view of the presumed notion that
polyglutamylation of classical antifolates is a requirement for eliciting antitumor activity.
Subsequent invivo t·~sting of MEDAM in mice revealed that it is dramatically less toxic
than MTX under identical experimental protocol. These results prompted us to examine
in detail the role of polyglutamylation of classical antifolates in cytotoxicity and the study
required the development of analogues with varying abilities of polyglutamylation, while
preserving the DHFR inhibition and transport properties similar to MTX. Replacement
of the phenyl ring of 10-deazaaminopterin (10-DAM) with a thiophene ring was judged to
Preliminary screening of compounds 1 and Z established that they were good inhibitors
of H35 rat hepatoma cell growth and CCRF-CEM human leukemia cell growth (Table 1).
Substitution of glutamate moiety of 1 with a ')'-methyleneglutamate resulted in - 5-fold
increase in IC50 in both cell lines. The IC50 of 1 was 1.3 fold lower than that of
methotrexate (MTX) and was only 3 times higher than that of 10-DAM in CCRF-CEM
human leukemia cell line. Compound Z was less potent than MDAM in inhibiting CCRF-
CEM leukemia cell growth (IC50 59 nM Vs 7.25 nM). Thus substitution of a thiophene
for benzene ring in this class leads to a small loss of potency even on continuous exposure.
Substrate activities of these analogues with purified FPGS from CCRF-CEM leukemia
cells showed that 1 was a fair substrate with a V/K ratio 1.3 times lower than
that of 10-DAM (Table II). Compound Zwas neither a substrate nor an inhibitor ofFPGS
as expected. Compounds 1 and 2 were evaluated as inhibitors of dihydrofolate reductase
(DHFR) (Table ill). Compound 1 inhibited human DHFR at equivalent potency to 10-
DAM; thus for DHFR inhibition thiophene substitution is conservative. Transport studies
showed that 1 competed 3.6 times more effectively than MTX for folinic acid transport.
In vitro studies led to the selection of 1 for further evaluation . It was evaluated in
NCI's human tumor, disease oriented in ~itro screen. 6 A broad range of sensitivities
among the various types of human tumors to the cytotoxic effects of 1 was observed.
Compound 1 showed enhanced activity relative to MTX against the growth of a number
of tumor cells, in spite of its comparable DHFR inhibition (Table IV).
In vitro antitumor evaluation of 1 against ip implanted P388 leukemia was carried out
in CD2F 1 mice. A 95% ILS was observed with 96mg/kg/dose given at a schedule Q2DX5
and it was nontoxic to the mice. (Table V). With 15 mg/kg/dose given at a schedule
Q2DX5, 100% ILS was obtained with MTX. A 48mg/kg/dose of 1 given by Q2DX5
schedule gave only a 40% ILS, but the same dose given at a Q1DX9 schedule gave a 70%
ILS.
Although we are unable to explain the observed differences in percent ILS of tumor
bearing mice at the same dose under different protocols, it would appear that 1 is cleared
more efficiently than MTX from murine tissues. Since 1 exhibits similar
polyglutamylation and enhanced transport relative to MTX, the striking reduction in host
toxicity (drug tolerance) may be due to enhanced efflux or deactivation of the drug by
metabolism. These possibilities as well as studies to optimize the therapeutic index of 1
using different protocols are being investigated.
15 10.2
2 76 59
MTX 10 13.5
10-DAM 3.4
MDAM 7.25
422
Table n. Substrate and Inhibitory activity with CCRF-CEM human leukemia cell FPGS4
Relative*
COMPOUND Km,J.!M Vmax Rei V/K Inhibition Substrate Activity
Inhibition of FPGS was measured by adding 100J.!M of compound to the assay mixture containing 50J.!M
aminopterin as the substrate. *Substrate activity of 2 was measured at 100J.!M of 2 and is relative to the
activity of 50JLM aminopterin.
COMPOUND
1 0.95
2 4.5
MTX 0.98
10-DAM 0.80
MDAM 1.30
Table IV.
Activity of 1 against the growth of selected tumor cells in culture
MTX 1
Leukemia:
CCRF-CEM -7.57 <-8.00
HL-60(TB) -7.48 <-8.00
K -562 -7.6 <-8.00
MOLT -4 -7.59 <-8.00
SR -7.52 <-8.00
Non-small cell lung cancer:
A549 (ATCC) -7.52 -7.11
NCI -H460 -7.54 <-8.00
NCI -H522 -6.50 7.04
LXFL529 -7.46 -7.42
Small Lung Cancer:
DMS -114 -7.48 -7.36
DMS -273 -7.51 -7.83
Colon Cancer:
HCC -2998 -7.00 -6.77
HCT-116 -7.54 <8.00
HCT -15 -7.49 -7.44
HT -12 -7.51 <-8.00
KM -29 -7.43 -7.08
sw -620 -7.51 <-8.00
CNS Cancer:
SF -268 -7.27 -7.20
423
Table IV Continued
0 COOH
HN
2 N
6)-CHC
N
"'2--()----c- ~ -)I
II
H
COOH
1: R= H ~ R = =CH 2 R
ACKNOWLEDGEMENT
This investigation was supported by NIH grants CA 27101 (MGN); CA 43500 (JJM)
and CA 25933 (JG).
REFERENCES
1. A. Abraham, J.J. McGuire, J. Galivan, Z. Nimec, R.L. Kisliuk, Y. Gaumont, and M.G. Nair, J. Med.
Chern. 34:222-227. (1991).
2. M.G. Nair, A. Abraham, U.S. Patent 4,996207 (1991).
3. S.D. Patil, C. Jones, M.G. Nair, J. Galivan, F. Maley, R.L. Kisliuk, Y. Gaumont, D. Duch. and R.
Ferone, J. Med. Chern.32:1284. (1989).
4. J.J. McGuire, W.E. Bolanowska, J.R. Piper, Biochern. Phannacol. 37:3931. (1988).
5. J.J. Mcguire, C.A. Russell, W.E. Bolanowska, C.M. Freitag, C.S. Jones, T.l. Kalman, Cancer
Research 50:1726. (1990).
6. R.W. Fuller, J.H. Cardellina II, Y. Kato, L.S. Brinen J. Clardy, K.M. Snader, M.R. Boyd, J. Med.
Chern. 35:3007. (1992).
424
EVALUATION OF THE ANTI-ARTHRITIC ACTIVITY AND AN ALTERNATE
SYNTHESIS OF A THIOPHENE-SUBSTITUTED 10-DEAZAAMINOPTERIN
INTRODUCTION
The antifolate methotrexate (MTX) has become an established treatment in patients with
rheumatoid arthritis (RA). Although the mechanism of action of this drug in RA is still
unknown, its efficacy has been demonstrated in short-term placebo-controlled studies,
comparative trials, and open prospective studies as well as in animal models of rheumatoid
arthritis. In a recent long-term study the effectiveness of methotrexate in the treatment of
RA has been demonstrated in patients who have received the drug for more than seven
years 1. While a sustained clinical response is seen with long-term MTX treatment, the
most common reason for withdrawal from the drug is toxicity.
The efficacy of MTX and the newer dihydrofolate reductase inhibitor 10-
deazaaminopterin (10-DAM) in a murine model of autoimmune disease has recently been
reported2 . In a short term clinical trial 10-DAM has been shown to be as effective as
MTX in the treatment of human rheumatoid arthritis with enhanced beneficial effects
relative to MTX in controlling joint pain, swelling and morning stiffness3 •4 .
The synthesis of a new 10-DAM analog in which the benzene moiety is replaced by a
thiophene ring has recently been accomplished in this laboratory5 . This compound, N-{5-
(2,4-diamino-6-pteridinyl) ethyl]-2-thenoyl}-L-glutamic acid (1), exhibits comparable
dihydrofolate reductase inhibition but superior antifolate activity relative to methotrexate
in a number of human tumor cell lines. Therefore it was appealing to explore this
compound as a potential anti-arthritic agent. The synthetic scheme as well as the
evaluation of this thiophene antifolate in the rat adjuvant arthritis model is presented in this
report.
METHODS
Chemistry
The methods used for the synthesis of compound (1) is illustrated in scheme 1. Direct
Biological evaluation
Previous studies reported from this laboratory revealed that both MTX and compound
1 exhibited comparable inhibition of dihydrofolate reductase and tumor cell growth in
vitro. Compound 1 was transported more efficiently than MTX into H 35 Hepatoma cells
and it exhibited superior antitumor activity in a number of human tumor cell lines.
Therefore, it was speculated that 1 might be a potential anti-arthritic agent.
Galivan et al. previously demonstrated the efficacy of low-dose methotrexate in rat
adjuvant arthritis7 . Our experiments confirmed these observations. A weekly dose of 625
p.g/kg of methotrexate was effective in inhibiting the footpad swelling associated with
adjuvant arthritis by 91 % (Table 1). However, to achieve comparable inhibition of
footpad swelling by compound 1, a 20 fold higher dose of the drug was required.
Although we cannot explain the high dose of 1 required for anti-arthritic activity at the
present time, it is conceivable that it is due to increased efflux from the cell or metabolic
deactivation of 1. However, it should be emphasized that 1 was tolerated by all animals
at higher doses with no apparent signs of toxicity relative to methotrexate while
preserving the anti-arthritic activity. In order to optimize the therapeutic index of 1 in this
model, studies with higher doses will be required. It is interesting to note that in in vivo
antitumor screens using CDF1 mice bearing P 388 leukemia, 1 exhibited comparable
activity to MTX at 8 times the dose of MTX. Since 1 appears to be less toxic than MTX
(high drug tolerance without toxicity) in mice, clearly additional studies with 1 are
warranted to evaluate its clinical potential as a less toxic anti-arthritic agent. Such studies
are in progress.
ACKNOWLEDGEMENT
This investigation was supported by grant CA 27101 from the National Cancer Institute.
426
Table 1. Effect of antifolates on the footpad swelling
in Lewis rats injected with mycobacterial adjuvant
SCHEME-1
REFERENCES
1. M.E. Weinblatt, B.N. Weissman, D.E. Holdsworth, P.A. Fraser, A.L. Maier, K.R. Falchuk, and J.S.
Coblyn, Arthritis and Rheumatism, 35:129-137 (1992).
2. J.E. Baggott, S.L. Morgan, L.E. Freeberg, B.B. Hudson, W.H. Vaughn, M.G. Nair, C.L. Krumdieck,
W.J. Koopman, R.E. Gay, and S. Gay, Agents and Actions, 35:104-111 (1992).
3. G.S. Alarcon, 0. Castaneda, M.G. Nair, M. Ferrandiz, W.J. Koopman, and C.L.Krumdieck, Annals
of the Rheumatic Diseases, 51:600-603 (1992).
427
4. G.S. Alarcon, 0. Castaneda, M. Ferrandiz, C.L. Krumdieck, and W.J. Koopman, Arthritis and
Rheumatism, 35:1318-1321 (1992).
5. A. Abraham, S.W. Li, J.J. McGuire, J. Galivan, B.R. Vishnuvajjala, and M.G. Nair, 1. of Medicinal
Chemistry, submitted (1993).
6. B.B. Newbould, Brit.J.Pharmacol., 21:127-136 (1963).
7. W.L. Welles, J. Silkworth, A.L. Oronsky, S.S. Kerwar, and J. Galivan, J. of Rheumatology 12:904-906
(1985).
428
LIPOPHILIC ANTIFOLATES AS CANDIDATES AGAINST
OPPORTUNISTIC INFECfiONS
INTRODUCfiON
Syntheses
The lipophilic candidates were selected from the general structural type shown
in Scheme 1. The target compounds were prepared by standard synthetic procedures
from key precursors reported from our laboratories. 7
Ar
N N NR, S, CHR, phenyl, pyridyl, biphenyl,
CR N SO, so 2 naphthyl. qumolyl.
CR CH Substltuenls on aromatic group:
alkyl, halogens, OCtl3. CF 3 . CN,
Nt!2.
Key precursors:
N!!2 R
~~CH2Br
HzN~;l_vJ
R = t!, Ctl3 R = H, CH 3
Y = N. C!! Y = N, CH
Target compounds were prepared from the key precursors by three general
approaches: (1) displacement reactions of the bromomethyl compounds with
substituted aniline and thiophenol types, (2) reductive alkylation between 6-cyano
precursors and anilino compounds, and (3) the Wittig reaction of phosphoranes
derived from bromomethyl precursors to give olefinic intermediates followed by
hydrogenation.
430
Antipathogenic Evaluations
NH 2 ~CH3
N~CH2-QOCH 3
H N~u~ OCH3
2 N
Trimethoprim Pyrimethamine
NH2 CH3
3: R = -sc 6H40CH3-4
~~CH2 R 4: R = -NHC10H7-1
H2 N~;(J 5: R = -NHC 6 H3 (0CH 3 ) 2 -2,5
6: R = -CH 2C6H3 (0CH 3) 2 -2,5
3-11 7: R = -NHC 6 H2(0CH 3) 3 -3,4,5
8: R = -NHC 6 H3 -2-CH 3-5-0CH 3
9: R = -N(CR 3)C 6 H 3 -2-0CH 3 -5-CF 3
10: R = -NHC6 H2 -2,6-(0CH 3) 2 -4-C0 2CH 3
11· R = -N~Cl
12
431
TABLE 1. Comparative Inhibition Data vs. T. gondii Cell Growth and DHFR from P.
carinii, T. gondii, and Rat Liver: Known Lipophilic Antifolates and Selected
Candidates.
CONCLUSIONS
The results show the high potential for the discovery of improved lipophilic
antifolates. Future work in our program will be in the ring systems of piritrexim and
trimetrexate; that is, 5-deaza- and 5,8-dideazapteridine types with emphasis on 5-alkyl
derivatives. Several of the promising candidates gave preliminary results indicating
they could be superior to agents in use or in advanced stages of clinical development.
Studies now in progress include tests for efficacy against the pathogens in infected
mice.
432
ACKNOWLEDGEMENT
REFERENCES
433
ANALOGUES OF CLASSICAL ANTIFOLATES BEARING NAPHTHOYL
IN PLACE OF BENZOYL
INTRODUCTION
Molecular Modelling
436
Effects on Human Folylpolyglutamate Synthetase (FPGS)
Antitumor Efficacy
10. X = CCH 3 • Y = N
r--- a senes: R = Et
r- 19a: R = El (by Method D)
11· X =
Y =CK L.. 1gb· R =K
L..- b series: R = H
Structure Method used in
~0. X y prepn of ester~
~
12 N N H A
13 N N CK 3 A
14 CK N H B, D
16 CH N CH3 c
16 CCH 3 N H B, C
17 CCH3 N CH3 B. C
16 CH CH H D
aMethods of synthests. A, 6-CH 2Br compound 4 and sidechain precursors 1 or 2 in DMAC; B, 8-CH2 Br compound
5 or 6 with 1 or 2 in DMAC containing MgO; C. 6-CHzOH compound 7 or 8 with Ph 3 P and CBr 4 in DMAC followed
by 1 or 2 and later treatment with AcOH; D, 6-CN compound 9 or 11 w1lh l or 3 in reductive condensallon
(Raney Ni, AcOH).
437
Table 1. In Vitro Comparisons of Naphthoyl Analogues 12b-18b and
Tetrahydronaphthoyl Analogue 19b with MTX Against Ll210, HL60, and S180.a
Table 2. Antitumor Activity of Naphthoyl Analogues 13b, 16b, and 17b, Compared with
MTX Against the E0771 Mammary Adenocarcinoma.a
438
CONCLUSION
REFERENCES
439
SYNTHESIS AND BIOLOGICAL ACTIVITY OF
TRICYCLIC, CONFORMATIONALLY RESTRICTED
ANAWGS OF LIPOPHILIC PYRID0[2,3-d]-
PYRIMIDINE ANTIFOLA TES.
School of Medicine
Indiana University
Indianapolis, IN 46202
INTRODUCTION
SCHEMEl
- a
- b
d e
3 [5] + 6
I air oxidation t
orf ACH3
A= ~OCH 3
4 OCH3
a: THF/60°C/3 days; b: BrCH 2COOC 2HstDMF/60°C; c: NaOEVToluene;
d: Glacial CHaCOOH/120°C/12 hours; e: BH3/THF; f: MeOH/reflux;
g: Dowtherm-N240°C/2 hours.
moiety allowed for a much better overlap with bound TMQ and hence the
trimethoxybenzyl moiety was included as the side chain in preference to the
trimethoxyphenyl.
CHEMISTRY
The synthesis of the target compounds 3-6 was accomplished via the regiospecific
cyclocondensation of the P-ketoester 9 with 2,4,6-triaminopyrimidine (Scheme 1). Hurlbert
et al. 5 as well as reports from our laboratorf·7•8 have confirmed that /j-ketoesters condense
with appropriate 6-amino pyrimidines to afford regiospecifically angular, 5,6-disubstituted
pyrido[2,3-d]pyrimidines rather than the linear, 6,7-disubstituted analogs. Compound 9
was synthesized by the reaction of 3,4,5-trimethoxybenzylamine with ethylacrylate
followed by alkylation with ethylbromoacetate to afford 8 which on Dieckmann cyclization
gave the desired P-ketoester 9. Cyclocondensation of 9 with 2,4,6-triaminopyrimidine in
442
glacial acetic acid at 120° C for 12 hrs. afforded exclusively the lactam 3 in 55% yield,
while similar cyclocondensation in Dowtherm-A at 240° C for 2 hr. gave the
dehydrogenated lactam 4 as the only product in 40% yield. 1H NMR of 3 showed an
exchangeable (D20) lactam NH at o8.98 and three sets of methylene protons at o3.17,
3.78 and 4.43, as was previously reported for similar tricyclic compounds. 6 In contrast
the 1H NMR of 4 indicated a nonexchangeable olefinic proton at o 8.82 as we have
observed earlier, 8 and only two sets of methylene protons at o4.38 and 4.65. Both 3 and
4 were characterized via their 1H NMR, 13 C NMR, IR and elemental analysis. The lactam
3 was reduced using BH3/THF9 to afford a mixture of 5 and 6 in a 1: 1 ratio as indicated
by the 1H NMR and the mass spectrum of the mixture. All attempts to separate the
mixture resulted in the oxidation of 5 to 6. Thus only 6 was isolated as the pure reduced
lactam. This oxidation also occurs when the mixture is allowed to stand at room
temperature for an extended period. Conversion of the mixture to pure 6 was also
accomplished by reflux in methanol. The 1H NMR, 13C NMR, IR and elemental analysis
of 6 confirmed its structure. Compound 6 has been claimed in a patent10 via a different
synthetic route, however, no spectral or biological activity was reported.
The compounds 3-4 and 6 were evaluated as inhibitors of DHFR from P. carinii, 11
T. gondii 12 and rat liver (RL). Selectivity ratios were determined using RL DHFR as the
mammalian source. These IC50 values along with selectivity ratios are shown in Table I.
The inhibitory values for 1 and 2 are also included for comparison. The most potent of
the three target compounds against P. carinii DHFR and T. gondii DHFR was the
dehydrogenated lactam 4. More significantly this compound was about 93 times more
selective against P. carinii DHFR and about 110 times more selective against T. gondii
DHFR than 2. All three compounds were more selective than 2 against both forms of
DHFR. The significant increase in both potency and selectivity of 4 compared to 3
strongly suggested that partial planarity of the C-ring with the pyrido[2,3-d]pyrimidine
system was important. Thus, conformationally restricting r 1 and r 2 of 1 with partial
planarity of the C-ring as in compound 4 significantly increases selectivity against both P.
carinii DHFR and T. gondii DHFR compared to 1 and 2. Based on a comparison of 3 and
6 it appears that in the absence of planarity in the C-ring the lactam is somewhat
detrimental to potency as well as selectivity (except for T. gondii DHFR). A more
definitive assessment of the role of the lactam will be provided by the dehydrogenation of
6, which is currently underway.
Table 1. Inhibitory concentrations (IC5o) in ~-tM against DHFRs and selectivity ratios
for 3,4 and 6.
Selectivity Selectivity
ratio ratio
Compound Pc' RLb RL/Pc Tg" RL!Tg
3 94.5 42.9 0.45 9.0 4.8
4 3.1 20.3 6.5 0.62 32.7
6 12.6 11.7 0.9 5.3 2.2
1 0.013 0.007 0.58 0.0008 8.9
TMO 0.042 0.003 0.07 0.001 0.3
a: Pneumocystis carinii DHFR; b: Rat liver DHFR; c: Toxoplasma gondii DHFR.
443
ACKNOWLEDGEMENTS
This work was supported by a grant GM 40998 (AG) from The National Institutes
of General Medical Sciences, NIH and by a Public Health Service contract AI-87240
(SFQ) from the Division of AIDS, NIH.
REFERENCES
1. Gangjee, A.; Shi, J.; Queener, S.F. 5-Deaza Nonclassical Folates as Potent and
Selective Inhibitors of Dihydrofolate Reductase From Pneumocystis carinii and
Toxoplasma gondii, Presented at the 23rd National Medicinal Chemistry
Symposium. June 14-18, (1992), Buffalo, N.Y. Abstr.:61.
2. Vasudevan, A.; Gangjee, A.; Queener, S.F. Nonclassical 2,4-Diamino-5-methyl-5-
deaza Antifolates: Synthesis and Biological Activity. Presented at the 204th
American Chemical Society National Meeting, Washington, D.C. August 23-38,
(1992), Abstr. :MEDI 148.
3. SYBYL 5.5, TRIPOS Associates Inc.; St. Louis, MO 63144.
4. Sutton, P.A.; Cody, V. J. Med. Chern., 30:1843, (1987).
5. Hurlbert, B.S.; Ledig, K.W.; Stenbuck, P.; Valenti, B.F.; Hitchings, G.H. J. Med.
Chern. 11:703, (1968).
6. Gangjee, A.; Patel, J. J. Heterocyclic Chern., 25:1597, (1988).
7. Gangjee, A.; Donkor, I.O.; Kisliuk, R.L.; Gaumont, Y.; Thorndike, J. J. Med.
Chern., 34:611, (1991).
8. Gangjee, A.; O'Donnell, J.K.; Bardos, T.J.; Kalman, T.I. J. Heterocyclic Chern.,
21:873, (1984).
9. Degraw, J.I.; Christie, P.H.; Colwell, W.T.; Sirontnak, F.M. J. Med. Chern.,
35:320, (1992).
10. Watanabe, K.A. U.S. Patent 4,925,939, (1990).
11. Broughton, M.C.; Queener, S.F. Antimicrob. Agents Chemother. 35:1348, (1991).
12. Queener, S.F. Identification of Potent and Selective Inhibitors of Toxoplasma gondii
Dihydrofolate Reductase (DHFR) and Dihydropteroate Synthase (DHPS).
Thirty-first Interscience Conference on Antimicrobial Agents and Chemotherapy,
(1991), Abstr. 385.
444
NOVEL 2,4-DIAMINO-S-SUBSTITUTED FUR0[2,3-d]-
PYRIMIDINES AS POTENTIAL ANTIFOLATES.
School of Medicine
Indiana University
Indianapolis, IN 46202
3Department of Biochemistry
Tufts University
Health Sciences Campus
Boston, MA 02111
INTRODUCTION
Opportunistic infections with Pneumocystis carinii and Toxoplasma gondii remain the
principal cause of death in patients with AIDS in the United States. For some time we
have been involved in the synthesis of antifolates in an attempt to provide more potent and
selective agents against dihydrofolate reductase from P. carinii and T. gondii than the
currently used antifolates for these infections. Our efforts have resulted in the synthesis
of bicyclic 6-6 ring fused analogs involving the pyrido[2,3-d]pyrimidines 1 and the
tetrahydroquinazolines. 2 In addition we have also synthesized 6-6-6 ring fused systems
involving the pyrimidonaphthyridines3 and the 6-6-5 pyrrolo fused pyrido[2,3-
d]pyrimidines.4 Of these analogs several have been found to be more potent and/or
selective than the currently approved antifolates, trimethoprim, pyrimethamine and
trimetrexate. In addition we have also observed significant antitumor activity in some of
these classical and nonclassical analogs.
NH2 X
N:)S~--o
HNAN 0
2
1 2. X = 3,4,5(0CH3b
3. X = 2,S(OCH3)2
4. X = 3,4(CI)2
5. X = 3,4,5(CI)3
Figure 1. Superimposition of a 6-5 ring fused system on a 6-6 ring fused system.
Though the furo[2,3-d]pyrimidine antifolates 2-5 are novel, other 6-5 ring fused
systems as potential antifolates have been reported by Roth et al. ,5 Rosowsky et al. 6,
Elslager et aP and others. A recent resurgence of interest in 6-5 ring fused classical
antifolates is evidenced by the significant inhibitory effects of pyrrolo[2,3-d]pyrimidines
against DHFR, thymidylate synthase and tumor cells reported by Miwa et al. 8 and Taylor
et al. 9 and the potent cytotoxic effects of the pyrazolo[2,3-d]pyrimidines.10
CHEMISTRY
The synthesis of the target compounds were carried out as shown in Scheme I.
Facile entry into the furo[2,3-d]pyrimidine ring system was provided by the reaction of
2,6-diamino-4-hydroxypyrimidine and 1,3-dichloro acetone in DMF at room temperature
SCHEME 1
NH2 X
6 +
b
N:):)~-o
H2NAN 0
7. X = 3,4,5(0CH3)3 2. X = 3,4,5(0CH3b
8. X = 2,5(0CH3)2 3. X = 2,5(0CH3)2
9. X = 3,4(CI)2 4. X = 3,4(CI)2
10. X = 3,4,5(CI)3 5. X = 3,4,5(CI)3
446
for 24-28 hrs. to afford 6 based on a report by Secrist and Liu. 11 Purification of the
product, which falls out of solution, was carried out via column chromatography to afford
pure 6 in 65-68% yield. Compound 6 was not soluble in DMF or DMAc at room
temperature, thus, heating to 55° C was necessary to form a solution to which was added
3,4,5-trimethoxyaniline 7. The displacement reaction was not fast enough and extensive
degradation of 6 occurred. The reaction, however, proceeded smoothly in anhydrous
DMSO with 2 equivalents of anhydrous K2C03 at room temperature over a period of 72
hrs. to afford the target compound 2. Isolation of 2 from the reaction mixture was greatly
simplified by adding excess water and stirring the mixture at room temperature for 6-8 hrs.
during which time the product 2 separated. The crude product was further purified by
chromatography on silica gel using 5% methanol in chloroform as the eluent. Target
compounds 3-5 were similarly obtained by halide displacement of 6 by the appropriate
anilines 8-10 respectively.
The compounds were evaluated as inhibitors of DHFR from P. carinii, rat liver
(RL), T. gondii, L. casei and recombinant human DHFR and the results are indicated as
IC50 values in Table I. None of the nonclassical compounds 2-5 showed significant
inhibitory effects. However, the classical analogs 11 and 12 (the synthesis and inhibitory
effects of which will be reported shortlyl4) showed significantly greater inhibitory activity
against DHFR and tumor cells in culture and are currently undergoing preclinical screening
against tumor cells in culture by the National Cancer Institute. Clearly a nonclassical 5-
substituted anilino methyl system is not conducive to potent DHFR inhibition in the
furo[2,3-d]-pyrimidines, however, in the classical series a methylamino bridge does
provide for significant inhibition. We have now developed synthetic methodology for three
atom bridged analogs as well as the 6- substituted, 5,6-disubstituted, and ~-alkyl analogs.
Synthesis and biological evaluations of these compounds is currently underway and should
provide a better understanding of the structure activity relationship of furo[2,3-d]-
pyrimidines as potential inhibitors of folate metabolizing enzymes.
447
ACKNOWLEDGEMENTS
This work was supported in part by a grant GM 40998 (AG) from The National
Institutes of General Medical Sciences, NIH, AI 30900 (AG) from NIAID, NIH and by
a Public Health Service contract AI-87240 (SFQ) from the Division of AIDS, NIH.
REFERENCES
1. Gangjee, A; Shi, J.; Queener, S.F. 5-Deaza Nonclassical Folates as Potent and
Selective Inhibitors of Dihydrofolate Reductase From Pneumocystis carinii and
Toxoplasma gondii, Presented at the 23rd National Medicinal Chemistry
Symposium. Buffalo, N.Y. June 14-18, 1992. Abstr:61.
2. Zaveri, N.; Gangjee, A.; Queener, S.F. A Series of Nonclassical2,4-Diamino-6-
(aminomethyl)tetrahydroquinazoline Antifolates: Synthesis and Biological
Activity. Presented at the 204th American Chemical Society National Meeting,
Washington, D.C. August 23-38, 1992, Abstr:MBDI 130.
3. Shi, J.; Gangjee, A.; Queener, S.F. Conformationally Restricted, Tricyclic
Pyrimido[4,5-c][2,7]napthyridine Analogs of Trimetrexate. Presented at the
203rd American Chemical Society National Meeting, San Francisco, CA. April
5-10, 1992. Abstr:MBDI 28.
4. Gangjee, A.; Mavandadi, F.; Queener, S.F. Synthesis and Biological Activity of
Tricyclic, Conformationally Restricted Analogs of Lipophilic Pyrido[2,3-
d]pyrimidines Antifolate. This Symposium.
5. Roth, B. J. Med. Chern. (1969), 12:227.
6. Rosowsky, A.; Chaykovsky, M.; Chen, K.K.N.; Lin, M. and Modest, B.J. J. Med.
Chern. (1973), 16:185,188,191.
7. Blslager, B.F; and Davoli, J. "Lee. in Hetero. Chern.," (1974), 2:S-97.
8. Miwa, T.; Titaka, T.; Akimoto, H. and Nomura, H. J. Med. Chern. (1991),
34:555.
9. Taylor, B.C.; Kuhnt, D.; Shih, C.; Rinzel, S.M.; Grindey, G.B.; Barredo, J.;
Jannatipour, M. and Moran, R.G. J. Med. Chern., (1992), 35:4450.
10. Taylor, B.C. and Patel, H.H. Tetrahedron, (1992), 48:8089.
11. Secrist, III, J.A. and Liu, P.S. J. Org. Chern., (1978), 43:3937.
12. Broughton, M.C.; Queener, S.F. Antimicrob. Agents Chemother, (1991),
35: 1348-1355.
13. Queener, S.F. Identification of Potent and Selective Inhibitors of Toxoplasma gondii
Dihydrofolate Reductase (DHFR) and Dihydropteroate Synthase (DHPS).
Thirty-first Interscience Conference on Antimicrobial Agents and
Chemotherapy, (1991), Abstr:385.
14. Devraj, R.; Gangjee, A. and Kisliuk, R.L. Novel 2,4-Diamino-5-substituted
furo[2,3-d]pyrimidines as Potential Classical Antifolates. Presented at the
205th American Chemical Society National Meeting. Denver, CO. March 28,
- April2, 1993. Abstr:MBDI 19.
448
BICYCLIC CONFORMATIONALLY RESTRICTED
ANALOGS OF NONCLASSICAL PYRID0[2,3-d]
PYRIMIDINES AS POTENTIAL INHffiiTORS
OF DlliYDROFOLATE REDUCTASES
School of Medicine
Indiana University
Indianapolis, IN 46202
INTRODUCTION
Pneumocystis carinii and Toxoplasma gondii remain the major cause of morbidity and
mortality in patients with AIDS. We have recently reported the synthesis of a series of
2,4-diamino-5-methyl-6-substituted pyrido[2,3-d]pyrimidines of general structure 11·2 and
their selective and potent inhibitory activity against dihydrofolate reductases (DHFR) from
P. carinii and T. gondii. These compounds, like the clinically used nonclassical
antifolates, trimethoprim, pyrimethamine and trimetrexate (TMQ), bypass the folate uptake
mechanisms necessary for classical antifolates such as methotrexate and thus are able to
penetrate P. carinii and T. gondii organisms which appear to lack the folate uptake
systems. Compounds 1 were designed as hybrid molecules of the nonselective DHFR
inhibitors TMQ and piritrexim (PTX) to provide more potent and selective inhibitors of
P. carinii DHFR and/or T. gondii DHFR. The most potent and selective of the series of
compounds 1 was that with R1 = CH3 and R2 = 3' ,4' ,5'-trimethoxy which was several
times as potent and selective as the analog with R1 = H as well as TMQ and PTX against
both P. carinii DHFR and T. gondii DHFR. Larger R 1 substituents such as Et, i-Pr and
propargyl decrease potency (except R1 = i-Pr for P. carinii DHFR) with some loss of
selectivity towards both P. carinii DHFR (except R1 = i-Pr) and T. gondii DHFR. In an
attempt to study the effect of conformational restrictions of 7 3 of 1 to potency and
selectivity we have synthesized the methoxy indoline analogs 2-4, the corresponding indole
·~WaR
2&5.R=4-0CH3 N~N8
3&6. R=5-0CH3 H NAN~NJ f ~
2
4 & 7. R = 5,6(0CH3)2 - R
2·4 5-7
CHEMISTRY
Our general approach towards the synthesis of the target compounds was a
modification of the procedure reported by Piper et al. 4 for the synthesis of the common
intermediate 2,4-diamino-5-methylpyrido[2,3-d]pyrimidine-6-carbonitrile 10 (Scheme 1).
Improved yields of this intermediate were obtained on increasing the molar ratios of
guanidine hydrochloride as well as the reaction time (76% :literature4 58%). Compound
10 was reduced to the corresponding aldehyde 11 using Ni-Al alloyS in quantitative yield.
We have previously reported the reductive amination of acetylated 2,4-diamino
tetrahydroquinazoline-6-carboxaldehyde with a variety of secondary anilines and
benzylamines including indoline. 3 This method was employed with the 2,4-diamino-5-
methylpyrido[2,3-d]pyrimidine-6-aldehyde 11 for the synthesis of the target compounds
2-4. The desired indolines were obtained via reduction of the corresponding indoles in
acetic acid with NaCNBH3 • Initial attempts at the reductive amination of 4-methoxy, 5-
methoxy and 5,6-dimethoxy indolines with 11 in 5N HCl-MeOH/NaCNBH3 did not afford
the target compounds 2-4. We reasoned that perhaps limited solubility of 11 in MeOH was
responsible for the failure of the reaction. Thus, we converted the aldehyde 11 to its
acetate salt and carried out the reductive amination in MeOH with NaCNBH3 at a pH =
6, (adjusted with HCl) to afford the target compounds 2,3 and 4 in 30%, 32% and 36%
yields respectively. The IR, 1H NMR and elemental analysis of these compounds
confirmed their structure.
For the synthesis of the corresponding indole derivatives compound 11 was reduced
to the corresponding alcohol 12 using NaBH4 in MeOH. Compound 12 was brominated
with anhydrous HBr/Dioxane to afford the bromomethyl compound 13 as its hydrobromide
salt which was used immediately without purification in the displacement reaction. Initial
450
attempts at alkylating the methoxy indoles with 13 resulted in recovery of starting material,
presumably due to the rapid quenching of the indole anion by the hydrobromic acid present
in 13. However, when 13 was stirred in anhydrous DMF with excess triethylamine and
was then added dropwise to the indole anion generated in situ with NaH in DMF the halide
displacement occurred affording the corresponding indole derivatives 5-7. 6, 7-Dimethoxy-
1,2,3,4-tetrahydroisoquinoline was alkylated with 13 in anhydrous N,N-DMAC using
CsC03 to yield 8 in 70% yield.
SCHEMEl
H : c r CH3
2 N CHO
N
Ni-Al alloy.._ 1_
HCOOH ~N N
(Quant.) H2N
10 11
9
NaCNBH3
MeOH
Ct:J
R R
N,N-DMAC
CsC03 H-N~
~OCH3
NaH,DMF (JQ I
OCH3 H
H
8 5 ,6&7 2,3&4.
Table 1. Inhibitory concentrations (IC 5o) in ~tM against DHFRs and selectivity ratios for
2,3, 4 and 14.
Selectivity Selectivity
ratio ratio
Compound No. Pc" RL!Pc Tg" RL!Tg
2 0.29 0.15 0.52 0.048 3.1
3 0.25 0.17 0.68 0.057 3.0
4 0.41 0.23 0.56 0.049 4.7
14 0.044 0.0076 0.17 0.0088 0.86
TMQ 0.042 0.003 0.07 0.01 0.3
PTX 0.038 0.0015 0.04 0.011 0.14
a: Pneumocystis carinii DHFR; b: Rat liver DHFR; c: Toxoplasma gondii DHFR.
451
This indicated that conformational restriction about r 3 is conclusive to selectivity. The
indole derivatives 5-7 and the tetrahydroisoquinoline analog 8 will be biologically evaluated
in the near future and the results should further define the effects of r 3 restriction with
respect to inhibition of DHFRs.
ACKNOWLEDGEMENTS
This work was supported by a grant GM 40998 (AG) from The National Institutes
of General Medical Sciences, NIH and by a Public Health Service contract AI-87240
(SFQ) from the Division of AIDS, NIH.
REFERENCES
1. Gangjee, A; Shi, J.; Queener, S.F. 5-Deaza Nonclassical Folates as Potent and
Selective Inhibitors of Dihydrofolate Reductase From Pnewnocystis carinii
and Toxoplasma gondii, Presented at the 23rd National Medicinal Chemistry
Symposium. Buffalo, N.Y. June 14-18, 1992. Abstr.:61.
2. Vasudevan, A.; Gangjee, A.; Queener, S.F. Nonclassical 2,4-Diamino-5-methyl-
5-deaza Antifolates: Synthesis and Biological Acitvity. Presented at the
204th American Chemical Society National Meeting, Washington, D.C.
August 23-28, 1992. Abstr: MEDI 148.
3. Zaveri, N.; Gangjee, A.; Queener, S.F. A Series of Nonclassical 2,4-Diamino-6-
(aminomethyl)tetrahydroquinazoline Antifolates: Synthesis and Biological
Activity. Presented at the 204th American Chemical Society National
Meeting, Washington, D.C. August 23-38, 1992, Abstr.:MEDI 130.
4. Piper, J.R.; McCaleb, G.S.; Montgomery, J.A.; Kisliuk, R.L.; Gaumont, Y.;
Sirotnak, F.M. J. Med. Chern., 29:1080-87, (1986).
5. Piper, J.R.; Montgomery, J.A.; Sirotnak, F.M.; Kisliuk, R.L. J. Med. Chern.,
31:264, (1988).
6. Broughton, M.C.; Queener, S.F. Pneumocystis carinii Dihydrofolate reductase used
to Screen Potential Antipneumocystis Drugs. Antimicrob. Agents
Chemother, 35:1348-1355, (1991).
7. Queener, S.F. Identification of Potent and Selective Inhibitors of Toxoplasma gondii
Dihydrofolate Reductase (DHFR) and Dihydropteroate Synthase (DHPS).
Thirty-first Interscience Conference on Antimicrobial Agents and
Chemotherapy, Abstr. 385, (1991).
452
SYNTHESIS, STRUCTURAL AND
BIOCHEMICAL CHARACTERIZATION OF
CYTOSTATIC METHOTREXATE-y-
GLUTAMYL-GLUTATHIONE CONJUGATES
Faculty of Chemistry
University ofKonstanz
P.O. Box 5560
W-77 50 Konstanz, Germany
Introduction
+ .: H 0
.: S H
~H 0 ~ (S H
H~N~N~N........,..COOtBu
APA : COOIBu : H 0
L J
l DCC,HOBt
·
~ COOIBu ~ H
1 -
Pleroy~N~
: H
:
0 :
N--c o
N/'COOtBu
S H
: : '
: H 0 : (S H
Pleroy~N~N~N........,..COOtBu
...
: COOIBu ~
n
H O
TFA-domgo r 1
TFA- cleavage,
DTI - reduction
~ COOH ~H O
Pleroy._;. N~ N..._)J...N/'COOH
: H 0 ~ l5 H
' I
: 0 : S H
.H
Pleroy~ N. ~~ . ~ N........,..COOH
, y - :-N n
: COOH ~ H O n = 2, 3
n 1 ..!
n = 2, 3
!·~
Figure 1. Scheme of synthetic pathways to MTX-y-oligoglutyrnyl-gluthathione conjugates, based on
corresponding oligopeptide precursors. y-Glutarnyl peptide building blocks were obtained by stepwise
N-terrninal prolongation using Frnoc and tert.butylester protecting groups.
454
The final MTX-GSH conjugates 1-4 were obtained by subsequent reductive
dithiothreitol (DTT) cleavage and trifluoroacetic acid (TFA) deblocking in good yields (1 0-
15%, relative to the common glutathionylester precursor; Table 1). Their structures and
molecular homogeneity were established by 1H-NMR and UV-spectroscopy and, particularly,
by fast atom bombardment (FAB) mass spectra (Table 1). As exemplified by the spectrum of
the tert.-butylester precursor of MTX-conjugate 2 (Figure 2), FAB-MS in
3-nitrobenzylalcohol or glyceroVacetic acid matrices provide abundant molecular ions even
for high molecular weight derivatives, and structurally characteristic fragmentation at the
peroyl amide and peptide bonds7.
Nt.xNt~-!2ii:~~HNY'f~~cootBu
H:!N~N N cootBu o cootBu 0)
D
C B
1099 AH+
DH+
2093
BH+ CH+
1887 2020
455
Table 1. Yields, structural data and biochemical characterization of MTX-y-
oligoglutamyl gluthathione conjugates 1-4.
MTX 183
ACKNOWLEDGEMENTS
This work has been supported by grants from the Deutsche Forschungsgemeinschaft,
Bonn, FRG, and by the Fonds der chemischen Industrie.
REFERENCES
l. F.M. Huennekens, K.S. Vitols, and G.B. Henderson, Adv. Enzyme Related Areas Mol. Bioi. 47:313
(1987).
2. K.S. Vitols, Y.D. Montejano, H. Kuefner, and F.M. Huennekens, Pteridines, 1:65 (1989).
3. M. Przybylski, R Renkel, and P. Fonrobert, in: "Chemistry and Biology ofPteridines", B.A. Cooper and
V.M. Whitehead, eds, De Gruyter, Berlin 1986, 65.
4. T. Knepper, M. Przybylski M. Ahlers, and H. Ringsdorf, in: "Chemistry and Biology ofPteridines",
H. C. Curtius, S. Ghisla, N. Blau, eds, De Gruyter, Berlin 1990, 1280.
5. A. Lescynska and G. Pfaff, Biochem. Pharmacal. 34:1627 (1985).
6. J.R. Bertino and G.A. Fischer, Meth. Med. Res. 10:297 (1964).
7. M. Przybylski: in: "Chemistry and Biology ofPteridines", H. C. Curtius, S. Ghisla, N. Blau, eds., De
Gruyter, Berlin 1990, 140.
456
ACTIVATION BY PEPTIDASES AND CYTOTOXICITY OF
2-(L-a-AMINOACYL) PRODRUGS OF METHOTREXATE
Stability of Prodrugs
458
Table 1. Stability and enzymic cleavage of prodrugs
• After a 60-min incubation in 2:10 serum- 1M phosphate buffer pH 7.3 at 37'C, unless otherwise stated.
b Composition refers to a 120-min incubation in 4:10 serum -buffer at 37'C.
Inhibition of DHFR
MTX and Val-MTX were found to inhibit DHFR with IC50 values of 4.7 x 10·8M
and 1.7 x 10·6M respectively. Since Val-MTX is contaminated by 0.6% MTX, the small
degree of inhibition observed is mostly due to contamination. Hence Val-MTX is a
very poor inhibitor of DHFR and is expected to be non-cytotoxic. After Val-MTX was
incubated with AP-M, 37% MTX was formed and the increase in the IC50 to 1.2 x 10·
1M correlates with the MTX concentration. Similar results were observed for Pyr-MTX.
Cytotoxicity
Prodrug - enzyme combinations were tested for their capacity to inhibit the growth
of murine L1210 cells in vitro (Table 2). Prodrugs alone were approximately 10 times
less cytotoxic than MTX, except for Leu-MTX which was substantially cytotoxic. For
the other prodrugs, significant cytotoxicity was observed at high concentrations. Initial
contamination by MTX may partially cause this toxicity. Additionally, the prodrug may
be enzymatically hydrolysed intra- or extracellularily. At this stage, it is not known if
the prodrugs are internalised without prior metabolism.
Inclusion of the appropriate enzyme with the prodrug generally increased
cytotoxicities (Table 2). In the case of Pyr-MTX at 10·8M, the cytotoxicity reached that
of MTX. The increase in cytotoxicities of the other prodrugs was not as great, possibly
because these prodrugs are converted slowly to non-cytotoxic decomposition products.
There was no observed cytotoxicity caused by enzyme alone.
459
Table 2. Effect of MTX-prodrugs on L1210 cell growth"
• After 48 hours; b mean of two determinations(± range); • not tested; d single determination only.
CONCLUSIONS
Our interim results indicate that 2-(L-a.-aminoacyl) derivatives of MTX (except Leu-
MTX) are potential prodrugs. Firstly, they are relatively non-cytotoxic and are not
significantly cleaved in serum. Whether or not these prodrugs are metabolised in vivo has
yet to be determined. Endogeneous intracellular aminopeptidases would be capable of
releasing MTX (except possibly from Pyr-MTX); however, this process would rely on the
prodrugs being transported into the cell. Secondly, exogeneous enzymes are available
which can release MTX and hence could be used in the ADEPT strategy. At present, Pyr-
MTX is the best candidate prodrug since it is very stable in serum. Although the other
prodrugs decompose slowly, it appears that the decomposition product is not cytotoxic.
The disadvantage of decomposition is that the concentration of the prodrug is decreased.
As for the contamination of the prodrugs with MTX, either an efficient method of
separation or an alternative deprotection method needs to be developed.
Acknowledgments: This work was supported by the Leo & Jenny Leukaemia &
Cancer Foundation and the National Health & Medical Research Council of Australia. We
thank Mr. Michael Costello for technical assistance.
References
1. J.H. Freisheim and D.A. Matthews, in: "Folate Antagonists as Therapeutic Agents, Vol.l", F.M. Sirotnak,
J.J. Burchall, W.D. Ensminger and J.A. Montgomery, eds, Academic Press, Orlando (1984).
2. B. Schlagenhauff, C. Klessen, S. Teichmann-Dorr, H. Breuninger and G. Rassner, Cancer 70:113 (1992)
and lit cited.
3. K.D. Bagshawe, Br. J. Cancer 60:275 (1989).
4. P.D. Senter, FASEB J. 4:188 (1990).
5. H.T.A. Cheung, D.K. Boadle and T.Q. Tran, Heterocycles 28:751 (1989).
6. H.T.A. Cheung, Z. Dong, M. Smal and M.H.N. Tattersall, Pteridines, 3:101 (1992).
460
EFFECT OF A NOVEL ANTIFOLATE, N"-(4-AMIN0-4-DEOXYPTEROYL)-N8-
HEMIPHffiALOYL-L-ORNITHINE (PT523), ON GROWffi OF H35 RAT
HEPATOMA AND HEPG2 HUMAN HEPATOMA CELLS
INTRODUCTION
Structural modifications of folic acid have generated various derivatives that act at
different target sites. Well-known examples include the dihydrofolate reductase (DHFR)
inhibitor methotrexate (MTX), 1-3 the thymidylate synthase inhibitor 2-desamino-2-methyl-
W0-propargyl-5,8-dideazafolic acid, 4·5 and the glycinamide ribonucleotide formyl-
transferase inhibitor 5,1 0-dideaza-5, 6, 7, 8-tetrahydrofolic acid. 6•7 More recently, folate
analogues containing ornithine in place of glutamate have been synthesized as inhibitors
of folylpolyglutamate synthetase. 8•9 These ornithine-containing analogues showed weaker
activity than the corresponding glutamate-containing analogues on cell growth presumably
because of inefficient transport across the cell membrane. 9•10 In contrast, a novel derivative
of an ornithine-containing antifolate, N"-(4-amino-4-deoxypteroyl)-N-hemiphthaloyl-L-
ornithine (PT523), exhibits potent in vitro and in vivo antitumor activity.U
In the present study the effect of PT523 on cell growth was examined in cultured
H35 rat hepatoma and HepG2 human hepatoma cells.
Cell Culture and Growth Inhibition. H35 rat hepatoma cells were grown in Swim's
medium containing 20% horse serum and 5% FBS, 13 HepG2 cells in Dulbecco's MEM
Table 1. Effect of PT523 on growth inhibition of H35 cells and HepG2 cells.
ICso (J.tM) •
H35 cells HepG2 cells
462
Table 2. Effect of PT523 on de novo biosynthesis of thymidylate and purine by H35 cells
and HepG2 cells.
Cells were exposed to drug for the last 4 h of a 72 h culture.
IC50 {J.tM)"
H35 cells HepG2 cells
WH]UdR
PT523 0.009 0.03 0.009 0.012
MTX 0.22 0.24 0.62 1.68
Due to its lack of a glutamate side chain, PT523 was not considered a likely
substrate for polyglutamylation. This was established by incubation with folylpolyglutamate
synthetase, ATP and [3H]glutamic acid which resulted in the complete absence of
glutamate incorporation (unpublished results). Yet, PT523 was clearly more potent than
MTX, which does form polyglutamates. One of the characteristics of the non-glutamatable
analogue of MTX, fluoro-MTX, is that its toxicity in short term treatment is vastly
reduced relative to MTX. 21 This is presumably because fluoro-MTX can not be
glutamylated and is poorly retained by the cell. When a 72 h exposure to MTX was
compared with a 2 h pulse, the latter condition required 80-fold more MTX to inhibit
growth by 50% (Table 1 & 3, ref 21). In an analogous experiment a 2 h pulse of fluoro-
MTX was 6000-fold less effective than a 72 h exposure. 21 When the same comparison was
made with PT523 in H35 and HepG2 cells, a 2 h pulse resulted in a 70-fold and 20-fold
increase in IC50 , respectively (Tables 1 & 3). Therefore, in spite of the fact that PT523
can not be glutamylated, it acts as a potent growth inhibitor even after an exposure time
of only 2 h. This suggests that there may be unidentified mechanism(s) for the cellular
retention of this compound or its growth inhibitory effects.
It has been demonstrated that treatment of cells with MTX resulted in DNA
fragmentation/2•23 which was closely linked to cytotoxicity. 22 We have examined the effect
of PT523 on DNA fragmentation in human U937 myeloid cells. Similar DNA laddering
in the multimers of approximately 200 base pairs was observed with a ten-fold lower
concentration of PT523 (150 nM) than MTX (1500 nM) (unpublished results).
463
In summary, the results of this study indicate that an unique analogue of aminopterin
with the glutamate side chain replaced by N8-hemiphthaloyl ornithine, PT523, exhibits a
greater potency than MTX on the growth of HepG2 human hepatoma and H35 rat
hepatoma cells. The 2,4-diamino structure of this compound, and its nearly equivalent
inhibition of glycine and deoxyuridine incorporation, suggest that dihydrofolate reductase
is the primary target site in intact cells. Although PT523 is unlikely to be glutamylated,
it appears to retain stronger inhibitory activity than MTX when used in short term
exposures. This result, coupled with the very low IC50 for growth inhibition, presents the
likelihood of facile cell entry and prolonged retention or activity once inside the cell.
Acknowledgements
This work was supported by NIH grants CA25933 (JG) and CA25394, CA19589 (AR).
The authors acknowledge the excellent technical assistance of Aiga Pupons.
REFERENCES
1. W.D. Ensminger, in: "Folate Antagonists as Therapeutic Agents," F.M. Sirotnak:, J.J. Burchall,
W.D. Ensminger, and J.A. Montgomery, eds., Academic Press. NY (1984).
2. J.R. Bertino, Cancer Res 39:293 (1979).
3. R.C. Jackson and G.B. Grindey, in "Folate Antagonists as Therapeutic Agents," F.M. Sirotnak:, J.J.
Burchall, W.B. Ensminger and J.A. Montgomery, eds., Academic Press, NY (1984).
4. L.R. Hughes, A.L. Jackman, J. Oldfield, R.C. Smith, K.D. Burrows, P.R. Marsham, J.A.M.
Bishop, T.R. Jones, B.M. O'Connor, and A.H. Calvert, J. Med. Chem. 33:3060 (1990).
5. S.D. Patil, C. Jones, M.G. Nair, J. Galivan, F. Maley, R.L. Kisliuk, Y. Gaumont, D. Duch, and
R. Perone, J. Med. Chem. 32:1284 (1989).
6. D.H. Boschelli, S. Webber, J.M. Whiteley, A.L. Oronsky, and S.S. Kerwar, Arch. Biochem.
Biophys. 265:43 (1988).
7. G.P. Beardsley, B.A. Moroson, E.C. Taylor, and R.G. Moran, J. Biol. Chem. 264:328 (1988).
8. S.A. Patil, B. Shane, J.H. Freisheim, S.K. Singh, and J.B. Hynes, J. Med. Chem. 32:1559 (1989).
9. A. Rosowsky, J.H. Freisheim, R.G. Moran, V.C. Solan, H. Bader, J.E. Wright, and M. Radike-
Smith, J. Med. Chem. 29:655 (1986).
10. J.J. McGuire, W.E. Bolanowska, and J.R. Piper, Biochem. Pharmacal. 37:3931 (1988).
11. A. Rosowsky, H. Bader, and E. Frei, Proc. Am. Assoc. Cancer Res. 32:325 (1991).
12. A. Rosowsky, H. Bader, and R.A. Forsch, Pteridines 1:91 (1989).
13. M.S. Rhee, M. Balinska, M. Bunni, D.G. Priest, G. Maley, F. Maley, and J. Galivan, Cancer Res.
50:3969 (1990).
14. J. Galivan, M.S. Rhee, D.G. Priest, M. Bunni, J. Freisheim, and J. Whiteley, in: "Purine and
Pyrimidine Metabolism in Man VII" R.A. Harkness, ed., Plenum Press, NY (1991).
15. M.L. Sherman, R.M. Stone, R. Datta, S.H. Bernstein, and D.W. Kufe, J. Biol. Chem. 265:3320
(1990).
16. J. Galivan, M.S. Rhee, T. Johnson, R. Dilwith, M.G. Nair, M. Bunni, and D.G. Priest, J. Biol.
Chem. 264:10685 (1989).
17. G.J. Finlay, B.C. Baguley, and W.R. Wilson, Anal. Biochem. 139:272 (1984).
18. D.S. Duch, M.P. Edelstein, S.S.W. Bowers, and C.A. Nichol, Cancer Res. 42:3987 (1982).
19. E. Cadman, C. Benz, R. Heimer, and J. O'Shaughnessy, Biochem. Pharmacal. 30:2469 (1981).
20. H. Gunji, S. Kharbanda, and D.W. Kufe, Cancer Res. 51:741 (1991).
21. J. Galivan, J. Inglese, J. McGuire, Z. Nimec, and J.K. Coward, Proc. Natl. Acad. Sci. 82:2598
(1985).
22. M.A. Barray, C.A. Behnke, and A. Eastman, Biochem. Pharmacal. 40:2353 (1990).
23. J.B. Kowk and M.H. Tattersall, Br. J. Cancer 65:503 (1992).
464
TUBULIN BINDING PROPERTIES OF TWO CHIRAL ISOMERS
WITH 1-DEAZA-7,8-DIHYDROPTERIDINE STRUCTURE*
INTRODUCTION
RESULTS
200
w
~
~ 150
~
;
w100
50
240 280 320 360 400 440 480 520 560 600 640
WAVELENGTH (nm)
Figure 1
Fluorescence changes produced by the tubulin-isomer interaction.
a) blank of 2 11M tubulin without ligand. b) fluorescence excitation
and emission spectra of 3 11M R-enantiomer without tubulin. c)
fluorescence excitation (emission at 470 nm) of 3 11M R and 2 11M
tubulin. d) fluorescence emission (excitation at 380 nm) of 3 11M R and
2 11M tubulin.
The inset shows (4-3) the bound fluorescence excitation and emission
spectra of 3 pM S-enantiomer, (2) fluorescence excitation and emission
spectra of 3 11M S-enantiomer without tubulin. (1) blank of 2 11M
tubulin without ligand.
466
indicated that podophyllotoxin and MTC displaced the two
enantiomers from their binding sites. The order of addition
of the reagents did not modify the results. To check
whether the R- and s-enantiomers bound to the same site, we
added the R-enantiomer to tubulin and recorded the relative
fluorescence. When the plateau was attained, an excess of
s-enantiomer was added and the time course of the
fluorescence change was followed. The effect of s-
enantiomer indicated that the R-tubulin complex was
dissociated in less than 20 minutes.
DISCUSSION
Inhibition of polymerization
Results indicated that the S and R enantiomers
substoichiometrically inhibited the assembly of
microtubules, as do colchicine, podophyllotoxin and
vinblastine. The s-enantiomer is a more potent inhibitor
than the R-enantiomer. Like colchicine analogues, they do
not disrupt preformed microtubules. In the same
experimental conditions (glycerol and high Mg
concentrations) vinca-alkaloids were reported to completely
disrupt preformed microtubules and to form a large number
of spirals3.
Binding characteristics
s- and R-enantiomer binding to tubulin as well as the
localization of their high affinity binding sites were
investigated. The apparent binding constants to tubulin
467
heterodimer are higher than that of the colchicine
analogue 4 (MTC : Ka = 5 x 105 M- 1 ), but close to that of
colchicine5 (c.a. 107 M-1) or podophyllotoxin6 2 x 106 M-1.
Furthermore, binding measurements indicated that there is
one binding sitejtubulin dimer, as for colchicine and its
analogues.
The consequences of the binding to tubulin (GTPase
activity) and competition reactions indicate that the two
enantiomers may bind to a site common to colchicine and
podophyllotoxin.
FOOTNOTES
REFERENCES
468
EFFECTS OF FOLIC ACID ON PYRIMETHAMINE TERATOGENESIS IN RATS
INTRODUCTION
ANIMAL STUDY
A. Embryotoxicity of PYR
Rats: Wistar rats were used. PYR and folinic acid were administered in-feed and
PteGlu was administered in-feed or intraperitoneally (i.p.) for 5 days of day 11-15 preg-
nancy. The results were represented in Table 1. The PYR embryotoxicity was potentiated
by oral PteGlu and reduced by i.p. PteGlu or oral folinic acid. Frequent malformations
included cleft palate and brachygnathia.
Mice: ICR mice were used. PYR and PteGlu were administered by gavage as
suspension in 1% carboxyl methyl cellulose solution and folinic acid was injected i.p. for 7
470
--..- PYR3.6(mg/kg)
----- PYR1.6+PteGlu50p.o.
150 --o- PYR3.6+PteGlu50i.p.
-tr- PYR3.6+folinic acid120p.o.
100
15 20 25
Time(hr)
Figure 1. The plasma 5-CH3 -HlteGlu concentration-time curves after single administration of PYR
3.6mg!kg, PYR1.6+PteGlu50mg!kg(p.o.), PYR3.6+PteGlu50mg!kg(i.p.) and PYR3.6+folinic acid 120mg!kg
(p.o.) in rats. Each point represents mean±S.E. (n=4).
level corresponded to the development of the embryotoxicity. Similar results were ob-
tained in mice.
Effects of oral PteGlu on the pharmacokinetic profile of PYR were determined using
non-pregnant rats and mice to examine a possible mechanism of the potentiated embryo-
toxicity of PYR by PteGlu. The plasma PYR level was determined by the HPLC-UV
method 6 • The time course of plasma PYR level was not affected by oral PteGlu. Similar
results were obtained in mice.
1) The embryotoxicity of PYR was potentiated by oral PteGlu in rats and mice. On
the other hand, it was reduced by i.p. PteGlu.
2) A good relation between the decrease of plasma 5-CH3-H4PteGlu level and the
embryotoxicity was demonstrated.
3) The pharmacokinetics of PYR was not affected by the concomitant oral PteGlu in
rats and mice.
We suggest that the potentiated embryotoxicity of PYR by oral PteGlu dosing resulted
from the decrease of plasma 5-CH3- HlteGlu in dams. It has been described that a large
amount of 5-CH3-H4 PteGlu is circulating in the enterohepatic cycle and it plays an
important role in folate homeostasis 7 • In addition it has been reported that PteGlu inhibits
the absorption of 5-CH3-H4PteGlu in the intestinal mucosa 8• Therefore, the potentiated
471
decrease of plasma 5-CH3-HlteGlu may be induced by the interruption of the entero-
hepatic circulation of 5-CH3-HlteGlu by PteGlu.
REFERENCES
472
MUTATIONS OF HUMAN DIHYDROFOLATE REDUCTASE CAUSING
DECREASED INHffiiTION BY METHOTREXATE
INTRODUCTION
Table 1. Variant DHFRs found in mammalian cell lines selected for resistance to
methotrexate
Most of the side chains lining the active site cavity of DHFR are hydrophobic and the
four variants of mammalian DHFR that have been identified in cells resistant to MTX have
substitutions in two of these residues, Leu22 and Phe31 (Table 1). Other variants of mouse
or human DHFR that have decreased sensitivity to MTX as a result of substitutions for
active site hydrophobic residues have been obtained by directed mutagenesis. 7 •8 We are
producing variants of hDHFR by directed mutagenesis at codons for such hydrophobic
residues, and we are extensively characterizing those variants that have greatly decreased
affinity for MTX but nevertheless retain a relatively high turnover number (k.:.J, and
relatively low Ku, values for NADPH and dihydrofolate.
RESULTS
Of the 13 variants that we have prepared and studied to date, all except three have
significantly decreased affinity for MTX (at least 70 times lower than for WT). Affinity
was measured in two ways as appropriate for the characteristics of the enzyme. (1) Where
474
K,. for dihydrofolate could be determined without difficulty, K, was determined by fitting
data for MTX inhibition of steady state velocity to the appropriate equation for a tight-
binding inhibitor by the use of a modification of the CRICF program. 10 (2) Where
substrate inhibition prevents accurate determination of K,. for dihydrofolate (Phe34 and
some Leu 22 variants) we determined the ternary equilibrium dissociation constant, KJ, for
MTX binding to the enzyme.NADPH complex. Kd was obtained by measuring the
quenching by MTX of the fluorescence of the enzyme.NADPH complex, and by fitting the
data to the appropriate equation by the use of the program already mentioned.
The greatest decrease in MTX affinity found to date was for the Phe34 ~ Ser mutation
for which the ternary Kct is 228 nM. Since K, for MTX for WT is 0.0034 nM, 11 this
represents a 67,000-fold decrease in affinity for MTX in this variant. It is noteworthy that
this represents a much lower affinity for MTX than measured for those variants found in
resistant cell lines that we have investigated.
The higher Kd for MTX could be the result of a decrease in k.,., an increase in korr,
or both. There is also another possibility. The WT hDHFR.NADPH.MTX initially
formed isomerizes to a non-dissociating form, and this isomerization increases MTX
binding by a factor of 60. If mutations make this isomerization unfavorable this would
also contribute to elevation of Kct for the MTX complex.
In the case of at least one variant, k.,. is decreased by a factor of only 5, so that most
of the increase in Kd is due either to an increase in korr or to decreased isomerization, or
both. We have been able to find no evidence for isomerization of the ternary MTX
complex of this variant, so that loss of this isomerization step appears to be the major
cause of decreased affinity of MTX.
MTX and dihydrofolate bind differently in the active site cavity, MTX having its
pterin ring rotated 180° (flipped over) compared with the way in which the pterin ring of
folate (and dihydrofolate) binds. This permits MTX to become protonated and make an
ionic interaction with the side chain carboxylate group of Glu30 • Folate and dihydrofolate
do not make such an ionic interaction. Nevertheless, when folate and dihydrofolate bind
to WT enzyme their pterin rings interact with hydrophobic side chains in the cavity in a
similar manner to MTX. It might therefore be expected that mutations greatly decreasing
the affinity for MTX will similarly decrease the affinity for dihydrofolate. Such a large
decrease in affinity for dihydrofolate, coupled with the fact that the concentration of
dihydrofolate is cells is very low (_~0.1 ~tM), would make the variant enzyme very
inefficient at maintaining levels of tetrahydrofolate and its derivatives.
The affinity of dihydrofolate for the DHFR.NADPH complex was measured in several
ways. (1) Although K"' is often a poor measure of substrate affinity, it provides a
reasonable approximation to Kct for the ternary substrate complex when the chemical
transformation step is very slow compared with the rate of substrate binding and
dissociation, and such is the case with these variants of hDHFR. Consequently, when
there was no substrate inhibition, so that K,. could be measured accurately, this parameter
was used as the estimate of Kct for binding to the DHFR.NADPH complex. (2) When
substrate inhibition prevented accurate determination of K,n and when Kd was large enough,
it could be measured by the dependence of the rate of product formation on dihydrofolate
concentration during transient state kinetics in single turnover experiments (NADPH
substoichiometric with respect to enzyme). These experiments were conducted by stopped-
flow measurement of the absorbance change at 340 nm as dihydrofolate binds and reacts.
475
(3) In cases of substrate inhibition where ~ for the ternary substrate complex was not
large ( -1 p.M), it can be obtained by examining the kinetics of dihydrofolate binding as
measured by stopped flow fluorimetry. This gives k,rr (rate constant for dihydrofolate
dissociation) and k,., (rate constant for dihydrofolate association). The ratio korrlk,n gives
the ternary Kct.
We have found that, in all the cases that we have examined, the decrease in affinity
of dihydrofolate for apoenzyme or for enzyme.NADPH complex is much less than the
decrease in affinity for MTX for the same variant. The maximum ternary ~ for
dihydrofolate observed was about 400-fold higher than for WT, but this increase is
associated with increases of 12,000 to 67,000 in the ternary ~ for MTX. For some
variants the affinity for dihydrofolate was actually increased.
~ values for binary complexes of dihydrofolate with some of the variant hDHFRs
were determined by titration of the enzyme fluorescence with dihydrofolate. It was found
that affinity of dihydrofolate for the apoenzyme was also decreased little or even increased,
even in the case of variants with large increases in ternary ~ for MTX.
The rate constant (~heJ for the chemical transformation step can be measured in
single turnover experiments with a stopped-flow spectrophotometer. Change in absorbance
at 340 nm with time over a short time period is described by an exponential term with a
rate constant, k,bs· When either k,b, or the initial velocity of the change is plotted as a
function of dihydrofolate concentration, a rectangular hyperbola is obtained. Under
favorable conditions both the ternary Kct for dihydrofolate and ~hem can be obtained by
suitable treatment of the data. For all variants for which it has been measured ~hem is
much lower than the value of 1360 s· 1 for WT hDHFR. 12 Values range from 7 to 36 s· 1 •
Clearly, the interaction of the substrates with the hydrophobic residues that were varied
is critically important for the chemical transformation step, i.e., hydride and proton
transfer to dihydrofolate.
On the other hand, ~.1 is decreased little by most mutations and increased by several.
This result is compatible with the greatly decreased k.:hem produced by these mutations
because for WT hDHFR k.:hem (1360 s· 1) is much greater than 1<,.1 (11 s· 1). 12 The rate of the
catalytic cycle for the WT enzyme is therefore completely limited by the rate of
dissociation of the products, NADP and tetrahydrofolate (Figure 1).
As seen in Figure 1, the rate constant for dissociation of NADP from E.NADP. THF,
the ternary product complex is only about twice that for tetrahydrofolate dissociation from
this complex, so that the enzyme uses a pathway branching at this point. Since the
resulting binary complexes of NADP and tetrahydrofolate have low dissociation rate
constants, substrate binds to them before they can dissociate, and the result is the formation
of the abortive ternary complexes: E.NADP.DHF and E.NADPH.THF. Dissociation of
product from the E.NADPH.THF complex is faster than for the E.THF complex, but is
still relatively slow, and this dissociation contributes to limitation on the rate of the overall
reaction. NADP dissociation from E.NADP.DHF is so slow that at steady state much of
the WT enzyme accumulates as this complex. Although about 70% of product formation
at steady state occurs by the pathway indicated by bold arrows (Figure 1), dissociation of
NADP from E.NADP.DHF is a major limitation of the overall rate.
Although some of the mutations we have investigated decrease ~hem by a factor of
40-50, ~.1 is often increased by these mutations because of decreased formation of
E.NADP.DHF and/or an increased rate of NADP dissociation from it. For many of our
hDHFR variants (perhaps all of them) the chemical transformation contributes to overall
rate limitation, as we have shown in some cases by demonstrating that the overall reaction
476
Figure 1. Major branched catalytic pathways for wild-type hDHFR. Bold arrows indicate the faster of the
two pathways. Numbers against arrows indicate association rate constants (units, JLM- 1 s 1), or dissociation
rate constants (units, s· 1). Symbols are: E, wthDHFR; NH, NADPH; DHF, dihydrofolate; N, NADP; THF,
tetrahydrofolate.
is slower when NADPD replaces NADPH in the reaction. However, this limitation is
offset to a greater or lesser extent by the faster overall dissociation of products.
In the case of variants that show substrate inhibition by dihydrofolate, this inhibition
is due to increased accumulation ofE.NADP.DHF at high concentrations of dihydrofolate.
Phe34 variants show such behavior, and in their case we have also obtained preliminary
evidence that tetrahydrofolate dissociates much more rapidly than NADP from the ternary
substrate complex, so that E.NADP is formed. At low concentrations of dihydrofolate this
dissociates to give apoenzyme which can then bind substrates to start a new cycle.
However, at increasing concentrations of dihydrofolate, more and more E.NADP is
converted to E.NADP.DHF from which NADP dissociation is quite slow.
477
Relation of Structural Changes to Function changes
Until the crystal structures of complexes of these variant hDHFRs with folate and with
MTX are solved, the extent of structural changes is largely a matter of speculation.
However, a number of conclusions seem plausible. Our results suggest that contact
between Phe34 and the pterin ring of bound folate, dihydrofolate or MTX is very important
for strong binding of these ligands, and for hydride transfer between NADPH and
dihydrofolate. It will be of interest to determine whether shrinking of the side chain of this
residue results in altered location of folate (and perhaps of NADPH also) in the active site
cavity.
Shrinking the side chain of residue 31 also decreases binding of MTX but binding of
folate and dihydrofolate is actually increased. A possible explanation may be that a fixed
water molecule occupies the space normally occupied by the phenyl ring of residue 31,
with a consequent alteration in the dielectric constant of the site, reducing the strength of
the ionic bond between Glu30 and N1 of bound MTX.
Effects of side chains that have been increased in size are most likely due to steric
effects, possibly resulting in significant movements of several components of the active
site, so that binding interactions become suboptimal.
It is significant that in all the replacements of Leu22 , Phe31 and Phe34 for which we
have information at this point, there is a drastic decrease in k.:hem· This suggests that all
these hydrophobic residues are important in promoting the formation of the transition state
in which hydride and proton transfer occurs.
Our results indicate that the potential exists to bioengineer variants of hDHFR that
should be superior to those isolated from resistant cell lines in their ability to confer
resistance to MTX on cells. Although trials of transfection of the eDNA for such variants
into cells have yet to be reported there seems no obvious reason why they should not be
as successful as those already reported for other variants. 5•6 Possibly some of them may
also be more protective of recipient animals against MTX in gene transfer experiments.
Acknowledgements
This work was supported in part by USPHS Research Grant CA 31922 from the
National Cancer Institute, by a John Sununu Postdoctoral Fellowship (to S.K.C.), and by
the American Lebanese Syrian Associated Charities.
REFERENCES
1. C.C. Simonsen and A.D. Levinson, Proc. Nat!. Acad. Sci. 80:2495 (1983).
2. P.W. Melera, J.P. Davide, and H. Oen, J. Bioi. Chern. 263:1978 (1988).
3. S. Srimatkandada, B.I. Schweitzer, B.A. Morenson, S. Dube, and J.R. Bertino, J.
Bioi. Chern. 264:3524 (1989).
4. R.S. Mcivor and C.S. Simonsen, Nucl. Acids Res. 18:7025 (1990).
5. D.A. Williams, K. Hsieh, A. DeSilva, and R.C. Mulligan, J. Exp. Med. 166:210
(1987).
6. C.A. Corey, A.D. DeSilva, C.A. Holland, and D.A. Williams, Blood 75:337
(1990).
7. J. Thillet, A. Josette, S.R. Stone, and R. Pictet, J. Bioi. Chern. 263:12500 (1988).
8. B.I. Schweitzer, S. Srimatkandada, H. Gritsman, R. Sheridan, R.
Venkataraghavan, and J.R. Bertino, J. Bioi. Chern. 264:20786 (1989).
478
9. J.F. Davis, T.J. Delcamp, N.J. Prendergast, V.A. Ashford, J.H. Freisheim, and
J. Kraut, Biochemistry 29:9467 (1990).
10. J.P. Chandler, D.E. Hill, and H.O. Spivey, Comp. Biomed. Res. 5:515 (1972).
11. J.R. Appleman, N. Prendergast, T.J. Delcamp, J.H. Freisheim, and R.L. Blakley,
J. Bioi. Chern. 263:10304 (1988).
12. J.R. Appleman, W.A. Beard, T.J. Delcamp, N.J. Prendergast, J.H. Freisheim, and
R.L. Blakley, J. Bioi. Chern. 265:2740 (1990).
479
CONFORMATIONAL ANALYSIS OF HUMAN DIHYDROFOLATE
REDUCTASE INHIBITOR COMPLEXES: CRYSTAL STRUCTURE
DETERMINATION OF WILD TYPE AND F31 MUTANT BINARY AND
TERNARY INHffiiTOR COMPLEXES
INTRODUCTION
DHFR Inhibitors
482
METHODS
Recombinant wild type human DHFR was obtained from Dr. Freisheim and the F31
mutants from Dr. Blakley. The antifolate samples MTXT and AMP were obtained from
Dr. Kalman, CB3717TG from ICI (UK), 10-EDAM from Dr. Bertino, PTX from
Burroughs Wellcome and TMQ from Park Davis (Ml). Crystals were grown with
NADPH and inhibitor incubated together with 2.7 mg/ml enzyme in O.lM potassium
phosphate buffer pH 6. 9 and 30% ammonium sulfate. Hanging drop experiments were
carried out at room temperature with 60% ammonium sulfate, O.lM phosphate buffer, pH
6. 9, in the wells and 10 ~-tl protein solution. Rhombohedral crystals grew in about 2-4
weeks. All complexes crystallize in the rhombohedral space group R3 and are
isomorphous with that reported for the R3 human folate binary complex 7 . Data for
CB3717TG was collected on a Siemens area detector at Wayne State University (with
special thanks to Jean Stuckey and Dr. Brian Edwards) and all others were collected on
the Rigaku RAXIS-IIc imaging plate area detector at the Medical Foundation of Buffalo.
Initial phases for the MTXT complex were calculated using the enzyme coordinates from
the human binary folate complex 7 and all others from the MTXT ternary complex X.
Refinement was carried out with the restrained-constrained least-squares program
PROLSQ in combination with the model building program FRODO on the graphics
graphics system.
RESULTS
Analysis of these crystal structure complexes reveals that their secondary structures
are similar to that of the isomorphous human DHFR folate binary complex 7 although
there is a different fold of the flexible loop near residues 40-47 and a cis-peptide link at
Pro-668. A suggested role of the flexible loop 40-46 in these enzymes has been to
communicate the effects of ligand binding and reversible protein unfolding during
activation 9. When the conformation of this loop is compared with that of the folate
binary structure 8, these data show that it has moved significantly away from the position
in the folate structure thereby removing the non bonded contacts with the loop at residues
100-IOS, also observed in the avian holo enzyme. However, in the triclinic human binary
complex 10, these interactions differ from those of the R3 data 7 in that the four N-
terminal residues were not observed in the electron density maps of the folate complex.
The proximity of these three loops to theN-terminus suggests that flexibility in this
region could permit communication with the active site and thus the binding interactions
of the inhibitors and substrates.
By far the most striking results are the unexpected binding interactions observed for
the lipophilic antifolates piritrexim and trimetrexate. Data for the ternary complex with
PTX reveals several differences in its active site interactions compared with MTXTX: the
diaminoquinazoline ring is oriented differently compared to the pteridine ring of other
antifolates, the PTX 5' -methoxy interacts with the nicotinamide-ribose rings, Phe-31
moves and has two alternate orientations, and Gln-35 and Thr-3X move to form hydrogen
bonds to Arg-70 in the absence of an inhibitor a-COOH (Fig. 2). This PTX orientation
also differs from those proposed from modeling studies which suggested that PTX could
occupy two different positions in which one of the methoxy groups could interact with
either Asn-21 or Asn-6411.
483
Figure 2. Stereo companson of DHFR-PTX (solid) and MTXT (dashed).
Unusual binding interactiOns were also observed in the ternary complex of the F31A
mutant with TMQ. In th1s structure, preliminary results show the cofactor nicotinamide
ring is nearly perpendicular to the methoxy benzoyl ring of TMQ (Fig. 3). The binding
of TMQ also differs from that of MTX and PTX as the pteridine ring is displaced further
away from from the cofactor stte than the MTX ternary complexes and is in the opposite
direction observed for PTX. While the absence of the bulk of the phenyl ring of F31 in
this F31 A mutant may accommodate this movement, at this early stage of refinement,
there are no significant dtfferences between the two structures.
Interpretation of the two CB3717 folate inhibitor complexes shows the pterin ring
binds in a folate onentatwn with N3 and N2 interacting with Glu-30 and the NlO-
propargyl group occupies two different orientations in the wild type and F31 A mutant.
The propargyl group is pointed toward Ser-59 in the wild type complex because of the
close interaction wtth a partially occupied cofactor site, probably 10% (Fig. 4). There is
also density for the trigluatmate in more than one orientation. However, because of
ambiguities in interpretatiOn of weak density for the cofactor and triglutamate side chain,
a final model will have to await completion of the refinement. In the case of the F31A
mutant, the propargyl group is oriented toward Leu-22 and there is no interpretable
density for the cofactor. However, as observed in the folate binary complex7 , sulfate ions
from the buffer are bound in the phosphate positions of the NADPH site. There was also
no interpretable density for the triglutamate side chain. There are no sigmficant changes
in the active site because of the F31 A mutant and a structural water fills the cavity made
by the replacement of Phe with Ala at position 31.
484
Data for the F31 G mutant bound with 10-EDAM and wild type MTXT (Fig. 5) show
that the orientation of the 10-ethyl differs from that of the NlO-methyl substituent. In this
case, the geometry and stereochemistry about the 10-position can vary compared to the
N 10 substituent in the normal folates. Again, these data are still in an unrefined state and
definitive details needs to await completion of the structure refmement.
Figure 4. Stereo comparison ofDHFR-F31A-CB3717 (solid) and wild type DHFR-CB3717TG (dashed).
Figure 5. Stereo comparison of wild type DHFR-MTXT (solid) and F31G-10-EDAM (dashed).
The interactions of MTXT and AMP in the ternary complex are similar to those of
MTX observed in bacterial ternary complexes in that Glu-30 hydrogen bonds to Nl and
N2 of MTXT and to Thr-136 which in turn interacts with a conserved water that also
hydrogen bonds to N2; N4 hydrogen bonds to the oxygens of Ile-7 and Tyr-121. While
the a-COOH of MTXT hydrogen bonds to the conserved Arg-70, there are no enzyme
contacts to the y-tetrazole ring which hydrogen bonds to a water. The cofactor NADPH
has an extended conformation, similar to other cofactor complexes and makes a close
contact to the MTXT N5 position 8. The conformation of AMP in its ternary complex is
similar to that of the MTXT.
The cofactor NADPH in all structures is bound in an extended conformation and
occupies a long, shallow cleft that covers the carboxy terminal ends of five strands of~
sheet. The closest enzyme-cofactor contacts, with the exception of the F31 A-TMQ
structure, are to the nicotinamide ring.
SUMMARY
These structural studies reveal unusual intermolecular interactions for the binding of
inhibitors and cofactor in ternary complexes with both wild type and F31 mutant
485
recombinant human DHFR and show that these inhibitors have flexibility in occupying
the active site. These studies also possibly indicate the first structural data for a ternary
complex with a folate inhibitor and a polyglutamate side chain. However, further
refinement of this data is necessary before this can be confirmed. In contrast to the
ternary complexes of folate and MTX, the lipophilic antifolate PTX binds with its
methoxybenzoyl ring oriented toward the cofactor nicotinamide ring, while that of TMQ
it is bound closer to the Phe-31 position. Furthermore, the nicotinamide ring makes a
close contact to the NlO amine of TMQ, significantly different from its binding site
interactions in MTX complexes. These data also reveal that the conserved contacts
between the cofactor carboxyamide with the enzyme backbone residues Ala-9 and Ile-16
are dictated by the enzyme and that changes in the orientation of the structural elements
requires only subtle changes in the secondary structural units in which they are contained.
Therefore, only by careful analysis of a series of enzyme complexes can the mechanisms
of binding action be delineated.
ACKNOWLEGDEMENTS
This research was supported in part by a grant from the Buffalo Foundation (VC)
and NIH CA34714 (VC), CA41461 (JHF), CA31922 (RLB) and CA35212 (TIK).
REFERENCES
1. Bertino, J. R., Sobrero, A., Mini, E., Moroson, B. A. & Cashmore,A., Design and Rationale for Novel
Antifolates, NCI Monogr 5:87-91 (1987).
2. Li, W-W., Lin, J.T., Tong, W.P., Trippett, T.M., Breunan, M.F., Bertino, JR., Mechanisms of Natural
Resistance to Antifolates in Human Soft Tissue Sarcomas, Can. Res. 52, 1434-1438 (1992).
3. Srimatkandada, S., Schweitzer, B., Moroson, B., Dube, S., Bertino, J., Amplification of a
Polymorphic Dihydrofolate Reductase Gene Expressing an Enzyme with Decreased Binding to
Methotrexate in a Human Colon Carcinoma Line, HCT8R4, Resistant to this Drug. J. Bioi.
Chern. 264, 3524-3528 (1989).
4. Schweitzer, B.l., Srimatkandada, S., Gritsman, H., Sheridan, R., Venkatarajhavan, R., Bertino, J.R.,
Probing the Role of Two Hydrophobic Active Site Residues in the Human Dihydrofolate
Reductase by Site-directed Mutagenesis, J. Bioi. Chern. 264,20786-20798 (1989).
5. Tsay, J.T., Appleman, J.R., Beard, W.A., Prendergast, N.J., Delcamp, T.J., Freisheim, J.H. &
Blakley, R.L., Kinetic Investigation of the Functional Role of Phe-31 of Recombinant Human
DHFR, Biochem. 29:6428-6436 (1990).
6. McGuire, J.J., Russell, C.A., Bolanowska, W. E., Freitag, C.M., Jonas, C.S. & Kalman, T.I.,
Biochemical and Growth Inhibition Studies of Methotrexate and Aminopterin Analogues
Containing a Tetrazole Ring in Place of they-Carboxy Group, Can. Res. 50: 1726-1731 (1990).
7. Oefner, C., D' Arcy, A., Winkler, F.K., Crystal Structure of Human Dihydrofolate Reductase
complexed with Folate, Eur. J. Biochem., 174:377-387 (1988).
8. Cody, V., Ciszak, E., Luft, J., Kalman, T.I. & Freisheim, J.H., Crystal Structure of Human
Dihydrofolate Reductase-NADPH-Methotrexate Tetrazole Ternary Complex, Anticancer Drug
Design, 7, 483-491 (1992).
9. Tan, X, Huang, S, Ratnam, M, Thompson, PD & Freisheim, JH, The Importance of Loop Region
Residues 40-46 in Human Dihydrofolate Reductase as Revealed by Site-directed Mutagensis, J.
Bioi. Chern., 265, 8027-8032 (1990).
10. Davis, J.A., Delcamp, T.S., Prendergrast, N.J., Asford, V.A., Freisheim, J.H., Kraut, J., Crystal
Structures of Recombinant Human Dihydrofolate Reductase Complexed with Folate and 5-
Deazafolate, Biochem., 29:9467 (1990).
11. Sutton, P.A., Cody, V., Conformational Analysis of Lipophilic Antifolates: Crystal Structure of
Piritrexim and a Theoretical Evaluation of Its Binding to Dihydrofolate Reductase, J. Amer.
Chern. Soc, 110:6219 (1988).
486
COMPUTER-AIDED DESIGN OF MECHANISM-BASED
PTERIN ANALOGUES AND MD/FEP SIMULATIONS OF
THEIR BINDING TO DIHYDROFOLATE REDUCTASE
INTRODUCTION
COMPUTATIONAL METHODS
DHFR(Giu-).NADPH.8-Me-N5d-Pt+ -7 DHFR(Glu-).NADPH.8-Me-Pt+
DHFR(Glu-).NADPH.6,8-diMe-Pt+ -7 DHFR(Glu-).NADPH.8-Me-Pt+
488
HN:.xo
I
x) 1. ·238 H.7)
)
1. X=N (PI)
2. X::C (N5d-Pt)
A .& ~·
-251 (-3.7
0
t:X12
H2N N N
N3(H)-tautomer + H+ HN~x)
+J:.x.:
19
7
••• ~ H,N;::.::.,)
.)i.:.,k. J
)l
N )
1. ·257 (-5.2)
extended-guanidinium
resonance substructure
H N N N 2. ·263 (-6.4)
2 H
NS(H )-tautomer
Figure 1. Relationship of SCF/6-31G** protonation and tautomer energies (kcal/mol) for pterin (1), N5-
deazapterin (2), and their N8(H) tautomers and N8-protonated forms. Experimental pKa's for compounds or
model compounds are given in brackets (see text).
2+-----.------.-----r----~----~~~
-265 -260 -255 -250 -245 -240 -235
Protonation Energies (kcal/mol)
Figure 2. Plot of SCF/6-31G** protonation energies versus experimental pKa's (see text) for pterin (0),
8-methyl-pterin<•).N5-deaza-pterin (0) and 8-methyl-N5-deazapterin (e).
375
!-5
X
• 0
350
•• 0
0
f 325
+ 0
0
0 • 0
~
[JO
~-
••
Ol
·il
~
~ 300
•/),.
A
275
300
t'7
325
* 350 375 400 425
Experimental Wavelength (nm)
Figure 3. Plot of experimental and theoretical results for the long-wavelength band of pterin (.L\), Nl+-
pterin (.&.), N5-deazapterin (V), N8+-N5-deazapterin (T), 8-methyl-pterins (0), N3+-8-methyl-pterins (e), 8-
methyl-NS-deazapterins (0), and N3+-8-methyl-N5-deazapterins <•).
Also shown are results for N5+-pterin
(x), N8+-pterin (+),and Nl+-N5-deazapterin (*):see text.
489
correlation 11 which may have value for predicting pKa's for similar compounds from
theoretical calculations.
,J:
1.3 1.3 1.4
N HN
1.40 ,1.31 1.35 ,1.36 1.36
1.~ 1.~
H2 N 1.28 N 1.37 1.31 H2 N 1.37 N 1.30 1.36 H2 N 1.31 N 1.33
(a) (b) (c)
Figure 4. SCF/6-31G** geometries for: (a) N5-deazapterin, (b) N8(H)-N5-deazapterin, and (c) N8-
protonated-N5-deazapterin.
Molecular Geometries
As suggested by these spectral results, the two heterocyclic ring structures for pterins
and NS-deazapterins have very different 1t-electron distributions both between the parent and
8-substituted forms, between the pterin and N5-deazapterin forms, and between the neutral
and cationic forms. These differences are reflected in the molecular geometries, particularly
in the pattern of ring bond lengths which provide an approximate measure of the aromaticity
of the ring system26 and structural evidence for predicted 1t-electron delocalization in the N l-
and N8-protonated cations. Such differences in 1t-properties can be expected to contribute to
differences in ring-stacking interactions with the conserved aromatic residue in the DHFR
active site, although the relative magnitude of this effect compared with other active site
interactions is unknown.24 Results for pterin, its N8(H) tautomer and protonated forms at
the SCF/ST0-3G and SCF/3-21G levels have been reported previously:4,11,27 results at the
SCF/6-31G** level and at the SCF/3-21G level for the various methylated forms shown in
Figure 3 are similar (J.E. Gready, unpublished results). SCF/6-31G** geometries for NS-
deaza-pterin, its N8(H) tautomer and N8-protonated form are shown in Figure 4: SCF/3-
21G geometries for these and for the various methylated forms shown in Figure 3 are similar
(J.E. Gready, unpublished results). The main features to note in these structures are that the
mostly aromatic pyridine ring in the parent compound becomes much less aromatic
(alternating bond lengths) in the quinonid tautomer, and that changes in the N3-N8 grouping
490
in the cation are consistent with delocalization as shown in Figure 1. Our efforts to obtain
crystals for the 8-R-Pts and 8-R-N5d-Pts suitable for x-ray analysis to test these structural
predictions have been unsuccessful so far except for 6,8-dimethyl-NS-deazapterin
hydrochloride (M.J. Koen, T.W. Hambley and J.E. Gready, unpublished results) the
structure of which compares well with both the SCF/6-31G** geometry for the cation shown
in Figure 4 and the SCF/3-21G geometry for N3-protonated-6,8-dimethyl-N5-deazapterin.
To illustrate the effect of replacing a ring-carbon with a nitrogen, results for the net
relative binding free energy and component solvation and enzyme binding terms for 8-Me-Pt
and 8-Me-N5d-Pt and their 6-methyl derivatives are shown in the first two lines of Table 1.
The solvation terms ilGsolv indicate the N5-deaza compounds are -4 kcal/molless stable in
solution and this hydrophobic effect could be expected to enhance their binding in the DHFR
active site. (Reference to other results in Table 1 for the 7,8-dimethyl and 6,7,8-trimethyl
analogues shows a very similar effect.) Consideration of the terms for the free energies for
interactions with the DHFR active site ilGbind shows they are of similar magnitude (-4
kcal/mol) and favour binding the pterins. When the solvation terms are subtracted from the
binding terms the net free energy change for binding is quite small, i.e neither compound
class is strongly favoured, a result roughly in agreement with available experimental kinetic
and binding data.4,6,8 Other results in Table 1 are for a number of transformations among 8-
Me-Pts and 8-Me-N5d-Pts involving ring methyl substituents. These results and
examination of the MD structures using molecular graphics suggest a quite complex interplay
of protein-ligand interactions, including steric effects and favourable hydrophobic
interactions, and solvation effects depending on the nature of the ring and substitution in
other ring positions. Although the trends correlate reasonably well with available
experimental binding data, it has become clear that in order to obtain more quantitative
predictions the theoretical model needs to be developed to allow better relaxation of the
enzyme with the different bound ligands.
491
SUMMARY
Using a combined theoretical and experimental approach we have been able to predict
several chemical properties and the contributions of the many factors which determine the
macroscopic binding behaviour of these new mechanism-based compounds with DHFR, and
also analyse experimental data to develop structure-activity relationships.
ACKNOWLEDGEMENT
We thank Dr Jeff Reimers for access to the VAX version of the CNDO/S-CI program
and Prof Wolfgang Pfleiderer, Dr Mark Koen and Michael Ivery and Soon-Seog Jeong for
compounds and experimental data. Funding from the National Health and Medical Research
Council is gratefully acknowledged.
REFERENCES
1. F.M. Huennekens and K.G. Scrimgeour, in: "Pteridine Chemistry," W. Pfleiderer and E.C. Taylor,
eds., Pergamon, Oxford (1964), pp. 355-76.
2. J.E. Gready, Biochemistry 24: 4761 (1985).
3. V. Thibault, M.J. Koen and J.E. Gready, Biochemistry 28:6042 (1989).
4. J.E. Gready, in: "Chemistry and Biology ofPteridines 1989," H.-Ch. Curtius, S. Ghisla and N. Blau,
eds., de Gruyter, Berlin (1990), pp. 23-30.
5. M.T.G. Ivery and J.E. Gready, Bioi. Chern. Hoppe-Seyler 373:1125 (1992).
6. J.E. Gready, M.T.G. Ivery, M.J. Koen and H.J. Yang, in: "Pteridines and Related Biogenic Amines and
Folates 1992," N. Blau, H.-Ch. Curtius, R. Levine and J. Yim, eds., Hanrim, Seoul (1992), pp.265-76.
7. M.J. Koen and J.E. Gready, J. Org. Chern. 58:1104 (1993).
8. M.T.G. Ivery and J.E. Gready, other paper this volume.
9. C. Oefner, A. D'Arcy and F.K. Winkler, Eur. J. Biochem. 174:377 (1988).
10. S.-S. Jeong and J.E. Gready, other paper this volume.
11. J.E. Gready, J. Comput. Chern. 6: 37 (1985).
12. W. Pfleiderer, in: "Comprehensive Heterocyclic Chemistry," A.J. Boulton and A. McKillop,
eds., Pergamon, New York (1984), pp. 263-327.
13. M. Pfleiderer, Masters Thesis, University of Konstanz (1986), p.19.
14. S.-S. Jeong, P. Wormell and J.E. Gready, Pteridines (1993) in press.
15. S.-S. Jeong and J.E. Gready, Bioi. Chern. Hoppe-Seyler 373:1139 (1992).
16. W.J. Hehre, SPARTAN (Version 2.0), Wavefunction Inc., Irvine CA, USA.
17. J. Del Bene, H.H. Jaffe, R.L. Ellis and G. Kuehnlenz, CNDO/S-CI, QCPE #174, Dept of Chemistry,
Indiana University.
18. U.C. Singh, P.K. Weiner, J.W. Caldwell and P.A. Kollman, AMBER (Version 3.2), Dept. of
Pharmaceutical Chemistry, University of California, San Francisco (1988).
19. P.L. Cummins, K. Ramnarayan, U.C. Singh and J.E. Gready, J. Am. Chern. Soc. 113:8247 (1991).
20. P.L. Cummins and J.E. Gready, Proteins: Struct. Funct. Genet. (1993) in press.
21. P.L. Cummins and J.E. Gready, J. Comput.-Aided Mol. Des. (1993) in press.
22. M.A. McTigue, J.F. Davies, B.T. Kaufman and J. Kraut, Biochemistry 31:7264 (1992).
23. U.C. Singh, F.K. Brown, P.A. Bash and P.A. Kollman, J. Am. Chern. Soc. 109:1607 (1987).
24. P.L. Cummins and J.E. Gready, other paper this volume.
25. P. Wormell and J.E. Gready, Chern. Phys., submitted.
26. J.E. Gready, Int. J. Quant. Chern. 91:369 (1987).
27. J.E. Gready, J. Mol. Struct.: THEOCHEM 124:1 (1985).
492
DOES R67 DffiYDROFOLATE REDUCTASE POSSESS A PROTON DONOR?
Department of Biochemistry
University of Tennessee
Knoxville, TN 37996-0840
The difference Fourier map describing thio-NADP+ binding to tetrameric R67 DHFR
shows electron density in the active site pore describing at least 2 symmetry related binding sites
(Matthews, Xuong, Narayana, personal communication). Therefore a productive model for
catalysis may describe binding of dihydrofolate in half the pore and binding of cofactor in the
other half. The pteridine ring of dihydrofolate and the nicotinamide ring of NADPH would
encounter each other at the center of the pore. This model is consistent with our preliminary
kinetic studies. Surprisingly, a proton donor has not been identified in the active site pore of
R67 DHFR although a proton donor greatly facilitates catalysis in E. coli chromosomal DHFR.
In a D27S mutant of E. coli chromosomal DHFR, the proton donor, Asp27, was removed by
site directed mutagenesis8 • The D27S DHFR partially compensated by binding pre-protonated
substrate (pKa=2.59~ and k..t increased at low pH where protonated dihydrofolate is the
predominate species.
To confirm our interpretation of the crystal structure indicating tetrameric R67 DHFR
does not possess a proton donor, we examined a pH profile of R67 DHFR activity expecting to
see a similar profile to D27S E. coli DHFR, ie. increased activity at low pH as the pKa of
protonated dihydrofolate (- 2.59)9 is approached. Instead a pH profile of percent activity in
R67 DHFR displays a bell shape with pKas of -6.2 and -7.3. The lower pKa value suggests
histidine may be ionizing and affecting enzyme activity. A single histidine (H62) occurs per
monomer in R67 DHFR and is found at the dimer-dimer interface between tetramers. From the
222 symmetry of the crystal structure, 2 histidines appear per interface (ie. H62,H362 at one
interface and Hl62,262 at the second). Protonation of H62 could potentially destabilize
tetrameric R67 DHFR and favor dimer formation. As the putative active site pore would be lost
in dimeric R67 DHFR, decreased activity should result.
To determine if the lower pKa in kinetic pH profiles is related to ionization of H62, the
stability of tetrameric R67 DHFR was monitored as a function of pH10• For the pH range 5-8,
tetrameric R67 DHFR reversibly dissociates into dimers as monitored by sedimentation
equilibrium and molecular sieving techniques. Ionization of histidine was confirmed by
monitoring the chemical shifts of the C2 proton in NMR experiments and best fits of an
incomplete titration curve yield a pKa of 6. 77. Since W38, 138,238,338 also occur at the dimer-
dimer interfaces, fluorescence can monitor the tetramer <:::% 2 dimer equilibrium. When
fluorescence was monitored over the pH range 5-8, a protein concentration dependence of
fluorescence was observed (since the reaction is bimolecular) and global fitting of three titration
curves yields Kd = 9. 72 nM, pK. = 6. 84 and n =2 for the linked reactions:
494
K.t K.2n
tetramer ~ 2 dimers + 2n H+ ~ 2n protonated dimers.
Since the ionization of H62 is linked to dissociation of active tetramer into inactive or
partially active dimers, any potential activity increase at low pH associated with protonation of
dihydrofolate in solution (pKa=2.59) will be masked. To investigate whether there is a proton
donor in R67 DHFR using kinetic methods, a stable tetramer needed to be constructed.
From our analysis of the tetrameric x-ray structure, a H62C mutation should allow
formation of disulfide bonds between H62C and H362C (and H162C & H262C) at the dimer-
dimer interfaces and results in covalently stabilized tetrameric R67 DHFR. The H62C mutation
was constructed by standard site directed mutagenesis techniques using a synthetic R67 DHFR
gene7 • The H62C mutant gene was sequenced to confirm that no additional mutations were
present.
H62C R67 DHFR was purified according to the protocol for purification of native R67
DHFR7 except that E. coli cells were lysed by sonication and no reducing agents were added to
buffers. Purification steps included PBE chromatofocusing, 075 molecular sieving and DEAE
ion-exchange chromatography.
Purified H62C R67 DHFR is predominately reduced and dimeric as determined by
molecular sieving studies and Ellmans titrations. Disulfide bond formation does occur
spontaneously, albeit slowly. Numerous procedures, for example disulfide exchange, were
investigated to induce disulfide bond formation, however the easiest and most efficient method
was to incubate H62C R67 DHFR at high protein concentrations ( ~ 15 mg/ml) at pH 8. 8, 4' C
for > 1 week. Formation of active tetramer was monitored by either increased enzyme activity
and/or by molecular sieving chromatography. For the latter, two peaks were observed during
elution from a Superose 12 HR10-30 column (Pharmacia FPLC), indicating tetrameric and
dimeric species are not in rapid equilibrium in H62C R67 DHFR. After 1 week, stable (S-S
crosslinked) tetramer comprises ~ 20% of the total H62C R67 DHFR population. To separate
active tetramer from dimer, a 0.03-0.05M KCl gradient on a monoQ column equilibrated in 10
mM Tris pH 8 was utilized (Pharmacia FPLC).
As shown in Figure 1, elution of native R67 DHFR from a Superose 12 HR 10-30
column at pH 7 and 5 shows a large change in elution position, consistent with dissociation of
tetramer to 2 dimers 10 • In contrast, molecular sieving studies of active H62C R67 DHFR at pHs
5 and 7 show only minimal changes in elution position, indicating perhaps a minor
conformational change. From a plot of K.. (= (elution volume - void volume) I (total bed
volume- void volume)) versus MW standards, the molecular weight of H62C R67 DHFR at pH
7 (and 5) is 42,000. This value is consistent with active H62C R67 DHFR being tetrameric.
495
(A)
000
~ 1----..J
A
100
(B)
-
";"
-...
(,)
Q)
0
0 10 15 20 25 >-
·s;
:;::
(,)
(C) <C
Q)
1G-1
>
:;::
ftl
Q)
a: 0
(D)
1~~~~~~~-L~~~~~~
U M U M U M n M M
Elutton Volume (mL) pH
Figure 1. Elution profiles from a Superose 12 Figure 2. pH profiles for native ( o) R67 DHFR
HR10-30 column. Native R67 DHFR at pH 7 and & the oxidiz.dd, tetrameric, H62C mutant ("') R67
5, panels A & B. H62C R67 DHFR at pH 7 and 5, DHFR.
panels C & D.
Ellmans titrations were performed to verify the formation of disulfide bonds in tetrameric
H62C R67 DHFR. Non-reducing Ellmans titrations yield 0.94 and 0.90 free sulfuydryls per
monomer in native and H62C R67 DHFRs respectively. In contrast, reducing Ellmans titrations
yield 1.36 and 1.96 sulfuydryls per monomer for native and H62C R67 DHFR respectively.
These studies clearly confirm a stable tetrameric species has been constructed by disulfide
crosslinking.
Oxidized, tetrameric H62C R67 DHFR is quite active with k.,.1 = 0.64 s· 1, K.n <DHFJ =
3.8~M and K.n <NADPHl = 6.2~M at pH 7.0. In comparison to native R67 DHFR values (see
Table I), K.n<NADPHl increases 2 fold while kcat and K.n<DHF) decrease 2 and 1.5 fold respectively.
These minimal changes indicate the conformation of the active site pore in H62C R67 DHFR
has changed only slightly.
As shown in Figure 2, a pH profile describing H62C R67 DHFR catalysis shows
increasing activity at low pH. This behavior is reminiscent of the pH profile for the mutant
D27S E. coli chromosomal DHFR8 and supports our model that R67 DHFR uses protonated
dihydrofolate as substrate. Catalytic activity increases at low pH as the pKa for N5 in
dihydrofolate ( =2.59~ is approached.
Based on the above results, our current model describing the mechanism of R67 DHFR
is shown in Scheme I below where T is tetramer and D, DH,. are unprotonated & protonated
dimers respectively. In this model, R67 DHFR uses protonated dihydrofolate (HDHF) as
substrate; binding of unprotonated dihydrofolate is unproductive. We note the binding
stoichiometry of ligands has not yet been determined.
496
2DH,.
+2nH+ 1 ~ p:£<.-6.77-6.84
Scheme I
2D
1~ ~
T + DHF + NADPH .;::: T • DHF •NADPH
p:£<.=2.591 ~ +H+ 1 ~ +H+
T + HDHF + NADPH :;::::: T • HDHF • NADPH ~ products
A broad cofactor tolerance has previously been noted in R67 DHFR as it can utilize
{3-NADPH, a-NADPH and NADH as cofactors; the latter two cofactors display 4 and 40
fold increases in K, and 1.5 and 17 fold decreases in ).(.,,1 respectively 12 • To investigate the
substrate tolerance of this enzyme, we have examined the ability of a quinonoid tautomer of
dihydropterin to serve as a substrate (Figure 3B). This tautomer is not reduced by
chromosomal DHFRs and a separate, nonhomologous eukaryotic enzyme, dihydropteridine
reductase (DHPR), reduces quinonoid-dihydropterin to tetrahydropterin 13 • We find R67
DHFR reduces quinonoid 6,6-dimethyl-dihydropterin (q-DMP) with ).(.,.1 = 0.40 sec· 1, K, (q-
DMPJ = 185 ~-tM and K, (IIIADPH) = 11 ~-tM (pH 7.0). Since the pKa of N3 m q-DMP is 5.15 14,
the ability of R67 DHFR to utilize this substrate shou!d be facilitated by the availability of
protonated q-DMP in solution. From a mechanistic perspective, reduction of q-DMP by R67
DHFR is surprising as reduction of dihydrofolate is proposed to occur via hydride transfer
from NADPH to C6 of the pteridine ring in chromosomal DHFR whereas reduction of q-
DMP is proposed to involve hydride transfer to N5 in DHPR15 •
Figure 3. Alternate substrates for R67 DHFR- A. DHF; B. quinonoid 6,6-dimethyldihydropterin; C. MTHF;
D. 5-iminium cation of MTHF. R = 4-aminobenzoyl[a~](L)-glutamic acid.
497
solution, ring opening of MTHF is facilitated by acid catalysis to yield the 5-iminium cation
(Figure 3D 17). Interestingly, eukaryotic MTHFR, a flavin enzyme, also possesses a DHPR
activity. The 5-iminium cation has been proposed to tautomerize to a quinonoid 5-CHrDHF
intermediate which could serve as a substrate for the DHPR activity of MTHFR18 • From
these model folate and eukaryotic MTHFR studies, we anticipate the activated MTHF species
being reduced by R67 DHFR is either the 5-iminium cation or the quinonoid 5-CH3-DHF
tautomer.
We note that folate is not a substrate for R67 DHFR, most likely because its pKa is
< -1.5 19 and the concentration of activated substrate (protonated folate) would be minimal in
our assays.
CONCLUSIONS The altered pH profile for the mutant H62C R67 DHFR as well as the
substrate tolerance studies for native R67 DHFR are both consistent with a model for
catalysis such that a proton is obtained from solution, not directly from the enzyme. This
contrasts with mechanisms proposed for chromosomally encoded DHFRs, which possess a
proton donor to facilitate catalysis.
REFERENCES
I. Amyes, S.G.B., Towner, K.J. and Young, H.-K., J. Med. Microbial. 36:1-3 (1992).
2. Stone, D. and Smith, S., J. Bioi. Chem. 254:10857-10861 (1979).
3. Matthews, D.A., Smith, S.L., Baccanari, D.P., Burchall, J.J., Oatley, S.J. and Kraut,
I., Biochemistry 25:4194-4204 (1986).
4. Stone, S.R. and Morrison, J.F., Biochim. Biophys. Acta 869:275-285 (1986).
5. Amyes, S.G.B. and Smith, J.T., Eur. J. Biochem. 61:597-603 (1976).
6. Howell, E.E., Booth, C.B., Farnum, M., Kraut, J. and Warren, M.S., Biochemistry
29:8561-8569 (1990).
7. Reece, L.J., Nichols, R., Ogden, R.C. and Howell, E.E., Biochemistry 30:10895-
10904 (1991).
8. Howell, E.E., Villafranca, I.E., Warren, M.S., Oatley, S.J. and Kraut, J., Science
231:1123-1128 (1986).
9. Maharaj, G., Selinsky, B.S., Appleman, J.R., Perlman, M., London, R.E. and Blakley,
R.L., Biochemistry 29:4554-4560 (1990).
10. Nichols, R., Weaver, C.D., Eisenstein, E., Blakley, R.L., Appleman, J., Huang, T.H.,
Huang, F.Y. and Howell, E.E., Biochemistry 32:1695-1706 (1993).
11. Miles, E.W., Methods Enzymol. 47:431-442 (1977).
12. Smith, S.L. and Burchall, J.J., Proc. Nat/. Acad. Sci. 80:4619-4623 (1983).
13. Kaufman, S., Neurochemical Research 16:1031-1036 (1991).
14. Bailey, S.W. and Ayling, I.E., Biochemistry 22:1790-1798 (1983).
15. Armarego, W.L.F. and Vasudevan, S.G. (1989) in: "Chemistry & Biology of
Pteridines, 1989," Curtius, H. -Ch., Ghisla, S. and Blau, N., Eds., Walter de
Gruyter, Berlin (1990).
16. Vanoni, M.A., Ballou, D.P. and Matthews, R.G., J. Bioi. Chem. 258:11510-11514
(1983).
17. Kallen, R.G. & Jencks, W.P., J. Bioi. Chem. 241:5851-5863 (1966).
18. Matthews, R.G. and Kaufman, S., J. Bioi. Chem. 255:6014-6017 (1980).
19. Poe, M., J. Bioi. Chem. 252:3724-3728 (1977).
498
LASER-SENSITIZED TAUTOMERS IN DIHYDROFOLATE REDUCTASE
INTRODUCTION
EXPERIMENTAL METHODS
0. 026 t
I
0
G. 0!71
0
....<_J
II
"'0
G. GG9
ru ~ !"J !" p
0 0 0 0
0 0 0 0 0
0
MiCROSECONDS
500
that the faster decay of pterin belongs to the lactim tautomer. However, the
rate constant is 1.4 times that of 3MP and not the 7.6 ratio for the pterin
decays. The methyl groups may account for this difference in the ratios.
The most obvious difference in the absorption decays of the derivatives is
the intensity of the triplet absorbance. This is clearly evident in Figure 1. We
have been able to use this difference to assign the triplet state tautomers of
pterin and L-biopterin in the following experiments. In Figure 2 we have plotted
the relative magnitudes of the two decay components of pterin as a function of
pH. The preexponential factors were determined by holding constant the decay
rate constants at 3.3 x 106 s-1 and 0.7 x 1o6 s-1 which represent an average
below pH 9.5. Above pH 9.5 the anionic pterin decayed with k = 1.5 x 1Q6 s-1,
so that number was used. The regression analysis then produced the
preexponential factors required to fit the curve. Residual absorption was
included. The factors as a fraction of 1 are plotted in Figure 2 for each decay.
This is an interesting plot in that it shows not only the pKa -9.8 for the triplet
state (Chahidi et al.6 reported 9.5-10) but also the formation at lower pH's of
one tautomer at the expense of the other. On excitation the tautomeric
equilibrium shifts from a predominately lactam structure to more of the lactim
structure depending on the pH. This process maximizes at pH -8.5. To prove
this point we now plot in Figure 3 the top absorbance change at t=O for the
triplet states against pH. At pH 6.5 the top 600's for equal concentrations of
pterin and 3MP coincide. At this pH the lactam tautomer clearly dominates in
the excited pterin solution. As the pH approaches 9.5 the top 600 increases
rapidly for pterin while that for 3MP decreases. The increase in 600 for pterin
approaches that for 4MP shown here at half the concentration, 0.2 mM. The
preexponential factors approach 40% at pH -8.5 in Figure 2 and, therefore, the
comparison of 4MP at one-half the pterin concentration may be
appropriate. So, while the decay rates of the derivatives suggest an assignment
0 . 034
0.023
0
0
...<
.J
U1
0
0 . 011
501
of tautomeric structures to the biexponential decay of pterin, the intensities
serve to substantiate that assignment. The faster triplet state decay of pterin
and L-biopterin results from the excited lactim tautomer. The slower decay
belongs to the lactam tautomer.
The assignment now allows a determination of the effect of the rHDHFR
binding site on the tautomeric equilibrium. For this comparison between
substrate in free solution and in the enzyme we used L-biopterin for which we
have both binding data and decay data. L-Biopterin binds to rHDHFR with a
KD = 202 J.1.M9. At the concentrations used, 60% of the L-biopterin was bound
to rHDHFR, so the results should be interpreted with caution. The lower plot of
Figure 4 represents the remarkable effect of rHDHFR on the triplet state
behavior of L-biopterin. Because an equivalent amount of BSA had a minor
effect (10% increase in the ratio oflactim/lactam preexponential factors) on the
biexponential decay. the effects of rHDHFR on L-biopterin probably occur at the
active site. The remaining exponential with k = 3.4 x106 s-1 could be the result
of active-site quenching of the slower decay of Figure 4 which is observed at pH
9.35 for free L-biopterin. However, the single exponential decay in rHDHFR
which also occurs at pH's 8.0 and 6.9 with a rate constant equal to that for the
lactim tautomer suggests a shift in the tautomeric equilibrium rather than
protein quenching. The lactim preexponential factor in fact increases from
-20% for free solution to -50% for the bound substrate. This picture could
mean that in rHDHFR the lactim tautomer predominates unless possibly the
triplet state of the lactam tautomer quenches so rapidly at the site that its
decay isn't observed.
REFERENCES
1. C. Oefner, A. D'Arcy, and F.K. Winkler, Eur. J. Biochem. 174:377-385
(1988).
2. W.A. Beard, J.R. Appleman, T.J. Delcamp, J.H. Freisheim, and R.L.
Blakley. J. Biol. Chern. 264: 9391-9399 (1989).
3. M.A. McTigue, J.F. Davies. B.T. Kaufmann, and J. Kraut, Biochemistry
31:7264-7273 (1992).
4. K. Taira, J.-T. Chen, C.A. Fierke, and S.J. Benkovic, Bull. Chern. Soc.
Japan 60:3025-3030 (1987).
5. B.S. Selinsky. M.E. Perlman, R.E. London, L.J. Unkefer, J. Mitchell, and
R.L. Blakley, Biochemistry 29:1290-1296 (1990).
6. L. Chahidi, M. Aubailly. A. Momzikoff, M. Bazin, and R. Santus,
Photochem. Photobiol. 33:641-649 (1981).
7. W. Pfleiderer, E. Liedek, R. Lohrmann, and M. Rukwied, Chern. Ber.
93:2015-2024 (1960).
8. N.J. Prendergast, T.J. Delcamp, P.L. Smith, and J.H. Freisheim,
Biochemistry 27:3664-3671 (1988).
9. J.W. Ledbetter and J.H. Freisheim, submitted for publication.
10. J.R. Lindroth, S.M. Martin, and J.W. Ledbetter, Comput. Biol. Med.
17:369-381 (1987).
11. L.S. Walters, T.J. Cornish. H.W. Askins, and J.W. Ledbetter, Anal.
Biochem. 127:361-367 (1982).
12. J.F. Ireland and P.A.H. Wyatt. Adv. Phys. Org. Chern. 12:131-221 (1976).
502
METHOTREXATE-INSENSITIVE MUTANTS OF HUMAN
DIHYDROFOLATE REDUCTASE (hDHFR) CONSTRUCTED BY SITE-
DIRECTED MUTAGENESIS AT PHENYLALANINE 34
INTRODUCTION
Dihydrofolate reductase (DHFR) catalyzes NADPH-dependent reduction of 7,8-
dihydrofolate (H2folate) into 5,6,7 ,8-tetrahydrofolate (H4folate), which is essential for the
synthesis of thymidylate and hence the synthesis of DNA Since rapidly growing cells can be
killed by inhibition of hDHFR by methotrexate (MTX), this and other inhibitory drugs are
used in the chemotherapy of cancer. A serious problem in such chemotherapy with MTX is
development of MTX-resistance in tumor cells. Spontaneous mutation in the DHFR gene is
suspected to be one of the causes for such resistance.
Phe 34 of hDHFR is a strictly conserved active site residue and interacts
hydrophobically with, and is in van der Waals contact with, the pteridine ring of bound
substrate or bound MTXl. Thus exchanging this residue for others should lead to variants of
hDHFR having greatly changed properties. The Phe 34 ~ Ser variant of hDHFR has been
partially characterized previously by Schweitzer et al.2. and shown to possess very low
affinity for MTX. We have produced variants ofhDHFR in which Phe 34 is replaced by Ala,
Ser or Thr by oligonucleotide-directed mutagenesis. The effects of the residue changes at
position 34 of hDHFR on the catalytic properties and on the interaction with MTX have been
studied.
An expression vector carrying eDNA for wild type (WT) hDHFR in pDS5/RBSII3
was generously provided by Dr. D. Stueber. Oligonucleotide-directed mutagenesis was
carried out with a MutaGene In Vitro Mutagenesis Kit (BioRad). Escherichia coli
Ml5(pREP4) was transformed by expression plasmids. Since the variants of hDHFR
produced have very low affinity for MTX, they could not be purified by affinity
chromatography on a MTX-Sepharose as routinely used for the purification of WT
hDHFR4. The methods used for purification of these variant hDHFR's included anion
exchange and gel-flltration columns.
The enzymic reaction rate was determined at 20°C at pH 7.65, by measuring the
decrease in absorbance at 340 nm with a Beckman DU-70 spectrophotometer. The reaction
was initiated by addition of H2folate solution to a mixture containing enzyme and 100 j.tM
NADPH in MATS buffer. Initial reaction rates at various concentrations of H2folate were
fitted to the appropriate rate equation.
In most cases the quenching of protein fluorescence emission at 330 nm upon addition
of ligand was determined with an SLM AMINCO fluorimeter. The excitation wavelength was
either 280 nm or 295 nm. For the measurement of Kd for MTX dissociation from the
E.NADPH.MTX complex, the decrease in fluorescence at 440 nm was monitored. The
inner-filter effects were corrected by use of the data from parallel measurements of the
quenching of the fluorescence of tryptophan.
504
do not reduce it greatly, the values of kchem are reduced to the point that the chemical
transformation step becomes the rate-limiting step of the catalytic cycle.
kcatfKm values for all the variant enzymes are much lower than for WT indicating
greatly decreased efficiency.
CONCLUSIONS
Variants of hDHFR having good catalytic efficiency as well as low affinity for MTX
are of particular interest in this study. Although the mutations described here cause very large
increases in Ki for MTX, without large decreases in kcat. there are sufficiently large increases
in Km for H2folate that catalytic efficiency, as measured by kcatfKm. is decreased by a factor
of 340 or more. Catalytic activity by the variants would therefore be very weak at the low
concentration of H2folate present in cells. It is therefore unlikely that these mutations could
cause clinical resistance to MTX. Results of the ongoing crystallography for these variant
enzymes are awaited for more detailed interpretation of the effects of the structural changes.
ACKNOWLEDGEMENT
This work was supported in part by USPHS Grant CA 31922 from the National
Cancer Institute, by a Post Doctoral Fellowship from St. Jude Children's Research Hospital
(toT. N)., and by American Lebanese Syrian Associated Charities.
REFERENCES
1. J. F. Davies, II, T. J. Delcamp, N.J. Prendergast, V. A. Ashford, J. H. Freisheim, and J. Kraut, Crystal
structures of recombinant human dihydrofolate reductase complexed with folate and 5-deazafolate,
Biochemistry 29:9467, (1990).
2. B. I. Schweitzer, S. Srimatkandada, H. Gritsman, R. Sheridan, R. Venkataraghavan and J. R. Bertino,
Probing the role of two hydrophobic active site residue in the human dihydrofolate reductase by
site-directed mutagenesis, J. Biol. Chem. 264:20786, (1989).
3. D. Stueber, I. Ibrahimi, D. Cutler, B. Dobberstein and H. Bujard, A novel in vitro transcription-
translation system: accurate and efficient synthesis of single proteins from cloned DNA sequences,
EMBO J. 3:3143, (1984).
4. N.J. Predergast, T. J. Delcamp, P. L. Smith and J. H. Freisheim, Expression and site-directed
mutagenesis of human dihydrofolate reductase. Biochemistry 27:3664, (1988).
505
KINETIC INVESTIGATION OF METHOTREXATE RESISTANT HUMAN
DIHYDROFOLATE REDUCTASE (hDHFR) MUTANTS AT PHE31
INTRODUCTION
Single stranded DNA for the mutagenesis reactions was prepared by cloning a 705 bp
fragment containing the full length eDNA for hDHFR (derived from pDSS/RBSII,
Sphi[Sphl-Pstl]/hDHFR), kindly provided by Dr. Sttiber, Hoffman-LaRoche, Basel,
Switzerland), into Ml3mpl8. Phe11 mutants were generated using the Mutagene Ml3 kit
The inhibition constant K; for MTX was obtained from the dependence of steady state
enzyme activity on inhibitor concentration as described previously. 3 Enzymes were
preincubated with 100 JLM NADPH and various concentrations of MTX and the reaction
was initiated by the addition of Hlolate to a final concentration of 50 J!M. After an initial
Jag, the reaction velocity increased until a constant reaction rate, i.e., steady-state rate is
reached. The steady-state rates thus obtained were then fitted by nonlinear least squares
techniques to the equation for tight binding inhibitors as described previously. 3
The steady-state kinetic parameters kcat• K"' for Hlolate substrate were determined by
following the disappearance of NADPH at 340 nm and fitting the data to the Michaelis-
Menten equation using the Kaleidagraph program.
The equilibrium dissociation constants (Kd) for the interaction of H2folate and folate
with all five Phe31 variants were determined by measuring the quenching of protein
fluorescence upon addition of ligand. The sample was excited at 280 nm and the emission
monitored at 330 nm with an SLM 8000 fluorimeter. The fluorescence values at various
ligand concentrations were fitted to the standard equation as described by Dunn et al.4 in
order to determine Kd values.
The association (k,J and dissociation (k.,rr) rate constants were determined by
measuring the exponential decrease in protein fluorescence following mixing of enzyme
and ligand in a Hi-Tech PQ/SF53 stopped-flow fluorimeter. Enzyme was excited at 280
nm, or in some cases at 295 nm to reduce ligand inner filter effects and/or to reduce ligand
fluorescence. Data from 5 to 10 replicate binding reactions were averaged and the mean
set analyzed. The apparent rate constant, k.x,, was obtained from each mean data set by
fitting to the equation F, = Feq + ilFe·kobs', where F, and Feq are the fluorescence values
at time t and after attainment of equilibrium, respectively, and ilF is the difference
between the initial and the equilibrium fluorescence. ko1,. values obtained at different ligand
concentrations were then fitted by Kaleidagraph to the equation k.,b, = k"" [L] + korr run
on a Macintosh computer system.
Three out of 5 variants were found to have significantly decreased affinity for MTX,
up to 100-fold higher K; than wild type hDHFR (wt). The other two substitutions resulted
in little change in K; to MTX (0. 73 and 1.47 times that of wt, respectively).
508
MTX Binding by Stopped Flow
Detailed studies of the interaction of MTX with one of the variants were carried out
using stopped-flow spectrophotometry/fluorimetry. The association rate constant (k,J for
MTX binding to E.NADPH was found to be 0.2 that for wt, and the apparent dissociation
rate constant (k.,rr,arr> for MTX from this complex was increased 94-fold. The latter
increase could be due either to an increase in the true k.,rr, or to decreased isomerization
of the initial MTX complex. Since no evidence could be obtained for the isomerization
of the MTX complex of the variant hDHFR, whereas such an isomerization increases MTX
binding by a factor of 60 for wt hDHFR, the Joss of this isomerization appears to be the
major factor in decreasing affinity for MTX, and korr actually decreases by a factor of 3.
The steady state kinetics of the variant DHFRs were examined in order to make an
assessment of the effects of mutations on the catalytic behavior of the enzyme. The K.n
values for Hlolate for the five variant enzymes were increased above that of wt several
fold, and the lowest 1<.:.1 (i.e., V01,./[E]) was 0.3 that for wt. Some variants had a higher
1<.,,1 than wt. 1<.,,/K"" the enzyme's catalytic efficiency for all five variant enzymes was
found to be slightly lower than for wt.
Kd for Hlolate in binary complexes were found to be considerably lower than for wt,
and the Kd for folate in binary complexes is slightly lower. Thus, although these mutations
greatly decreased affinity for MTX, they increased affinity for folate and Hlolate.
Effect of Mutation on k.n and korr for Substrate and Product Complexes
CONCLUSIONS
The steady-state velocity under intracellular conditions at 0.1 ~-tM H2folate and
saturating NADPH for these variants is 1-2 s·• (6.9 s·• for wt). Thus, the catalytic
efficiency and affinity for MTX would probably permit cell survival in the presence of
high concentrations of intracellular MTX. The fact that only the F31S variant has been
509
found by selection with MTX in tissue culture, is probably because mutation to other
variants requires 2 or 3 base changes.
Acknowledgements
This work was supported in part by USPHS research grant CA 31922 from the
National Cancer Institute, by a John H. Sununu postdoctoral fellowship (S.K.C.), and by
the American Lebanese Syrian Associated Charities.
REFERENCES
510
THE EFFECT OF CODON 31 ON THE RELATIVE AFFINITIES FOR THE
BINDING OF DESIGNED 8-ALKYL-PTERINS TO DIHYDROFOLATE
REDUCTASE: A STATISTICAL PERTURBATION THEORY AND
MOLECULAR DYNAMICS SIMULATION STUDY
Department of Biochemistry
University of Sydney
N.S.W. 2006 Australia
INTRODUCTION
Although a high degree of primary sequence and structural homology exists between
rhDHFR (recombinant human dihydrofolate reductase) and clDHFR (chicken liver DHFR),
particularly in the active-site region,l,2 kinetic studies of the designed 8-alkyl-pterin
substrates appear to have revealed small but consistent differences in the Km's for these two
enzymes,3 with those for clDHFR being the lower. In contrast, the dissociation constants
(~<d's) for the binding of a number of 8-alkyl-NS-deazapterin inhibitors indicate a preference
for rhDHFR.4 The elucidation of the origin of these small differences in terms of specific
structural differences between the enzymes and resulting differences in molecular interactions
represents an interesting and challenging problem which lends itself to computational study
using modem-day molecular simulation techniques.S The structurally-aligned primary
sequences of clDHFR and rhDHFR are compared below for sections that contain most of the
important active-site residues (within ca. 8A of the pterin center):
METHODS
The protein and cofactor coordinates were taken from the clDHFR X-ray crystal
structure in which both cofactor (NADP+) and biopterin are bound to the DHFR molecule}
The AMBER programs6 were used to carry out the molecular dynamics simulation and free
energy perturbation calculations. The force-fields of Weiner et alJ,8 were used for the
DHFR molecules. The NADPH and ligand force fields have been described elesewhere.9-ll
The chemical mutations are achieved by coupling the force fields for residue 31, and the free
energy changes are calculated using a perturbation method: full details of this computational
method can be found elesewhere.12 The following three chemical mutations were carried out
with AMBER:
I DHFR(Glu-:Tyr).NADPH ~ DHFR(Glu-:Phe).NADPH
II DHFR(Glu-:Tyr).NADPH.8p+ ~ DHFR(Glu-:Phe).NADPH.8p+
III DHFR(Glu-:Tyr).NADPH.68p+ ~ DHFR(Glu-:Phe).NADPH.68p+
I gives the free energy change for mutation of Codon 31 for an ionized Glu (Codon 30)
active site without bound substrate, while II and III give the corresponding changes for the
bound protonated substrates 8-methyl-pterin (8p+) and 6,8-dimethyl-pterin (68p+). Each
simulation for the free energy calculation was carried out over a period of 120 ps of
molecular dynamics. The relative free energies can be obtained from the thermodynamic
cycle shown in Figure 1.
E' (aq)
~Gr
Ci3
E
Q)
E
-~ K
a.
X
w
~Grr & ~Grn
E:L(aq) E':L(aq)
Figure 1 Thermodynamic cycle used to determine free energy change due to the mutation at Codon 31 in
clDHFR. E = clDHFR.NADPH, L = Sp+ or 68p+.
~G 1 , ~Gn and ~Gm are the calculated free energy changes for the mutations I, II and III
respectively. The net free energy change 66G, for example when 8p+ binds to DHFR, is
related to the ratio of binding constants by:
512
where R = gas constant and T = absolute temperature. Thus a negative ~~G indicates that
the mutation favours ligand binding.
RESULTS
The results of the free energy calculations for mutations I-III are given Table 1. The
free energies have been decomposed into electrostatic (~Geie) and van der Waals (~Gvdw)
contributions from the molecular dynamics force-field, i.e. the total ~Gtotal = ~Gele +
~Gvdw· The net total free energy changes MGtotal on the binding of each ligand due to the
mutation are also given.
Table 1. Computed free energy differences for the mutation Y ~ F at Codon 31 (clDHFR).
First we note that the magnitude of the electrostatic contribution is appreciably larger
than the vdW term, which is not surprising as the structural, i.e. steric, changes would be
relatively small for OR mutated to H, whereas the dipole of OR group would be expected to
introduce a more significant electrostatic effect. It is interesting to compare these results with
the mutation of phenol to benzene molecule in aqueous solution. Rao and Singh13 obtain
2.52 ± 0.01 and 1.00 ± 0.00 kcal/mol respectively for ~Gele and ~Gvdw· While the vdW
term is close to the values given in Table 1, the electrostatic component is of the opposite
sign. This indicates that the local electrostatic environments in protein and solvent are quite
dissimilar. Although the individual free energy changes are substantial, the net free energy
change (MGtotai) is small, and hence we would predict small differences in the binding for
the mutant enzyme. The results suggest that binding of 8p+ is stronger for native clDHFR
consistent with experimental Km's, although stronger binding to the mutant is predicted for
68p+. However, it should be stressed that the differences are quite small and we have not
made an assessment of the errors in the simulation. Also we have considered only one
difference by chemical mutation, but other sequence differences may also contribute to the
free energy. In particular long-range electrostatic interactions may play a role since both the
active substrates and inhibitors are expected to be protonated when bound to DHFR:3 this has
now been shown to be the case for the inhibitors.14 The free energy due to interaction of two
charges q and q' separated by distance r in the protein may be calculated using the formula 15
Gion = qq'exp(Kr)/(E(r)r)
where exp(Kr) is an electrolyte screening factor with Debye length K-1 and e(r) is an
empirically-derived distance-dependent dielectric permittivity. The positions of the charges
513
are fixed by the X-ray coordinates for clDHFR 1 and rhDHFR,2 assuming these are close to
the average solution structures. Using this approach for calculating electrostatic free energies
at infinite dilution (exp(Kr) = 1), we estimate the interactions between the charged residues of
DHFR and a cation in the active site would lead to differences in the range 0.5-1.0 kcal/mol
with the rhDHFR complex the more stable.
CONCLUSION
We have used computer simulation methods (molecular dynamics combined with free
energy perturbation techniques) to calculate the free energy change for the transformation Y
--7 F (at codon 31) in an effort to gain some general understanding of the species-dependent
differences in enzyme activity with our new substrates and inhibitors. The magnitude of the
free energy change for Y --7 F is computed to be small, i.e. < 1 kcal/mol, consistent with the
experimental Km's for binding of 8-R-pterin substrates. Other amino acid replacements (e.g.
K --7 R at 32 or S --7 T at 39) may well produce similarly small free energy changes.
Differences in long-range electrostatic interactions with charged residues may also be a
factor. We have made an estimate of the total ion-pair contribution to the free energy
difference using a macroscopic model for the electrostatics, and found a greater tendency for
binding to rhDHFR. The observed differences in binding are thus likely to result from the
cumulative effects of many small structural/sequence variations. However, the simulation
methods were unable to resolve such small free energy changes with sufficient accuracy to
confidently predict that clDHFR rather than rhDHFR provides the stronger binding as
measured by Km's, simply on the basis of a single mutation at Codon 31.
ACKNOWLEDGEMENT
This work was supported by the National Health and Medical Research Council.
REFERENCES
1. M.A. McTigue, J.F. Davies, B.T. Kaufman and J. Kraut, Biochem. 31:7264 (1992).
2. C. Oefner, A. D'Arcy and F.K. Winkler, Eur. 1. Biochem. 174:377 (1988).
3. J.E. Gready, in: "Chemistry and Biology of Pteridines 1989," H.-Ch. Curti us, S. Ghisla and N. Blau,
eds., de Gruyter, Berlin (1990), pp. 23-30.
4. M.T.G. Ivery and J.E. Gready, this volume and to be published.
5. B.L. Tern be and J.A. McCammon, Comput. Chern. 8:281 (1984).
6. U.C. Singh, P.K. Weiner, J.W. Caldwell and P.A. Kollman, AMBER (Version 3.2), Dept.
Pharmaceutical Chern., Univ. of California, San Francisco, 1988.
7. S.J. Weiner, P.A. Kollman, D.A. Case, U.C. Singh, C. Ghio, G. Alagona, S. Profeta and P. Weiner,
1. Am. Chern. Soc. 106:765 (1984).
8. S.J. Weiner, P.A. Kollman, D.T. Nguyen and D.A. Case, 1. Comput. Chern. 7:230 (1986).
9. P.L. Cummins, K. Ramnarayan, U.C. Singh and J.E. Gready, 1. Am. Chern. Soc. 113:8247 (1991).
10. P.L. Cummins and J.E. Gready, Proteins: Struct. Funct. Genet., in press.
11. P.L. Cummins and J.E. Gready, 1. Comput.-Aided Mol. Des., in press.
12. U.C. Singh, F.K. Brown, P.A. Bash and P.A. Kollman, 1. Am. Chern. Soc. 109:1607 (1987).
13. B.G. Rao and U.C. Singh, 1. Am. Chern. Soc. 111:3125 (1989).
14. S.-S. Jeong and J.E. Gready, this volume.
15. E.L. Mehler and T. Solmajer, Protein Eng. 4:903 (1991).
514
EFFECT OF CODON 22 MUTATIONS ON SUBSTRATE AND INHIBITOR
BINDING FOR HUMAN DffiYDROFOLATE REDUCTASE
INTRODUCTION
Mutagenesis was performed using a PCR technique [7] involving two separate sets
of primers; one set flanking the entire eDNA of DHFR and the second set being
complementary to one another and containing the desired mutation. The final PCR
product (incorporating a mutated full length eDNA) was digested and cloned into a
pBR322 vector then infected into JM109 E. coli.
Standard techniques [8] were used to purify recombinant mutant DHFRs from E.
coli lysates, however column dimensions, bed volume and washing & elution conditions
for the MTX-affinity absorption step were altered to maximize retardation of the mutant
enzyme during chromatography. Subsequent steps of dialysis and ion-exchange
chromatography resulted in homogeneous preparations by the criteria of SDS-PAGE.
Catalytic properties were determined using the spectrophotometric assay at 25°C in
MATS assay buffer (pH 7.4, [9]) unless otherwise stated.
516
Table 1. Kinetic and inhibition parameters of wild-type and codon 22 mutants of
humanDHFR
a Michaelis constants were obtained by fitting the hyperbolic form of the Michaelis-Menten equation (by
iterative analysis) to progress curve data. 10-cm path-length cuvettes were used for these experiments to
assist in monitoring reactions at low H2folate concentrations. Values of kcat were obtained by active site
titration experiments using MTX and/or from activity and total protein measurements of purified enzyme
species.
b Ki values for methotrexate (MTX), aminopterin (APT) and piritrexim (PTX) were evaluated by fitting
the equation for tight-binding competitive inhibition to inhibited steady-state data. ND = not determined.
c These values were estimated previously in this laboratory under similar experimental conditions.
350
2
·c:
300
"'
Ill 250
.::
iii
! 200
~
·;;
150
~
"'
.2 100
>-
iU
iii 50
0
0
5.50 6.50 7.50 8.50 9.50
pH
Figure 1. pH rate profiles for wild-type and codon 22 mutants of human DHFR. Assays were performed
in MTEN buffer [9} at 25°C and rates normalized for activity at pH 7.4 (i.e. rate at pH 7.4 set to 100).
Wild-type, +; L221, £; L22M, +; L22F, •; L22Y, e.
517
selectable markers. The human Phe 22 mutant may be superior to the rodent versions
(already in use by a number of laboratories) as the Km for substrate is less affected, yet it
displays a similar reduced affinity for MTX. One remarkable feature is that L22F is
more potently inhibited by piritrexim (by comparison with MTX & APT), presumably
due to the shortened bridge region between the pteridine and the benzoyl group. Thus,
piritrexim is predicted to be somewhat more cytotoxic towards established cell lines
which harbor this form of mutant DHFR [1,2,5].
Inspection of the inhibition progress curves also reveal that the mechanism of
inhibition or the pathway to formation of a final tight antifolate complex, as usually
observed for wild-type DHFR, is impaired for Phe and Tyr mutants. The Tyr mutant
displays an initial inhibited reaction rate without slow onset of inhibition or
"isomerization" (for MTX, APT & PTX, data not shown). Likewise, the Phe mutant
does not isomerize but only when in combination with APT. These results imply that
either an antifolate induced isomerization process does not occur for these particular
combinations, or that a naturally occuring isomerized form of the protein (also occuring
for the mutant enzyme) is not stabilized by the antifolate. It appears that the
isomerization must not be crucial for catalysis as both mutants display reasonable
catalytic activity.
Figure 2. Putative inhibitors of Phe and Tyr mutants at position 22. Steric hinderance should be removed
if the bridge region between pteridine and the p-aminobenzoyl moiety is removed from C6 to C5. An
oxygen, nitrogen or double bond in the bridging region is introduced for rigidity, preventing rotation
about the C6-C9 axis.
As the rank order of inhibitor binding differs between wild-type and codon 22
mutants, particular antifolates may be more cytotoxic to cell lines that contain different
residue 22 mutants, and specific inhibitor compounds could be developed for these
altered DHFR forms. On this latter point, three plausible inhibitor compounds have
been designed for the Phe and Tyr mutants (Fig. 2). We plan to synthesize and trial
these compounds in the near future.
518
REFERENCES
2. Flintoff, W.F., Davidson, S.V. and Siminovitch,L. (1976) Somatic Cell Genet.
2:245-261.
3. Dicker, A.P., Volkenandt, M., Schweitzer, B.I., Banerjee, D. and Bertino, J.R.
(1990) J. Biol. Chern. 265:8317-8321.
4. Simonsen, C.C., and Levinson, A.D. (1983) Proc. Natl. Acad. Sci. U.S.A.
80:2495-2499.
5. Melera, P.W., Davide, J.P., Hession, C.A. and Scotto, K.W. (1984) Mol. Cell.
Biol. 4:38-48.
6. Thillet, J., Absil, J., Stone, S.R. and Pictet, R. (1988) J. Biol. Chern. 263:12500-
12508.
7. Higuchi, R., Krummel, B. and Saiki, R.K. (1988) Nuc. Acid Res. 16:7351-7367.
10. Bolin, J.T., Filman, D.J., Matthews, D.A., Hamlin, R.C. and Krraut, J. (1982) J.
Biol. Chern. 257:1360-13662.
11. Schweitzer, B.I., Gritsman, H., Dicker, A., Volkenandt, M. and Bertino, J.R. in
Chemistry and Biology of Pteridines: Pteridines & Folic acid derivatives (eds Curtis, H-
Ch., Ghilsa, S. & Blau, N.) 760-764 (Walter de Gruyter, Berlin, New York., 1990).
519
THERMODYNAMIC STUDY OF FOLATE ANALOGUE BINDING TO
INTRODUCTION
DHFRb DHFRc
522
Nevertheless, these additional hydrophobic contacts do not
compensate the less numerous hydrophilic interactions (~H=-
44 kJ.mol- 1 ), and finally, TMP affinity is 220 times lower
than that of MTX.
TMQ affinity is intermediate between those of MTX and
TMP; like TMP, it presents lipopholic interactions ( ~S=+l4
J.K- 1 .mol- 1 ) but also exhibits additional electrostatic
contacts (~H=-52 kJ.mol- 1 ) which make its thermodynamic
behavior close to that of MTX. This could be explained by
the same location of MTX and TMQ in the protein binding
site5.
2) For DHFRb :
The poor affinity of TMP for bovine liver DHFR might
entail, for example, that the trimethoxybenzyl ring is less
buried, inducing a decrease in hydrophobic interactions 6
(~S=-88 J.K- 1 .mol- 1 ), or might be due to the lack of
hydrogen bond between the 4-amino group and the carbonyl
oxygen of Val 115 which participates in MTX binding3.
TMQ shows a more favorable ~s than MTX due to its
trimethoxybenzene moiety, and a more favorable ~H than TMP.
Hence it exhibits a higher affinity than MTX and TMP.
In conclusion for binary complexes, the folate
analogues present an entropy driven selectivity in favor of
the bacterial enzyme. The selectivity is correlated with a
weak conformational change for this enzyme.
DHFRb DHFRc
~H Ka ~s ~H Ka ~s
523
interaction in DHFRb, because of the markedly different
orientation of the trimethoxybenzene ring, does not lead to
a decrease in o~S which actually is higher (153 J.K-1.mol-1
for DHFRb instead of 40 J.K-1.mol- 1 for DHFRc). Thus one can
hypothesize that the difference of o~S between the two
enzymes is due more to the conformational change of the
proteins already induced by NADPH, than to the binding of a
folate analogue. Indeed for DHFRb the o~S are highly similar
for the three compounds whereas their affinities are
drastically different. On the other hand, the most important
factor for the presence or absence of selectivity for MTX
and TMQ is the modulation of the favorable entropic effect
by an unfavorable enthalpic effect. This unfavorable effect
appears essentially for MTX and the bacterial enzyme (o~H=15
kJ.mol- 1 ) and, even more so, for TMP and the mammalian
enzyme (o~H=40 kJ.mol- 1 ). For TMQ, o~S is intermediate
between TMP and MTX values as could be predicted by its
structure, but the cooperative effect of NADPH in DHFRb is
allowed by a less unfavorable MH. Thus, as for MTX, no
selectivity is observed in ternary complexes for TMQ.
In conclusion this study evidences that the
cooperativity between NADPH and antifolate drugs has an
enthalpic origin. Moreover it reveals that the most
important role of NADPH in the species selectivity of
antifolate compounds is not to induce antibacterial agent
selectivity for bacterial DHFR, but only to increase it.
Surprisingly, NADPH cancels the selectivity of anticancer
agents for bacterial enzyme in binary complexes by
drastically increasing drug affinity for vertebrate enzyme.
FOOTNOTES
REFERENCES
1. J.N. Champness, D.K. Stammers and C.R. Bedell, FEBS Lett. 199:61
(1986).
2. R.M. Gilli, J.C. Sari, C.L. Lopez, O.S. Rimet and C.M. Briand,
Biochem. Biophys. Acta 1040:245 (1990).
524
COMPARISON OF BINDING AND ACTIVITY OF 8-ALKYL-PTERINS
AND 8-ALKYL-NS-DEAZA-PTERINS WITH DIHYDROFOLATE
REDUCTASE
INTRODUCTION
R, R2 R3 R4
0 1a -CH 3 -H -H
1b -CH2CH 3 -H -H
N) : N
.... I Ra
1c -CH 2CH2CH3 -H -H
H NJ!.N NJ(R2 1d -CH(CH)a -H -H
2 I 1e -CH2-CH=CH2 -H -H
R1 1f -CH3 -H -CHa
1 2a -CH 3 -H -H -H
2b -CH 2CH3 -H -H -H
2c -CH 2CH2CHa -H -H -H
0 R4 2d -CH(CH)a -H -H -H
NnR3 2e -CH 3 -CH 3
I ....: I 2f -CH 2CH3
-H
-H -CH 3
-H
-H
H NJ!.N N R2 -CH3
2 I 2g -CH2CH2CH3 -H -H
R, 2h -CH(CH)a -H -CH 3 -H
21 -CH3 -CH 3 -H -H
2 2j -CH 2CH2CHa -CH3 -H -H
2k -CH 3 -H -H -CH 3
2m -CH2CH2CH3 -H -H -CHa
These compounds have been designed as analogues of folate, 1•2 but with increased
basicities compared with the parent. This increased basicity allows the compounds to readily
form an N3-protonated cation which mimics the assumed enzymically-active form of the
natural substrate. Previous studies 1•2 on the 8-alkyl-pterins have shown them to be good
Instruments and Reagents Perkin-Elmer LS-50 and Shimadzu spectrometers were used
for fluorimetric binding and UV/vis spectral kinetic studies respectively. 8-alkyl-pterins and
deaza-pterins were reported. 3•4 Ellis and Morrison5 MESffRIZMA/NaCl/ethanolamine pH
buffers with 1=0.15 M were used. Recombinant human DHFR was a gift from Prof. J.H.
Freisheim, chicken liver DHFR was from Sigma, and NADPH and NADP+ were from
Boehringer. Enzyme concentration was determined by methotrexate titration. 6
526
complexes indicates that the presence of cofactor increases the strength of binding in each
case with the ratio ranging from 1.2 to 2.1 for the chicken enzyme and 3 to 17.9 for the
human enzyme. This co-operativity effect has been observed previously in the binding of
several different ligands including methotrexate to DHFRs. 6•8 The degree of cooperativity is
dependent on both the substituent and the enzyme with the effect generally much greater for
human than chicken enzyme, especially for the isopropyl compound. This result may partly
be due to the presence of some cofactor in the Sigma chicken DHFR.
For the doubly substituted deaza-pterins 2e-2m, again, each compound shows some
binding to both DHFRs. However, this binding varies over a much wider range than
observed for the singly (8-) substituted pterins. For the 6-methyl derivatives 2e-2h the
strongest binding in the binary complex is for the 6,8-dimethyl compound (2f) with binding
for the chicken enzyme decreasing in the order methyl >isopropyl> ethyl> propyl and with
significantly weaker binding for the latter three compounds. For the human enzyme binding
of the ethyl and propyl compounds is similar. For ternary complexes with chicken DHFR,
the 6,8-dimethyl compound binds more than 20 times stronger than any of the other 6-
substituted compounds with its binding increased -15 times by the presence of cofactor, but
with cooperativity for the other compounds.in the range of only 0.8 to 5.5. For ternary
complexes with human DHFR the 6,8-dimethyl compound again binds most strongly with
its binding increased -44 times by the presence of cofactor. The other 6-substituted
compounds show significantly greater cooperativity with human enzyme, particularly for the
propyl compound 2g. In general these results suggest both enzymes have difficulty in
accommodating both a large 8-substituent and a 6-methyl- group. However, the greater
binding cooperativity for ternary complexes of the human enzyme implies greater active site
flexibility in accommodating the cofactor and ligand in an optimum relative orientation than
does the chicken enzyme. The results for the 7,8-dimethyl- (2i) and 7-methyl-8-propyl (2j)
compounds show both compounds bind strongly to both enzymes with 2j having the lowest
Kd value of any compound for the binary complexes. In the ternary complexes 2i shows
strong binding cooperativity with both enzymes with "K<! values similar to those for the 6,8-
dimethyl- compound 2e. For the ternary complexes of the 7-methyl-8-propyl- compound
chicken enzyme shows negative cooperativity (0.6), but with modest cooperativity (1.7) with
human enzyme. Both 5,8-dimethyl- (2k) and 5-methyl-8-propyl- (2m) compounds bind
527
well to both enzymes with significantly stronger binding than for the 6-methyl- analogues 2e
and 2g in binary complexes but with weaker binding cooperativity in the ternary complexes
than for 2e and 2g.
In summary: comparison· of binding strengths of all compounds with each enzyme
indicates that human enzyme can bind larger 8-substituents more strongly in the ternary
complex than the chicken enzyme, suggesting the active site of human enzyme has more
space for optimum binding of even large 8-substituents as well as cofactor.
Table 2. Michaelis-Menten Km (JlM) values at pH 5.8 for 8-alkyl-pterins for both human
and chicken DHFRs.
Enzyme Com12ound
la lb lc ld le 1f
chicken DHFR 25a 62±4 9.4±0.9 7.7±0.4 16±11 4.3±0.3
humanDHFRa 130 140 b 19 b 11
a Reported in ref. 2 b Not determined
REFERENCES
1. V. Thibault, M.J. Koen and J.E. Gready, Biochem. 28: 6042 (1989).
2. J.E. Gready, in: "Chemistry and Biology ofPteridines 1989," H.-Ch. Curtius, S. Ghisla and N. Blau,
eds., de Gruyter, Berlin (1990), pp. 23-30.
3. J.E. Gready, M.T.G. Ivery, M.J. Koen and H.J. Yang, in: "Pteridines and Related Biogenic Amines and
Folates.1992," N. Blau, H-Ch. Curtius, R. Levine andY. Yim, eds., Hanrim, Seoul (1992), pp. 265-76.
4. M.T.G. Ivery and J.E. Gready, Bioi. Chem. Hoppe-Seyler 373: 1125 (1992).
5. K.J. Ellis and J.F. Morrison, Meth. Enzym. 87: 405 (1982).
6. J.W. Wiiiiams, J.F. Morrison and R.G. Duggleby, Biochem. 18: 3449 (1979).
7. B. Birdsall, R.W. King, M.R. Wheeler, C.A. Lewis, S.R. Goode, R.B. Dunlap and G.C.K. Roberts,
Anal. Biochem. 132: 353 (1983).
8. B. Birdsall, S.V. Burgen and G.C.K. Roberts, Biochem. 19: 3732 (1980).
9. C. Bystroff, S.J. Oatley and J. Kraut, Biochem. 29: 3263 (1990).
10. P.L. Cummins, K. Ramnarayan, U.C. Singh and J.E. Gready, J. Am. Chem. Soc. 113: 8247 (1991).
528
DEVELOPMENT OF A SPECTROFLUORIMETRIC METHOD
FOR DETERMINING THE pKa OF
PTERIN-ANALOGUE LIGANDS BOUND TO DHFR
Department of Biochemistry
University of Sydney
Sydney, NSW 2006, Australia
INTRODUCTION
As part of our interest in new mechanism-based substrates and inhibitors of the enzyme
dihydrofolate reductase (DHFR), a series of 8-alkyl substituted pterins (8-R-Pt's) and 8-alkyl
substituted-N5-deazapterins (8-R-N5d-Pt's) have been synthesizedl-4 and the pH-
dependence of their electronic spectra studied.5,6 The UV/vis and excitation and emission
spectra of neutral and cationic forms of both classes of compound are distinctly different, and
both classes are highly fluorescent, especially for 8-R-N5d-Pt's with very high quantum
yields (<I> > 0.7).5,6 In agreement with values determined by UV/vis spectral methods,?
pKa's determined by fluorimetric methods showed high basic values of ca. 5.5 for 8-R-Pt's
and ca. 6.6 for 8-R-N5d-Pt's.5,6
As these compounds have been designed to bind to the DHFR active site in substrate-
like orientation but in a protonated form, 8 we were interested in studying the ionization state
and effective pKa's of enzyme-bound compounds. Previous reports in the literature of the
charge state of ligands bound to DHFRs by UV/vis spectroscopy9,10 and nmr11,12 studied
mainly methotrexate which displays tight binding. However, as our initial compounds have
much weaker binding with Kd's in the micromolar range UV/vis methods will not be
successful. The strong fluorescence of our compounds and possibility to discriminate ligand
from enzyme and cofactor emission suggested the use of spectrofluorimetry.6 In this paper
we introduce a spectrofluorimetric method for investigating the charge state and determining
the pKa of our ligands bound to DHFR.
A Perkin Elmer LS50 spectrofluorimeter and a 5mm x 5mm quartz cuvette were used
with excitation and emission slits set at 5 nm for determining the pKa and at 10 nm for
determining the binding constants (KJ'g). Recombinant human dihydrofolate reductase
Of available compounds 6,8-diMe-N5d-Pt was chosen for study as it had the best
binding to DHFR in the presence of NADPH. Initial examination of experimental conditions
suggested the main technical problems were overlapping absorption by enzyme and cofactor
and UV absorption by components in the Tris/MES/ethanolarnine multicomponent buffer14
previously used in pH-dependent enzyme studies to ensure constant ionic strength.1,8 The
Tris/AcOH/ethanolamine system was found to be satisfactory over the pH range 5.0- 8.0
and the strong fluorescence of the ligand coupled with high fluorimeter sensitivity made it
possible to follow the emission intensity of ligands by exciting at an edge wavelength (380
nm) of an absorption band at which the enzyme and the cofactor neither absorb nor emit
significantly. Similarly, excitation spectra of the ligands were run following emission at an
edge wavelength (400 nm).
6,8-diMe-N5d-Pt has unique peaks at 258 and 278 nm in the excitation spectra for
neutral and cationic forms, respectively, and also the long wavelength band (365 compared
with 354 nm) and emission spectrum of the neutral form (427 compared with 420 nm) are
red shifted. Thus exciting at the edge wavelength (380 nm) increases the relative intensity of
the neutral emission spectrum, allowing greater sensitivity in following intensity shifts for the
variation in the proportions of neutral and cationic forms with pH. Following the emission at
400nm as the pH was varied showed similar excitation spectra in the presence and absence of
DHFR, suggesting the same cationic form for bound ligand. pKa's of 6,8-diMe-N5d-Pt
under the different conditions were determined both from the intensities at 258nm in
excitation and at 431nm in emission spectra: the values are given in Table 1.
As shown in Table 1, there was an increase in the ligand pKa value of about one unit
compared with that of free form or in the control experiments under the experimental
conditions which correspond to a mixture of free and bound form. Kd measurements as a
function of pH, as shown in Table 2, indicated significant pH-dependence. A plot of Kd
versus pH showed a bell-shape curve, from which apparent acidic constants of the enzyme
and ligand, and the pH-independent dissociation constant were determined to be 5.93 ± 0.14,
7.04 ± 0.16, and 0.36 ± 0.10 )lM, respectively, using the method of Morrison.16,17 From
the Kd's values, fractions of bound and unbound forms as a function of pH were calculated
as shown in Table 2. Then the pKa of 6,8-diMe-N5d-Pt bound to rhDHFR.NADPH was
530
determined by correcting the total intensities at the various pH values for the proportion of
unbound form using data from the control spectra for ligand in the presence of NADPH and
casein, and then scaling the intensities for 100% bound form. The resulting value of 9.1 is
about 2.5 units higher than the value for free ligand of -6.7. Figure 1 shows the pH-
dependence of the uncorrected and corrected intensities, together with those for the control
experiment.
600
500
4000
:c z-1
.! 400 m
z
>
1- (/)
Cii
ffi 300
~
~
200
1000
Figure 1. pH-dependent changes of intensities of 6,8-diMe-NSd-Pt in presence of: (a) NADPH and casein
(<1); (b) NADPH and rhDHFR (0) and (c) 100% bound form after correction(.).
Then using the apparent and measured pKa values of 9.1 and 6.7 for bound and free
ligand, respectively, the fractions of cationic and neutral forms of bound and unbound ligand
were calculated: the values are shown in Table 2. Total fractions of cationic and neutral
forms were then calculated by summing bound and unbound fractions of each form (see
Table 2). Simulated spectra at the various pHs were then calculated by multiplying the
excitation spectra of the control experiment in the presence of NADPH and casein at pH 4.6
for cation and pH 8.8 for neutral form with the relevant fractions and summing the two
components. Comparison of the shape and pH-dependence of the experimental (ligand in the
presence of NADPH and DHFR) and simulated spectra showed they were very similar, and
quite different from those for binary complex (ligand in the presence of DHFR only) at the
same pHs. This result is consistent with earlier results at pHs 6.6 and 7.4 showing that 6,8-
diMe-N5d-Pt binds to rhDHFR about 15 to 20 times less strongly in the binary complex
than in the ternary complex.5,15
531
Table 2. The fractions of bound and unbound forms and the total fractions of cationic and
neutral forms of ligand 6,8-diMe-N5d-Pt calculated from measured Kd and pKa values.
CONCLUSIONS
ACKNOWLEDGEMENT
We thank Prof. Freisheim for the enzyme and Mr. Michael Ivery for the sample of 6,8-
dimethy1-N5-deazapterin.
REFERENCES
1. V. Thibault, M.J. Koen and J.E. Gready, Biochemistry 28:6042 (1989).
2. M.T.G. Ivery and J.E. Gready, Bioi. Chern. Hoppe-Seyler 373:1125 (1992).
3. S.-S. Jeong and J.E. Gready, Bioi. Chern. Hoppe-Seyler 373:1139 (1992).
4. M.J. Koen and J.E. Gready, J. Org. Chern. (1993) in press.
5. J.E. Gready, M.T.G. Ivery, M.J. Koen and H.J. Yang, in: "Pteridines and Related Biogenic Amines and
Folates 1992," N. Blau, H.-Ch. Curtius, R. Levine and J. Yim, eds., Hanrim, Seoul (1992) pp.265-76.
6. S.-S. Jeong, P. Wormell and J.E. Gready, Pteridines (1993) in press.
7. M.T.G. Ivery, M.J. Koen and J.E. Gready, unpublished results.
8. J.E. Gready, in: "Chemistry and Biology ofPteridines 1989," H.-Ch. Curtius, S. Ghisla and N. Blau,
eds., de Gruyter, Berlin (1990) pp.23-30.
9. K. Hood and G.C.K. Roberts, Biochem. J. 171:357 (1978).
10. S. Subramanian and B.T. Kaufman, Proc. Natl. Acad. Sci. USA 75:3201 (1978).
II. L. Cocco, J.P. Groff, C. Temple, Jr., J.A. Montgomery, R.E. London, N.A. Matwiyoff and R.L.
Blakley, Biochemistry 20:3972 (1981).
12. B.S. Selinsky, M.E. Perlman, R.E. London, C.J. Unkefer, J. Mitchell and R.L. Blakley, Biochemistry
29:1290 (1990).
13. J.W. Williams, J.F. Morrison and R.G. Duggleby, Biochemistry 18:3449 (1979).
14. K.J. Ellis and J.F. Morrison, Meth. Enzymol. 87:405 (1982).
15. M.T.G. Ivery and J.E. Gready, other paper this volume.
16. S.R. Stone and J.F. Morrison, Biochim. Biophys. Acta 745:237 (1983).
17. S.R. Stone and J.F. Morrison, Biochim. Biophys. Acta 745:247 (1983).
532
SELECTIVE INHIBITION OF DIHYDROFOLATE
REDUCTASE FROM PROBLEM HUMAN PATHOGENS
INTRODUCTION
DHFRs from E.coli, P.carinii and the two staphylococcal DHFRs were
overexpressed in E.coli and purified to homogeneity as described5,6,7.
Expression and purification of the human DHFR has been described8.
DHFR inhibitors were either selected from inhibitors available at
F.Hoffmann-La Roche Ltd, Basel, Switzerland, or synthesized de novo to fill
the gaps in SAR.
All compounds were tested against the DHFRs from P.carinii, S.aureus
and the DHFR on transposon Tn4003 from staphylococci. DHFRs from E.coli
and man served as reference. Data are shown in Table 1. Among more than
200 compounds tested for inhibition of the purified DHFR from P. carinii,
several emerged with a distinctly higher activity than TMP. The best
compound among a series of pyrrole-substituted 2,4-diamino-benzyl-pyrimi-
dines was Ro 11-8958, which is 14 times more active than TMP. Ro 11-8958
also has a ten times better specificity with respect to the human enzyme than
TMP. Replacing the ethoxy-group in positions 3 and 5 by a wide range of
substituents resulted in compounds with reduced affinity for the P. carinii
DHFR.
Efforts were undertaken to find inhibitors of the TMP-resistant staphy-
lococcal DHFR, located on transposon Tn4003. A number of compounds
emerged which showed distinctly higher activity than TMP. Among various
substitued 2,4-diamino-benzyl-pyrimidines Ro 11-8958 was the most active
but one (-20 fold lower ICso). Several quinazolines (Ro 18-4802, 18-5771) were
even more active, but devoid of selectivity. None of these compounds over-
came resistance in vitro.
The chromosomal DHFR from S. aureus is fourfold less sensitive
towards TMP than that from E.coli. The enzymes have 36 % amino acid
homology6. Probing both enzymes with a variety of inhibitors showed that
the majority of the 2,4-diamino-5-benzyl-pyrimidines tested were less active
against the staphylococcal than the E. coli DHFR. Substitution in position 2',
however, resulted in compounds with greater affinity for the staphylococcal
DHFR. Several compounds (Ro 11-7396, 15-4672, 21-0057) strongly discrimi-
nated between the two enzymes, pointing to significant differences in the
active site of the two DHFRs.
534
Table 1. Activity of Selected Compounds Against DHFRs from Several Problem Human
Pathogens.
ICSO (iJ.M) for DHFR from
Compound Structure P.carinii Tn4003 S.aureus E.coli man
12-5279
HzNANr·Oy(r) _.:I
180 300 0.85 0.012 >300
·~~0
H,N_..4NI "I
13-4670
HzNAN·&t:x"0 ,...I
Cl - 23 >100 0.55 0.6 >300
H1N
·&yc~
).,
~N
I
"
I
NL)
11-8960
HzNANI
·r« '-I
HzNAN
·~r:1 " 0
.,....NY-o:o,
6. '0
..,
46·4561 4.6 6.0 0.027 0.0095 >300
('
H2N
!7'Qto
N ' 't;)
11-8958 r' - 3 2.9 0.011 0.0018 600
08-4484
H1N~N·5L¢c'' I
_.ol
'
I
0
.,.1~,
18-2049
" 5.5 2.3 0.0065 0.0015 170
18-4802
·35-JJ
Hlf_.l.!_t( ""
4.0 1.5 0.002 0.001 0.004
59-~
Cl
16-8820
·r«
Hlf),_N
Hlf_£:
' 8r
.))._
H1N~
•:]:"
•:X>- o+r
11-7396 NHl
nt >100 24 0.071 nt
NH1
r
Hlf...L:::,N I s s
15-4672 120 56 0.18 7.2 >300
21·0057
·W,
H1N_.4N I I " 0
I >100 280 0.7 80 >300
535
ACKNOWLEDGEMENT
We thank Dr. S. Jolidon for his advice and help during this work.
REFERENCES
536
TRANSLATIONAL REGULATION OF THE SYNTHESIS OF DIHYDROFOLATE REDUCTASE
INTRODUCTION
Earlier studies showed that administration of MTX to patients leads
to an increase in the level of DHFR protein in both normal and leukemic
leukocytes as well as in erythrocytes within hours to days. 1•2•3 In vitro
studies using a human lymphoblastoid cell line showed that increase in DHFR
protein is not transcriptionally mediated but was abolished by
cycloheximide treatment, suggesting that new protein synthesis is required.r.
The rapid increase observed was attributed to either protection of DHFR
from degradation by bound MTX and/or dihydrofolate, 4 or to an increase in
translation of this enzyme. 5 An increase in thymidylate synthase activity
has been reported after 5-fluorouracil treatment, 6- 8 and it has been
suggested that this increase may also be regulated at the translational
1eve 1. 7•8 In this communication, we show that DHFR protein regulates its
synthesis by exerting an inhibitory influence on its translation and that
addition of MTX or dihydrofolate to the reticulocyte translation system
relieves this inhibition, thus providing a possible explanation for the
rapid increase in this enzyme activity noted in certain cells after MTX
administration. In addition, preliminary experiments using CHO cells
lacking the DHFR gene and transfected with DHFR eDNA lacking the 5' leader
sequence and treated with MTX showed an increase in DHFR, indicating that
this region may not be required for the DHFR protein/RNA interaction.
METHODS
Preparation of eDNA Template and In Vitro Transcription
A 141 bp fragment of 5' untranslated leader sequence was amplified
by PCR from genomic DNA isolated from a T47D human breast cancer cell line
using the following set of primers:
PI GGATCCTAATACGACTCACTATAGGGAGAGGGGGGGCGGAAGCTTGCCTGCACAAATAGG
PII AGTTTTAGCGAACCAACCATGGCAGCAGCGGGAGG
PCR conditions were 94·C x 1 min., 50·C x 1 min., and 72·C x 1 min.
for 40 cycles. Another eDNA template was amplified by PCR using the DHFR
eDNA present in the plasmid, pKT7HDR (containing the 639 bp wild type human
DHFR eDNA Ncoi and Hindiii fragment) with the following primers:
RESULTS
The in vitro reticulocyte lysate translation system was optimized
both for the concentration of DHFR mRNA and for the time of translation.
7.5 pmols of mRNA and 20 min. of translation time at 37·C were found to
give the best yield of DHFR protein.
These conditions were used to study the effect of exogenously added
recombinant normal human DHFR protein 10 on the translation of DHFR mRNA.
Figure 1 shows that 238 pmols of human DHFR inhibits translation of DHFR
mRNA. This inhibition was relieved by the addition of 43 ~M MTX-Glu 4 or 43
~M FH.f!' suggesting that inhibition was a direct effect of added DHFR
prote1n. MTX and FH 2 alone appeared to increase the translation of DHFR.
DG44 cells transfected with the mammalian expression vector, pSV5HDR (see
Materials and Methods), and treated with either 500 or 1000 nM drug MTX
exhibited a 3-4-fold increase in DHFR activity at 24 and 48h. Wild type CHO
cells had no or only a slight increase in DHFR activity after MTX treatment
(Figure 2).
DISCUSSION
In this reticulocyte lysate assay, DHFR protein is shown to inhibit
translation of DHFR mRNA. The reversal of this inhibition by MTX or FH 2 may
explain in part the observed "induction" of DHFR activity in normal and
leukemic cells after MTX treatment. Other proteins that have been shown to
regulate their translation in eukaryotes are ferritin and thymidylate
synthase. A 90 kDa ferritin repressor protein has been shown to bind to the
iron responsive element within the 5' UTR of ferritin mRNA. 12 The TS protein
has recently been shown to bind to its own mRNA and inhibit translation,
although the exact location and sequences in TS mRNA that the protein binds
538
1 2 3 4 5 6 7 8 9
Figure 1. Inhibition of DHFR synthesis by exogenously added recombinant hDHFR protein can be reversed
by addition of MTX·Glu4 and FH 2 • No mRNA (lane 1); 7.5 pmol DHFR mRNA alone (lane 2) and 1n the presence
of human recombinant DHFR protein (240 pmol 1n lane 3) and with MTX-Glu4 (43 /.IM and 86 /.IM in lanes 4 and
5, respectively) and w1th FH 2 (43 /.IM and 86 /.IM 1n lanes 7 and 8, respectively). Lanes 6 and 9 show that
MTX-Glu4 (43 f.IMJ and FH 2 (43 /.IM) alone d1d not 1nh1bit translat i on.
2.00
- 24 h (ilii'ill 48 h
LOO
0.80
- 24 h mEtlll 48 h
1.60 w
..
a: ?.
~ ..
a:
l: 0 .60
·~
l:
0
1.20 f. 0
!! 2
"'
E
:~
:~ ~it ~. "'e
!i
~(
5
e ;~
~
IT 5
e
0.40 ~
!~ ,.
~·
0. 80 1%
H {:
~~ j
~ ~ "
'~
t¥1..
ijl i~
Iii ~~~
~·'
I
0.40 :g ~::
0 .20
I
;~
:1!
"'~
~:.:-:
,~
"
w
'1}
1ft
~.
~ *
.
~t.
0.00
if it 7:
0.00
0 0 '*
.5
".. .. ,x
0 .5 1 0 .5 .5
"M MTX
Figure 2. DHFR activity in ce ll free lysate of MTX treated CHO wild type cell s (l e ft panel) and
transfected DG44 cells (right panel).
539
to have not been reported. 8 Transfection studies in CHO DG44 cells with the
pSV5DHFR construct containing the human DHFR eDNA suggest that the 5'
leader sequence is not involved in DHFR binding. Studies by Cowan et al.
also using CHO cells lacking the DHFR gene and transfected with a human
DHFR minigene concluded that sequences other than the coding region affect
regulation by MTX. 11 This raises the possibility that the 3' untranslated
region (approximately 80 bp downstream of the TAA stop signal) may be
involved in the autoregulation process. Our current studies are directed
to understanding the sequences in DHFR mRNA involved in binding the DHFR
protein and the sequences in the protein that bind to the mRNA.
REFERENCES
1. J.R. Bertino, D.M. Donohue, B.W. Gabrio, R. Silber, A. Alenty, M.
Meyers, and F.M. Huennekens, Increased level of dihydrofolate
reductase in leukocytes of patients treated with aminopterin, Nature
193:140-141 (1962).
2. J.R. Bertino, D.M. Donohue, B. Simmons, B.W. Gabrio, R. Silber, and
F.M. Huennekens, The "induction" of dihydrofolate reductase in
leukocytes and erythrocytes of patients treated with methotrexate,
J. Clin. Invest. 43:466-475 (1963).
3. J.R. Bertino and B.l. Hillcoat, Regulation of dihydrofolate reductase
and other folate requiring enzymes, in: "Advances in Enzyme
Regulation," Pergamon Press, New York (1968).
4. B.l. Hillcoat, V. Swett, and J.R. Bertino, Increase of dihydrofolate
reductase activity in cultured mamma 1ian ce 11 s after eJCposure to
methotrexate, Proc. Natl. Acad. Sci., U.S.A. 58:1632-1637 (1967).
5. K. Bastow, R. Prabhu, and Y.-C. Cheng, The intracellular content of
dihydrofolate reductase: possibilities for control and implications
for chemotherapy, Adv. Enz. Reg. 22:15-26 (1984).
6. K.D. Danenberg and P.V. Danenberg, Activity of thymidylate synthase and
its inhibition by 5-fluorouracil in highly enzyme-overproducing cells
resistant to 10-propargyl-5,8,-dideazafolate, Mol. Pharmacal. 36:219-
223 (1989).
7. E. Chu, J.C. Drake, D.M. Koeller, S. Zinn, C.A. Jamis-Dow, G.C. Yeh,
and C.A. Allegra, Induction of thymidylate synthase associated with
multidrug resistance in human breast and colon cancer cell lines,
Mol. Pharmacal. 36:136-143 (1990).
8. E. Chu, D.M. Koeller, J.l. Casey, J.C. Drake, B.A. Chabner, P.C.
Elwood, S. Zinn, and C.J. Allegra, Autoregulation of human
thymidylate synthase messenger RNA translation by thymidylate, Proc.
Natl. Acad. Sci., U.S.A. 88:8977-8981 (1991).
9. G. Urlaub, E. Kas, A.M. Carothers, and l. Chasin, Deletion of the
diploid dihydrofolate reductase locus from cultured mammalian cells,
Cell 33:405-412 (1983).
10. B.I. Schweitzer, S. Srimatkandada, H. Gritsman, R. Sheridan, R.
Venkataraghavan, and J.R. Bertino, Probing the role of two
hydrophobic active site residues in the human dihydrofolate reductase
by site directed mutagenesis. J. Biol. Chern. 264:20786-20795 (1989).
11. K.H. Cowan, M.E. Goldsmith, M.D. Ricciardone, R. levine, E. Rubalcaba,
and J. Jolivet, Regulation of dihydrofolate reductase in human breast
cancer cells and in mutant hamster cells transfected with a human
dihydrofolate reductase minigene, Mol. Pharmacal. 30:69-76 (1990).
12. E.C. Theil, Regulation of ferritin and transferrin receptor mRNAs, J.
Biol. Chern. 9:4771-4774 (1990).
540
EXPRESSION OF THE TRIMETHOPRIM RESISTANT DIHYDROFOLATE
REDUCTASE ENCODED BY TRANSPOSON TN4003 IN A SOLUBLE
FORM AND ITS SUBSEQUENT PURIFICATION TO HOMOGENEITY
INTRODUCTION
In recent years resistance to trimethoprim (Tmp) has increased and several Tmp-
resistant (Tmpf) dihydrofolate reductases have been described in gram-negative bacteria. In
staphylococci, however, only one Tmpr dihydrofolate reductase (DHFR) has been found so
far and this is located on transposon Tn40031. To understand the mechanism of resistance
we are interested in determining the three dimensional structure of this enzyme (type Sl
DHFR). However, the expression level of the recombinant enzyme in E. coli was rather low
and the expressed protein was poorly soluble. Furthermore, as a result of an internal start of
translation a truncated derivative was produced which copurified with the full length
enzyme. In contrast to the type S 1 DHFR, the chromosomal Tmp-sensitive (TmpS) enzyme,
termed SaDHFR, of Staphylococcus aureus ATCC 25923 could be highly over-produced in
E. coli in a soluble and active form.
Based on the differences in the DNA and the amino acid sequences of these DHFRs we
increased the expression level of the type S 1 DHFR and eliminated the internal start of
translation. Furthermore, we changed amino acids on the surface of the type S 1 DHFR
resulting in a soluble and active mutein of the enzyme. This recombinant Tmpr enzyme was
purified nearly to homogeneity.
METHODS
E. coli M15(pREP4) cells2 harboring expression plasmids were grown to A600 = 0.9
in super-medium2 containing 100 j.lg/ml ampicillin and 25 j.lg/ml kanamycin, before gene
expression was induced by addition oflPTG. After 4 h of induction the cells were harvested
by centrifugation. Samples for SDS-PAGE were prepared by either directly resuspending
the cells in sample buffer or by resuspending the supernatants of cells disrupted by
sonication in sample buffer. The DHFR assay has been described4. A unit ofDHFR activity
was taken as the conversion of 1 j.lM of dihydrofolate per minute.
RESULTS
To analyse the basis why SaDHFR is expressed to a far higher level than type S 1
DHFR we constructed plasmids containing chimeric genes composed of defined regions of
the two DHFR genes. Both genes contain a convenient Styi site at position 66, which
corresponds on the amino acid level to position 22. This site and a Pvui site introduced by
site directed mutagenesis into the genes at position 150 (amino acid position 50) were used
542
for construction of four plasmids containing chimeric genes. Both of the plasmids containing
the 5' end of the gene for SaDHFR direct a high level expression of the encoded proteins,
whereas the remaining two plasmids containing the 5' end of the gene for the type S 1 DHFR
direct only a low level expression. Obviously, the nucleotides encoding the first 22 amino
acids of SaDHFR exhibit a positive effect on the expression level of the chimeric proteins.
Within this region SaDHFR and the type S 1 DHFR differ by 4 amino acids and the
corresponding genes by 18 nucleotides. Consequently, to eventually increase the expression
level of the type S1 DHFR we mutated the coding region present in plasmid pS1(Is) by
replacing as many of the 18 nucleotides as possible by nucleotides occurring in the gene for
SaDHFR. In fact, E. coli cells containing the resulting plasmid pS1(RNA) produce type Sl
DHFR to the same high level, which is achieved for SaDHFR.
1 Production conditions: 10 ml shaking culture, LB medium, 37'C, 210 rpm, induced at 0060()=0.9 for 4h.
The second value gives the expression level obtained with a coding region for the enzyme optimized for
expression.
2 Relative solubilities (SaDHFR = 100; Type Sl DHFR = 1) after sonication of E. coli cells in SO mM
phosphate buffer, pH7.
3 Enzyme activity in the supernatant of sonicated producing E. coli cells.
543
gene optimized for expression (internal start of translation removed, RNA optimized for
expression) this mutein showed a solubility comparable to SaDHFR (Table 1). The increase
in solubility of S1 DHFR[N48E,N130D] versus the type S1 DHFR is best demonstrated by
comparing the enzymatic activities present in the supernatants of cultures after disruption of
the cells (Table 1). Interestingly, the mutein S1 DHFR[N48E,N130D] exhibited a similar
IC50 for Tmp as type S1 DHFR indicating that the activity of the mutein towards the
substrate is not affected by the mutations.
Purification of Sl DHFR[N48E,N130D]
SUMMARY
A high level expression in E. coli of the Tmpr type S1 DHFR was achieved by: (1)
elimination of an internal start of translation within the RNA, and (2) optimization of gene
expression by replacing nucleotides at the 5' end of the gene by nucleotides present in the
highly expressible gene for SaDHFR.
In addition, by replacing amino acids supposed to be on the surface of the protein, the
mutein S1 DHFR[N48E,N130D] was constructed, which can be expressed in E. coli to
high levels in a soluble and active form.
The mutein S1 DHFR[N48E,N130D] was purified nearly to homogeneity. The enzyme
is highly active and remains soluble even at a protein concentration of 10 mg/ml.
REFERENCES
1. D.A. Rouch, L.J. Messerotti, L.S.L. Loo, C.A. Jackson, and R.A. Skurray, Trimethoprim resistance
transposon Tn4003 from Staphylococcus aureus encodes genes for a dihydrofolate reductase and
thymidylate synthetase flanked by three copies of IS257, Molec. Microbiology 3:161 (1989).
2. D. Stiiber, H. Matile, and G. Garotta, System for high level production in E. coli and rapid purification
of recombinant proteins: Application to epitope mapping, preparation of antibodies and structure-
function analysis, in: "Immunological Methods", I. Lefkovits and B. Pemis, eds., Academic Press,
Orlando (1990).
3. M.A. Innis, D.H. Gelfand, J.J. Sninsky, and T.J. White. "PCR Protocols: A Guide to Methods and
Applications", Academic Press, San Diego (1990).
4. D.P. Baccanari and S.S. Joyner, Dihydrofolate reductase hysteresis and its effect on inhibitor binding
analyses, Biochemistry 20:1710 (1981).
544
EFFECT OF GENOMIC POSITION ON AMPLIFICATION OF THE DFR1 GENE IN
SACCHAROMYCES CEREVISIAE
INTRODUCTION
Drug Selection
MTXR strains were selected by plating 1-2 x1 o7 stationary phase cells on
complex medium (YEPD) agar plates containing 100 Jlg/ml MTX and 5mg/ml
sulfanilamide (Sigma). Cells were grown on selection plates for 5 days at 3ooc which
produced a confluent lawn and then replica-plated onto fresh drug plates. MTXR colonies
were then scored as discrete colonies after 5-6 days further incubation. ~-gal activity
in drug-resistant isolates was assayed qualitatively on buffered SDZ agar plates
containing 1oo Jlg/ml X-gal4 and quantitatively according to the culture assay method of
Rose and BotsteinS. Reaction mixtures were incubated at 37oc for 25-40 min and
stopped by addition of 1M Na2 C 0 3. Units of activity were defined as
OD42o/ODsoo/min/ml measured in a Beckman model DU7 spectrophotometer.
Transformations
Spheroplasts of strain M1-2B (genotype: Mata., trp1-289, ura3-52) were
transformed by the spheroplast method. The plasmid DNA used for transformations was
linearized by restriction enzyme digestion at a site yielding ends homologous with the
target genomic DNA. Ura+ transformants having the predicted Southern hybridization
pattern and ~-gal activities consistent with a single cassette insertion event were used
for further study (data not shown).
RESULTS
Haploid yeast cells were transformed with a DNA cassette containing the DFR1
geneS and a fusion of the yeast LElJ2 upstream DNA sequence with the lacz coding region
of E. coli. Since the DFR1 gene and the /eu2::/acz fusion were regulated independently we
considered an increase in the activity of both gene products by a single mutational event
to be unlikely. Thus, by using MTX resistance as a selected marker and increased ~-gal
activity as a secondary reporter activity we supposed that DNA amplification events
could be easily distinguished from other genetic alterations, which might have given rise
to a drug-resistant cell.
When strains containing the DNA cassette in one of a variety of different genomic
positions were plated on MTX medium a large variation in the frequency of MTXR
outgrowths was observed (Table1 ). The highest frequency of MTXR clones was seen in
the strain in which the cassette had been integrated at the RDN1 locus. Other genomic
locations which increased the frequency of drug resistance were: proximity to a telomere
or integration into an actively transcribed region (Table1 ). When drug-resistant
outgrowths were grown in culture and assayed for ~-gal activity 80-90% had eiiOlvated
enzyme levels compared to the host (Fig.1 ). This suggests that DNA amplification is a
relatively common mechanism of MTX-resistance.
546
Table 1 Effect of genomic position on MrxR frequency
15
;;...
....
>
.....
....
10
u
<
..J
<
0
....<
5
w
=
0
SUC2 HIS! RDN1 URA3
GENOMIC POSITION
Figure1_ Effect of genomic position on ~-gal activity of MTXR clones. The target locus
for cassette integration for each strain is indicated. ~ -gal activities were determined as
described in "Methods". Each bar represents an independent isolate.
547
20
15
;><
u
7-
W;l
;:::> 10
c;
W;l
Qii
~
5
0
2 3 4 5 6 7
BETA-GAL ACTIVITY
Figure2. Frequency distribution of ~-gal activity of MrxR clones at the URA3 locus. MTXR
colonies were selected a random and assayed for ~ -gal activity as described in "Methods".
40
><
....
..... 30
>
.....
....
u
<
...l 20
<
"....<
W;l
;:!:~
10
Figure3. Effect of increased MTX concentration on ~-gal activity at the RDN1 locus. MTXR
colonies were selected on agar plates as described in "Methods". Colonies were
replica-plated onto medium containing 5mg/ml sulfanilamide and step-wise increases in MTX
concentration. 20 colonies were selected at random from each series of drug plates and
assayed for ~-gal activity as described in "Methods". The data represents the mean ~ - gal
activity for each series.
548
Ml/28 Ml3 5 4
DFRJ_,
E 4.5 E 3.2 E
genomic
s E B
probe
F1gure 4. Southern hybnd1zat1on analys1s of MTXR clones at the RDN1 locus
M1-2b=host strain, M13= cassette mtegrated at RDN1 , samples 4 and 5= MTXR clones havmg
mcreased ~-gal actiVIties of 13 8 and 12 6 fold, respectively Genomic DNA was extracted
from cultured cells and digested w1th EcoR1 2 5 ug DNA was loaded 1n each lane and probed
w1th a 1 8 kbp Sa/1-BamH1 genomic fragment conta1mng the DFR1 cod1ng reg1onB Fragment
s1zes are g1ven for cassette DNA sequence
The frequency distribution of ~-gal activities of MTXR clones at the URA3 locus is
shown in F1g.2. The mean increase in enzyme activity was about 3 fold. Similar results
were found for several other genomic locations (data not shown). When cells from
several of these MTXR clones were growth in stepwise increases in drug concentration
the mean ~ -gal activity of the population increased about 6-fold (data not shown). In
contrast, cells contaming the cassette at RDN1, which were subjected to the same drug
regimen, showed an mcrease in enzymatic activity of about 30 fold (Fig.3}. Southern
hybridization analysis showed that the cassette DNA was amplified in these strains
(F1gA). However the gene copy number as determined by Southerns was consistently
lower (1.5-6 fold} than that calculated on the basis of ~-gal activity. This may indicate
that the enzyme assay method is a very sensitive indicator of DNA amplification events
or that newly amplified reg1ons have increased levels of gene expression.
549
DISCUSSION
In this study we have amplified the DFR1 gene at at several genomic locations in
S. cerevisiae. The frequency of MTXR outgrowths varied over a 2000 fold range at the
different chromosomal loci. Similar chromosomal position effects have been observed in
animal cells8. The RDN1 locus gave the highest frequency of drug resistance. This
genomic location is a special case as it contains a large number of repeated DNA
sequences (ca. 140}. Our results are in agreement with reports published previously
for other genes integrated at the RDN1 locus9.
Although there is considerable variation in MTXR frequencies at other genomic
locations (Table 1), at the present time we cannot ascribe these differences with any
certainty to any particular chromosomal structure. Further more detailed study is
required to determine whether these or other DNA context elements, such as retroposon
(Ty) sequences or DNA replication origins influence the amplification process. There is
a hint from this data that differences in amplification frequency may be due, at least in
part, to accessibility of the cassette DNA by the transcription apparatus, regions known
to have higher recombination rates in yeast, or to proximity to a telomere (Table1 ).
The finding that 80-90% of primary drug resistant clones had elevated ~-gal
levels suggests that DNA amplification is a relatively common mechanism for MTX
resistance in yeast. In addition, all primary drug resistant clones examined were highly
unstable, as measured by the loss of ~-gal activity in the absence of selection. This may
suggest that nascent DNA amplification structures are inherently unstable ( as would be
expected if chromosome fragmentation was an early step in the amplification process3)
or that increased DHFR activity in amplified strains destabilizes the genome. A recent
report suggests that the latter is the case in MTXR Chinese hamster V79 cells 1o.
If this genetic instability observed in MTXR yeast and Chinese hamster cells is
also true of human tumor cells, these findings may have important clinical
considerations. It will imply that MTXR cells not only represent a clinical problem
because of the outgrowth of drug-resistant cells but also because the genomic instability
of drug-treated cells may generate new variants at higher rates. Thus, the inherent
instability of MTX-resistant cells may contribute to more rapid tumor progression and
the generation of cells with increased metastatic potential. The series of strains
described here will provide a useful model system, in a simple eukaryote, for the study
of the molecular mechanism of DFR1 gene amplification and the effect of these events on
the stability of the genome.
REFERENCES
1. G.R. Stark, M. Debatisse, E. Giulotto and G.M. Wahl, Cell 57:901 (1989}.
2. G.M. Wahl, Cancer Res. 49:1333 (1989}.
3. B.E.Windle and G.M. Wahl, Mutat. Res.
4. M.J. Casadaban, A. Martinez-Arias, S.K. Shapira, and J. Chou, Methods in Enzymol.
100:293 (1983).
5. M. Rose, and D.Botstein, Methods in Enzymol. 101:167 (1983).
6. B.J. Barclay, T.Huang, M.G. Nagel, V.L. Misener, J.C. Game, and G.M. Wahl, Gene
63:171 (1988).
7. R.K. Mortimer, C.R. Contopoulou and J.S. King, Yeast 8:817 (1992}.
8. G.M. Wahl, R. de Saint-Vincent and M. DeRose, Nature 307:516 (1984).
9. J. W. Szostak and R. Wu, Nature 284:426 (1980).
10. M. Roy, S. Sengupta, R. Ghosh, N.P. Bhattacharyya, S.K. Dey and S.B.Bhattacharjee
Mutat.Res. 291:43 (1992).
550
DIHYDROFOLATE REDUCTASE IS NOT THE TARGET OF TRIMETHOPRIM IN
SACCHAROMYCES CEREVISIAE
INTRODUCTION
rad6 and rad18 strains, cultured in complex medium containing MTX, show dose-
dependent inhibition of cell growth, with the same kinetics and at similar drug
concentrations as wild-type cells (Fig.1). Thus, the TRM sensitivity of the DNA repair
mutants does not appear to be due to an impairment in folate biosynthesis or to a
decrease in the level of DFR1 gene expression. Transformants harboring additional
copies (8-1 0) of the DFR1 gene, are significantly more MTX-resistant than cells
containing a single copy of the gene (Fig.1). Similar results obtained for MTX-treated
cells in defined medium have been published previously?.
The results of parallel experiments using TRM as the inhibitor are in contrast to
those obtained with MTX. Firstly, the rad mutants have different growth inhibition
kinetics than wild-type, and are more sensitive to low concentrations of the drug
(Fig.2). Secondly, there is no detectable effect of increased DFR1 gene copy number on
the TAM-sensitivity of any of these strains (Fig.2). lastly, unlike MTX, TRM caused
significant lethality in medium lacking all one-carbon metabolites12 ( Table1).
Cells were incubated for 20h in medium containing 500 J.Lglml MTX or TRM as described in the
legend to Fig.1. Viability was determined by colony forming ability on YEPD agar plates. After 3-4 days
incubation at 30°C, colonies were overlaid with 2,3,5-triphenyltetrazolium chloride9 and scored for
respiratory-activity. ND = none detected. +DFR1 = transformant containing multi-copy plasmid.
The two drugs also affect the respiratory competence of treated yeast cells quite
differently. Anti-folate drugs induce respiratory-deficient mutants (petites) in yeast
by two mechanisms: by depletion of intracellular pools of 10-formyltetrahydrofolate,
required for the initiation of mitochondrial protein synthesis 10 , and by thymidylate
stress-induced mutagenesis of the mitochondrial genome 11. In both RAO+ and rad1 8
strains, MTX induced petites at high frequency, as expected (Table1). In contrast, TAM
had no detectable effect on the frequency of respiratory-deficient cells, in the
population.
552
100
Rad + rad 6 rad 18
,. !'i
6
X 75
1- fj
;;: 6
0 6
a:
(!)
w 6
> 50
i=
<(
.....
w
a:
25
--~
0
0 2 3 4 0 2 3 4 5 0
[Methotrexate] (f.Lg/ml x 1o-l)
0
0 1 2 3 4 5
[Tnmethopnm] (f.Lg/ml x 10-2)
553
TRM has been used clinically as an effective anti-microbial agent for over three
decades and is well-characterized as a DHFR inhibitor13. However, the results presented
here suggest another target for the drug in S. cerevisiae. Although the precise nature of
any alternate target for the drug is unknown at the present time, the drug-sensitivity of
DNA repair mutants suggests that DNA damage might be implicated. TRM may cause DNA
damage directly, repaired by the error-prone pathway, in wild-type cells. Conversely,
the RAD6 and RAD18 gene products might be complexed with proteins involved in semi-
conservative DNA replication. The TAM-sensitivity of the mutants could be a
consequence of increased affinity for the drug by a folate binding protein, (perhaps a
structural function of DHFR), of the DNA replication complex. A similar explanation has
been proposed for the increased sensitivity of DNA synthesis mutants of T 4
bacteriophage to the DHFR inhibitor pyrimethamine14.
Although the detailed roles of the RAD6 and RAD18 genes are not known, they are
thought to have closely related functions in error-prone DNA replication 15. Mutants
defective in these genes, fail to respond to the mutagenic action of UV-Iight16 and DNA-
damaging chemicals 17. The RAD6 gene product has been identified as a ubiquitin
conjugating enzyme 18 and has been reported to play a role in cell-cycle progression 19.
Why a defect in either of these activities would sensitize yeast cells to TRM is unclear.
A possible connection between folate metabolism and the product of the RAD6 gene
may be via thymidylate synthase as it has been suggested that rad6 mutants fail to
recognize a thymine nucleotide signal in the induction of error-prone repair20.
The identification of an alternate target for TRM, may help to clarify this
potential relationship between folate metabolism and the mutagenic DNA repair pathway.
REFERENCES
1. J.C. Game, J.G. Little and R.H. Haynes, Mutat. Res. 28:175 (1975).
2. C.W. Lawrence and R. Christensen, J. Bacterial. 139:866 (1979).
3. V.W. Mayer and C.J. Gain, Genetics 106:577 (1984).
4. J.L. Johnson, S. Hamm-Aiverez, G. Payne, G.Sancar,and G.B. Rajagopalan, Proc. Nat/. Acad.
Sci. USA 85:2046 (1988).
5. G.B. Sancar Mutat. Res. 236:147 (1990).
6. M.S. Jorns in: "Chemistry and Biology of Pteridines" H-Ch.Curtius, S. Ghisla and N. Blau
eds. Walter de Gruyter Berlin, New York (198g).
7. T. Huang, B.J. Barclay, T.l. Kalman, R.C. von Borstel, and P.J. Hastings, Gene
121:167 (1992).
8. B.J. Barclay, K.J. Silva, T. Huang, S.M. Rosenberg and P.J. Hastings, (submitted).
9. B.J.Barclay, and J.G. Little, Mol. Gen. Genet. 160: 33 (1978).
10. U. Wintersberger and J. Hirsch, Molec. Gen. Genet. 126:61 (1973).
11. B.J. Barclay, B.A. Kunz, J.G. Little and R.H. Haynes, Can. J. Biochem. 60:172 (1982).
12. B.J. Barclay and J.G. Little, J. Bacterial. 132:1036 (1977).
13. G.H. Hitchings, ed., "Inhibition of Folate Metabolism in Chemotherapy" Springer-Verlag, New
York. (1983).
14. P.M. MacDonald and D.H. Hall, Genetics 107:343 (1984).
15. C. Cassier-Chauvat and F. Fabre, Mutat. Res. 254:247 (1991 ).
16. C.W. Lawrence, J.W. Stewart, F. Sherman and F.L.X. Thomas, Genetics 64:S36 (1970).
17. L. Prakash Genetics 78:1101 (1974).
18. S. Jentsch, J.P. McGrath and A. Varshafsky, Nature 329:131 (1987).
19. K.S. Ellison, T. Gwozd, J.A. Pendergast, M.C.Paterson and M.J. Ellison, J. Bioi. Chern.
266:24116 (1991 ).
20. B.J. Barclay and J.G. Little, Mol. Gen. Genet. 181:279 (1981).
554
POINT MUTATIONS IN THE DIHYDROPTEROATE SYNTHASE GENE
CAUSING SULFONAMIDE RESISTANCE
INTRODUCTION
M K L F A Q G T S L D L S H P H
(a) ATG AAA CTT TTT GCC CAG GGT ACT TCA CTG GAC CTT AGC CAT CCT CAC
(b)
(c) --- --- --c --- --- --- --- --- --- --- --- --- --- --- --- ---
V M G I L N V T P D S I S D G G
(a) GTA ATG GGG ATC CTC AAC GTC ACG CCT GAT TCC ATT TCG GAT GGT GGC
(b) --- --- --- --- --- --- --- --- --- --- --- T-- --- --- --- ---
(c) --- --- --- --- --- --- --- --- --- --- --- T-- --- --- --- ---
Figure 1. The first 96 nucleotides of the tlhps coding sequence from the E. coli strains C-167ts20
(a), C-167 (b), and K12 (c). Identical nucleotides are marked with hyphens(-).
556
resistant strain G72 were determined and a comparison of the deduced
amino acid sequences are shown in Fig 2. The number of differences
between the three strains is remarkable but not evenly distributed. In the 5'
part Gl and G72 are almost identical, while G56 differs in many positions.
From position 38, G56 and G72 are almost identical and differ from Gl.
Towards the 3' end the three sequences again becomes more similar with
still some but markedly less differences.
G56 MKIGKFVIDGNAAIMGILNVTPDSFSDGGSYTTVQKVLQQVDQLIAGGAKIIDVGGESTR
Gl .... R.. VE ........................... A.DH. E .M .. D............ .
G72 .... R.. VE.K ......................... A...................... .
G56 PGYQFVSAADEIERVVPMIKAIKAKYDVLISIDTYKTETARAALEAGADILNDVRAGLYD
Gl .. CR .... T ••• D •••• V ••••• EN •• I •••••••••••••••.•••••••••• W•••••
G72 ••••••••••••••••••• I •••••••••••••••••••••••••••••••••• W•••••
G56 GEMLALAAEYDVPIILMHNQKEEVYQDVTQDVCDFLSARAQAAIDAGVPKDNIWIDPGFG
Gl .Q.F ....... A •••••••• D ••••• E ••••••••• GN ..... L •••••• K •••••••••
G72 ........................................................ .....
G56 FPKSVQHNMELLKGLDHVCQLGYPVLFGISRKGVVDALLGGNTKAKERDGATAALSAYAL
Gl .A •••. Q••••••••• R •••••••••.••••• R •.••••••••••.••••.•••••••••
G72 .A •.•••••••••... R ••••.•••••••••. HI ......................... .
G56 GKGCQLVRVHDVKANQEIVAVLSQLM*
Gl ••••• I •••..•.••• D .•.•••.••
G72
The E. coli ts mutant had a F to I change at pos 28. Also another E. coli
mutant with a changed amino acid at pos 25 has been reported2. Also the
Neisseria meningitidis clinical isolates BT227 and 3976 has amino acid
changes at the corresponding position. However, the resistant isolates
M0035 and 418 as well as the S.pyogenes resistant strains has the wild type F
at this position. In the isolate 418 the first 130 amino acids are identical to
those found in sensitive isolates, while the following amino acids differ
557
substantially from the sensitive strains and are instead identical to those
found in other resistant strains. Crucial differences should thus be found in
the part of the sequence that is unique for the resistant strains. One
remarkable difference between the sensitive and resistant strains of N.
meningitidis is an SG insertion next to a conserved part of the enzyme.
However, the sulfonamide resistant strain BT227lacks the SG insertion and
there is no obvious difference between the sulfonamide resistant and
sensitive strains of S. pyogenes in this part of the sequence. Around pos 230
another conserved sequence SRK is found in all strains, both sensitive and
resistant. The amino acid following this conserved sequence is in most
sensitive strains an R, whereas many resistant strains has an S instead. In
the S. pyogenes strains, G1 has an R, while the resistant strains G56 has G
and G72 has H, respectively. Of all possibilities, these differences seems to be
most likely to be important for resistance, although this has to be shown by
directed mutagenesis.
Figure 3. Comparison of amino acid sequences for dihydropteroate synthases from strains of
Neisseria meningitidis showing resistance or sensitivity to sulfonamides. Hyphens (-)
denotes identical amino acids. Asterisks (*) denotes conserved amino acids.
REFERENCES
558
FREQUENT AMPLIFICATION OF A SHORT CHAIN DEHYDROGENASE
GENE IN METHOTREXATE RESISTANT LEISHMANIA
Amplification of the H locus does not correlate with elevated levels of DHFR-TslO,
with decreased uptake of the drug 0 or with increased MTX hydrolysisll. These studies were
done in mutants selected for MTX resistance in a step by step fashion. In L. tarentolae, the
transfected ltdh gene, due to its better expression, gave much higher resistance than when
amplified as part oflarge amplicons8. We have therefore reexamine whether a decrease in the
~ neo
pNeo40.8
minutes
Figure 1. Steady-state accumulation of radioactive MTX (expressed as pmol MTX/mg protein) versus time
in control cells (neo) and ltdh tran~fectant (pNeo40.8). Experiments were carried essentially as described6,7.
Each time point is the mean of three independent measures.
It is therefore clear that ltdh confers resistance to MTX by a novel mechanism. Our
working hypothesis is that ltdh. once expressed at high levels, is capable of providing
reduced folates to the cells even when the DHFR is blocked8,14. Leishmania were thought
to be auxotrophic for folates but there is now clear evidence that Leishmania is capable of de
novo folate synthesis from biopterinl5. The overproduced LTDH could either replace
DHFR-TS similarly to the plasmid encoded DHFR in ttimethroprim resistant bacteria, or
could be involved in the pathway responsible for the conversion of biopterin to reduced
folates. Interestingly, some enzymes that are pa11 of the bioptetin metabolism belong to the
same short chain dehydrogenase family as LTDH16,17.
If ltdh overexpression is capable to replace DHFR, it should, in principle, confer
resistance to all molecules acting as DHFR inhibitors in Leishmania. Ltdh transfectants were
indeed found to be resistant to ttimetrexate and aminopterin 8. The sensitivity measurements
are usually done in tich medium in which thymidine is present, hence reducing the need for
reduced folates. The ltdh transfectants were also tested in various medium, including
completely defined medium IS, lacking folates and thymidine (Table 1). The less folate or
560
thymidine the medium contains, the lower is the inhibitory concentration for MTX (Table 1).
However, the ltdh transfectant (pNeo40.8) was always highly resistant to MTX even in poor
medium where reduced folates are absolutely needed for the synthesis of thymidylate
precursors (Table 1). Wild type cells are capable to grow for 10-15 generations in fdDMEL,
living on their stored folate pools hut will eventually die. The ltdh transfectants are capable to
grow for more than 60 generations, albeit at much reduced rates than in DMEL (unpublished)
indicating either that LTDH might synthesize, inefficiently, reduced folates from a medium
lacking folates or biopterin, or that the pool of reduced folates is much larger in pNeo40.8.
Table 1. Ltdh confers high level resistance to MTX in rich and poor medium
lsDM-79 is a rich medium containing M199 (Gibco), DMEM (Gibco), and fetal calf serumlO.
M199 is Ml99 medium pin:- fetal calf serum. DMEL medium is a defined medium for
Leishnurnia18 and fdDMEL is a DMEL medium deficient in folates.
2The relative MTX resistance values were obtained by dividing the 50% growth inhibition value
of the strain tested by the :-mne value for the wild type cells. A value of 1 indicates that the
strain tested and the wild type have the smne sensitivity for MTX.
3rm·II pNeo. a wild type Leishmania strain transfected with the vector alone; Tm-II pNeo40.8, a
strain o·ansfected with the ti"agment containing the ltdh gene.
4Ec 50 values for MTX in the different medium m·e in pm-enthesis.
In collaboration with Jolivet (Montreal) and Priest (South Carolina) we have measured
the level of oxidized and reduced folates in Leishmania control and transfectant cells.
Preliminary results indicate that the level of dihydrofolate is much lower in ltdh transfectants
treated with MTX than in control cells treated with MTX (unpublished). This observation
would argue for a direct role of LTDH in the fmmation of reduced folates through the DHFR
pathway. Experiments to show that dihydrofolate is the substrate for LTDH have failed so
far, however. In order to better study the biochemistry of LTDH in resistance, we have
statted its overexpression and purification in E. coli cells.
AMPLIFICATION OF LTDH
561
their ltdh gene as part of circular or linear amplicons of various size with different
rearrangement points. The amplicons were usually stable when cells were selected with the
drug, but were lost rapidly in revertants. In some cell lines the amplicon appeared early
during the selection process whereas in others the amplified ltdh gene appeared only late.
The amplification of ltdh represents therefore a common mechanism for MTX resistance in
Leishmania. None of our MTX resistant mutants contained an amplified dhfr-ts gene.
We used steady-state accumulation transport studies with radiolabeled MTX to look at
its transport in Leishmania MTX resistant mutants with and without ltdh amplification. The
highly MTX resistant mutants (resistant to 1 mM MTX in SDM-79) all showed a decreased
steady-state accumulation of the drug, but could be separated in two classes. The first one
showed a five-fold decreased accumulation of MTX when compared to wild type. No
accumulation of radio labeled MTX could be measured in the mutants of the second class.
Interestingly, the mutants of the first class had ltdh amplified whereas no gene amplification
could be observed in the mutants that are part of the second transport category. It seems that
ltdh amplification is observed only in mutants where the transport mutations do not abolish
MTX accumulation.
The level of MTX accumulation is commensurate with the level of resistance in the
mutants that showed a five-fold decrease in accumulation. More MTX accumulates in the
mutants selected at the earlier passage at low dmg concentration than in later passages at
higher drug concentration. The mutation responsible for the lack of accumulation in the
mutants without ltdh amplification arises early during the selection process since no detectable
accumulation could be measured even in the mutants that were adapted to low drug
concentration. This explains well why these mutants were adapting much more rapidly to
higher MTX concentration than mutants that had ltdh amplification. We will now try to
isolate the gene(s) responsible for MTX entry and characterize the mutations responsible for
the differential accumulation of MTX in MTX resistant mutants.
ACKNOWLEDGEMENTS
REFERENCES
1. Ouellette, M. and Papadopoulou, B. (1993). Pru·asitol. Today. in press.
2. Codene, .T.A. eta!.. (19R3). Proc. Nat!. Acad. Sci. USA 80:2132-2136.
3. Grumont, R. eta!., (19R6). Proc. Nat! Acad. Sci. USA 83:5387-5391.
4. Beverley, S., Ellenberger. T.. ru1d Cordingley. .T. (1986). Proc. Nat!. Acad. Sci. USA 83:2584-2588.
5. Dewes, H., O;tergamd, I-LL., ru1d Simp~oon, L. (1986). Mol. Biochem. Pru·asitol. 19:149-161.
6. Ellenberger, T.E .. and Beverley. S.M. (1987) . .T. Bioi. Chern. 262:13501-13506.
7. Kaur K. eta!. (1988) . .T. Bioi. Chern. 263:7020-7028.
8. Papadopoulou, B., Roy, G., and Ouellette M., (1992). EMBO J., 11:3601-3608.
9. Callahan, H.L. and Beverley. S.M. (1992) . .T. Bioi. Chern. 267:24165-24168.
10. White, T.C'.et al. (1988) . .T. Bioi. Chern. 263:16977-16983.
11. Ellenberger, T.E. et al. (1989) . .T. Bioi. Chern. 264:15960-15966.
12. Cowan, K.H. and .Tolivet, .T..T. (1984) . .T. Bioi. Chern. 259:10793-10800.
13. Santi, D.V., Nolan, P., and Shane, B. (1987). Biochem. Biophys. Res. Comm. 146:1089-1092.
14. Ouellette M., & BoN P. (1991). Rei>. Microbiol. 142:737-746.
15. Beck, .T.T., and Ullman, B. (1991). Mol. Biochem. Pmasitol. 49:21-28
16. Ichino~oe, H.et a! (1991). Biochem. Biophys. Res. Comrn. 179:183-189.
17. Pru·k, Y.S.et a!. (1991). Biochem Biophy,. Res. Comm. 175:738-744.
18. Iovanni~oci. D.M., and Ullman, B. (1983) . .T. Pmasitol. 69:633-636.
19. Grondin, K., Papadopoulou, B., and Ouellette, M. (1993). Nucleic Acid Res. in press
562
ENZYME INTERACTIONS INVOLVING T4 PHAGE-CODED THYMIDYLATE
SYNTHASE AND DEOXYCYTIDYLATE HYDROXYMETHYLASE
INTRODUCTION
The enzymatic machinery for DNA replication functions at a high rate and
with extremely high accuracy. Typically, an Escherichia coli cell replicates its 4000-
kilobase pair genome in 40 minutes, using two replication forks, each of which
extends two chains. Thus, the rate of chain growth is about 800 nucleotides per
second at 37o. The four deoxyribonucleoside triphosphates (dNTPs) must be
provided efficiently at these few sites, in order to meet the demand. At the same
time the four dNTPs must be maintained at balanced concentrations. An excess or
deficiency of any one of the four leads to inaccurate DNA replication, thereby
stimulating spontaneous mutagenesis. Evidence suggests that steady-state dNTP
concentrations at replication sites are severalfold higher than intracellular
concentrations, as estimated from dNTP pool measurementsl. Thus, dNTP
concentration gradients must be maintained in the face of enormous rates of dNTP
pool turnover.
Because of these kinetic factors and because most of the dNTPs produced in a
cell are used for DNA replication (as opposed to DNA repair, recombination, or
transposition), it seemed reasonable to ask whether the enzymes of dNTP
biosynthesis interact with each other, and with DNA replication enzymes, to
facilitate synthesis of dNTPs and their movement from sites of production to sites
of utilization. Evidence supporting this concept emerged from experiments on T4
phage-infected E. coli, carried out in G. R. Greenberg's laboratory2,3. T4 encodes
nearly all of its own enzymes for both dNTP synthesis and DNA replication.
Figure 1 summarizes present knowledge of pathways of dNTP synthesis in T4
phage infection. Note that T4 encodes its own thymidylate synthase. A structurally
related enzyme, dCMP hydroxymethylase, catalyzes the synthesis of the modified
~CTPaa'}/t.'
/""'"•t)~:~ dC:monalt /dCTPalt·dUTPaao
FH
4 synthetase TdR
reduc~FH2 ~khymodone
'[i.:. 'l;._. . . :;,·lr r·
'/
/k•n-~se
dATP dTTP
""f.... . .... 'T
hm-dCTP dGTP
I I
lJ I
DNA polymerase
I
DNA
l DNA Qlucotyltrontferau&, methyloat
modified DNA
nucleotide, 5-hm-dCMP, from dCMP, and this accounts for the substitution of 5-
hydroxymethylcytosine for cytosine in phage DNA.
Greenberg and his colleagues devised the tritium release assay, widely used
since then in many laboratories to estimate intracellular flux through thymidylate
synthase. Administration to infected cells of 5[3H]deoxyuridine creates a pool of
labeled dUMP, from which radioactivity is displaced by the activity of dTMP
synthase. The rate of transfer of label to water is related to intracellular dTMP
synthase flux, and simple modifications to the procedure allowed simultaneous
measurement of dCMP hydroxymethylase flux rates. The ratio of synthase to
hydroxymethylase flux rates was found to be 2:1, consistent with the fact that the
AT-rich T4 genome requires thymine nucleotides to be synthesized at twice the
rate of hydroxymethylcytosine nucleotides2. That 2:1 ratio was maintained over a
wide range of physiological conditions3, suggesting either physical or functional
associations between these two enzymes, associations that could help regulate
their activities relative to each other.
Several other lines of evidence, both in the Greenberg laboratory and in ours,
supported the concept of enzyme interactions, and in 1977 we4 reported the
isolation of a multienzyme aggregate containing several phage-coded enzymes of
dNTP synthesis. We have been able to purify this aggregate, which we call the
dNTP synthetase complex, by several hundredfold5. All of the phage-coded
enzymes of dNTP synthesis shown in Figure 1 are present in this complex, plus at
564
least two enzymes of host origin-(deoxy)adenylate kinase and nucleoside
diphosphokinase. The complex has a molecular mass of about 1.5 million, as
shown by gel filtration. The purified complex carries out multi-step reaction
pathways with virtually no lag, and with negligible accumulation of intermediates,
as expected if it is designed as a substrate shuttle. One example of such a coupled
reaction pathway is the five-step sequence shown below.
synthesis
regulatory
dNTPs
Figure 2. A speculative view of the relationship between dNTP synthesis and DNA replication in
T4 phage-infected E. coli. The dNTP synthetase complex is represented as a "funnel", taking raw
materials from ribonucleotide reduction (the predominant pathway) or from host cell DNA
breakdown. Phage proteins functioning at the replication fork include the products of genes 43
(DNA polymerase); 44, 45, and 62 (processivity-enhancing proteins); 32 (single-strand DNA-
binding protein); and 41 and 61 (helicase-primase complex).
565
plasmids. Most of the enzymes that we have detected in the T4 dNTP synthetase
complex are now available as the products of cloned genes.
0
One dimensional analysis of radioactive proteins
(35S] methioKne labeled T 4 proteins 1E£2!!. proteins
E.coll
FT Q2 06 2.0
loaded on the aHinity column
circulated overnight al 0.1 mVmin
0. 2 Msa~sallcut
43
b} tJ
I I
211
18
Figure 3. SDS-P AGE analysts of T4 or E col! protems eluted from tmmobihzed T4 dCTPase-
dUTPase. Protems, [35S]methwnme-labelcd from 3 to 8 mmutes after mfectwn or mock mfectwn,
wpre eluted at the mdicated NaCI concentratiOns, with each fraction analyzed by electrophoresis
and radwautography FT, flow-through fractions
Note that of the tightly bound proteins (0.6 M and 2.0 M salt eluates) far more
phage proteins than E. coli proteins are bound, and that the bound proteins are
distinct subsets of the total populations of labeled proteins. Specifically bound
proteins can be identified by two-dimensional gel electrophoresis. Figure 4 shows
a radioautogram of a 20 gel display of total labeled T4 proteins. Most of the spot
identifications derive from analysis either of cells infected with T4 mutants missing
known gene products or of purified proteins.
To date we have analyzed proteins bound to five different enzymes of the T4
dNTP synthetase complex- dCMP hydroxymethylase (gp42, the product of gene
42), dTMP synthase (gptd), dCTPase-dUTPase (gp56), dCMP deaminase (gpcd),
and E. coli nucleoside diphosphokinase. Analysis of T4 deoxyribonudeoside
monophosphokinase (gpl) is under way. Table 1 summarizes our Identifications of
proteins bound specifically to each ligand. Note that each column retains between
566
Table 1. Association of T4 proteins with immobilized enzymes (0.6 M salt eluates)
Gene Gene product Retained by Immobilized
td dTMP + + + +
synthase
frd DHF + + + + +
reductase
56 dCTPase- +
dUTPase
nrdB rNDPreduc- +
tase R2
32 ssDNA-bind- + + + + +
ing protein
44 polymerase
+
accessory
45 polymerase + + +
accessory
61 DNA + + +
primase
62 polymerase +
accessory
f3gt DNAP-glu- + + +
cosyltrans-
ferase
pseT DNA kinase- + +
phosphatase
regA translation- + + +
a! control
6 and 12 T4 proteins. The bound proteins include both dNTP synthetase complex
enzymes and DNA replication and repair proteins.
Do these data mean that each immobilized enzyme binds each of the dozen or
so proteins bound to the column? Not at all; some of the interactions are
567
97
,.,,
68
•
43 1
S.1
~t
,.
kDa
t4
. T
29
62.
18
14
568
polyclonal antiserum against purified gp56 immunoprecipitated two T4 proteins,
with molecular weights suggesting identities as gp56 (18 kDa) and gpl (27 kDa).
These identifications were confirmed by a dilution experiment; addition to an
immunoprecipitation mixture of excess nonradioactive gp56 caused the 18-kDa
band to disappear, while addition of purified gpl caused the 27-kDa band to
disappear. These results suggest that the rabbit immunized against gp56
developed an anti-idiotypic immune reaction against gpl, supporting the idea that
these two proteins interact in vivo.
2 3 4 5
43
29
18
14
'i) ~
+pure +pure
gp56 gp1
569
1 2 3
...
cd + + +
9P56 - + +
gp42 - +
Figure 6. Identification of a gp56-gpcd-gp42 subassembly, by Western blot analysis of purified
protein mixtures, using polyclonal antiserum against purified T4 dCMP deaminase.
Acknowledgments
We thank colleagues for clones or purified proteins-Drs. Gisela Mosig (gene 56),
Maurice Bessman (gene 1), Masayori Inouye (NDP kinase gene), William
Konigsberg (genes 32 and 43), and Frank Maley (purified dCMP deaminase).
Financial support came from NSF Research Grant No. 9218618.
References
1. C. K. Mathews and N. K. Sinha, Proc. Nat/. Acad. Sci. USA 79:302 (1982).
2. P. K. Tomich, C-S. Chiu, M.G. Wovcha, and G. R. Greenberg,]. Bioi. Chern. 249:7613 (1974).
3. J. B. Flanegan and G. R. Greenberg, f. Bioi. Chern. 252:3019 (1977).
4. G. P. V. Reddy, M. E. Stafford , A. Singh, and C. K. Mathews, Proc. Nat/. Acad. Sci. USA 74:3152
(1977).
5.L. K. Moen, M. L. Howell, G. W. La~ser, and C. K. Mathews, J. Mol. Recogn. 1:48 (1988).
6. C. Thylcn and C. K. Mathews,]. Bwl. Chern. 264:15169 (1 989).
7. L. J. Wheeler, Y. Wang, and C. K. Mathews, f. Bioi. Chern. 267:7664 (1992).
8. J.P. Young and C. K. Mathews, J. Bioi. Chern. 267:10786 (1992).
9. H. J. Hoffmann, S. K. Lyman, C. Lu, M-A. Petit, and H. Echols, Proc. Nat/. Acad. Sci. USA 89:12108
(1992).
10. R. E. Davis and C. K. Mathews, Proc. Nat/. Acad. Sci. USA 90:745.
570
ISOlATION OF CDNAS ENCODING THYMIDYLATE SYNTHASE FROM
SOYBEAN SEEDLINGS AND EXPRESSION OF TilE PROTEIN IN _6. COLI
University of Michigan
Ann Arbor, MI 48109
INTRODUCTION
A .Agtll eDNA library constructed using polyA+ RNA from soybean seedlings
was screened with antiserum directed against soybean dihydrofolate reductase. One
clone (D2) was isolated and subsequent sequence analysis suggested that it encoded
thymidylate synthase. Further screening of the eDNA library with D 2 as a probe
resulted in the isolation of a full length eDNA. This eDNA was subcloned into
pBluescript II sk (-). A restriction map of the insert was determined by various
Soybean MA L P P C HMF A Q P L L T T K K V F WR
Human MA L P P C H A L C Q P L L T T K R V F WK
L. casei MA L P P C H T L Y Q P L L T T KKV P F G
E. co 7i MA L A P C H A F F Q P L VT T KR C H L R
F.gwe 1. Comparison of substrate and co-factor binding sites of thymidylate synthases from different sources.
J:. casei:
Lactobacillus casei.
The results presented in this paper show that plant TS is very conservative as
those from other origins. Since little information is available about plant TS, cloning,
sequencing and expression of plant TS would provide a basis for structural and
functional studies of the plant TS. We have purified TS after removing GST by
protease cleavage and presently examining conditions for refolding the enzyme in an
active form.
572
REFERENCES
1. M.Y. Lorenson, G.F. Maley, and F. Maley, The purification and properties of
thymidylate synthase from chick embryo extracts, J. Bi o 7. Chem.
242:3332-3344 (1967).
2. H. Hornishi and D.M. Greenberg, Purification and properties of thymidylate
synthase from calf thymus, Biochem. Biophys. Acta 258:741-752 (1972).
3. M. Friedkin, E.J. Crawford, E. Donovan, and E.J. Pastore, The enzymatic
synthesis of thymidylate. III. The further purification of thymidylate
synthase and its separation from natural fluorescent inhibitors, J. Bio7.
Chem. 237:3811-3814 (1962).
4. B. Bachmann and H. Follmann, Deoxyribonucleotide biosynthesis in green
algae: characterization of thymidylate synthase-dihydrofolate reductase in
Scenedesmus ob7iquus, Arch. Biochem. Biophys. 256:244-252 (1987).
5. A.H. Rosenberg, B.N. Lade, D-S. Chui, S-W. Lin, J.J. Dunn, and F.W. Studier,
Vectors for selective expression of cloned cDNAs by T 7 RNA polymerase,
Gene 56:125-135 (1987).
6. D.B. Smith and K.S. Johnson, Single-step purification of polypeptides
expressed in Escherichia coli as fusions with glutathione S-transferase,
Gene 67:31-40 (1988).
7. K. Liang and J.E. Dixon, Eukaryotic protein expressed in Escherichia co 7i:
An improved thrombin cleavage and purification procedure of fusion
proteins with glutathione S-transferase, Ana 7. Bi ochem. 192:262-267
(1991).
573
USE OF 10-PROPARGYL-5,8-DiDEAZAFOLATE AND DIRECTED
MUTAGENESIS TO PROBE THE CATALYTIC MECHANISM OF
THYMIDYLATE SYNTHASE
INTRODUCTION
TS +dUMP = TS.dUMP
\_.
-
ayv-cllf<§>-~-glu
0 ~a2
C~B
o
TERNARY COMPLEX
B WITH SUBSTRATES
dUMP -~.146
-o{o :_)
H
H2~ ~f· TS
~~l-glu o-
~~B 0 nOB
Bf
o
TERNARY COMPLEX
0 s TS (TS.dUMP.PDDF) AFTERCWSURE
! B OF PROTEIN C-TERMINUS
TERNARY COMPLEX
AFTER ATTACK OF
NUCLEOTIDE BY CYs146
Figure 1: Schematic showing the processes believed to occur at one of the two binding sites
during the interaction of dUMP and the CH2H4folate analogue PDDF with TS.
analogue undergoes reactions similar to the first few catalytic steps. (See figure 1 for a
schematic depicting the binding of PDDF toTS.) Interpretation of the kinetics with this
ligand and the crippled mutants is much simpler than with the wild-type enzyme and the
natural substrates because the reactions do not proceed past ternary complex formation.
576
Figure 2: Time course and best fit curves for the binding of PDDF to wt TS.dUMP,
Cl46A.dUMP, and P261Amber.dUMP. The wt TS time course was fitted to a three
exponential equation, the C146A and P261Amber time courses were fitted to a two
exponential equation. The final concentration of enzyme, dUMP, and PDDF were 1 J.LM,
500 J.!M and 6 J.!M, respectively.
The time course for wt TS is best described by 3 phases. Two rapid processes result
in decreases in fluorescence and a slower process results in an increase in fluorescence. The
time course for the interaction with P261Amber was similar to that of wt TS. The
fluorescence decrease, however, is described by only a single phase and the process
resulting in the fluorescence increase is more rapid compared to wt TS. For C146A the two
phases resulting in fluorescence decreases are observed and have similar rate constants
compared to wt TS but the fluorescence increase phase is not observed. These results are
summarized in Figure 3.
For wt TS and the two mutants the first phase is linearly dependent on the
concentration of PDDF, indicating that this process represents ligand binding. The second
phase, observed only for wt TS and C146A, shows a hyperbolic dependence on PDDF
concentration, indicating a post binding process. Because this second phase is not observed
with P261Amber this phase most likely represents conformational changes dependent on the
--
Phase 1
-
Phase 2
--
Phase3 Enzyme
wild type
- -
P261Amber
truncated C·terminus
C146A
TS.dUMP~TS.dUMP.PDDF~ TS.dUMP.PDDF ~TS-dUMP.PDDF
PDDF C-terminus Conformational
. . c 146
binding closure ch anges requmng ys
attack on dUMP
Figure 3: Summary of the phases observed by stopped flow fluorescence monitoring of the
interaction of wt TS, C146A, or P261Amber with PDDF. An arrow indicates that the phase
was observed.
577
C-tenninus. Phase 3 is observed with wt TS and P261Amber, is hyperbolically dependent
on the concentration of PDDF and reaches a maximum of approximately 4 s-1 for wt TS and
approximately 16 s-1 for P261Amber. This phase is not seen for C146A, which indicates it
is due to processes, eg. confonnational changes, dependent on attack of the nucleotide by the
active site thiol.
These results clearly show that the binding processes of an analogue of the folate
cofactor to the binary complex of TS.dUMP is easily distinguished from conformational
changes involving movement of the C-tenninus. These results also show that a process
requiring the active site cysteine can be observed spectrophotometrically. This third process,
which requires attack of the bound nucleotide by the active site thiol, is likely confonnational
changes involved in the collapsing of the active site around the bound ligands.
REFERENCES
1. Perry, K.M., Fauman, E.B., Finer-Moore, J.S., Moatfort, W.R., Maley, G.F., Maley,
F., and Stroud, R.M., 1990, Plastic adaptation toward mutations in proteins:
structural comparison of thymidylate synthase,Proteins: Struct., Funct., Genet. 8,
315-333.
2. Galivan, J.H., Maley, G.F., and Maley, F., 1976, Factors affecting substrate binding in
lactobacillus casei thymidylate synthetase as studied by equilibrium dialysis,
Biochemistry 15, 356-362.
3. Kamb, A., Finer-Moore, J.S., and Stroud, R.M., 1992, Cofactor triggers the
confonnational change in thymidylate synthase: implications for an ordered binding
mechanism, Biochemistry 31, 12876-12884.
4. Kunkel, T.A., Roberts, J.D., Zakour, R.A., 1987, Rapid and efficient site-specific
mutagenesis without phenotypic selection, Methods Enzymol. 154,367-382.
5. Appleman, J.R., and Villafranca, J.E., 1992, in: "Techniques in protein chemistry llf'
(Angelletti, R.H., ed.), Academic Press, Inc. Orlando Florida, 407-416.
578
y-LINKED DIPEPTIDE ANALOGUES OF 2-DESAMIN0-2-METHYL-
N10-PROPARGYL-5,8-DIDEAZAFOLATE AS ANTITUMOUR AGENTS
INTRODUCTION
METHODS
580
Table 2. Inhibition of TS and L1210 cell growth by y-dipeptide analogues of ICI
198583
glutamate equivalent) by HPLC (manuscript submitted). A 1hr time point was chosen
because of the rapid plasma clearance of ICI 198583 and dipeptide analogues of ICI
198583 diglutamate (t 112f3 -15mins).
Representative examples of this class of agent were tested for activity against the
Ll210:MB3 cell line. This resistant line did not demonstrate significant cross-resistance
to these analogues, suggesting that they are not active through polyglutamation (data
not shown). This suggests that a) they are not substrates for FPGS, and, b) they are
stable in vitro and not significantly broken down to ICI 198583, a substrate for FPGS.
However it is well known that an ubiquitous class of hydrolytic enzymes exists in
mammalian tissues, the y-glutamyl hydrolases, which hydrolyse amide bonds of
polyglutamates8• In this manner the terminal amino acid of the y-linked dipeptides
could be removed, releasing the FPGS substrate, ICI 198583. This would defeat the
object of this new class of agent. It was therefore necessary to determine whether these
581
Table 3. Plasma and liver concentrations of the dipeptides and their hydrolysis
product, ICI 198583, 1hr post-injection of 100mgjkg (5 mice per group)
dipeptides were hydrolysed in vivo. HPLC analysis of plasma, liver and kidneys of mice
treated with a number of dipeptides revealed that significant hydrolysis to ICI 198583
occurred. Examples are given in Table 3.
The unsuitability of these y-linked dipeptides as in vivo antitumour agents led
to new chemical synthesis concentrating on the development of dipeptides stable to in
vivo hydrolysis. Two approaches were explored 1) removal of the carboxyl on the a-
carbon of the second amino acid (defined here as a' -COOH) and 2) replacement of the
first and/or second amino acid with an unnatural D-amino acid.
Table 4; Removal of the carboxyl from the a-carbon of the terminal amino acid
0 ~
N-{}-----li~,~~)).,coou
H
HN:Xr-
~ ~ HL
I
II H .•,,/"cooH
~ ~ o L
e.g. -L-glu-L-glu and -L-glu-GABA
Data from two pairs of compounds are shown in Table 4 where the o:' -COOH
has been removed to give the corresponding L-glu-y-amide. In both cases removal of
the a'-COOH resulted in a compound stable to in vivo hydrolysis. For example the
L-glu-GABA analogue, when injected into mice gave a plasma and liver concentration
at lhr of 20J,£M and 125nmolesjg respectively with no ICI 198583 being detected. Only
a 5-fold loss in activity (over the -L-glu-L-glu analogue) was observed against isolated
TS. Removal of the a-carbon on the first glutamate e.g. GABA-glu was far more
582
Table 5. First or second glutamate replacement of ICI 198583-y-diglutamate
with its D-enantiomer
-L-glu-L-glu NO 2 0.1 23
-0-glu-L-glu NO 36 2.9
-0-glu-0-glu YES 26 1.3
-L-glu-0-glu YES 5 0.22 3
7-CH 3 , 2'F -L-glu-0-glu YES 0.9 0.2 2
583
Table 6. The in vivo antitumour activity of the 7-CH3, 2'F-L-glu-y-D-glu
analogue
L5178Y TK" 1· (1 day sub- L5178Y TK+ !- (7 day sub- HX62 xenograft (14 day
cutaneous infusion) cutaneous infusion) sub-cutaneous infusion)
4.2 day growth delay at 3.7 day growth delay at 1OOmgjkg 30 day growth delay at
30mgjkg 80mgjkg
5/5 cures at 50mgjkg 11 day growth delay at 150mgjkg
(20% body weight loss)
SUMMARY
Our search for water-soluble quinazoline TS inhibitors that are transported into
cells via the RFC, but are not substrates for FPGS, led us to the synthesis of dipeptide
analogues of ICI 198583 diglutamate. Although a number of dipeptide analogues were
active against isolated TS and L1210 cells in vitro, lack of in vivo stability was a
problem. This was circumvented by the synthesis of modified dipeptides where either
the a-carboxyl of the second amino acid was removed (a'-COOH) e.g. -L-glu-GABA
or where the second amino acid was the unnatural D-enantiomer e.g. -L-glu-D-glu.
Further studies were performed with the -L-glu-D-glu and its 7-CH3, 2'F modified
analogue, demonstrating that they use the RFC for cell entry but are not active through
polyglutamate formation. The latter compound was tested against experimental
tumour models and found to have good activity.
REFERENCES
1. S.J. Clarke, A.L. Jackman and I.R. Judson. In: "Novel approaches to selective treatment of human solid
tumours:laboratory and clinical correlations". (Y. Rustum. Ed.) Plenum Press, in press.
2. A.L. Jackman, G.A. Taylor, W. Gibson, R. Kimbell, M. Brown, A.H. Calvert, I.R. Judson and L.R.
Hughes. Cancer Res. 51: 5529-5586, 1991.
3. A.L. Jackman, W. Gibson, M. Brown, R. Kimbell and F.T. Boyle. In: "Novel approaches to selective
treatment of human tumours: laboratory and clinical correlations". (Y. Rustum. Ed.) Plenum Press,
in press.
4. P.M. Sirotnak, and J.I. DeGraw. In: Folate Antagonists as Therapeutic Agents. Vol.2. (P.M. Sirotnak
et a!. eds.) Academic Press Inc. pp 43-95, 1984.
5. A.L. Jackman, D.R. Newell, W. Gibson, D.I. Jodrell, G.A. Taylor, J.A. Bishop, L.R. Hughes and A.H.
Calvert. Biochem. Pharmacol. 42:1885-1895, 1991.
6. A.J. Barker, F.T. Boyle, A.L. Jackman, A.H. Calvert and S.J. Pegg. Proc. Amer. Assoc. Cancer Res. 32:
327, 1991.
7. A.L. Jackman, L.R. Kelland, M. Brown, W. Gibson, R. Kimbell, W. Aherne and I.R. Judson. Proc.
Amer. Assoc. Cancer Res. 33: 406, 1992.
8. J.J. McGuire, and J.K. Coward. In: Folates and Pterins, Vol.l (R. Blakley and S.J. Benkovic, eds.) J.
Wiley and Sons Inc. pp 135-190, 1984
584
SUBSTITUTED-2-DESAMIN0-2-METHYL-QUINAZOLINONES. A SERIES
OF NOVEL ANTITUMOUR AGENTS
INTRODUCTION
ICI D1694, a quinazolinone based inhibitor of thymidylate synthase (TS) was
developed to act in part through efficient metabolism to polyglutamates by the
enzyme folypolyglutamyl synthetase (FPGS)l. The addition ofy-glutamates to agents
such as ICI D1694 has two major consequences- the polyglutamates are up to 100-
fold more active against isolated TS and the increased polyionic character results in
intracellular retention leading to extended TS inhibition even after drug removal. In a
cell line with altered expression levels of FPGS these classical agents have been
shown to be less effective and cytotoxicity then generally correlates with TS
inhibitory activity.(See accompanying paper A.L.Jackman et al .). In our search for
agents to compliment ICI D1694, we therefore wanted compounds which were potent
inhibitors of TS, used the reduced folate I methotrexate carrier (RFC) for cell entry
but did not depend on intracellular polyglutamation for activity. Because of its
excellent TS inhibitory activity we chose 2-desamino-2-methyl-NlO-propargyl-5,8-
dideazafolic acid (ICI 198583)2 as the basis of this investigation.
The starting point for this study was the finding3,4 that in the crystal structures
of E. coli TS ternary complex with FdUMP and CB3717 indicate that CB3717 binds
in a partially folded conformation with the para-aminobenzoic acid ring inclined at
65° to the quinazolinone.Molecular mechanics analysis of CB3717 using SCANOPT5
~(2)
"~~/ 1~'"'~'-·•
following stepwise rotations around the torsion angles defining bonds (1) and (2)
indicate 3 pairs of populations. Conformational pairs are a consequence of 180°
Method A R1 R1
(1) I I
0 R1
H N~N-oCONH-Giutamate
Me..kN~R ~
NC~GN
Method C
AcNH~R
Conditions
(1) Br2 : AcOH: 10-15°C. (2) Ae;.O: Pyridine: EtoAc: 25°C. (2A) Ac20: 100°C. (3) CuCN : NMP: 120°C.
(3A) CuCN : NMP : 150°C. (3 8 ) CuCN : NMP: 175°C.(4) Hp2 : NaOH :EtCH : Hp.(5) POMCI : KOBu 1 : DMSO.
(6) NBS: CCI 4.(7) CaC03 : DMA: 110°C.(8)TFA: 25°C.(9) Pentafluorophenol: DCCI : DCM: 25°C.
(10) NH-Ligand: Et3 N: DMF: HOST :25°C.(11) 1N NaOH: 25°C.(12) Raney Nickel: AcOH: 50°C.
(13) Propargyl Bromide: CaC03 : DMA: 110°C.
586
C7-methyl substitution reinforced the binding conformation whereas C5-methyl
favoured a non-binding conformation as its preferred minimum. Analysis of C7,9-
methylated analogues gave mixed results. In the C7 ,9R enantiomer two almost
equivalent low energy conformations were predictive of the optimum TS binding
conformation, however for the C7 ,9S enantiomer neither pair of conformations
matched that found in the ternary complex.
SYNTHESIS
A convergent synthesis (Scheme 1) was developed which allowed the
production of a series of C5, C7 and racemic C9 methyl substituents as well as a
range of sterically differing, electron withdrawing and donating substitutions at C7 of
the quinazolinone nucleus. The general synthesis (Method A)was applicable to most
compounds and modifications in the sequencing (Method B for 7-CN, Method C for
7-Et and CF3,) were applied when required. Method D (for C7,9 substitution) was
necessary due to the steric bulk of the incoming nucleophile reducing the reaction rate
to unacceptable levels
BIOLOGICAL RESULTS
TS inhibition was assessed using partially purified Ll210 TS. In vitro growth
inhibitions were assessed using LU210 cell lines. The impact of structural changes on
uptake into L1210 by the reduced folate/methotrexate carrier (RFC), and ability to
form intracellular polyglutamates were determined using the L1210 mutants 1565
(impaired RFC) and MB3 (impaired antifolate polyglutamation) respectively.
198583 is a moderately potent growth inhibitor, a consequence of good uptake
by the RFC (1565 cross resistance ratio of 62) and its converson to polyglutamates as
587
evidenced by MB3 ratio of21 (confirmed by HPLC analysis ofH3 ICI 198583). C7-
methyl substitution improved TS inhibition (28 vs SOnM) and equivalent growth
inhibition to ICI 198583 results from good uptake by the RFC despite no conversion
to intracellular polyglutamates. (Detailed kinetics of this compound by Professor R
Moran confirm that it is has no FPGS substrate activity). CS-methyl substitution as
predicted by modelling produced a poor TS inhibitor, however very high MB3 cross
resistance ratios suggest that growth inhibition results entirely from intracellular
polyglutamated species. Racemic C7,9 dimethyl substitution gives a 5 and 10 fold
worse inhibitor of TS and cell growth. Sub-optimal conformation and poor
intracellular conversion to polyglutamates, is the likely reason for the reduced
activity.
Extending the range of C7 substituents in ICI 198583 gave the following results:
C7-Br (TS ICso=17nM), Et (30nM), and C1 (40nM) showed improved TS enzyme
inhibition and CF3 (116nM) OMe (250nM) and CN (680nM) were worse. For this
class of agents relatively poor growth inhibition was observed. As evidenced by
significant cross resistan:ce against 1565 most of the compounds enter cells on the
RFC but the low MB3 cross resistance ratios suggest that the major reason for the
poor cytotoxicities is a failure to form intracellular polyglutamates.
Activity in vivo was assessed in a range of acute and chronic models using
Alzet mini-pump infusion protocols (See accompanying paper Stephens et al.).
Profiling 7-methyl ICI 198583 by bolus protocols gave no activity, however using
Alzet mini pumps to maintain enzyme cover, good activity was seen in mice bearing
the L5178Y TK-/- and TK+/- murine lymphoma at 80 and 300 mg/kg/day
respectively. Statistically significant growth delays were also seen against the HX62
human xenograft with a 14 day infusion at 80 mg/kg/day. In all these studies no
toxicity was observed.
CONCLUSIONS
REFERENCES
(1) A.L. Jackman, G.A.Taylor, W. Gibson, R. Kimbell, A.H. Calvert, I.R. Judson and
L.R. Hughes. Cancer Research 51: 5529-5536 (1991).
(2) A.L..Jackman, D.R. Newell, W.Gibson, D.I. Jodrell, G.A. Taylor, J.A. Bishop,
L.R. Hughes and A. H. Calvert Biochem. Pharmacol. 42: 1885-1895 ( 1991 ).
(3) D.A. Matthews, J.E. Villafranca, C.A. Jonson, W.W. Smith, K.Welsh and S.Freer.
Mol. JBiol. 214: 937-948 (1990).
(4) W.R. Montfort, K.M. Perry, E.B. Fauman, J.S.Finer-Moore, G.F. Maley, L.
Hardy, F. Maley, and R.M. Stroud. Biochemistry 29: 6964-6977 (1990).
588
USE OF MURINE L5178Y LYMPHOMA THYMIDINE KINASE MUTANTS
FOR IN VITRO AND IN VIVO ANTITUMOUR EFFICACY EVALUATION
OF NOVEL THYMIDYLATE SYNTHASE INHIBITORS
INTRODUCTION
The L5178Y TK+/- cell line used in these studies (3.7.2C) was derived from a
"wild-type" TK+/+ parent by ethyl methanesulphonate mutagenesis and bromo-
deoxyuridine selection by Clive3. The TK-/- line was a spontaneous mutant selected with
trifluoromethylthymidine by Dr M Cross (ZENECA Central Toxicology Laboratory,
Macclesfield.
L5178Y TK-/- cells in logarithmic growth were harvested and replated at a density
of 5xl05 cells per Sml culture medium (RPMI 1640 supplemented with 10% foetal calf
serum and antibiotics). After incubation for 24 hours, compounds were added in a small
volume of 0.15M sodium bicarbonate or DMSO. Four or 18 hours later the drug was
removed by gently centrifuging the cells, and after washing once with fresh culture medium
they were counted and diluted for cell viability measurement by colony formation in soft-
agar4. Macroscopic colonies were obtained following incubation for about 12 days and were
counted by image analyser. Surviving Fraction (SF) was calculated as the ratio of Plating
Efficiencies (PE's) of treated and control groups (PE =number of colonies per dish/number
of cells plated per dish). In the Table compound activity is expressed as SF following
treatment with a fixed compound concentration of lOJ.!M.
L5178Y in vivo antitumour assays
Although the L5178Y tumour is a lymphoma it was found to grow very well as a
solid tumour if implanted intramuscularly.
DBA2 mice were injected with 5x106 cultured L5178Y cells (TK-/- or TK+/-) into
the gastrocnemius muscle on day 0. Treatment began on day 3 when the tumour was visible
as a slight swelling of the leg. Compounds were formulated in 0.15M sodium bicarbonate
for intraperitoneal (ip) bolus administration or subcutaneous (sc) infusion using ALZET
osmotic minipumps (models 2001D and 2001). Tumour growth was monitored by daily leg
diameter measurements using a perspex disc with calibrated holes that was passed up the
tumour bearing leg to find the size of hole that would just traverse the tumour.
In the initial studies it became apparent that L5178Y cells were slightly immunogenic
in the host mouse strain. Tumours would not grow when less than 1x104 cells were
implanted into previously untreated mice and in animals where a tumour had been "cured"
by drug treatment the take-rate was very poor if they were re-challenged with 5x106 cells.
Thus, for the TK-/- tumour a cure endpoint (no tumour growth within 3 weeks) was
adopted. Cure is thought to reflect 2-3 decades of cell kill, plus the immune effect. Cures
were less common with the TK+/- tumour so an endpoint of 5 days growth delay was
adopted (approximately 4 tumour doubling times). In the Table compound potencies are
expressed as dose per day (mg/kg/day) to produce ?:.3/5 cures in the TK-/- model, or 5 days
growth delay in the TK+/- model.
RESULTS
The in vitro cytotoxicity and in vivo antitumour activity of a range of classical and
non-classical TS inhibitors, against L5178Y TK-/- and TK+/- cells, are tabulated.
For compounds designed to be in the classical class an exposure time of 4 hours was
routinely used in the in vitro L5178Y TK-/- cell survival assay since compounds that are
rapidly transported and retained by cells should show good cytotoxicity with a brief
treatment. As expected, however, several compounds designed to be non-classical showed
little activity with a treatment time of 4 hours, but were highly cytotoxic when a prolonged
exposure of 18 hours was used. The SF at 4 hours for a typical non-classical compound is
shown in the Table. The high value of 0.25 is consistent with no polyglutamation or other
mechanism of retention occurring within 4 hours. Other compounds classified as "non-
classical" were shown by various specific methods not to be retained in cells.
In antitumour studies with TK-/- cells classical compounds were routinely
administered ip twice on one day with 8 hours between doses. Non-classical compounds,
however, were administered by continuous sc infusion over 24 hours using minipumps.
590
Table 1. ACTIVITY OF TS INHIBITORS AGAINST L5178Y TK MUTANTS
--o-
H Me <0.0035 -200 -300
4
-GLU
H Et <0.001 <50 120
--o- s
H Me (ICI 01694) <0.0001 -5 6.6
-GLU
H Et <0.0005 -25 90
H Me <0.0006 -30 70
s
~r
H Et -GLU <0.0008 25 110
--o-
exposure infusion infusion
Me Pg 0.0096 80 -300
-GLU
4h 0.25
Me Me F NT -80 >200
4
-GLU
Me Pg 0.00075 30 275
4
I
4
I
(CH2)4COOH
4
(CH2)3CONHS02CH3
Me
Pg
Pg
--o- F
-IGLU-Y-dGLU
0.0046
0.00075
50
30
150
-120
4
* = mg/kg/day, ** = 8h x 5 doses, *** = 8h x 15 doses, NT= not tested, Pg = propargyl
591
In both cases cures could be achieved with low doses in the range 10-50mg!kg/day.
To obtain activity with L5178Y TK+/- tumours compounds needed to be
administered over about a week. By analogy with previous studiesl it is believed that during
this period circulating thymidine levels gradually fall until they are below a protective level
and antitumour activity is then achieved in a salvage competent tumour.
Classical compounds were therefore administered ip twice daily for 5 days and non-
classical compounds were infused sc for 7 days. Growth delays of 5 days were achieved
with some compounds from both classes at doses of 10-50mg/kg/day, but some other
compounds required much higher doses to achieve the chosen endpoint.
DISCUSSION
Although it does not indicate the mechanism of retention, the data demonstrate that
the 4 hour exposure L5178Y TK-/- clonogenic assay described here can readily identify TS
inhibitors that are rapidly taken up and retained in tumour cells. By increasing the cell
exposure time it can also be useful in ranking non-classical compounds in terms of
potency. Using the 4 hour exposure assay we have identified more than 50 classical,
glutamate containing, compounds that killed >2 decades of L5178Y TK-/- cells when
dosed at a concentration of 1011M for 4 hours, and by extending the exposure period to 18
hours about 100 non-retained compounds with similar activity have been identified for in
vivo study. In vitro studies using mutant cell lines have been used to establish compound
uptake on the RFC and whether compounds are capable of polyglutamation.
The L5178Y TK-/- antitumour test provides a rapid and simple primary in vivo
screen forTS inhibitors. Classical compounds such as ICI D1694 are highly active when
bolus dosed ip on a single day, and non-classical compounds show similar activity when
infused sc over 24 hours. More than 25 classical compounds have produced cures with the
bolus dosing protocol and -70 compounds that are not efficiently retained in cells have
shown activity by sc infusion.
Some compounds are also active against the thymidine salvage competent variant,
L5178Y TK+/-, although a much more intensive treatment dosing regime is required and
growth delays are more usually observed. With the daily bolus dosing protocol 8
promising classical compounds were identified, from which ICI D1694 was selected for
development. By prolonged infusion for 7 days we have so far identified 8 promising non-
classical compounds. These are now being evaluated for efficacy against a panel of human
tumour xenografts, and toxicity to normal murine tissues is also being assessed.
We conclude that the TK mutants of the L5178Y tumour are very useful pre-clinical
models for efficacy evaluation of TS inhibitors.
REFERENCES
592
QUINAZOLINE ANTIFOLATES INHIBITING THYMIDYLATE
SYNTHASE: SYNTHESIS OF y-LINKED PEPTIDE AND AMIDE
1The Institute of Cancer Research, 15, Cotswold Rd, Sutton, Surrey, U.K.
2Zeneca Pharmaceuticals (ICI), Alderley Park, Macclesfield, Cheshire, U.K.
INTRODUCTION
Thymidylate Synthase (TS) inhibitors such as ICI D16941 and to lesser extent ICI
1985832 rely on their poly-y-glutamate metabolites for their antitumour activity. The
polyglutamate metabolites are more potent inhibitors of TS than the parent monoglutamate
forms and in addition, their polyionic nature leads to prolonged retention within the cells.
However, drugs dependent on polyglutamation may have some disadvantages such as a) lack
of activity in tumours expressing low levels of, or an altered expression of,
folylpolyglutamate synthetase (FPGS) or b) prolonged normal tissue toxicities caused by
polyglutamate retention. For these reasons, we were interested in designing and
synthesising tight-binding TS inhibitors which would not be dependent on polyglutamation
for antitumour activity. Addition of one glutamate residue on the y-carboxyl of 2-desamino-
2-methyl-N10-propargyl-5,8-dideazafolic acid (ICI 198583), i.e. dipeptide (1), resulted in
stronger binding toTS by approximately 30-fold2. This finding was the starting point in our
search for a tight TS inhibitor that could not be a substrate for FPGS. We report here the
synthesis of22 dipeptide and 6 y-arnide analogues ofiCI 198583-y-L-Glu.
RESULTS-DISCUSSION
ICI 198583 dipeptide analogues (or quinazoline antifolate dipeptides) were synthesised
Scheme 1
1}2 ~X
Xc
0 HN~C02Bu1 O X
Xr l}~
!
HN BrR2 =Pg,EtorMe,X=H,F HN ?' N COB t
,4 ,4I A ~ ~ 2 u
H:J(: N R1 CaC03 /DMF or H:J(: N R1
2 2,6-Lutidine/DMF 4
aRl =H TFA
b.R1 =Me
o 1}2 Ax
HN N~COOH
H:J(:,4N R1
5
R1 =H or Me R2 = Pg, Me or Et
X=HorF
The preparation of the second key intermediate, the dipeptide (10), is shown in Scheme
2. Amino acids (6) were first protected as their ten-butyl esters (7) either by treatment with
isobutylene I cone. H 2S04 or by transesterification with ten-butyl acetate. Subsequent
coupling to a-ten-butyl-N-benzyloxycarbonyl-L-glutamate (8) using the mixed carbonic
anhydride coupling method4 afforded the Z-protected dipeptide (9), from which (10) was
obtained by catalytic hydrogenation.
Scheme2
Finally, the dipeptide free base (10) was condensed with the pteroate analogue (5) using
diethyl phosphorocyanidate (DEPC) as carboxyl activating reagentS to give the quinazoline
antifolate dipeptide ester (11), which was converted to the final product (12) upon treatment
with trifluoroacetic acid (Scheme 3).
594
The quinazoline antifolate L-L dipeptides (1, 12a-12n) synthesised by this procedure are
shown in Table 1.
Cmpd Rl R2 X -HNCH(COOH)-R3
2nd Amino Acid
Nearly all the quinazoline antifolate L-L dipeptides were potent inhibitors of TS and of
L1210 cell growth (see accompanying paper, A.L. Jackman et al.). However, when these
dipeptides were injected into mice they were partially degraded to the monoglutamate forms
by y-hydrolase enzymes, which act by cleaving the glutamyl y-amide bond. As a result,
further effort was concentrated on making this amide bond resistant to enzymatic hydrolysis.
To achieve this objective we have chosen two main strategies:
595
i) Replacement of the second amino acid by a primary amine lacking a.-carboxyl groups
ii) Replacement of the ftrst and I or second amino acids by their D-enantiomers.
ICI 198583 y-linked amide analogues (13a-13f) were prepared by a similar route to the
one described above but primary amines were used in place of amino acids.
In general, ICI 198583 y-linked amides were poorer inhibitors ofTS and ofL1210 cell
growth compared with their corresponding parent L-L dipeptides. The advantage of these
compounds, however, lies in their resistance to enzymatic hydrolysis (see accompanying
paper, A.L. Jackman eta/.).
Quinazoline antifolate L-D dipeptides (14a-14f) and the D-D and D-L stereoisomers of
(1) were prepared by an analogous route to that described above for the synthesis of the L-L
dipeptide analogues. a.-tert-Butyl-N-benzyloxycarbonyl-D-glutamate, which was required
for the synthesis of the D-D and D-L stereoisomers of (1), was synthesised via a route
previously described for the preparation of the L-enantiomer. 6
H3C
HN~~:~~Zxcoo"
..4-..
N
T~D
R1 14
0 L • nH
0 D
Rs
When quinazoline L-D dipeptides were injected into mice no breakdown products were
observed. Moreover each analogue exhibited approximately the same TS inhibition as its L-L
counterpart. The D-Glu-L-Glu and D-Glu-D-Glu analogues were less potent inhibitors of TS
compared with the parent L-Glu-L-Glu dipeptide (1), with the former being unstable in vivo
and the latter resistant to enzymatic hydrolysis (see accompanying paper A.L Jackman et al.).
REFERENCES
1. A.L. Jackman, G.A. Taylor, W. Gibson, R. Kimbell, M. Brown, A. H. Calvert, I. R.
Judson and L.R. Hughes, Cancer Res., 1991, 51, 5579-5586.
2 A.L. Jackman, D.R. Newell, W. Gibson, D.I.Jodrell, G.A. Taylor, J.A. Bishop, L.R.
Hughes and A.H. Calvert, Biochem. Pharmacol., 1991,4 2, 1885-1895.
3. G.M.F. Bisset, K. Pawelczak, A.L. Jackman, A.H. Calvert and L.R. Hughes, J. Med.
Chern., 1992, 35, 859-866.
4. J. Meinhofer, The Peptides, Analysis, Synthesis, Biology, E. Gross and J. Meinhofer
Eds, Academic Press, New York, 1979, 1, pp 264-309.
5. A. Rosowsky, R. Forsch, J. Uren and M. Wick, J. Med. Chern., 1981,24, 1450-1455.
6. K. Pawelczak, I. Krzyzanowski and B. Rzeszotarska, Org. Prep. Proced. Int., 1985,
17, 416-419 and references cited therein.
596
TilE DURATION OF TilE INHIBITION OF THYMIDYLATE
SYNTHASE IN INTACT L1210 CELLS EXPOSED TO 1WO
DIFFERENT CLASSES OF QUINAZOLINE ANALOGUES
INTRODUCTION
It is actively transported into cells via the MTX/reduced folate carrier (RFC)
and rapidly polyglutamated by folylpolyglutamate synthetase (FPGS). The intracellular
drug species in mouse and human cell lines have been shown to be higher chain length
polyglutamates, principally tetra- and penta-glutamates. These are substantially more
potent as TS inhibitors (e.g. ICI D1694 tetraglutamate Ki=1nM) than the parent
molecule (ICI D1694 Ki=60nM). These high chain length polyglutamates are retained
intracellularly due to their increased net negative charge.
To overcome some potential disadvantages of drugs subject to polyglutamation
(see Jackman et al, accompanying paper), a second class of TS inhibitors, which do not
undergo polyglutamation, was designed. Novel quinazolines were synthesised and based
on 2-desamino-2-methyl-N10-propargyl-5,8-dideazafolic acid (ICI 198583) and its
diglutamate (ICI 198583-y-L-glu) because they are both intrinsically better inhibitors
of TS (Ki = lOnM and -0.5nM respectively) than ICI D16943• They are polyglutamated
intracellularly, but to a lesser extent than ICI D1694.
R = C7 = H or CH 3
X = 2' = H or F
Y = OH or L-glu or D-glu
These structural analogues are not active through polyglutamate formation (see
below). It is postulated that compounds such as these, that are prevented from forming
intracellular polyglutamates, will only inhibit TS whilst drug is present in the
extracellular medium. Therefore, a selected group of compounds has been tested by
measuring TS activity in intact L1210 cells, both during drug exposure, and after
removal of drug from the extracellular medium. The method used is the rate of the
release of 3H 20 from 5-3H dUrd and based on that of Yalowich and Kalman4•5•
Intracellular nucleotide levels (TIP and dUMP) were also measured by radio-
immunoassay (Aherne et al; manuscript in preparation).
Transport into the cell by the reduced-folate carrier (RFC) was confirmed using
the Ll210:1565 cell line which has a greatly impaired RFCi. Polyglutamation was
confirmed or otherwise using the L1210:MB3 cell line, which has an altered FPGS that
does not polyglutamate anti-folates 7• A small cross-resistance factor of up to five is
seen with compounds that use the RFC, due to a small transport defect in this line.
Results in Table 1 demonstrate that 7-CH3, 2'F ICI 198583, ICI 198583-y-0-glu
and 7-CH3, 2'F ICI 198583-y-0-glu retain good activity in the L1210:MB3 cell line
which suggests that they are not active through polyglutamation.
After 4hr exposure at equitoxic (10 X IC50) doses, all the compounds inhibited
the rate of 3H release from 5-3H dUrd by > 90% (Table 2). However, after 4hr or 24hr
exposure followed by 4hr in drug-free medium some differences were seen. TS
inhibition was maintained by those compounds which are polyglutamated (ICI 01694,
ICI 198583 and ICI 198583-y-L-glu). The less marked effect of ICI 198583 after only
4hrs incubation (79% of control) reflects its relatively slow formation of polyglutamates
compared with ICI 01694. However the higher dose of 5J,£M (50 x IC50) resulted in this
drug-retentive effect (17% of control; data not shown). With the three non-
polyglutamated compounds, activity returned to control levels during the drug-free
period, after an initial 4hr incubation. However, increasing the exposure time to 24hr
598
Table 1. In vitro activity of quinazoline TS inhibitors
7-CH 3,2'F ICI 198583 9.0 0.080 5.9 (74) 0.47 (6}
7-CH 3 ,2'F ICI 198583 0.8011M 3.±.1 144 .±. 17 92 .±. 4 153, 99
L1210 cells were exposed to equitoxic concentrations (10 x IC50 at 48hrs) of the compounds. All24hr
incubations included 1011M dThd to prevent cell death
599
intracellular 3H dUMP pool. After 4hrs incubation with the above compounds the
dUMP pool increased 3-fold (Table 3). This may have contributed to the degree of
"flux" inhibition (92%) being greater than that of the TTP pool (-50%) in the cells
treated with ICI D1694 for 4hrs and actual specific activity measurements of the dUMP
pool are therefore required. The dipeptide analogue inhibited TTP more effectively
than ICI D1694 after 4hrs (equitoxic growth inhibitory concentrations by continuous
exposure) and probably reflects the lack of drug metabolism (polyglutamation) required
for this agent. However a 5-fold higher ICI D1694 concentration resulted in an 88%
inhibition of TTP which did not recover after resuspension of the cells in drug-free
medium. The recovery of the TTP pool after 7-CH3,2'F ICI 198583-y-D-glu removal
was in contrast to the lack of recovery seen with ICI D1694 and in agreement with the
results of the in situ TS assay.
SUMMARY
REFERENCES
1. A.L. Jackman, G.A. Taylor, W. Gibson, R. Kimbell, M. Brown, A.H. Calvert, I.R. Judson, and L.R.
Hughes. Cancer Res. 51: 5529-5586, 1991.
2. S.J. Clarke, A.L. Jackman and I.R. Judson. In:"Novel approaches to selective treatment of human
tumours: laboratory and clinical correlations". (Y. Rustum. Ed.) Plenum Press, In Press.
3. A.L. Jackman, D.R. Newell, W. Gibson, D.l. Jodrell, G.A. Taylor, J.A. Bishop, L.R. Hughes, and A.H.
Calvert. Biochem. Pharmacal. 42: 1885-1895, 1991.
4. J.C. Yalowich and T.l. Kalman. Biochem. Pharmacal. 34: 2319-2324, 1985.
5. G.A. Taylor, A.L. Jackman, K. Balmanno, L.R. Hughes, and A.H. Calvert. In: "Purine Metabolism in
Man", Vol.6 (K. Mikanagi eta!, Eds.) pp. 383-388, Plenum Publishing Corp. New York, 1989.
6. D. Fry, J.A. Besserer, and TJ. Boritzki. Cancer Res. 44: 3366-3370, 1984.
7. A.L. Jackman, L.R. Kelland, M. Brown, W. Gibson, R. Kimbell, W. Aherne, and I.R. Judson. Proc.
Amer. Assoc. Cancer Res. 33: 406, 1992.
600
THE TOXICITY OF ICI D1694 IN MAN AND MOUSE
INTRODUCTION
Sixty one patients received 160 courses ofiCI D1694. Forty nine patients (80%) were
treated in the UK and 12 (20%) in Holland. There was a slight male predominance and
the mean age was 53 years. Fifty two patients (85%) had a performance status ofO or
1. A wide variety of tumour types were treated with a slight predominance of colon
(26%) and ovarian (18%) cancers. Fifty five patients (90%) had received prior
chemotherapy and of these 25 (41%) had received 5-FU. The median number of
courses received was 2, although of 23 patients treated at 3.0mg!m2, 7 received 5 or
more courses.
602
TOXICITIES
Toxicity was first seen at 1.6 mg!m2 where two patients (50%) developed mild
elevation of liver function tests after a second course of treatment. By this time
treatment had commenced at 2.6 mg!m2 and similar abnormalities were seen. The
changes were mainly in transaminases (ALT/AST) with lesser and later elevations in
serum alkaline phosphatase (SAP) and gamma glutamyl transferase (yGT). These
changes were also seen at 3.0 and 3.5 mg!m2. The abnormalities did not delay
treatment and settled with repeated dosing and cessation of treatment. No patient
developed progressive liver impairment or jaundice. Three of four patients who
experienced malaise at 3.5 mg!m2 also had WHO grade 3 or 4liver dysfunction, but all
other patients with abnormal liver function tests were asymptomatic.
Myelosuppression was first seen in 5 patients (50%-3 WHO grade 1 and 2
grade 2) at 2.6 mg!m2 and the incidence increased with increasing dose. At 3.0
mg!m2, 14 patients (61%) had myelosuppression with 5 patients (22%) developing
grade 3 or 4 toxicity. Two patients (33%) had grade 3 and 4 neutropenia at 3.5
mg!m2. The mean time to nadir was 8 days (range 7-21 days) with a mean time to
recovery of 10 days (range 2-22). Toxicity was cumulative, but completely reversible
on cessation of treatment and appeared to be less severe in those treated with
concomitant corticosteroids. Anaemia and thrombocytopenia occurred less commonly
than myelosuppression. The incidence of gastrointestinal toxicities also increased with
increasing dose. Fourteen patients (60%) experienced diarrhoea at 3.0 mg!m2. Six of
these and one other patient at 3. 5 mg!m2 had severe diarrhoea (5 WHO grade 3 and 2
grade 4). Five of the 7 patients required hospitalisation and cessation of further
treatment and in 3 the diarrhoea may have contributed to their demise. The diarrhoea
was characterised by profuse, protracted fluid loss with rapid onset of dehydration and
hypoalbuminaemia in those unable to maintain adequate fluid intake. Nausea and
vomiting were commonly seen (14/23 or 61% at 3.0 mg!m2) and in all except 3 cases
the symptoms were readily managed by oral emetics, usually dexamethasone and
metoclopramide. In the other 3 patients, all treated at 3.0 mg!m2, hospitalisation was
required to manage severe symptoms. Mucositis was seen in 11 patients (48%) at 3.0
mg!m2, but did not effect oral intake.
Other toxicities seen were rash, fever, arthralgia and elevated erythrocyte
sedimentation rate. The highest dose level investigated was 3.5 mg!m2 at which six
patients received only nine courses oftreatment because of the occurrence in 4 (67%)
of debilitating malaise. In one patient the symptoms were related to WHO grade 4
myelosuppression. In the other 3 there were no significant anti-proliferative toxicities
although, as mentioned above, in each there were grade 3 or 4 abnormalities in hepatic
function which may have contributed to the malaise This poor tolerance of3.5 mg!m2
prompted expansion of accrual at 3.0 mg!m2, the dose which has been recommended
for phase II trials.
Anitumour activity was seen in 4 patients at 3.0 mg!m2 and 1 at 2.6 mg!m2.
One patient with breast cancer achieved a complete response and other responses were
seen in ovarian cancer (2 minor responses), nasopharyngeal cancer (minor response)
and adenocarcinoma ofunknown primary (partial response).
The toxicity which was most difficult to manage was diarrhoea. We have
recently reported the finding of diarrhoea in Balb C mice treated with ICI D 1694 and
this may provide a model with which to explain and treat the unpredictable symptoms
seen in man12.
603
MURINE MODEL
On a daily times five schedule of intraperitoneal (i. p) injections the maximally tolerated
dose (that dose at which no deaths occurs) in Balb C mice is 5 mglkg. The mice lose
20-25% of body weight with nadir weight loss occurring on day 7. Diarrhoea
commences on day 4 and continues for several days. Histopathology of small bowel
shows ulceration and villous atrophy. In DBA2 mice a dose of 50-100 mglkg is
required to induce 14-22% weight loss, which is maximal on day 9, although the mice
can tolerate >500 mglkg without the occurrence of diarrhoea. The diarrhoea and most
of the weight loss is abolished by the co-administration of thymidine in a dose of 500
mglkg given three times a day for 8 days. Folinic acid co-administration, 20mglkg
daily times five, completely abolishes weight loss and diarrhoea. Full blood count with
differential on days 1, 5, 8 and 12 was performed in both strains after the following
doses ofiCI D1694: 5 mglkg for Balb C and 100 mglkg for DBA2 on a daily x 5 i.p
schedule. Severe neutropenia was seen in the DBA2 mice on day 8, but not on any
day in the Balb C mice. Serum thymidine levels appear to be similar in both strains at a
level of 1-21J.M. Further experiments may provide information as to the cause of this
differential toxicity and its applicability to the clinical situation.
REFERENCES
1. A.H. Calvert, D.L. Alison, S.J. Harland, B.A. Robinson, A.L. Jackman, T.R Jones, D.R Newell,
Z.H. Ziddik, E: Wiltshaw, T.J. McElwain, I.E. Smith, and K.R Harrap, J C/in Onco/. 4:
1245-1252, (1986)
2. B.M.J. Cantwell, V. Macaulay, A.L. Harris, S.B. Kaye, I.E. Smith, RA.V. Milstead, and A.H.
Calvert, Eur J Cancer C/in Oncol. 24: 733-736, (1988)
3. M.F. Bassendine, N.J. Curtin, H. Loose, A.L. Harris, and O.F.W. James, J Hepato/. 4: 349-356,
(1987)
4. D.L. Alison, D.R Newell, C. Sessa, S.J. Harland, L.I. Hart, K.R. Harrap, and A.H. Calvert, Cancer
Chemother Pharmacal. 14: 265-271, (1985)
5. D.R. Newell, D.L. Alison, A.H. Calvert, K.R. Harrap, M Jarman, T.R Jones, M. Manteuffel-
Cyrnborowska, and P. O'Connor, Cancer Treat Rep. 70:971-979, (1986)
6. T.R Jones, T.J. Thornton, A. Flinn, A.L Jackman, D.R Newell, and A.H. Calvert, J Med Chem.
32:847-852,(1989)
7. L.R. Hughes, A.L. Jackman, J. Oldfield, R.C. Smith, K.D. Burrows, P.R Marsham, J.A.M. Bishop,
T.R. Jones, B.M. O'Connor, and A.H. Calvert, J Med Chem. 33: 3060-3067, (1990)
8. A.L. Jackman, G.A. Taylor, B.M. O'Connor, J.A. Bishop, RG. Moran, and A.H. Calvert, Cancer
Res. 50: 5212-5218, (1990)
9. P.R. Marsham, L.R. Hughes, A.L. Jackman, A.J. Hayter, J. Oldfield, J.M. Wardleworth, J.A.M.
Bishop, B.M. O'Connor, and A.H. Calvert, J Med Chem. 34: 1594-1605, (1991)
10. A.L. Jackman, D.R Newell, W. Gibson, D.I. Jodrell, G.A. Taylor, J.A.M. Bishop, L.R. Hughes,
and A.H. Calvert, Biochem Pharmacal. 42: 1885-1895, (1991)
11. A.L. Jackman, G.A. Taylor, W. Gibson, R. Kimbell, M. Brown, A.H. Calvert, I.R. Judson, and
L.R Hughes, Cancer Res. 51: 5579-5586, (1991)
12. D.I. Jodrell, D.R. Newell, S.E. Morgan, S. Clinton, J.P.M. Bensted, L.R. Hughes and A.H.
Calvert, Br J Cancer. 64: 833-838, (1991).
13. A.L. Jackman, D.I. Jodrell, W. Gibson and T.C. Stephens, In R.A. Harkness, G. Elion and N.
Zollner (eds.), Purine and Pyrimidine Metabolism in Man VII, pp. 19-23, Plenum press, New
York, (1991)
14. S.J. Clarke and A.L. Jackman, Proc Amer Assoc Cancer Res. (1993) In press
604
EVALUATION OF IMMUNOHISTOCHEMICAL STAINING AND ACTIVITY
Kingdom
INTRODUCTION
METHODS
A panel of 13 cell lines (Table 1) was used for IHC staining and measure-
ments of FdUMP binding and catalytic activity including 3 murine, 1 rat and 4 human
colon cancer cell lines; 3 human cell lines derived from squamous cell carcinoma of the
head and neck and 2 human lympoblastoid cell lines, the parent Wl-L2 and the
resistant, TS overproducing Wl-L2:Cl 8 • We applied standard IHC staining methods.
RESULTS
The lympoblastoid cells had an intense staining at the rim of the cell, while
the cytoplasm showed minimal staining (Fig. la-b). Two of the human colon cancer cell
lines also stained stronger at the rim of the cell than in the cytoplasm, but all the other
cells had a homogeneous staining of the cytoplasm. The ahTS also recognized rat and
murine TS. The murine and rat cells showed a staining comparable to that of the human
colon cancer cells.
Comparison of the intensity of the staining with the known catalytic activity
or FdUMP binding of the cell lines revealed a good correlation of high intensity and
high TS activity and high capacity of FdUMP binding to TS within the murine colon
cancer cells and the human head and neck cancer cells (Table 1). For the head and neck
cancer cell lines UM-SCC-14C with 379 pmol/h/mg protein (catalytic activity) and 158
fmol/mg protein (FdUMP binding) had a staining scored as ( +), while those values for
UM-SCC-llB were 2526, 864 and(++++), respectively (Fig. le-e). The staining
of the resistant lympoblastoid cells ( + + +) was stronger than that of the parent ( +)
(Fig la-b). Within the panel of the human colon cancer cell lines no clear relation could
be detected. Interestingly two colon cancer cell lines (1 murine, 1 human), which have
been adapted to low folate levels showed an increase in TS catalytic activity (1.5x and
2.5x, resp.) and intensity of lliC staining (1.25x and 2x, resp.) as compared to their
parental line.
DISCUSSION
rnc staining of cytospins revealed two types of staining, cytoplasmic and cell
rim. In most of the cell lines grouped according to origin a good relation between TS
levels measured with classic enzyme assays and intensity of lliC staining was observed.
A similar trend has been observed for results obtained by Western blotting with a
monoclonal antibody against human TS and FdUMP binding9 •
rnc staining for TS can be an additional method to indicate TS protein
levels, but quantification of TS levels was disputable with this method. Quantification
may be performed by densitometric measurements of Western blots or EUSN. It has
been shown for the parent and resistant lympoblastoid cells that the difference in TS
protein levels could also be detected by EUSA methods, with the polyclonal antibody7 .
The rnc detection of TS in tumor samples could be of prognostic value for patients
which receive (adjuvant) FU therapy, since high TS levels seem to be correlated to
resistance against FU.
606
A
607
Table 1
Comparison of intensity of lliC staining of TS
with FdUMP Binding to TS an TS Catalytic activity
Human squamous cell carcinoma cell lines of the head and neck
UM-SCC-14C + 379 ± 177 158 ± 39
UM-SCC-22B +++ 969 ± 119 150 ± 19
UM-SCC-llB ++++ 2526 ± 1498 864 ± 339
• Cell lines derived from WiDr and C26-10, respectively, but adapted to grow in folate depleted medium
(1 nM folinic acid). Values are means of 2 independent scores (IHC) or at least 3 enzyme assays
ACKNOWLEDGEMENT
The lymphoblastoid cell lines were a gift from Dr. A.L. Jackman. This research was supported by grant
92-88 of the Dutch Cancer Society
REFERENCES
608
THE INTERVAL BETWEEN METHOTREXATE AND LEUCOVORIN
Hospital, Amsterdam
3 Netherlands Cancer Institute, Amsterdam
INTRODUCTION
METHODS
Two colon cancer cell lines, SW948 (human) and C26-10 (murine), and one
head and neck cancer cell line, UM-SCC-14C were used for growth inhibition tests with
MTX, FU and LV. Cells were seeded in 96 well plates in different densities, depending
or their doubling time. MTX was added at final concentrations of 0, 0.05, 0.1 and 1 p,M,
after 24 h (SW948, UM-SCC-14C) or 48 h (C26-10). Subsequently FU and/or LV was
added after different time intervals: 2, 4, 6, 24 h. Fixed fmal concentrations of LV and FU
were used, 5 p,M and 1 p,M, respectively. The FU concentration corresponded to the IC 50
100
.,e. 80
.s::.
i0 60
...Cl
.. 40
Q)
>
!II
20
...
Q)
0
0 0.05 0.1
concentration MTX (~M)
Figure 1 Growth inhibitory effects of MTX/FU/LV on the human colon cancer cell line SW948. Time
interval between addition of various concentrations of MTX and FU (I ~M) and/or LV (5 ~M) was 2 h.
Values are means ± SEM of three different experiments.
RESULTS
Additive growth inhibitory effects of MTX and FU (without LV) were observed
in SW948 at all time intervals (2 (Fig. 1), 4, 6 and 24 h), in C26-10 only after 24 hand
in UM-SCC-14C not at all. LV reversed the MTX (without FU) effects completely in all
cell lines, up to the 6 h interval between MTX and LV. At 24 h interval the 80% growth
inhibition of the high concentration of MTX could not be reversed anymore. Potentiation
of the FU effect (without MTX) by LV was seen exclusively in SW948 (Fig. 1, left panel
of bars). Consequently, additive antiproliferative effects of FU, LV and MTX compared
to FU/MTX occurred only in this cell line, but those effects were restricted to the 2 hr
interval between MTX and LV/FU and a relatively low MTX concentration (0.05 ~M)
(Fig. 1). At all other time intervals and higher MTX concentrations (0 .1 and I ~M) a
reversal of the MTX/FU induced growth inhibition was seen in SW948. Similar reversal
effects of LV on the combination with MTX/FU were observed in C26-10, but in UM-
SCC-14C those effects were absent.
610
MTX potentiated the in vivo antitumor effect of FU in nude mice bearing UM-
SCC-14C tumors (Table 1), at a time interval of 8 h compared to 1 hand 4 h. Addition
of LV to this combination reduced the antitumor effect of MTX/FU when a time interval
of 4 h was used. MTX/FU showed a good antitumor activity compared to FU alone in
mice bearing Colon 26 tumors, but it was very toxic too. A time interval of 17 h between
MTX and FU was more effective than a 4 h interval. The antitumor effect of FU as a
single agent could be enhanced by LV in this tumor with a two-fold increase of and was
comparable to MTX/FU, but a much lower toxicity was observed (8.9% weight loss for
MTX/FU compared to 4.3 % for LV/FU). The addition of LV to MTX/FU treatment did
not increase the antitumor effect and even a tendency to reversal of MTX/FU antitumor
effect was observed.
UM-SCC-14C
<0
0.4
Colon 26
O.Q7
1.2
DISCUSSION
611
interval. Benz and Cadman9 described synergistic effects of MTX/FU for HCT-8, colon
cancer cells when time intervals of 12-24 h were used; for L1210 and CCRF-CEM cells,
which have a very short doubling time, time intervals of 3-4 h were sufficient to obtain
synergystic effects7 •10 • The absence of additive or synergystic effects of sequential MTX/FU
for UM-SCC-14C cells might be related to a low FPGS activity 11 and low accumulation of
MTX-polyglutamates 12 • Optimal sequencing of MTX, FU and LV appeared to be very
difficult. We achieved a very small additive effect of MTX/FU/LV at one MTX
concentration, in one cell line, one time interval of the 36 combinations tested ( 3 cell lines
x 3 MTX concentrations x 4 time intervals, respectively). In an other in vitro study,
Danhauser et a/ 13 also reported no increase of growth inhibition for MTX/FU/LV compared
to MTX/FU.
Preclinical in vivo experiments on sequential MTX/FU described superior
antitumor effects when intervals of 24 h were used instead of 6-12 h14 • Our data showed
a similar trend although different doses of FU were used at 4 and 17 h interval of drug
administration. The addition of LV to this combination seemed to reverse antitumor
activity compared to MTX/FU.
Trials using the combination of MTX/FU/LV are often reported as MTX/FU
trials although varying doses and schedules were used7•15 • Martin 15 postulated that many
trials on the MTX/FU combination were negative because of the too short interval between
MTX and FU. Clinical evidence from a randomized trial was obtained by Browman et a/16 ,
who observed a better anticancer effect at the long interval compared to the short interval.
In a randomized study Glimelius et aP 1 observed a better antitumor activity of MTX/FU
(with LV) compared toFU alone, although in all arms low response rates were observed.
It might however very well be possible that the increased response rate are just due to a
modulating effect of LV on FU, even despite the low dose of LV. Preclinical data,
including this report, do not support the addition of LV to MTX/FU therapy, due to
possible reversal effect of LV.
REFERENCES
1. S. Bernard, M.C. Etienne, j,L. Fischel, P. Formento, G. Milano, Br. J. Cancer 63: 303-307 (1991)
2. F.M. Sirotnak, R.C. Donsbach, D.M. Moccio, D.M. Dorick, Cancer Res. 36: 4679-4686 (1976)
3. K. Keyomarsi, R.G. Moran. J. Biol. Chern. 263: 14402-14409 (1988)
4. J.C. Nadal, C.J. van Groeningen, H.M. Pinedo, G.J. Peters, Invest. New Drugs 7: 163-172 (1989)
5. C.L. van der Wilt, H.M. Pinedo, K. Smid, G.J. Peters, Cancer Res. 52: 4922-4929 (1992)
6. E. Cadman, R. Heimer, L. Davis, Science 205: 1135-1137 (1979)
7. E. Mini, J.R. Bertino, In: Synergism and antagonism in chemotherapy, Academic Press, San Diego
pp. 449-490 (1991)
8. Y. P. Keepers, P. E. Pizao, G.J. Peters, J. van Ark-Otte, B. Winograd, H.M Pinedo, Eur. J. Cancer
27: 897-900 (1991)
9. C. Benz, E. Cadman, Cancer Res. 41: 994-999 (1981)
10. D.J. Fernandes, J.R. Bertino, Proc. Natl. Acad. Sci. U.S.A. 77: 5663-5667 (1980)
11. G.J. Peters, C.L. van der Wilt, J. Cloos, H.M. Pinedo, these proceedings (1993)
12. B.J.M. Braakhuis, G. Jansen, G.J. Peters, these proceedings (1993)
13. L.L. Danhauser, R. Heimer, E. Cadman, Cancer Chemother. Pharmacal. 15: 214-219 (1985)
14. I. Brown, H.W.C. Ward, Cancer Letters 5: 291-297 (1978)
15. D.S. Martin, In: New avenues in developmental cancer chemotherapy, K. Harrap, T. Connors, ed.,
Academic Press, London, pp 113-161 (1987)
16. G.P. Browman, M.N. Levine, M.D. Goodyear, R. Russell, S.D. Archibald, B.S. Jackson, J.E.M.
Young, V. Basrur, C. Johanson, J. Clin. Oncol. 6: 963-968 (1988)
17. B. Glimelius, C. Ginman, S. Graffman, L. Pahlman, E. Stahle, Eur. J. Cancer Clin. Oncol. 22:295-
300 (1986)
612
POTENTIATION OF 5-FLUOROURACIL INDUCED INHIBITION OF
INTRODUCTION
RESULTS
For all patients a large variation was found in both the number of total
FdUMP binding sites (0-383 fmol/mg protein, median 70; 35 patients) and the
total catalytic activity (0-178 pmol/hr/mg protein, median 35; 35 patients). A
significant inhibition of TS was observed in tumor samples of patients who
received 5FU as a bolus injection (Table 1). In patients receiving HD-LV a clear
potentiation of the inhibition of TS was observed, as could be evaluated using
both assays. However, in patients receiving the LD-LV the inhibition of TS was
clearly less than with HD-LV, although the inhibition as evaluated using the
FdUMP binding assay was more pronounced than with 5FU alone. However,
when using the catalytic assay for evaluation of the results, the effect of LD-LV is
lower than that of HD-LV and an even slightly higher TS activity was observed
than for 5FU alone. It should be noted that the TS activity was measured at a low
non-saturating dUMP concentraiton of 1 1-LM; however, at a substrate concentra-
tion of 10 1-LM dUMP, which is saturating, a similar relative inhibition was obser-
ved as at 1 1-LM dUMP. The inhibition of TS was selective for the tumor tissue,
614
since the inhibition of TS in normal liver and normal mucosa in these patients
was not affected by LV (both LD-LV and HD-LV; data not shown). The number of
free FdUMP binding sites in normal liver was 70-80% for all three protocols. For
the catalytic activity (at 1 J.LM) these values ranged from 69 to 106%.
DISCUSSION
615
effect was even more pronounced for the catalytic assay. It should be noted that
the catalytic assay represents the actual biochemical proces to be inhibited in
the tumor. Although up to now a limited number of patients could be entered in
the LD-LV arm, these preliminary data suggest that LD-LV is not sufficient for
most patients to achieve the desired potentiation of TS inhibition. Pending
confirmation of this pattern in more patients it seems desirable to treat patients at
a relatively high dose of LV.
REFERENCES
1. G.J. Peters and C.J. van Groeningen. Ann Onco/2: 469-480 (1991)
2. C.-H. Kohne-Wompner, H.-J. Schmoll, A. Harstrick, Y.M. Rustum. Sem Onco/19 (sup):
105-125 (1992}
3. P. Piedbois, M. Buyse, Y. Rustum, D. Machover, C. Erlichman, R.W. Carlson, F. Valone,
R. Labianca, J.H. Doroshow, N. Petrelli J Clin Onco/10: 896-903 (1992}
4. N. Petrelli, L. Herrara, Y. Rustum, P. Burke, P. Creaven, J. Stulc, L.J. Emrich, A.
Mittelman. J Clin Onco/ 5: 1559-1565 (1987)
5. C. Erlichman, S.W. Fine, Wong et al. J Clin Oncol 6: 469-475 (1988}
6. M.J. O'Connell. Cancer 63: 1022-1025 (1989}
7. N. Petrelli, H.O. Douglas Jr, L. Herrera, et al. J Clin Onco/7: 1419-1426 (1989)
8. G.J. Peters, Y.M. Rustum. Ann Onco/4: in press (1993)
9. E. Mini and J.R. Bertino. In: Synergism and Antagonism in Chemotherapy (Acad. Press),
449-506 (1991)
10. P. Trave, Y.M. Rustum, N.J. Petrelli, L. Herrera, A. Mittelman, C. Frank, P. Creaven.
J Clin Oncol 6: 1184-1191 (1988}
11. G.J. Peters, C.J. van Groeningen, C.L. van der Wilt, S. Meijer, K. Smid, E. Laurensse,
H.M. Pinedo. Sem Onco/19 (Sup): 26-35 (1992)
12. G.J. Peters, C.J. van Groeningen, C.L. van der Wilt, K. Smid, S. Meijer, H.M. Pinedo HM.
Adv Exp Med Bio/309A: 131-134 (1991)
13. G.J. Peters, C.L. van der Wilt, C.J. van Groeningen, K. Smid, S. Meijer, H.M. Pinedo.
submitted for publication
14. C.L. van der Wilt, H.M. Pinedo, K. Smid, G.J. Peters. Cancer Res 52: 4922-4928 (1992)
15. C.L. van der Wilt, M. de Jong, B.J.M. Braakhuis, H.M. Pinedo, G.J. Peters.
These proceedings
16. S. Radparvar, P.J. Houghton, J.A. Houghton. Arch Biochem Biophys 260: 342-350
(1988)
17. J.C. Nadal, C.J. van Groeningen, H.M. Pinedo, G.J. Peters. Invest New Drugs 7: 163-172
(1989}
616
INTERACTION WITH 2(4)-THI0-5-FLUORO-dUMP
OF THYMIDYLATE SYNTHASES WITII DIFFERING
SENSITIVITIES TO 5-FLUORO-dUMP
INTRODUCTION
Inhibition of the enzymes from Ll210P, Ll210R, RRL and H. d., by competition vs
dUMP, of 2-thio- and 4-thio- analogues of FdUMP, was examined by varying the dUMP
concentration with different concentrations of inhibitor, added simultaneously to the reaction
mixture. Competitive inhibition was indicated by intersection at the ordinate of
Lineweaver-Burk plots (not shown), described by the apparent Ki values presented in Table
1.
0.33
[2-thio-5-fluoro-dUMP] (pM)
:;::
·;;
=fi
~
• 0.07
:;:: 40
:2:
<1:
~
~
~0.11
u
<1:
~2.00
~
20
~ 0.27
0.34
20
100 6 8 10 10
2 4 0 2 4 6 8 10
~o•
60
10o:---=2-~4:---6!--~8-----:1'::-0- -
Preincubation time (min) Preincubation time (min)
Fig. 1. Slow-binding inhibition of RRL (upper panels) and H. d. (lower panels) thymidylate synthase (TS) by
2-thio-FdUMP (left panels) and 4-thio FdUMP (right panels).
618
When preincubated with each of the enzymes studied, in the presence of N5, 10-meth-
ylenetetrahydrofoJate, the FdUMP analogues caused time-dependent inactivation (Fig. 1),
consistent with the behaviour of each as a slow-binding inhibitor. 7 The inactivation rate
usually decreased after about 2 min preincubation. reflected by a biphasic plot of log (re-
maining activity) vs time (Fig. 1), consistent with differing interactions of each inhibitor with
the two binding sites on the thymidylate synthase molecule. Consequently, inhibition con-
stants and inactivation rate constants were calculated with the use of apparent inactivation
rate constants during the initial (0.0-1.5 min) and later (4-10 min) periods of preincubation
v1rith a given inhibitor at various concentrations. The corresponding inhibition constants and
inactivation rate constants are then .Ki' and k2', and .Ki" and k2", respectively (Tables 2 and
3). Only for inactivation of the RRL enzyme by 4-thio-FdUMP did the inactivation rate not
change during preincubation (Fig. 1, Table 3).
FdUMPa
L1210P 1.8 ± 0.4 (6)b 20 ± 5 (4) 0.17 ± 0.02 (6) 0.12± 0.04 (5)
L1210R 12.2 ± 1.4 (6) 14±3(4) 0.25 ± 0.04 (6) 0.06 ± 0.02 (4)
2-thio-FdUMP
Ll210P 41 ± 9(3) 46± 25 (3) 0.12 ± 0.02 (3) 0.02 ± 0.01 (3)
Ll2lOR 297 ± 93 (3) 93 ± 31 (3) 0.40 ± 0.04 (3) 0.04 ± 0.01 (3)'
4-thio-FdUMP
L1210P 102 ± 36 (3) 202± 36 (3) 0.21 ± 0.04 (3) 0.05 ± 0.00 (3)
Ll210R 14 ± 4(5) 34± 9 (5) 0.11 ± 0.03 (5) 0.03 ± 0.01 (5)
aFromrefl
bResults are presented as means ± SEM, followed by the number of separate experiments in parentheses.
FdUMP
RRL 10± 1 (3) 15± 5 (3) 0.29 ± O.o7 (3) 0.14±0.03(3)
H. d. 146 ± 32 (3)a 25± 3 (3) 1.22 ± 0.17 (3) 0.09 ± 0.03 (3)
2-Thio-FdUMP
RRL 64± 10(3) 14± 4(3) 0.30 ± 0.08 (3) 0.03 ± 0.01 (3)
H. d. 632 ± 179 (3) 52± 7 (3) 0.82 ± 0.09 (3) 0.22 ± 0.02 (3)
4-Thio-F-dUMP
RRL 850 ± 40 (4) 0.10 ± 0.03 (4)
H. d. 910 ± 290 (3) 1,600 ± 610 (3) 0.22 ± 0.01 (3) 0.11 ± 0.02 (3)
3 Results are presented as means ± SEM, followed by the number of separate experiments in parentheses.
619
Relative to FdUMP, inactivation by 2-thio-FdUMP was about 5-fold weaker for the
H.d and RRL enzymes, and about 20-fold weaker vs the L1210P and L1210R enzymes. By
contrast, although 4-thio-FdUMP was not a better inactivator of the H.d enzyme than the 2-
thio analogue, it was significantly less active vs RRL (Ki ~w-6 M) and L1210P (Ki ~w-1
M) enzymes, but more potently inactivated the L1210R enzyme (Ki ~to-8 M) lhan 2-thio-
FdUMP.
Hence 4-thio-FdUMP was more specific vs the Ll210R, relative to the L1210P (the
reverse of that observed with FdUMP) or RRL (the same but less pronounced relation found
with FdUMP) enzyme forms. Furthermore, while both FdUMP and 2-thio-FdUMP were
distinctly more effective inhibitors ofRRL than of H. d. thymidylate synthase, 4-thio-FdUMP
lacked their specificity. These findings, in conjunction with those describing similar specific-
ity variations concerning inactivation of different enzyme forms by N4-hydroxy-5-fluoro-
dCMP, relative to FdUMP, 1 suggest that modification of the C(4)=0 of FdUMP may pro-
vide some control over selective inactivation of thymidylate synthase from different sources.
ACK...""l'OWLEDGMENTS
Supported by the State Committee for Scientific Research (Grant No. 0071/P2/92/03).
REFERENCES
620
MECHANISM OF THYMIDYLATE SYNTHASE
INHIBITION BY N4-HYDROXY -(N4-HYDROXY-
5-FLUORO)-dCMP IN VIEW OF THE STRUCTURE
AND CONFORMATION OF N4-HYDROXY-
(N4-HYDROXY -5-FLUORO)-CYTOSINE CALCULATED
BY THE AB INI110 QUANTUM MECHANICAL METHODS
INTRODUCTION
THEORETICAL CALCULATIONS
Structural and energetic properties of amino and imino tautomers, and syn and anti ro-
tamers of oh4c and oh¥C were calculated. Optimal molecular geometries and molecular
energies were obtained within the Self Consistent Field (SCF) method corrected for the
electron correlation effects by the second-order Many Body Perturbation Theory (SCF +
MBPT(2)). Molecular structures were optimized by the SCF method with the standard 3-21G
basis set andre-optimized with the use of the SCF procedure and the 6-31 G** Gaussian ba-
sis set. The calculations were perfonned with the use of the GAUSSIA...""J 90 program.2 While
geometries of the imino fonns were assumed planar, in the amino forms where significant
The results of the ab initio calculations are presented in Tables 1 and 2. The relative total
en~es of various tautomers and rotamers are also shown on Fig. 1. For each oh4C and
oh4f.'C the most stable is the imino-syn and the next stable the imino-anti form, with the 5-
fluoro substituent raising the energy difference between the syn and anti rotamers over 3-fold.
Such an unexpected effect of the 5-fluoro substituent can be rationalized based on the atomi-
zation energies, defined as the diference between the total energy of a molecule (Tables 1 and
2, SCF/6-31G** values) and the sum of the atomic energies (values from ref.3). A compari-
son of atomization energies shows that the intetnal bonding effect in oh4c is weakened by
some 200 kJ mot·l when the fluorine atom replaces the hydrogen atom at the C( 5) position.
As a consequence the imino-anti form of oh4f5C with the internal hydrogen bond is signifi-
cantly less favourable than the non-substituted oh4C molecule (Fig. 1).
Table 1. Theoretical ab initio calculations for oh4c in Tl, T3, T5 and T7 tautomeric forms
(see Fig. 1)
Tl T3 T5 T7
Energy (a.u.)
SCFI3-21Ga -464.813924 -464.810601 -464.790623 -464.791823
SCF/6-31G**b -467.437426 -467.433300 -467.421148 -467.423744
MBPT(2)c -1.353234 -1.352349 -1.353498 -1.351360
ZPEd 0.100885 0.100839 0.100503 0.101134
Total energy e -468.689774 -468.684910 -468.674143 -468.673970
Relative f total
energy (kJ/mol) 0.00 12.77 41.05 41.49
a SCF/3-21G//3-21G calculations.
b SCF/6-31G**//6-31G** calculations.
c MBPT(2)/6-31G**//6-31G** calculations.
d ZPE is the zero-point nuclear vibration energy. A common factor of0.9 was used to scale down all
hannonic frequencies obtained with the SCF/6-31G**//6-3IG** method.
e SCF(6-31G**)+MBPT(2)(6-31G**)+0.9*ZPE(6-31G**).
f 1 a.u. of energy= 2625.5 kJ/mol.
Table 2. Theoretical ab initio calculations for oh4f.SC in T2, T4, T6 and T8 tautomeric forms
(see Fig. 1)
T2 T4 T6 T8
Energy (a.u.)
SCF/3-21Ga -563.122552 -563.105322 -563.102126 -563.099148
SCF/6-3IG**b -566.271677 -566.254868 -566.256150 -566.254941
MBPT(2)c -1.515117 -1.516875 -1.516380 -1.515006
ZPEd 0.093133 0.092743 0.092573 0.093352
Total energy e -567.693661 -567.679000 -567.679957 -567.676595
Relative f total
energy (kJ /mol) 0.00 38.49 35.98 44.81
622
H
.o.E I
H/O'N/H H,N/0
j):JJ:
kJ mor1
50
I I
H H
40
H,
/0
30 N
"':)" _t
H
10 N I
O.(N H
I
H
0
r, T3 Ts Tl
.o.E H,N/O'IIH
kJ mor1
N
/o,H
.
/'N/H
N~'
~ I
50 H,NJF : )F 0
.N::?' N
I N
H,
N
/0 O~N I H ~ IH H
I 0 N
40 H I
H'NJF H
30
O.(N IH
I
H
/H 44.8
20 o, 38.5
"'J'
N 36.0
10 N I 25.3
O.(N H
I
H
0
T1 Tn T4 Ts Ta
Figure 1. Total energy differences for various tautomeric forms of oh4c (upper panel) and oh4f 5c (lower
panel). Energies ofTl and T2 forms are taken as the reference values (see Tables 1 and 2).
In order to estimate the barrier height for the rotation of the hydroxyl about the C( 4)=N4
double bond, oh4C feometry was optimized with the SCF/3-21G method assuming the tetra-
hedral N(3)-C(4)-N -0 angle fixed to 90 degrees. One of the harmonic frequencies, calcu-
lated after the optimiztion process had been completed, was imaginary indicating a transition
state structure (Fig. 2). Single-point SCF + :tvmPT(2) calculations, performed with the 6-
31G** basis set on the transition state structure, showed the energy of the latter to be by
184.5 kJ/mol higher than the energy of the non-rotated syn-imino form. Thus the rotation bar-
rier appears to be high enough to prevent the syn-anti flip of the imino N4(0H) group at any
temperatures relevant to biochemical processes. In consideration of a possibility of syn-imino-
623
Figure l. Stereo-view of the oh4c transition state. The chemical bonds are marked by the thick solid lines. Thin
lines are added to make the transirion structure more transparent. Circles ofincreasing diameter denote
hydrogen, carbon, nitrogen, and oxygen atoms.
oh4c and syn-amino-oh4c enerf difference reduction, due to the C(5)-C(6) bond saturation
in the thymidylate synthase - oh dCMP - methylenetetrahydrofolate ternary complex, 4 the to-
tal energy difference between amino and imino tautomers of syn-oh4c with saturated C(5)-
C(6) bond was calculated. Since it was found to be increased up to 74.4 kJ/moL then the
C(5)-C(6) bond saturation should not facilitate an imino --. amino transformation. Moreover,
the rotation of the amino-like N4(0H)(H) group must be also strongly hindered, since the
apparently single C(4)-N4 bond becomes conjugated with the ring system. The latter
statement is based on the calculated values of the Mulliken overlap populations, a by-product
of the SCF calculations, indicating that the "single" C(4)-N4 bond in syn-amino-oh4c is
stronger than N(l)-C(2) or N(l)-C(6) bonds in the aromatic ring. In agreement with the
foregoing, studies of 1-methyl-N4-hydroxycytosine hydrochloride crystals showed the C(4)-
N4 bond (1.30 A)5, in the protonated oh4c residue, to be longer than the double bond in the
imino form (1.29 A)6 but shorter than the single bond in cytosine (1.32-1.33 A)7,8.
The theoretical ab initio results suggest that (i) the 5-fluoro substituent in oh4f5dCMP
potentiates thymidylate synthase inhibition by a mechanism different than the intramolecular
hydrogen bond formation and (ii) the syn-imino and anti-imino forms of oh4(oh4f5)dCMP, at
temperatures relevant to biochemical conditions, can be treated as two structural isomers that
do not interconvert, and thus are not in thermodynamic equilibrium as formerly assumed. Fur-
thermore, it appears that obtaining the anti rotamer of oh"(oh4f5)dCMP in pure form should
be possible via either separation from the syn rotamer or stereospecific synthesis.
ACKNOWLEDGMENTS
A. Les and W. Rode were supported by the State Committee for Scientific Research
(Grant Nos KBN-CHEM-BST-412/23 and 0071/P2/92/03, respectively), and L. Adamowicz
by the American Cancer Society Junior Faculty Research Award.
REFERENCES
1. W. Rode, Z. Zieliil.ski, J.M. Dzik, T. Kulikowski, M. Bretner, B. Kierdaszuk. J. Ciesla, and D. Shugar,
Biochemistry 29: I 0835 (1990).
2. GAUSSIAN 90, Revision I, M.J. Frisch, M. Head-Gordon, G.W. Trucks, J.B. Foresman, H.B. Schlegel,
K. Raghavachari, M. Robb, J.S. Binkley, C. Gonzalez, D.J. Defrees, D.J. Fox, R.A Whiteside,
R. Seeger, C.F. Melius, J. Baker, R.L. Martin, L.R. Kahn, J.J.P. Steward, S. Topiol, and J.A
Pople, Gaussian, Inc., Pittsburgh PA (1990).
3. J. Leszczyitski,J Phys. Chern. 96:1649 (1992).
4. S. Goldstein, A.L. Pogolotti, Jr., E.P. Garvey, and D. Santi,J. Med. Chern. 27:1259 (1984).
5. G.I. Birnbaum, T. Kulikowski, and D. Shugar, Can. J Biochem. 57:308 (1979).
6. D. Shugar, C.P. Huber, and G.I. Birnbaum, Biochim. Biophys. Acta 447:274 (1976).
7. D.L. Barker, and R.E. Marsh, Acta Cryst. 17:1581 (1964).
8. R.J. McClure, and BM. Craven, Acta Cryst. 26:20 (1973).
624
SULPHONAMIDE ANTIFOLATES INHffiiTING
THYMIDYLATE SYNTHASE: SYNTHESIS, ENZYME
INHffiiTION AND CYTOTOXICITY
INTRODUCTION
( Ill )
( II )
c=cH
I
0 CH R = NH2 , CH 3
R (IV)
l TFA
c=cH
I
0 CH
H~)~CH2-~-oS02 - NHR'
AN
R (V)
626
Table 1. 10-Propargyl-5,8-dideazafolic acid 1, 2-desamino-2-methyl-10-propargyl-5,8-di-
deazafolic acid 2 and their analogs 3-9. Structures and parameters of Ehrlich carcinoma
thymidylate synthase and L5178Y cell growth inhibition.
C::CH
I
0 CH
:m-CH,-~-o-X-NHR'
Ki,JlM TC50, JlM
COOH
COOH
COOH
COOH
COOH
5 CH3 502 HN_/ 0.303 ± 0.061 300
COOH
6 CH3 502 HNi- 0.386 ± 0.074 300
COOH
7 CH3 502 HN-< 0.184 ± 0.022 250
COOH
8 CH3 so2 HN-<o 0.150 ± 0.020 80
COOH
9 CH3 502 HN~ 0.048 ± 0.001 60
a From ref. 1
with glycine, alanine, valine and phenylglycine were either without a distinct effect
(Table 1, compound 8) or lowered inhibitory potency (Table 1, compounds 5-7).
627
ACKNOWLEDGMENTS
Supported by the State Committee for Scientific Research Grant no. 6 6254 92 03.
REFERENCES
1. L.R. Hughes, A.L Jackman, J. Oldfield, R.C. Smith, K.D. Burrows, P.R. Marsham, J.A.M. Bishop,
T.R. Jones, B.M O'Connor and A.H. Calvert, J. Med. Chern. 33:3060 (1990).
2. T.R. Jones, A.H. Calvert, A.L. Jackman, S.J. Brown, M Jones and K.R. Harrap, Eur. J. Cancer 17:11
(1981).
3. M. Jastreboff, B. K~dzierska and W. Rode, Biachem. Pharmacal. 31:217 (1982).
4. W. Rode, T. Kulikowski, M. Jastreboff and D. Shugar, Biachem. Pharmacal. 31:2299 (1984).
628
FOLYLPOLY-y-GLUTAMATE SYNTHETASE
Barry Shane, Tim Garrow, Alfred Brenner, Linda Chen, Yun-Jung Choi,
Juei-Chuan Hsu and Patrick Stover
INTRODUCTION
Three distinct yeast genes were isolated that complemented an E. coli FPGS- mutant.
The genes were over-expressed in E. coli and the gene products were characterized. The first
gene encoded a dihydrofolate synthetase (DHFS) which was purified to homogeneity. The
properties of this enzyme are compared to bacterial FPGS/DHFS enzymes in Table 1. Yeast
DHFS lacks any FPGS activity and pteroylmonoglutamates have little, if any, affinity for the
protein. This is in sharp contrast to the Corynebacterium and E. coli proteins which possess
both DHFS and FPGS activities. Yeast DHFS shares limited (approx. 30 percent) amino acid
The second yeast gene encoded a protein which possessed FPGS activity but lacked
DHFS activity. The third yeast gene encodes a protein of unknown function and its deduced
amino acid sequence has no similarility to any DHFS or FPGS protein.
A human eDNA for FPGS was isolated by expression cloning in E. coli and the eDNA
characterized and its gene product over-expresssed and purified&. The human and yeast
FPGS proteins share the highest degree of amino acid identity (36 percent) and these proteins
share only 6 percent amino acid identity with the E. coli, Lactobacillus and yeast (DHFS)
proteins. The major sequence conservation among these proteins are in the regions of the A
and B nucleotide binding sites.
1. ND not done
2. mature protein
630
The properties of yeast, human and pig FPGS are compared in Table 2. The properties
of the proteins are similar and differ from the bacterial proteins and yeast DHFS (Table 1) in
their larger molecular size, their lower requirement forK+, and their preference for DHF and
THF as the optimal pteroylmonoglutamate substrates. The eukaryotic proteins will also
metabolize folate substrates to long chain polyglutamates while the bacterial FPGS proteins
extend the polyglutamate chain primarily to the tri- and tetraglutamate derivatives.
We have shown that FPGS is located in the mitochondria and cytosol of eukaryotic cells
and mitochondrial FPGS activity is required for mitochondrial one carbon metabolism and
for a normal one carbon flux in the cytosol (unpublished data). Expression of the human
FPGS eDNA in AUXB 1 cells, Chinese hamster ovary (CHO) cell mutants that lack FPGS
activity9, restored cytosolic FPGS activity in these cells and overcame the cell's requirement
for thymidine and purines but the cells remained auxotrophic for glycine, reflecting the
absence of a folate pool in the mitochondria (Table 3). The 5' region of the human eDNA
prior to the first ATG codon would code for an amino acid sequence with homology to a
mitochondrial leader sequence (Figure 1), but lacking a start methionine. When an ATG
codon was introduced at the start of this region and the modified eDNA transfected into
AUXB 1 cells, transfectants expressed FPGS activity in the mitochondria and contained
normal mitochondrial folate pools (Table 3).
Table 3. Folate and FPGS distribution and glycine requirement in CHO AUXBl
transfectants
None No No No No Yes
human eDNA Yes No Yes No Yes
human cDNA(ATG) Nol Yes Yes Yes No
yeast gene Yes Yes Yes Yes No
1. proportion of cellular FPGS activity in cytosol similar to that of a mitochondrial matrix marker
+1
ATG .... G CGC GGC ATA ACG ACC CAG GTC GCG GCG CGG CGG GGC TTG
Met ..... Arg Gly Ile Thr Thr Gln Val Ala Ala Arg Arg Gly Leu
+71
AGC GCG TGG CCG GTG CCG CAG GAG CCG AGC ATG GAG TAC CAG GAT
Ser Ala Trp Pro Val Pro Gln Glu Pro Ser MET Glu Tyr Gln Asp
Figure 1. 5' Region of Human FPGS eDNA. The first ATG in the eDNA is shown in bold. The amino
acid sequence of the putative mitochondrial leader sequence is shown italicized.
631
Transfection of AUXB 1 cells with the yeast FPGS gene also restored mitochondrial and
cytosolic folate pools and FPGS activity (Table 3). Translation of the yeast gene from its first
ATG would generate a protein with an N terminal resembling a mitochondrial leader
sequence. Translation from a downstream ATG, preceded by concensus transcription and
translation signals, would result in a mature protein (Table 2) lacking a leader sequence.
Table 4 shows the effect of FPGS activity on the cellular accumulation of folinate and
methotrexate. When CHO cell transfectants were incubated with physiological levels of
folinate (2 nM), there was little effect of FPGS activity on folate accumulation in cells
expressing low to very high levels of human FPGS. At the lowest level of FPGS activity,
folinate accumulation was depressed somewhat. Under these conditions, folinate
accumulation is limited by influx and essentially all transported folate is metabolized to
polyglutamates and retained by the cell.
1. AUX-human-x are CHO cells expressing human FPGS activity, x representing percent activity relative
to wild type CHO cells.
632
Table 5. Effect of FPGS activity on sensitivity of cells to methotrexate
ED so
nM J1M
CHO--WT 3-10 10-33
HT1080 3-10 0.1-0.3
AUX-human-2 1-3 33-100
AUX-human-7 3-10 10-33
AUX-human-21 3-10 3-10
AUX-human-79 3-10 1-3
The catalytic mechanism and substrate binding specificity of E. coli DHFS•FPGS has
been investigated by affinity labelling of active site residues, stopped flow fluorescence,
rapid quench kinetics, isolation of reaction intermediates and by site-directed mutagenesis.
12000 r - - - - - - - - - - - - - - - - - w - - r - - - - - - ,
• H2Pte
--o-- H2Pte + Glu
ATP
8000
~a.
(.)
Pi
acyi-P
4000
H2Pte
~
0
0 10 20 30 40
fraction no.
Figure 2. HPLC separation of reaction intermediates. E. coli DHFS•FPGS (2iJ.M) was incubated with
dihydropteroate (10 j..lM) and [y_32p]ATP (10 j..lM) for 5 seconds and products were separated on a SAX
column.
633
The E. coli enzyme uses an unusual mechanism for increasing the affinity of the
dihydropteroate substrate for the DHFS reaction. The enzyme catalyzes the rapid formation
of a dihydropteroate quinonoid species. This species is highly fluorescent which has allowed
a rapid reaction kinetic analysis. The enzyme catalyzes the formation of an acyl-phosphate
intermediate. This intermediate slowly forms in the absence of the glutamate substrate but
glutamate binding, which causes a conformational change in the protein, accelerates acyl-
phosphate formation. The rate limiting steps in the overall DHFS reaction (kcat 0.35 sec-1 at
250) are acyl-phosphate formation (0.8 sec-1) and a conformational change in the protein
required before products can be released (1.2 sec-1).
The acyl phosphate intermediate, which forms slowly in the absence of glutamate, can be
isolated by HPLC using an anionic exchanger (Figure 2). The slow formation of this
intermediate, and its even slower conversion back to substrates, explains previous
observations that dihydropteroate is a non-competitive inhibitor of the FPGS reaction. These
studies were usually carried out with non-saturating levels of glutamate. The DHFS and
FPGS reactions are ordered, with ATP binding as the first substrate. Folates and
dihydropteroate do bind to free enzyme in a nonproductive fashion but have to be displaced
by ATP. This binding to free enzyme, and consequent competition with ATP, explains the
substrate inhibition observed with higher levels of some folate substrates.
ACKNOWLEDGEMENTS
Supported in part by PHS grants CA-41991 and DK-42033 from the Department of
Health and Human Services.
REFERENCES
634
INCREASED ACTIVITY OF 1-GLUTAMYL HYDROLASE IN HUMAN SARCOMA CELL. LINES:
A NOVEL MECHANISM OF INTRINSIC RESISTANCE TO METHOTREXATE (MTX)
INTRODUCTION
Intracellular levels of folate or methotrexate (MTX) polyglutamates
are regulated at least in part by the enzyme, folylpolyglutamate synthase
(FPGS), which is responsible for synthesis, and 1 -glutamate hydrolase
(GGH), which catalyzes the hydrolysis of polyglutamates to monoglutamate
forms. 1 Decreased accumulation of long chain polyglutamates of methotrexate
(MTX) may result from decreased FPGS activity or increased GGH activity.
Previous studies showed that natural resistance to MTX in soft tissue
sarcomas is associated with the inability of these cells to accumulate long
chain MTX polyglutamates after exposure to this drug. 2•3 As no appreciable
difference of FPGS activity was observed between MTX-resistant and
sensitive cells, we measured GGH activity in these cell lines and found
increased levels of this enzyme in MTX resistant soft tissue sarcoma cell
lines.
METHODS
Cell Lines
Human lymphoblastic leukemia cell line, CCRF-CEM, human lympho-
blastoid cell line, RPMI-1788, and 3 human soft tissue sarcoma cell lines,
HT-1080, HS-16, and HS-42, were studied. The cell lines were maintained in
RPMI-1640 medium containing 10% fetal bovine serum (FBS) as a cell
suspension (CEM and RPMI-1788) or monolayer culture (HT-1080, HS-16, and
HS-42). HS-16 and HS-42 cells are 7-, 13-, and 30-40-fold more resistant
to MTX (24h exposure) as compared to the MTX-sensitive lines, RPMI-1788 and
HT -1080. 3• 4
Analysis of Polyglutamate Formation
Cells were incubated in complete medium containing 10 ~M [3H] MTX at
37·C either for 24h or for 24h followed by 4-12h efflux in fresh drug-free
medium. Cells were harvested and suspended in 500 ~1 of boiling 50 mM
sodium phosphate, pH 5.5, boiled for 5 min., and centrifuged at 20,000 x
g for 10 min. Supernatant was analyzed by HPLC. MTX polyglutamate standards
were added to certify the radiolabeled peaks.
RESULTS
The accumulation of long chain MTX polyglutamates (3-6) of HS-16 and
HS-42 cells after exposure to MTX for 24h was much less compared to the
other 3 MTX-sensitive cell lines (Figure 1). After cells were resuspended
in drug-free medium for 4-12h, the level of polyglutamates in HT-1080 cells
decreased rapidly. MTX polyglutamates decreased in GEM cells but remained
high even after 12h of efflux, while the levels of long chain MTX
polyglutamates in the 1788 cell line did not decrease appreciably. The low
levels of MTX polyglutamates persisted in HS-16 and HS-42 cells and after
12h of efflux still had the lowest level of MTX polyglutamates as compared
to the other 3 cell lines. Increased GGH activity was observed at pH 4.5
in HS-16 cells than that in HT-1080, GEM, and RPMI-1788 cells (Figure 2).
There is a significant correlation (p < 0.05) between the increase of GGH
activity and the decreased retention of long chain polyglutamates of MTX
when cells {excluding HS-42 cells) were re-incubated in MTX-free medium for
4-8h. GGH activity measured in HS-42 cells was similar to that in MTX-
sensitive cells. Thus, other factors in addition to hydrolase activity are
important in regulating the level of intracellular polyglutamates. GGH from
all 5 cell lines appears to be an exopeptidase and is inhibited completely
by PHMB in vitro (data not shown).
DISCUSSION
In present study, increased GGH activity was observed in HS-16 cells
which is naturally resistant to MTX due to low levels of MTX polyglutamates
that accumulate in the cells. No significant increase of GGH activity was
observed in HS-42 cells although this cell line is also naturally resistant
to MTX. However, it is possible that GGH activity increases when cells are
exposed to MTX (unpublished data, references 6,7). Results from McCloskey
et al. 8 showed that long chain MTX polyglutamates were not accumulated in
a MTX-resistant cell line with too low FPGS activity. In contrast we
observed that tri-, tetra-, and pentaglutamates are still present in small
amounts in HS-16 and HS-42 cells. This result suggests that the reduced
intracellular levels of MTX polyglutamates that are formed in HS-16 and HS-
42 cells are most probably due to increased hydrolysis rather than
decreased synthesis since GGH exopeptidase can breakdown long chain
polyglutamates stepwise.
636
120 r-----------------------------~
wash
·~
100
·~
80
0~~
60
~CEM
-
E
....
0
01788
0
E
Q. 40
20
~0---L). 1080
Figure 1. Long chain MTX polyglutamates (3-6) retained in cells after a 24h incubation with 10 jt)4 3 H- MTX.
MTX polyglutamates were determined by HPLC (see Materials and Methods).
1 .4 .----------------------------------------------~
0.2
0 .0
Figure Z. GGH activity in extracts from 5 cell lines measured at pH 4.5 and 7.2.
637
Increased FPGH activity may be a novel mechanism of natural
resistance to MTX. We are testing other tumors in addition to human soft
tissue sarcoma cells intrinsically resistant to MTX for evidence of this
phenotype.
REFERENCES
1. J.R. Barruceco and F.M. Sirotnak, J. Biol. Chern. 266:11732-11737 (1991).
2. W.W. Li, J.T. Lin, W.P. Tong, T.M. Trippett, M.F. Brennan, and J.R.
Bertino, Cancer Res. 52:1434-1438 (1992).
3. W.W. Li, J.T. Lin, B.I. Schweitzer, W.P. Tong, D. Niedzwiecki, and J.R.
Bertino, Cancer Res. 52:3908-3913 (1992).
4. W.W. Li and J.R. Bertino, Cancer Res. 52:6866-6870 (1992).
5. L.L. Samuels, L.J. Goutas, D.G. Priest, J.R. Piper, and F.M. Sirotnak,
Cancer Res. 46:2230-2235 (1986).
6. E. Sikora, B. Kaninska, and B. Grzelakowska-Sztabert, Cell Biol. Intl.
Rep. 16:369-375 (1992).
7. P. Sur, D.G. Priest, and M.T. Doig, Biochem. Cell Biol. 64:363-367
(1986).
8. D.E. McCloskey, J.J. McGuire, C.A. Russell, B.G. Rowan, and J.R.
Bertino, J. Biol. Chern. 266:6181-6187 (1991).
638
MECHANISM-BASED APPROACHES TO INHffiiTION
OF THE SYNTHESIS AND DEGRADATION OF
FOLATE AND ANTIFOLATE POLYGLUTAMATES
Thomas I. Kalman
INTRODUCTION
Tetrahydrofolate and its one-carbon coenzyme derivatives undergo in the cell poly-
glutamylation, which is essential for their cellular retention and optimal enzymatic
activity. 1•2 The biolegical activity of glutamate-containing "classical" antifolates also
depends on the extent of their intracellular poly-y-glutamylation. Cells unable to
polyglutamylate these antifolates are resistant to the cytotoxicity of these drugs. While the
importance of polyglutamate chain length has been clearly demonstrated, the regulatory
role of the enzymes responsible for the synthesis and breakdown of the poly-y-glutamyl
chain, folylpolyglutamate synthetase (FPGS) and y-glutamyl hydrolase (GGH, conjugase),
respectively, is poorly understood. Complicating factors are the low rate of chain
elongation and shortening compared to other coenzyme metabolizing activities and the
tissue-to-tissue, cell-to-cell and subcellular variation of GGH activities associated with
different proteins. 1•2
0 COOH H
0 ~N~N~COOH
H,N~N"Y'~~ H 8"" COOH
A ..Jl) H
HN N N PteGlu
2 n+ 1
FPGS
PteGlu0 + ATP + Glu ----~ PteGlu0 +1 + ADP +Pi
GGH
PteGlun+ 1 + H20 ----~ PteGlllu + Glu
Selective inhibitors of FPGS and GGH can serve as biochemical tools helping to
elucidate the mechanism of the regulation of cellular polyglutamate turnover and may have
Our design strategy is based on the mechanistic similarity between FPGS and two
glutamate metabolizing enzymes: glutamine synthetase and y-glutamylcysteine synthetase. 3
The common mechanism involves ATP-mediated phosphorylation of the y-COOH group
to form a carboxylic-phosphoric mixed anhydride, which reacts with the nucleophilic N-
atom of the second substrate NH2R. The resulting tetrahedral intermediate collapses to
product and inorganic phosphate.
Many mechanism-based inhibitors of glutamine synthetase and y-glutamyl cysteine
synthetase are known. The extensively studied natural products methionine sulfoximine and
phosphinothricin and their derivatives are prototype inhibitors, which undergo enzymic
phophorylation resulting in tightly bound tetrahedral intermediate analogs. These
y-substituted glutamate analogs exert their inhibitory effect as "enzyme generated transition
state analogs" 4 or "reaction coordinate analogs". 5 Following these leads, we have
synthesized derivatives of folate, aminopterin and MTX, in which the glutamate is replaced
by S-alkylhomocysteine sulfoximines3 ' 6 and L-phosphinothricin, 7 structures 1 and 2,
respective! y:
While analog 1 had no effect on FPGS activity, analog 2 showed weak competitive
inhibition. There was no evidence for phosphorylation - preincubation of the enzyme with
ATP and 1 or 2 did not change the results. The inactivity of the sulfoximines 1 suggested
that no binding of these analogs to the active site of FPGS can occur. The inhibitory
activity of 2 was attributed to the presence of the negative charge on the y-substituent. This
640
charge effect is a general property of folate analogs, e.g., phosphonates and sulfonates can
be effective inhibitors of FPGS, 8 and even a negatively charged ring at this position, like
tetrazolate, binds to the enzyme. 9
It is surprising that no analog, in which the y-COOH has been replaced by another
functionality, could serve as an acceptor of phosphate from ATP in the FPGS reaction.
Coward's y-F-glutamate derivatives 10 having the y-COOH group intact, do serve as
substrates, but create obstacles to chain elongation. The planar tetrazole ring is both acidic
and nucleophilic, yet is incapable of attacking the P-atom. These observations indicate that
very significant differences must exist between the architecture of the active site of FPGS
and its mechanistic relatives glutamate and y-glutamylcysteine synthetase.
It is of interest to examine the geometric changes associated with the enzyme
catalyzed reaction. As outlined in Figure 1., there is no change in the sp2 hybridization at
the C-atom of the y-COOH during the phosphorylation step - the trigonal (planar)
geometry remains unchanged until the nucleophilic attack involved in amide bond
formation takes place.
0 0
I I
P-0 P-0
o/ 'o
0 ~ '0 RNH2
~0
ATP
0- ~0
NHR
tngonal tngonal tetrahedral
0
I
.P-0
0 NH ATP NIH 'o
I
yo
-.......;-s-R
'o
---\-· -.......;-s-R
'o
F 0
I
0 0 /P;-0
N-N ATP I 0
JN
N'
I
-.......;-P;-Me
0
---\-· -.......;-P;-~e
Figure 1. Geometric changes at the cS-carbon atom of the glutamate of folates leading to the tetrahedral
intermediate in the FPGS catalyzed reaction. The corresponding trigonal (planar) and tetrahedral
geometries of representative y-substituted folate analogs are represented for comparison.
There may be greater restrictions at the active site of FPGS than for the other two
enzymes and the tetrahedral geometry of some of the substrate analogs may not permit
productive attack on the y-phosphate of ATP during the phosphorylation step. Faithful
analogs of the tetrahedral intermediate, while potential tight-binding inhibitors, must
contain phosphates, phosphonates and related highly charged functionalities with the known
handicap of inefficient cellular penetration. 8
The inability to cross the cell membrane is also a serious problem with inhibitors of
GGH. There is a large variety of conjugase enzymes capable of hydrolyzing folate and
antifolate polyglutamates. The development of GGH inhibitors in our laboratory was based
on the assumption that an intracellular regulatory enzyme would show preference to
sequentially remove one glutamate at a time. Thus, we were targeting a C-terminal
glutamate-specific metallo(Zn)-carboxypeptidase. Based on the generally accepted
mechanism of the carboxypetidase catalyzed reaction, 5 a prototype inhibitor, 2-mercapto-
methylglutaric acid (MMGA) was designed. Although it is active against isolated enzymes
at submicromolar concentrations, it requires ~ 100 11-M for cellular activity .U Interaction
641
of its SH-group with the zinc at the active site of GGH is primarily responsible for the
inhibitory activity of MMGA, while the glutarate backbone provides selectivity for C-
terminal glutamate specific carboxypeptidases.
As an alternate approach, N-(benzylthiocarbamoyl)-L-glutamic acid and (BTGA) and
N-(benzylcarbamoyl)-L-glutamic acid (BCGA) were designed as potential reaction
coordinate analogs. Both inhibited carboxypeptidase G2 strongly - Ki-values for BTGA
and BCGA are 4.5 J1.M (competitive) and 0.12 J1.M (noncompetitive), respectively. The
inhibitory pattern of BCGA is consistent with the action of a reaction coordinate analog.
It is interesting that the sulfur-containing BTGA is less potent than the urea derivative
(BCGA). This may reflect a water promotion role for the zinc ion in carboxypeptidase G,
rather than carbonyl activation of the substrate by direct coordination to the carbonyl
oxygen of the scissile bond.
Whitehead et al. 11 reported previously on the effects of MMGA on the accumulation
and retention of methotrexate (MTX) polyglutamates in leukemia cells isolated from ALL
and AML patients. Since that time, cells of more patients were examined and the observed
characteristic difference between the two cell types was confirmed. Myeloblasts, which
accumulate shorter chain length MTX polyglutamates (triglutamate predominating) are
more effected by MMGA exposure than ALL cells, which tend to accumulate longer chains
(pentaglutamate predominating). In the presence of MMGA, AML cells change their
pattern of MTX polyglutamate distribution to resemble that of the ALL cells - greatly
increasing the MTX pentaglutamates at the expense of the MTX triglutamates. Figure 2.
illustrates this phenomenon by comparing the effects of MMGA on MTX polyglutamate
distribution during cellular uptake and during efflux. It should be pointed out that there are
considerable individual variations in these effects, therefore, it is important that the average
differences between the penta- vs. triglutamate values are statistically significant.
The data suggest that if the intrinsic resistance of AML to MTX is related to an
inability to accumulate longer chain MTX polyglutamates, than this resistance should be
reversible by pharmacologic modulation using GGH inhibitors in most of those cases which
are not the result of an FPGS defect.
NS <.02
n= 1 2 3 4 5 6 n= 1 2 3 4 5 6
MTX Glu ( n)
Figure 2. The effects of MMGA (100 J.JM) on the chain length distribution of MTX-polyglutamates in
myeloblasts of patients with acute myeloblastic leukemia (AML). The accumulation and retention of
I J.JM 3H-MTX expressed as the percent difference in the presence and absence of MMGA. Uptake
(8 patients) of 3H-MTX is during 0 - 24 hours, efflux (5 patients) represents values at the end of an
additional 24 hours incubation in the absence of 3H-MTX. (Data provided by V.M. Whitehead, Montreal
Children's Hospital, Montreal, Quebec).
642
It is important to note that natural resistance of human acute nonlymphocytic leukemia
associated with impaired MTX polyglutamylation was indeed described recently by Bertino
and coworkers. 12
ACKNOWLEDGMENT
This work was supported in part by grant CA35212 from the National Cancer
Institute, NIH, USPHS.
REFERENCES
1. J.J. McGuire and J.K. Coward, in: "Folates and Pterins," R.L. Blakley and S.J. Benkovic, Wiley,
New York (1984).
2. B. Shane, Vitamins Hormones 45:263 (1989).
3. R.G. Moran, P.D. Colman, P.J. Harvison and T.I. Kalman, Biochem. Pharmacal. 37:1997 (1988).
4. T.I. Kalman, Acta Pharm. Suecica, (Suppl. 2):297 (1985).
5. D.W. Christianson, W.N. Lipscomb, Accounts Chern. Res. 22:62 (1989).
6. P.J. Harvison and T.I.Kalman, J. Med. Chern. 35:1227 (1992).
7. T.I. Kalman, C.S. Jones and R.G. Moran, Proc. Amer. Assoc. Cancer Res. 31:337 (1990).
8. A. Rosowsky, R.A. Forsch, V.E. Reich, J.H. Freisheim and R.G. Moran, J. Med. Chern. 35:1578
(1992).
9. J.J. McGuire, C.A. Russel, W.A. Bolanowska, C.M. Freitag, C.S. Jones and T.I. Kalman, Cancer
Res. 50:1726 (1990).
10. J.J. McGuire and J.K. Coward, J. Biol. Chern. 260:6747 (1985).
11. V.M. Whitehead, T.I. Kalman, D.S. Rosenblatt, M.-J. Vuchich and C. Payment, Proc. Amer.
Assoc. Cancer Res. 29:287 (1988).
12. J.T. Lin, W.P. Tong, T.M. Trippett, D. Niedzwiecki, Y. Tao, C. Tan, P. Steinherz, B.I. Schweizer
and J.R. Bertino, Leuk. Res. 15:1191 (1991).
643
POLYGLUTAMATE PRODUCT FORMATION BY LACTOBACILLUS CASE/
FOLYLPOLYGLUTAMATE SYNTHETASE IN VITRO AND IN VIVO IN
RECOMBINANT ESCHERICHIA COLI
Department of Microbiology
University of Toronto
Toronto, Ontario, Canada M5S lAS
INTRODUCTION
The L. casei FPGS gene was expressed from the lac promoter of plasmid pGT3-
8.1 (2) in E. coli strain SF4, which is deficient in dihydrofolate synthetase-
folylpolyglutamate syntetase (3,4). The L. casei FPGS was purified from recombinant
E. coli as described previously (5) FPGS was assayed as described previously (6,7)
using 5, 10-methylene-H 4PteGlu 1_6 derivatives as substrates. F alate polyglutamates were
purchased from Schirks Laboratories and enzymatically reduced to tetrahydrofolate
derivatives using L. casei dihydrofolate reductase (provided by B. Shane). Folates were
labelled with 14C-glutamate (Amersham) in the in vitro reaction. Folate pools in
control and recombinant E. coli SF4 were labelled by growth in folate-free medium
supplemented with 14C-p-aminobenzoic acid (p-aba)(ICN). Cellular folates were
extracted and polyglutamate chain lengths were determined by the HPLC method of
Shane (8) using Partisil 10 SAX columns (Whatman). To determine y-glutamate
chain lengths, 14C-p-abaglu products were eluted from the HPLC, purified with C 18 Sep-
RESULTS
The amount of purified enzyme used was 10-fold higher than in the previously
reported in vitro experiments (1). The apparent activity with 5,10-methylene-H4PteGlu4
was 1% that of the monoglutamate, while activity with pentaglutamate and
hexaglutamate were 0.02% and 0.04% of monoglutamate values, respectively. To verify
that the products of the in vitro reaction were the H4 PteGlun+l derivatives, the products
were converted to p-abaGlun and subjected to HPLC analysis. Figure 1 shows that
the products with the tetraglutamate substrate gave equal-sized peaks which eluted
with the retention times corresponding to those of tetraglutamate and pentaglutamate.
The profiles obtained with the products of the reactions with pentaglutamate and
hexaglutamate substrates showed no H4PteGlun+l peaks but only shorter chain length
products corresponding to tri-, tetra- and pentaglutamates (not shown).
4,---------------------------------,
"' 3
I~
><
E pABA-5
C.2
(,)
..~\ .-....--v·
obL~~==~~--~~~~~~~~-L--~
~
0 10 20 30 40 50 60 70 80
Fractions
646
2000
A 56 7 9
1500-
~ 1000
u
~
500
0
__..,..!• \_
0 10 20 30 40 50 60 70 60 90
Fractions
500
B 7 8 9
400
300
E
Q.
u
ro w ~ ~ ~ ~ ro ~ ~
Fractions
4oo~c--------------~6~7~B~9~--------~
300
E
Q.
2oo
u
100
ro w ~ ~ ~ ~ ro ~ ~
Fractions
Figure 2. HPLC profiles of pabaGlun extracted from pGT3-8.1/SF4 cells. A, whole cell
extracts; B, p-abaGlu products eluted and purified with Sep-Pak C18; C, eluted
products from B treated with carboxypeptidase Y.
647
1400
A 3 4 5 6 7
1200
1000
800
E 800
Q
()
400
200
0
0 10 20 30 40 50 eo 70 80 90
Fractions
300
B 7 8
250
200
E
Q 150
()
10 20 30 40 50 60 70 80 90
Fractions
350.-c----------~~4
.-----------------.
300
250
200
E
c. 150
()
100
50
w w ~ ~ ~ ~ ro ~ ~
Fractions
Figure 3. HPLC profiles of pabaGlun extracted from SF4 cells. A, whole cell extracts;
B, p-abaGlu products eluted and purified with Sep-Pak Cl8; C, eluted products from
B treated with carboxypeptidase Y.
648
An in vivo system was developed to determine if the L. casei FPGS expressed
in E. coli was capable of generating long chain folate polyglutamates. The plasmid
pGT3-8.1 (2), which encodes the FPGS gene but not the downstream gene was
transformed into E. coli SF4. The transformants and control cells were grown with
radiolabelled p-aba, folates were extracted and polyglutamate chain lengths
determined by HPLC (Figures 2A and 3A). Radioactive peaks with retention times
from 40 to 72 min were observed with extracts from the pGT3-8.1/SF4 transformant.
Peaks eluting after 52 min are assumed to be longer chain lengths than
theheptaglutamate standard, suggesting that folate polyglutamates up to H 4PteGlu12
were synthesized with nonaglutamate and decaglutamate predominant (Figure 2A).
However long chain polyglutamates were also observed in the untransformed host
strain, although these products were of slightly shorter chain length, with
heptaglutamate predominant (Figure 3A). The amount of labelled folates in both
strains were comparable despite the high FPGS activity from the L. casei enzyme,
since this depended on the dihydrofolate synthetase activity of the mutant host strain.
These folates in E. coli were likely to be H 4Pte-y-Glu3-a-Glun as described by Ferone
et al. (9). Our ion exchange columns do not distinguish between y- and a-
polyglutamates, as do the reverse phase columns of Ferone et al. but the o:-linked
polyglutamates are suceptible to cleavage by carboxypeptidase Y (9). The longest
chain major p-abaGlu derivatives from the SF4 cells, hepta and octaglutamates, were
eluted, purified and digested with carboxypeptidase Y. The retention times were
shifted to those of tri- and tetraglutamates as a result of the carboxypeptidase Y
treatment (Figure 3C). In contrast, similarly treated derivatives from the transformant
containing the L. casei enzyme were resistant to carboxypeptidase Y treatment (Figure
2C), suggesting that they were y-linked polyglutamates. There was an increase in the
amount of hexaglutamate present after carboxypeptidase Y treatment, indicating that
the E. coli o:- FPGS did contribute to thelength of the polyglutamates and that that
enzyme can use y-glutamates longer than triglutamate as substrates.
DISCUSSION
The L. casei FPGS was shown to produce pentaglutamate products in vitro but
we found no evidence for longer chain products. This is in contrast to the E. coli
enzyme, which normally makes triglutamate products in vivo in cells containing normal
concentrations of enzyme but can produce hexaglutamates in vitro when high
concentrations of enzyme are used (R. Ferone, personal communication). Penta- and
hexa-y-glutamates were identified following extraction and carboxypeptidase Y
cleavage from E. coli cells transformed with pAC5, which overproduces the E. coli
FPGS 15-100-fold (10) (not shown). We have tried different reaction conditions,
including those which favour the E. coli o:-FPGS (9) but have produced no longer
chain product. The shorter chain products observed with the polyglutamate substrates
may be the result of elongation of shorter chain length polyglutamates present as
impurities in the substrate or produced by a hydrolase activity of the L. casei enzyme
or by a hydrolase contaminant in the extract. The amounts of these shorter chain
products found are < 0.5% of the substrate conversion observed with the
monoglutamate, suggesting that any putative hydrolysis is minor.
The in vivo experiments in recombinant E. coli show that the L. casei FPGS gene
alone is capable of generating the long chain polyglutamates observed in L. casei
extracts. If any accessory factor is required, which is not present in the in vitro
reaction, then the factor is also present in E. coli cells and is not specific to L. casei.
The product of the downstream gene found adjacent to the L. casei FPGS gene is not
649
involved in this elongation, since transformants containing plasmids which coexpress
both genes had no longer chain polyglutamates than transformants expressing only the
FPGS gene (not shown). The putative accessory factors may simply be other folate-
binding enzymes in the cell, although addition of crude extracts to purified enryme did
not increase the chain length of products formed in vitro.
Although its total folate pools are depleted, SF4 contains long chain
polyglutamates similar to those found in wild type E. coli cells (9). The y-linked
glutamates may be longer chain than in the wild type cells, since tetraglutamates were
observed in SF4 cells after carboxxypeptidase Y digestion, whereas only y-
triglutamates were observed in wild type cells (3,9). This may be due to the low
intracellular concentrations of folate monoglutamates, which would normally compete
with polyglutamates as substrates for the enzyme. The defect in the dihydrofolate
synthetase activity in this mutant appears to be more severe than in the FPGS activity
(11) allowing sufficient FPGS activity to produce longer chain products from the lower
folate pools. Alternatively, the carboxypeptidase cleavage may have been incomplete.
REFERENCES
650
DEVELOPMENT OF A SIMPLE FOLYLPOLYGLUTAMATE SYNTHETASE
INTRODUCTION
RESULTS
652
PEI-TLC; the use of the columns was however rather laborious and results were
variable. The above-mentioned TLC procedure yielded the best reproducible
results. Qualitative and quantitative verification of the formation of polyglutamate
was achieved by separation of the reaction with anion-exchange HPLC, a
procedure similar to quantify polyglutamates of MTX and 1O-ethyl-1 0-
deazaaminopterin {10-Edam). 12 This revealed a clear formation of the
diglutamate, but not of higher glutamates.
The final assay {as described in Materials and Methods) was subsequently
used to measure the FPGS activity in a number of different cell lines and tissues
{Table 1). As a control several tissues were included known to have either high
or low FPGS activities. Our data confirmed that livers had a higher FPGS activity
than gut mucosa or bone marrow cells. From the other tissues tested all colon
tumors had a high activity of FPGS, even higher than the liver. Various cell lines
with a different histological origin have been tested. A large range of FPGS
activity was observed.
Table 1. Activity of FPGS in normal and tumor tissues and cell lines.
Tissue Cell line Origin FPGS activity
(pmol diglutamate formed/hr/)
Liver Mouse 24 ± 5
Gut mucosa Mouse 7 ± 0.2
Colon 38 Murine colon tumor 28 ± 2
Colon 26 Murine colon tumor 52± 6
Colon 26-10 Murine colon tumor 48 ± 1
Bone marrow Mouse 35 ± 6
C26-10 Murine colon tumor 156 ± 28
C26-10/F** Murine colon tumor 567 ± 140
C38-1 murine colon tumor 82 ± 9
UM-SCC-118 Human SCC* 233 ± 23
UM-SCC-228 Human SCC 141 ± 41
UM-SCC-14C Human SCC 113 ± 7
HT 29 Human colon cancer 424 ± 18
WiDr Human colon cancer 178 ± 54
WiDr/F** Human colon cancer 413 ± 105
SW948 Human colon cancer 272 ± 33
CC531 Rat colon cancer 656 ± 43
Values are means ± SEM of 3-6 separate samples. C26-1 0 and C38-1 are cell lines derived
from the murine colon tumors Colon 26 and Colon 38, respectively. C26-10 was used for
establishment the tumor designated Colon 26-10.
*,sec, squamous cell carcinoma;**, cell lines derived from C26-10 and WiDr, respectively, but
adapted to growth in folate-depleted medium.
DISCUSSION
653
exchange TLC. Previously the same principle had been used to separate
nucleotides with a different charge. The data were confirmed using standard
HPLC separation of mono- and diglutamates. The appearance of the radioactivity
in the diglutamate demonstrated that not only a qualitative separation was
achieved with the TLC, but that the data could also be verified quantitatively. A
limitation of TLC assay is the limited loading capacity of the thin layers which we
used. This is especially a problem when samples with a low activity have to be
evaluated. However, the amount of radioactivity determined after elution of the
thin-layers was comparable to that used after quantification with columns. 8 The
TLC method enables to evaluate many samples (18 on one TLC sheet) in one
run.
The pattern of FPGS activity as observed in tissues is comparable to that
reported in literature1•2 with a low activity in bone marrow and gut mucosa and a
high activity in liver. The FPGS activity also agrees excellently with the pattern
reported previousll' 13 and with the accumulation of MTX and 10-Edam
polyglutamates in the squamous cell carcinoma celllines. 12 It should however be
noted that polyglutamate accumulation is also dependent on other factors than
the FPGS activity. These include not only the exposure time but also the
intracellular degradation catalyzed by e.g. folylpolyglutamate hydrolase.
Measurement of FPGS activity will enable to screen tumors for their capacity to
polyglutamylate antifolates. This is of particular interest because of the
development of a number of new antifolates, some being selected for their
polyglutamylation properties.
In conclusion, we established a new assay for FPGS enabling a rapid
measurement of the FPGS activity in cell lines and tissues. The results are
comparable to existing assays, but the analytical procedure is more easily to be
performed.
REFERENCES
1. B.A. Chabner, C.J. Allegra, G.A. Curt, N.J. Clendeninn, J. Baram, S. Koizumi, J.C. Drake, and
J. Jolivet, J. Clin. Invest. 76:907-912 (1985).
2. I. Fabre, G. Fabre, and I.D. Goldman, Cancer Res. 44:3190-3195 (1984).
3. R.G. Moran, P.O. Colman, and A. Rosowsky, NCI monographs 5:133-138 (1987).
4. H.M. Pinedo and G.J. Peters, J. C!in. Oncol. 6:1653-1664 (1988).
5. S. Radparvar, P.J. Houghton, and J.A. Houghton, Arch. Biochem. Biophys. 260:342-350
(1988).
6. G.J. Peters and C. van Groeningen, Ann. Oncol. 2:469-480 (1992).
7. B. Antonsson, J. Barreda, and R.G. Moran, Anal. Biochem. 186:8-13 (1990).
8. G. Jansen, J.H. Schornagel, I. Kathmann, G.R. Westerhof, G.-J. Hordijk, B.F.A.M. van der
Laan, Oncol. Res. 4:299-305 (1992).
9. J. Barreda and R.G. Moran, Mol. Pharmacal. 42:687-694 (1992).
10. D.E. McKioskey, J.J. McGuire, C.A. Russell, B.G. Rowan, J.R. Bertino, G. Pizzorno, and E.
Mini, J. Bioi. Chern. 266:6181-6187 (1991).
11. G.J. Peters, E.J. Laurensse, A. Leyva, and H.M. Pinedo, Clin. Chim. Acta 158:193-198
(1986).
12. B.J.M. Braakhuis, G. Jansen, and G.J. Peters, these proceedings.
13. B.F.A.M. van der Laan, G. Jansen, G.A.M. Kathmann, G.R. Westerhof, J.H. Schornagel, and
G.J. Hordijk, Int. J. Cancer 51:909-914 (1992).
654
TWO NOVEL HPLC METHODS WHICH RAPIDLY DETECT THE
SUBSTRATES AND CLEAVAGE PRODUCTS OF ')'-GLUTAMYL HYDROLASE
INTRODUCTION
growth of folate-requiring bacteria24 • The synthesis of [3' ,5', 7-3H]PteGlq, madr it possible
to detect 1'-glutamyl hydrolase cleavage products using paper chromatography or high-
voltage electrophoresis by analyzing the pteroyl-p-aminobenzoate portion of the reaction
products2•5 • Priest et al. 2•6 developed a sensitive method that measured -y-glutamyl hydrolase
activity using the product formed with 5, 1O-CH2H4PteGlu" in ternary complex with
[ 3H]FdUMP and l. casei thymidylate synthase. Reversed-phase HPLC was also used to
detect the pterin-containing products of hydrolysis7•8• An alternative way to detect the
cleaved products was to examine the glutamate released during the enzyme reaction.
Radiolabelled glutamate, which had been covalently linked to PteGlu by bacterial or
chemical synthesis, was used to detect free glutamate and poly--y-glutamate2•9-11 • While this
system is sensitive and accurate, the need to prepare specifically labelled folyl-[3H or 14C]-
-y-glutamyl substrates is complex and time-consuming. Ninhydrin or TNB (2,4,6-
trinitrobenzene sulfonic acid) was also used as a detection method for released glutamate2•
All of these assays can detect -y-glutamyl hydrolase cleavage products but, many are
limited by their slowness, expense, lack of sensitivity, or complexity of design2 •
Studies reported previously from this laboratory established for the first time that -y-
glutamyl hydrolase is extensively secreted by primary cultures of non-absorptive cells and
many transformed cell lines. During the purification of -y-glutamyl hydrolase secreted from
-y-Glu 1_5 were purchased from the Dr. B. Schircks Laboratories (Jona, Switzerland),
and all other chemicals were reagent grade. DABSGlun was synthesized by the method of
Chang et alY. -y-Glun (20 mg) in 2.5 mL of 0.2 M sodium bicarbonate buffer (pH 9.0)
was mixed with 4-dimethylamino-azo-benzenesulfonyl chloride (13 mg, Pierce) in 2.5 mL
of acetone. The mixture was incubated at 700C for 30 min, diluted with 7.5 mL water and
lyophilized. The product was purified by reversed-phase HPLC (Bakerbond C18 column,
1.5 x 30 em) using a gradient from 20% to 70 % acetonitrile in 50 mM ammonium acetate
buffer, pH 4.5. The DABSGlun was used as a substrate for -y-glutamyl hydrolase.
Pre-column derivatization using OPA was done by mixing 25 ~tL of reaction mixture,
12.5 ~tL methanol, and 12.5 ~tL OPA derivatization reagent for 1 min. The derivatization
reagent contained 5.0 mg OPA in 0.2 mL methanol, 1.8 mL 0.4 M sodium borate (pH
10.5), and 8 ~tL 2-mercaptoethanol. This reagent was made fresh daily. The sample was
then loaded onto a reversed-phase C18 HPLC column for separation and quantitation.
656
5 4 3 2
w
u
z
<(
m
0::::
0
(f)
m
<(
0 3 6 12 15
100
5 4 3 2
80
w
u
z
w 60
u OJ
(f)
w ~
0::::
0 40
::;
_j
LL
20
.............-······················
···················································································"' ........
.................... '- c__ ' - - L___ _ ___j L----~
0
0 5 10 15 20 25 30
657
detect poly--y-glutamates released from any substrate (MTXGlun, PteGlun, DABSGlUn,
PABAGlum -y-Glum etc.) and can be used with UV-absorption-HPLC to give a complete
description of the products of the hydrolytic reaction. In this manner, an accurate analysis
of the catalytic properties of -y-glutamyl hydrolase from any source can be made. Both
methods can be used together to measure DABSGlun and the poly--y-glutamates and
glutamate released from the DABSGlu substrate.
ACKNOWLEDGEMENTS
This work was supported by Grant CA25933 from the NCI/NIH. We acknowledge
the assistance of Dr. Robert A. Waniewski of the Wadsworth Center for Laboratories and
Research for his suggestions in the development of the OPA-derivatization assay.
REFERENCES
1. C.H. Halsted, Intestinal absorption of dietary folates, in: FOLIC ACID METABOLISM IN
HEALTH AND DISEASE, M.F. Picciano, E.L. Stokstad and J.F. Gregory III, eds. Wiley-Liss,
Inc., New York (1990).
2. J.J. McGuire and J.K. Coward, Pteroylpolyglutamates: biosynthesis, degradation, and function, in:
FOLATES AND PTERINS: VOLUME 1 CHEMISTRY AND BIOCHEMISTRY OF
FOLATES, R.L. Blakley and S.J. Benkovic, eds. John Wiley & Sons, Inc., New York (1984).
3. O.D. Bird, S.B. Binkley, E.S. Bloom, A.D. Emmett and J.J. Pfiffner, J.Biol.Chem. 157:413 (1945).
4. V. Mims, M.E. Swenseid and O.D. Bird, J.Biol.Chem. 170:367 (1947).
5. I.H. Rosenberg and H. Neumann, J.Biol.Chem. 249:5126 (1974).
6. D.G. Priest, C.D. Veronee, M. Mangum, J.M. Bednarek and M.T. Doig, Mol.Cell.Biochem.
43:81 (1982).
7. D.W. Fry, J.C. Yalowich and I.D. Goldman, J.Biol.Chem. 257:1890 (1982).
8. Z. Nimec and J. Galivan, Arch.Biochem.Biophys. 226:671 (1983).
9. C.L. Krumdieck and C.M. Baugh, Anal.Biochem. 35:123 (1970).
10. M. Silink, R. Reddel, M. Bethel and P.B. Rowe, J.Biol.Chem. 250:5982 (1975).
11. L.M. Kozloff and M. Lute, J. Virol. 40:645 (1981).
12. J.Y. Chang, R. Knecht and D.G. Brown, Methods Enzymol. 91:41 (1983).
13. D.C. Spink, J.W. Swann, O.C. Snead, R.A. Waniewski and D.L. Martin, Anal.Biochem. 158:79
(1986).
14. M.H. Fernstrom and J.D. Fernstrom, Life Sci. 29:2119 (1981).
15. S.S. Simons and D.F. Johnson, J. Org. Chern. 43:2886 (1978).
658
PURIFICATION AND GENERAL PROPERTIES OF HUMAN
FOLYLPOLYGLUTAMATE SYNTHETASE
INTRODUCTION
RESULTS
Figure 1 shows tl1e construction of pET3A-25, a plasmid designed for the expression of
FPGS in E. coli strain JM109(DE3). Plasmid pET3A-25 has the human FPGS eDNA
inserted between the bacteriophage T7 gene 10 promoter/ribosome binding site and
transcriptional termination sequences. JM109(DE3) is a lambda lysogen which has the
bacteriophage T7 RNA polymerase (gene 1) linked to the inducible lacUV5 promoter.
FPGS was purified by a combination of hydroxylapatite, Affigel blue, phenyl agarose,
heparin agarose, and DEAE cellulose chromatography. The preparation was judged to be
homogeneous by SDS-PAGE and had a Mr of -60,000 consistent with the molecular weight
predicted from tl1e deduced amino acid sequence.
Human FPGS had a pH optima of approximately 9.4, required a monovalent cation for
activity (Figure 2A), and used MgATP2 - as the nucleotide substrate (Figure 2B). Excess
Mg2+ or ATP inhibits enzyme activity. Potassium was tl1e preferred monovalent cation while
ammonium and rubidium stimulated activity to a lesser extent. Sodium or cesium were
unable to stimulate FPGS activity and all of the monovalent cations inhibited activity (45-
70%) when the standard assay mixture (20 mM K+) contained 200 mM of the desired
monovalent cation. Manganese was the only other divalent cation that stimulated FPGS
activity, supporting 13% of the activity obtained with magnesium (1 mM cation and 100 ~M
ATP), while no activity was observed with cobalt, calcium, or zinc. Human FPGS required
the presence of a reducing agent for activity. Half-maximal stimulation occurred at 0.48 mM
DTT or 5.5 mM BME. Maximal stimulation was obtained at 5 mM DTT or 50 mM BME and
the maximum activity obtained with BME was 90% of tl1at obtained with DTT.
ECORI
pSE936-25 pTZ18U-25
IOkbp 5039bp
lox
/
site-directed
mutagenesis
/
pTZ18U-25-
Ndel pET3A-25
504Ibp 6720bp
Figure 1. Construction of pET3A-25 from pSE936-25 for the expression of human FPGS in E. coli. The
EcoRI insert of pSE936-25 was subcloned into the phagemid pTZ 18U for the production of ssDNA used
in the mutagenesis protocol (Eckstein). The Ndel-BamHI fragment containing the entire ORF of the eDNA
was then subcloned into the expression vector pET3A.
660
100 100 B
75 75
~ ~
·::;: ·::;:
·.c ·.c
g 50 g 50
lf'
25
* 25
0 0
.1 1 10 1 00 .01 .1 1 10 100
!cation! mM LMg] mM
Figure 2. Effect of monovalent cations (panel A), and magnesium concentration on FPGS activity. Assay
conditions have been previously described 2.
The kinetic constants of folylmonoglutamates and analogs for human FPGS are shown
in Table 1. Enzyme activity was assayed using 1 mM ATP and 2 mM glutamate as the fixed
substrates and various concentrations of folylmonoglutamate or analog substrates. The
catalytic efficiency of the enzyme for dihydrofolate and aminopterin were higher and 10-
formyltetrahydrofolate was lower compared to the hog liver enzyme3,4.
PteGlu 60 59 2
H2PteGlu 0.9 101 225
(6RS)-H4PteGlu 2.0 100 100
(6R)-10-formyl-H4PteGlu 3.7 27 14
(6S)-5-formyl-H4PteGlu 105 99 2
(6S)-5-methyl-H4PteGlu 48 96 4
Aminopterin 4.4 136 62
Methotrexate 81 108 3
DISCUSSION
Human FPGS has been overexpressed in E. coli and the purified enzyme has general
and kinetic properties similar to hog liver FPGS2,3. A notable difference between the hog
and human enzymes are the reduced Km values for folic acid, aminopterin, and methotrexate,
and a higher Vmax for aminopterin3,4. The di- and triglutamates of methotrexate are also
better substrates (lower Km and higher Vm/Km) for the human than for the hog liver enzyme
(data not shown). Previous studies regarding the substrate kinetics of (6RS)-5-
formyltetrahydrofolate for human FPGS reported values significantly lower than we report
here (approximately an order of magnitude). This discrepancy may have been due to
661
metabolism of the 5-formyl compound into a derivative which has higher affinity for FPGS
since the former studies used relatively crude enzyme preparations.
ACKNOWLEDGEMENT
This research was supported in part by grant no. CA 41991 from the National Cancer
Institute, Department of Health and Human Services.
REFERENCES
1. T.A. Garrow, A. Admon, and B. Shane. 1992 Proc. Natl. Acail. Sci. USA 89: 9151.
2. D.J. Cichowicz and B. Shane.1977 Biochemistry 26: 504.
3. D.J. Cichowicz and B. Shane. 1987 Biochemistry 26: 513.
4. R.J. Coll, D. Cesar, J.B. Hynes, and B. Shane. 1991 Biochem. Pharmacal. 42: 833.
662
ANTITUMOR EFFICACY OF CLASSICAL NON-POLYGLUTAMYLATABLE
ANTIFOLATES THAT INHffiiT DffiYDROFOLATE REDUCTASE
INTRODUCTION
Leukemia
CCRF-CEM -7.57 -9.13 -9.16
HL-60 (TB) -7.48 <-10.0 -9.84
K-562 -7.6 <-10.0 <-10.0
MOLT-4 -7.59 -8.75 -9.03
SR -7.57 -9.6 -9.91
Non-Small Cell Lung Cancer
A549/ATCC -7.52 -8.88 -9.23
NCI-H322M -6.77 -8.14 >-6.0
NCI-H460 -7.54 -9.18
Small Cell Lung Cancer
DMS 114 -7.48 -7.92 -8.18
DMS 273 -7.51 -8.41 -9.19
Colon Cancer
DLD-1 -7.43 -8.88 -9.24
HCC-2998 -7.0 -8.71 -6.3
HCT-116 -7.54 -9.4 -9.61
HCT-15 -7.49 -9.21
HT-29 -7.43 -9.01 -8.89
SW-620 -7.51 -8.95
CNS Cancer
664
Table I. Continued
A 48 h continuous drug exposure protocol was used combined with an SR13 protein assay to estimate cell
growth or viability.
Table II. Relative efficacy of MTX and MEDAM on the survival of normal BD2F 1 mice
-------------------------------------------------------------1
Compound Dose/day MST Average wt Dose
(days) (GM) Schedule
Table ill. Relative efficacy of MTX and MEDAM on the survival of normal BD2F 1
mice on continuous infusion (SC) using osmotic pumps
Table IV. Relative efficacy of MTX and MEDAM on the survival of normal BD2F 1 mice
when administered orally
Compound Dose/day MST (days) Dose Schedule
~2/
H
H NJ:C?_JO)-cH2-
I@
R
I
0 -c-~-c--H
CH-
0
II
COOH
2 N N MDAM ,R = H H ) - COOH
MEDAM ,R = Et 2
665
Table V. Antitumor activity of MTX and MEDAM in mice bearing ip
implanted L1210 and P388 leukemia*
MST(days) %ILS
Control 14 14.5
MTX 5.0 19 20.5 33 41
MEDAM 15.0 19 25 33 72
• Time released pellets of MTX, and MEDAM were prepared by Innovative Research, Inc., Ohio. Each
pellet was designed to uniformly release the drug during a 15 day period. The following amounts of drug
was encapsulated in each pellet: MTX, 1.5 mg; MEDAM 4.5 mg and 9.0 mg. The pellet was surgically
inserted SC in animals 24 hours after tumor implantation.
1 A bolus ip injection of 100 mg/kg was given to all animals in the group 24 hours after tumor implantation.
ACKNOWLEDGEMENT
This investigation was supported by grants CA 27101 (MGN), CA 25933 (JG) and CA 43500 (JJM) from
the National Cancer Institute.
REFERENCES
1. A. Abraham, J.J. McGuire, J. Ga!ivan, Z. Nimec, R.L. Kisliuk, Y. Gaumont, and M.G. Nair, J. Med.
Chem. 34:222. (1991).
2. M.G. Nair, A. Abraham, U.S. Patent 4,996,207, (1991).
3. M.R. Boyd, in "Principles and Practice of Oncology" V.T. DeVita, Jr. S. Hellman, S.A. Rosenberg,
eds., Lippincot, Philadelphia, (1992).
4. R.W. Fuiier, J.H. Cardeilina, II, Y. Kato, L.S. Brinen, J. Clardy, K.M. Snader, and M.R. Boyd, J.
Med. Chem. 35:3007. (1992).
666
STUDIES ON THE CROSS RESISTANCE OF FOLYLPOLYGLUTAMATE
SYNTHETASE-DEFICIENT, METHOTREXATE-RESISTANT CCRF-CEM
HUMAN LEUKEMIA SUBLINES
INTRODUCTION
RESULTS
668
Table 1. Growth inhibition of CCRF-CEM, R3/7, and R30dm cell lines selected
agents during continuous (120 h) exposure.
DRUG EC~Values
CCRF-CEM R3/7 R30dm
MTX(nM) 15 15 18
TMTX(nM)a 2.3 n.d. 0.6
DMPDDF(nM) 17 40 225
ICI D1694 (nM) 3.5 3.9 17
BW1843U89 (nM) 0.6 1.0 1.1
Q-Orn (J..LM) 200 130 86
Actinomycin D (nM) 6 17 19 18
Adriamycin (nM) 6 28 44 50
Etoposide (nM) 6 580 2150 750
Vincristine (nM) 6 10 13 7
cisplatin (J..LM) 6 1.2 1.1 1.4
araC (nM) 6 22 56 80
6-MP (J..LM) 6 >100 >100 >100
5-FU (J..LM) 14.5 14 n.d. 12
5-FUdR (nM) 14.5 2.2 n.d. 8.1
i!This is EC70 value. R30dm plateaus in growth inhibition at about 50-60% inhibition
669
Table 3. Effect of exrosure time on potentiation by 20 11M LV of growth
inhibition by 5-FUdR o parental and FPGS-deficient CCRF-CEM cell lines.
120 1.2 0.29 4.1 2.9 0.56 5.2 3.8 0.63 6.0
24* 1.3 0.32 4.1 1.6 0.39 4.1 4.0 1.1 3.6
*LV was not added back to the cells after the wash at 24 h. This experiment was performed
separately from the other 24 h exposure experiments.
maximum level by 24 h. Maximum pool values were similar for cell lines, but
they appeared to increase slightly as a function of relative FPGS level. Each
pool remained elevated until the last time point (120 h); parental cell pools
were unchanged over this period while there appeared to be a slight decrease in
the pool of each FPGS-deficient line.
In summary, the drug responses of cell lines which are MIX-resistant
because of decreased FPGS activity have been determined. These lines are not
cross-resistant to many standard chemotherapeutic agents and regimens. In
particular, FPGS-deficient cells are sensitive to LV modulation of 5-FU and 5-
FUdR growth inhibition as long as the exposure interval is ;:::4 h. This result
also suggests that folylpolyglutamates may not be essential to promoting this
modulation; further studies of the polyglutamate chain lengths m treated cells
will be required to substantiate th1s suggestion. FPGS-deficient cell lines are
cross-resistant to antifolate agents that are dependent on polyglutamylation to
be "activated", such as ICI D1694. These results have implications for the
testing of these new inhibitors in clinical trials and in general clinical use in
patients who have failed MIX-based therapy. The observation that these lines
are collaterally sensitive to TMTX and an FPGS-specific inhibitor offers a lead to
the development of strategies for the selective eradication of this resistance
phenotype.
REFERENCES
1. G. Pizzorno; Mini, E.; Caronnelo, M.; McGuire, J. J.; Moroson, B. A.; Cashmore, A. R.; Dreyer, R.
N.; Lin, J. T.; Mazzei, T.; Periti, P.; Bertino, J. R. Cancer Res. 1988, 48, 2149.
2. D.E. McCloskey; McGuire, J. J.; Russell, C. A.; Rowan, B. G.; Bertino, J. R.; Pizzorno, G.; Mini, E.
f. Bioi. Chem. 1991, 266, 6181. , -
3. J.J. McGuire; Bolanowska, W. E.; Piper, J. R. Biochem. Pharmacal. 1988, 37, 3931.
4. S.D.Patil; Jones, C.; Nair, M.G.; Galivan, J.; Maley, F.; Kisliuk, R. L.; Gaumont, Y.; Ouch, D.;
Perone, R. J. Med. Chem. 1989, 32, 1284.
5. D.J. McNamara; Berman, E. M.; Fry, D. W.; Werbcl, L. M. f.Med. Chem. 1990,33, 2045.
6. A.L. Jackman; Taylor, G. A.; Gibson, W.; Kimbell, R.; Brown, M.; Calvert, A. H.; Judson, I. R.;
Hughes, L. R. Cancer Res. 1991, 51, 5579.
7. A. Romanini; Lin, J. T.; Niedzwiecki, D.; Bunni, M.; Priest, D. G.; Bertino, J. R. Cancer Res.
1991,51, 789.
670
VARIABLE PHARMACODYNAMICS OF ANTIFOLATES IN SQUAMOUS CELL
CARCINOMA OF THE HEAD AND NECK
INTRODUCTION
MTX and [3' ,5', 7,9-3H]-MTX (10 mCi/p.mol) were purchased from Lederle (Etten-Leur,
the Netherlands) and Amersham (Amersham, UK), respectively. 10-ethyl-10-deaza-aminopterin
(1 0-EdAM, Edatrexate) was a gift from Ciba-Geigy (Arnhem, the Netherlands). fH]-10-EdAM
was synthesized by Moravek Biochemicals (Brea, CA, USA) and was a gift from dr J. Jolivet,
Montreal, Canada. MTX-polyglutamate standards, GlucGlu5 , were purchased from B. Schircks
Laboratories (Jona, Switzerland).
HNSCC cell lines were obtained from dr T.E. Carey, Ann Arbor, MI, USA and are
When the experiments without a drug free period were analyzed, it was found that,
the IC50-values strongly depended on the time of exposure. For example, with respect to
MTX, IC50-values at 24 hr ranged from 2.9 (UM-SCC-14C) to over 10 t-tM (UM-SCC-22B
and UM-SCC-llB), but when exposed for 96 hr, IC50-values varied between 0.039 and 0.1
t-tM (Table 1). The minimal time to achieve significant growth inhibition varied between
the cell lines, less than 24 hr for UM-SCC-14C and over 24 hr and 48 hr for UM-SCC-llB
and UM-SCC-22B, respectively. 10-EdAM followed a similar sensitivity pattern with 5 to
20-fold lower IC50-values, confirming previous results. 10
The cell lines also varied with respect to growth behavior when cultured in drug free
medium for an additional period (Table 1). As for UM-SCC-14C, the MTX IC50-values did
not change after the additional drug free period of 24 or 48 hr, indicating that recovery has
taken place to a significant extent. When the drug remained present during the additional
period, growth inhibition continued: the IC50-values of 72 and 96 hr continuous exposure
were lower than the one corresponding to 48 hr exposure. Cells from the UM-SCC-llB
cell line showed a similar behavior as that of UM-SCC-14C, but UM-SCC-22B showed a
different pattern with a more continuous growth inhibition. With respect to this latter cell
line, after 48 hr the IC50-values decreased dramatically, when the cells were incubated in
drug free medium for an additional period. As for MTX, the IC50-values were almost independent
of the drug being absent or present.
This variable pattern of sensitivity was correlated with the capacity of the cells to form
polyglutamates. Polyglutamylation has been reported being important in the activity of MTX
in HNSCC cells. 5•11 Folylpolyglutamatesynthetase levels were 40.4 (UM-SCC-14C), 135.2
(UM-SCC-11 B) and 39.1 (UM-SCC-22B) pmol glutamate incorporated/hr/ 1ff' cells, as published
previously. 11 In addition, polyglutamated forms of both MTX and 10-EdAM were measured
672
Table 1. Pharmacodynamic profile of antifolates
Data are expressed as IC50 -values (~-tM), means of three separate experiments.
1Drug exposure time was 24 hr, extracellular concentration [3H]MTX: 50 ~-tM (specific activity:
100 cpm/pmol), extracellular concentration of PHJ-1 0-EdAM: 1~-tM (specific activity: 100 cpm/pmol).
Results are expressed as mean from 3 separate experiments. S.D. never exceeded 15% of the mean.
20ur highest glutamate standard during the HPLC analysis was MTX-GilJs. It is reasonable to assume
that the Glu5 fraction may also contain higher glutamate forms.
after 3 hr and 24 hr exposure to 50 and 1 ~tM, respectively, and an additional drug free period
of 24 hr after the three hr exposure period, was included (Table 2 shows the results of the
24 hr continuous exposure). After 24 hr exposure drug accumulation of 10-EdAM and MTX
was higher in the UM-SCC-llB and -22B cell lines than in the -14C cell line. In the UM-SCC-llB
and -22B lines the intracellular retention of 10-EdAM polyglutamates was higher than that
ofMTX, with predominant formation of the higher polyglutamates. This pattern, UM-SCC-14C
being impaired with respect to polyglutamylation, and 10-EdAM being superior with respect
to retention, could already be observed after 3 hr exposure. Additionally, after 3 hr exposure,
predominant polyglutamates (PG) in UM-SCC-llB were PG2 and PG3, and in UM-SCC-22B
more PG4 and PG5 were present (data not shown).
In conclusion, these experiments show that the pharmacodynamic profile varies between
HNSCC cell lines and plays a role in the growth inhibition by antifolates. Both exposure
time and the intrinsic capacity to synthesize polyglutamates are important determinants in
the sensitivity to antifolate drugs.
673
REFERENCES
674
METABOLISM OF FOLATE GLUT AMATES
IN ASPERGILLUS NIDULANS
INTRODUCTION
Folate polyglutamates of various glutamyl chain lengths represent active folate deri-
vatives involved in methionine, purine and thymidylate synthesis in all organisms. Fungi
possess a vitamin B12-independent methyltetrahydropteroiltriglutamate:homocysteine met-
hyltransferase [EC 2.1.1.14], which utilizes the triglutamate derivative of methyltetrahydro-
folate as a methyl donor. 1•2 Among fungi synthesis of folate polyglutamates has been
studied mostly in Neurospora crassa3A· 5 and yeast6.
We have previously observed that synthesis of a number of folate enzymes in Asper-
gillus nidulans is coordinately regulated. 7 It was therefore of interest to determine if this
is also true in the case of enzymes involved in the metabolism of folate polyglutamates,
namely polyglutamate synthetase (tetrahydrofolate:L-glutamate y-ligase (A TP-forming),
[EC 6.3.2.17]) andy-hydrolase (y-glutamyl hydrolase, [EC 3.4.22.12]), and whether the
levels of these enzymes affect the proportion of various folate polyglutamates in the cell.
The wild type strain and two methionine requiring mutants, methD and methH, of
A. nidulans were used in this study. Both mutants are leaky: the growth of methH is
stimulated only by methionine, while methD also grows on betaine. 9 Interestingly, these
two mutations seem to be allelic 9 (no wild-type recombinants among 4000 progeny scored
in the cross methH x methD). MethD but not methH was found to have an increased level
of methyltetrahydropteroiltriglutamate:homocysteine methyltransferase and betaine:homo-
cysteine methyltransferase as compared with the wild type strain. Both mutants exhibited
lower than wild-type levels of serine hydroxylmethyltransferase [EC 2.1.2.1]. 10 Evidently,
both mutations have pleiotropic metabolic effects.
The results shown in Table 1 indicate that the mutants possess a lower level of poly-
glutamate synthetase than the wild type. What is more interesting, however, methionine
in the growth medium brings the enzyme to the same repressed level in all three strains.
Besides this, homocysteine added to the growth medium induces (derepresses) the enzyme
over two-fold in the wild-type strain, while it has only a slight effect in the mutant strains.
This implies that synthesis of polyglutamate synthetase is repressed by methionine and
induced by homocysteine as was observed earlier for other folate enzymes,U and that the
latter regulation is impaired in the mutants.
The y-hydrolase activities in the studied strains are given in Table 2. These results
are preliminary, but it should be noted that a high level of the enzyme in the methD mutant
was observed repeatedly. We have found no effect of methionine in the growth medium
on the level of y-hydrolase. To our knowledge, this is the first demonstration of y-hydrolase
in fungi.
676
Table 3. In vivo glutamylation of methotrexate in the wild-type and two methionine-
requiring mutants of A. nidulans.
Acknowledgments
Supported by the State Commmittee for Scientific Research grant number 2231/4/91.
REFERENCES
1. E.G. Burton, J. Selhub and W. Sakami, Biochem. J. 111:795 (1969).
2. M. Flavin, in: "Metabolic Pathways", D.M. Greenberg, ed., Academic Press, New York, London (1980)
p. 457.
3. P.Y. Chan and E.A. Cossins, Arch. Biochem. Biophys. 200:346 (1980).
4. E.A. Cossins and P.Y. Chan, in: "Folyl- and Antifolyl Polyglutamates", I.D. Goldman, B.A. Chabner and
J.R. Bertino, eds., Plenum Press, New York and London (1985) p.183.
5. P.Y. Chan, I.J. Atkinson, F.E. Nargang and E.A. Cossins, in: "Chemistry and Biology of Pteridines"
H-Ch. Curtius, S. Ghisla and N. Blau, eds., Walter de Gruyter, Berlin, (1990) p.926.
6. R. Bossett, D.G. Weir and J.M. Scott, J. Gen. Microbial. 93:169 (1976).
7. J. Nadolska-Lutyk, M. Balinska and A. Paszewski, Eur. J. Biochem. 181:231 (1989).
8. A. Paszewski and J. Grabski, J. Bacterial. 124:893 (1975).
9. A.J. Clutlerbuck, Fungal Genetics News Letters 34:27 (1987).
10. M. Balinska and A. Paszewski, Biochem. Biophys. Res. Commun. 91:1095 (1979).
11. R. Natorff, M. Balinska and A. Paszewski, Mol. Gen. Genet. (in press) (1993).
12. J.J. McGuire, P. Hsieh, J.K. Coward and J.R. Bertino, J. Bioi. Chern. 255:5776 (1980).
13. E. Sikora, L. Krzyzanowski and B. Rzeszotarska, J. Chromatogr. 422:420 (1988).
14. M. Balinska, J. Galivan and J.K. Coward, Cancer Res. 41:2751 (1981).
677
EVIDENCE THAT 5-FORMYLTETRAHYDROPTEROYLGLUTAMATE HAS
A METABOLIC ROLE IN ONE-CARBON METABOLISM
INTRODUCTION
The metabolic function of 5-formyltetrahydrofolate and its polyglutamate forms
(If4PteGlun) have not been elucidated. There are no known biosynthetic reactions in which it
serves as the one-carbon donor, and until recently only a single enzyme was known to use
this folate derivative as a substrate. Methenyltetrahydrofolate synthetase catalyzes the
conversion of 5-CHO-H4PteGlun to 5,10-CH+-If4PteGlun as shown in Equation 1.1,2 This
irreversible reaction was considered a salvage pathway for the reincorporation of one-carbon
units into those folate derivatives active in biosynthetic reactions. In 1984, when
methenyltetrahydrofolate synthetase was first purified to homogeneity from eucaryotic and
procaryotic sources, it was not established that 5-CHO-H4PteGlun was a normal metabolite
of the cell. Some believed that 5-CHO-If4PteGlun was an artifact of isolation, but this did
not explain the existence of an enzyme that utilized it as a substrate. Since that time the
presence of 5-CHO-H4PteGlun in cells has been firmly established, and methenyl-
tetrahydrofolate activity has been shown to be present in a wide variety of cells.3,4
The origin of 5-CHO-If4PteGlun in cells could be accounted for by the nonenzymatic
hydrolysis of 5,10-CH+-H4PteGlun to 5-CHO-If4PteGlun.5 However, the preferred
pathway for the hydrolysis of 5,10-CH+If4PteGlun is to form 10-CHO-If4PteGlun. Also, at
the pH of cell, the concentration of 5,10-CH+-H4PteGlun must be very small because it is in
rapid equilibrium with 10-CHO-If4PteGlun. The equilibrium for this reaction lies far toward
10-CHO-H4PteGlun at pH values above 7. If the nonenzymatic formation of 5-CHO-
H4PteGlun is slow and the cell has methenyltetrahydrofolate synthetase activity, it is difficult
to explain why there is any 5-CHO-H4PteGlun in vivo. This enigma suggested that there
was another source of 5-CHO-If4PteGlun in the cell. This view was further supported by
the observations of several investigators that in seeds and spores the predominate folate was
5-CHO-If4PteGlun.3
In 1952 Kisliuk and Sakami6 showed that rat liver slices converted [14C]formate to serine
when glucose 6-phosphate was included in the medium. However, when the glucose 6-
phosphate was omitted, it appeared that the formate was converted to 5-CHO-If4PteGlun. In
our study of the conversion of serine to formate by the coupled reactions of serine
Eucaryotic cells that have been studied with respect to SHMT have both cytosolic and
mitochondrial isoenzymes.9 The role of the cytosolic enzyme is to supply one-carbon units
for three major biosynthetic pathways. These are purine ring biosynthesis, thymidylate
biosynthesis, and methionine biosynthesis. In addition, methionine is the major methyl
donor for a host of methylation reactions through its derivative S-adenosyl methionine.
Carbon-3 of serine has been shown to supply as much as 70% of these one-carbon units.
The role of the mitochondrial isoenzyme of SHMT is less clear. In this organelle there are
folate enzymes for oxidizing methyl groups to formate and COz. Serine and glycine can pass
through the mitochondrial membrane as can formate. At this time it is not clear whether
mitochondrial SHMT functions in the metabolism of serine by converting it to glycine, or if it
supplies serine for the cytosol by converting glycine to serine. ApplinglO has an extensive
review on this subject.
In procaryotes, SHMT plays a role similar to the one in the cytosol of eucaryotes. The
enzymes involved in the biosynthesis of purines, thymidylate, and methionine are present in
bacteria and appear, for the most part, to be related to the eucaryotic enzymes. 5,10-CHz-
R4PteGlun serves as the principle one-carbon donor in bacteria with SHMT being the major
source of S,lO-CHz-H4PteGlun.
680
CHO-H4PteGlun compared to the wild type strain. Hopefully, future studies will focus on
the problem of the relationship of SHMT and 5-CHO-H4PteGlun levels in mutant strains of
eucaryotic organisms.
The assay for the SHMT catalysis of Reaction 2 took advantage of a previous
observation that SHMT forms a ternary complex with glycine and several folate compounds
that absorb near 500 nm.ll Glycine forms an external aldimine with the enzyme bound
pyridoxal phosphate which is converted to a quinonoid complex when either S-CHO-
H4PteGlun, S-CH3-H4PteGlun, or H4PteGlun are bound. In the quinonoid complex the
glycine has lost it pro-2S proton. The apparent molar absorbtivity coefficient for these
ternary complexes is about 40,000 M-1cm-1. The assay for Reaction 2 is to incubate SHMT
with 50 mM glycine and 5,10-CH+-H4PteGlun and to monitor the increase in absorbance at
502 nm, where the SHMT•Gly•S-CHO-H4PteGlun ternary complex absorbs. In this assay
the concentration of SHMT is in the 11M range and the absorbance changes are in the 0.02 to
0.2 range.
The first observation in this assay was that a burst of absorbance at 502 nm was followed
by a slower steady-state rate. This burst could be evidence of two forms of SHMT, one that
catalyzed a rapid formation of S-CHO-H4PteGlun until it became inhibited by its own
product, and another form of SHMT that catalyzed a slower formation of 5-CHO-
H4PteGlun. By raising the concentration of SHMT in these studies one should observe only
the rapid phase. However, the ratio of the amplitudes of the burst and slow phases remained
essentially constant, even when the SHMT concentration was in excess of the concentration
of 5,10-CH+-H4PteGlun. This suggested that the burst was not due to two forms of SHMT,
but rather two forms of the substrate 5,10-CH+-H4PteGlun. Comparison of the amplitudes
for the burst and slow phases showed that the stock 5,10-CH+-H4PteGlun contained about
20% of a compound which was converted to S-CHO-H4PteGlun much faster than 5,10-
CH+-H4PteGlun. The putative structure of this compound will be described in the following
paragraphs.
As noted above, the assay for SHMT catalysis of the reaction shown in Equ. 2 had
glycine in addition to SHMT. In experiments where the glycine was omitted it was observed
that S,lO-CH+-H4PteGlun was not converted to 5-CHO-H4PteGlun by SHMT. Serine or L-
alanine could not substitute for glycine, but D-alanine could serve as a substitute. Glycine
and D-alanine share the property that both have an alpha proton that is transferred to a base
on the enzyme to form the quinonoid complex. The results suggest that this proton plays
some role in the catalysis of Reaction 2.12 The Km and kcat for the SHMT catalysis of the
monoglutamate form of 5,10-CH+-H4PteGlun to S-CHO-H4PteGlun are 0.14 mM and 1 x
I0-4 s-1, respectively (Table I).
In the assay of the SHMT catalysis of 5-CHO-H4PteGlun, it became apparent that the
polyglutamate forms of the product were effective inhibitors. Interaction of 5-CHO-
H4PteGlun polyglutamates with SHMT was investigated to characterize this inhibition. The
assay determined the rate of increase in absorbance at 502 nm in the formation of the SHMT•
Gly •S-CHO-H4PteGlun ternary complex. Reaction with the monoglutamate form was
observed to give biphasic kinetics with the slow phase having a t112 of about 2 s. A study of
the relative amplitudes and the rate constants for the fast and slow phases confirmed that the
fast phase was the result of only one of two rotamers binding to SHMT, and the slow phase
was the nonenzymatic interconversion of the two rotamers. The rotamer which binds to
SHMT has the formyl oxygen facing away from the C4 keto group of the pteridine ring
(Figure 1).13
The triglutamate form of the coenzyme was found to bind slowly to SHMT with a t112 of
about 15 s. The off-rate of the triglutamate form was determined and found also to be 15 s.
Kct values for the monoglutamate and triglutamate forms of S-CHO-H4PteGlun are 10 and
0.2 11M, respectively, with the rabbit cytosolic enzyme.
681
THE NONENZYMATIC FORMATION OF S-CHO-H4PTEGLU 0
0
II
"'r'ii)~~ . o~
c
I
~H,
CH 2
r~~c
NH·CH
i:.oH
II
0
Enol Form of Rotamer I .. / " 30%
0 H
tt 0
y
'"(11:)~~""0'
I
9H2
CH 2
~II
NH·CH
g i:.oH
c II
0
Enol Form of Rotamer II / " • 70%
H 0
Figure 1. The enol form of the two rotamers of S-CHO-H4PteGlun. The rate of interconversion of the
rotamer exhibits a tl/2 of about 2 s. Only rotamer II binds tightly to SHMT.
682
THE MECHANISM OF THE SHMT HYDROLYSIS OF CH+-H4PTEGLU 0
The next question addressed was whether the mechanism of the SHMT catalysis of 5,10-
CH+-H4PteGlun to S-CHO-H4PteGlun was related to the nonenzymatic mechanism as
shown by Reactions A, D, and E in Figure 2. A key experiment was to determine if the
SHMT catalysis of Reaction 2 results in exchange of the Cl Lproton, as demanded by this
pathway, as opposed to the previously proposed pathway of Reactions A and C.12 The
experimental results confirmed that the SHMT catalysis of Reaction 2 results in complete loss
of the ClLproton ofCH+-B4PteGlun.
The natural folate substrate for SHMT is S,lO-CH2-H4PteGlun, where the one-
carbon group is at the oxidation level of formaldehyde, while in Equ. 2 the one-carbon group
is at the oxidation level of formate. In a comparison of the proposed mechanisms for the
catalysis of Reactions 1 and 2 a striking similarity was observed. In each mechanism there is
a hydration of a carbon-nitrogen double bond, an inversion of the attacking water adduct
oxygen from below the plane of the pteridine ring to above the pteridine ring, and elimination
of NlO. This similarity of mechanisms helps support the conclusion that the SHMT catalysis
of the reaction shown in Equ. 2 occurs by the same mechanism proposed for the
nonenzymatic reaction as shown in Figure 2.
"'h,~
N
H
N
I
//c,
0 H
10-CHO-H4 PteGiu 0
Figure 2. The proposed mechanism for the interconversion of formylfolates. Reactions A, B, and C are
the accepted pathway for the interconversion of 5-CHO-lf4PteGlun lO-CHO-H4PteGlun and 5,10-CH+-
H4PteGlun. Reactions A, D, and E are the proposed pathway for both'the nonenzymatic and SHMT catalyzed
formation of 5-CHO-lf4PteGlun from 5, 10-CH+-lf4PteGiun
683
A study of the role of the polyglutamate forms of 5,10-CH+-H4PteGlun suggests that the
high Km value for the mono glutamate form of the substrate and its low concentration in the
cell make it a poor candidate for an important physiological role. However, the Km for the
tetraglutamate of 5,10-CHOH-fl4PteGlun is below 0.5J.1M, suggesting that the polyglutamyl
forms could be the true substrates for SHMT. Although the nonenzymatic mechanism is
suggested to be the origin of the putative (llR) 5,10-CHOH-f4PteGlun, it can not be ruled
out that there is an enzyme which catalyzes its formation in vivo from 5,10-CH+-f4PteGlun.
Even if you assume that the true substrate is the hydroxymethylene derivative of
tetrahydrofolate, it appears that the reaction catalyzed by SHMT may be too slow to account
for the 5-CHO-I4PteGlun found in the cell (Table 1). However, there are two observations
which may negate the apparent slow rate of catalysis of the reaction shown in Equ. 2. First,
in liver cells the concentration of SHMT is greater then the pool of 5-CHO-fl4PteGlun. This
suggests that only a single turnover of SHMT could account for all of the cellular 5-CHO-
fl4PteGlun. Second, the tight binding properties of the product suggests that in the cell the 5-
C H 0- H 4PteG 1un is bound to SHMT and is not available as a substrate for
methenyltetrahydrofolate synthetase.
~
H4PteG1un H2PteG1un
ser B JLThymidylate
gly gly
ser
V
ser H4PteGiun
Purines
Figure 3. Metabolic cycles of one-carbon metabolism in procaryotes and the cytosol of eucaryotes. Cycle
A is methionine biosynthesis and the origin of S-adenosylmethionine used for many methylation reactions.
Cycle B is thymidylate biosynthesis. Cycle C is the biosynthesis of the purine ring. Cycle D is a putative
futile cycle involved in regulating one-carbon metabolism by controlling the in vivo level of 5-CHO-
H4PteGlun
684
In addition to AICAR formyltransferase other enzymes have been found to be inhibited by
5-CHO-H4PteGlun. These include sarcosine dehydrogenase, dimethylglycine
dehydrogenase, methionyl-tRNA formyltransferase, 5,10-methenyltetrahydrofolate
cyclohydrolase, 5,10-methylenetetrahydrofolate dehydrogenase, and dihydrofolate reductase
(see references in 12). Of particular importance is the observation that methionyl-tRNA
formyltransferase is inhibited by 5-CHO-H4PteGlun. This enzyme is important in the
regulation and expression of proteins, and it has been suggested that the level of folates in the
cell may regulate this enzyme activity.17 There has not been a systematic study of the effect
of 5-CHO-H4PteGlun polyglutamates on other folate enzymes. We propose that this is an
area that needs further study.
The existence of futile cycleD (Fig. 3) and its role in regulating one-carbon metabolism
is our current research focus. Previous studies have shown that in seeds and spores the
principle folate is 5-CHO-H4PteGlun. This would be consistent with the stability of this
compound to high temperature, alkaline pH, and oxygen. However, because it is not a
donor in any one-carbon biosynthetic reactions, this compound must first be converted back
to 5,10-CH+-H4PteGlun by methenyltetrahydrofolate synthetase. An organism that has to go
from a vegetative state to a dormant state, such as a spore, may use futile cycle D shown in
Figure 3 as the mechanism for storing its folate and one-carbon groups.
An ideal organism to test the putative role of CycleD (Fig. 3) is Neurospora crassa. This
organism has a well-defined life cycle which includes a spore stage. It grows rapidly on
simple media and can be manipulated genetically. We have shown that 5-CHO-R4PteGlun is
the major folate in the spore. We have also purified cytosolic SHMT from this organism and
shown that it exhibits all the properties previously found for both the rabbit liver isoenzymes
and the E. coli enzyme. The most important of these properties is the ability to catalyze the
hydrolysis of 5,10-CH+-H4PteGlun to 5-CHO-H4PteGlun (Equation 2) and that 5-CHO-
R4PteGlun polyglutamates are slow tight binding inhibitors. In addition, we have found that
the N. crassa enzyme is stabilized against high temperature denaturation by forming a
complex with glycine and 5-CHO-R4PteGlun polyglutamates. Future studies will determine
the role of cycle D during spore formation and regeneration to the mycelia state.
ACKNOWLEDGMENTS
This work was supported by Grant GM 28143 from the National Institutes of Health.
REFERENCES
685
COBALAMIN-DEPENDENT AND COBALAMIN-INDEPENDENT
INTRODUCTION
Two genes encoding proteins with methionine synthase activity are found in Escherichia
coli. Both enzymes use methyltetrahydrofolate as a methyl donor to catalyze the conversion
of homocysteine to methionine, as shown below:
The metH gene encodes a cobalamin-dependent methionine synthase (MetH). This protein is
monomeric, with a deduced molecular weight of 136,055.1 It can use CH3-l4PteGlu1 as a
substrate, and requires a reducing system and AdoMet for activation.2,3 The metE gene
encodes a cobalamin-independent methionine synthase that requires methyltetrahydrofolate
substrates with at least two glutamyl residues and is completely inactive with
CH3-H4PteGlu1.4 This enzyme shows no requirement for reductive activation, but does
require phosphate ion and magnesium for optimal rates of catalysis.5 It has a deduced
molecular weight of 84,654,6 in good agreement with the value of 84,000 obtained by
ultracentrifugation of the native enzyme.5 Both the metH 1,7,8 and metE 6,9genes have been
sequenced, and their coding sequences show no detectable homologies. Thus these two
proteins appear to have evolved independently to perform highly similar methyl transfers
from N5 of methyltetrahydrofolate to the sulfur of homocysteine.
The catalytic cycle of MetH is diagrammed on the next page. During turnover, enzyme-
bound cobalamin shuttles between methylcobalamin and cob(I)alamin forms, alternately
accepting a methyl group from methyltetrahydrofolate and donating it to homocysteine.
Occasionally, the cob(I)alamin prosthetic group is oxidized to form cob(II)alamin, and this
form of the enzyme is inactive. Return of the enzyme to the catalytic cycle requires a
o ,
..........................................
'
''
-1 e·
US--<:o(l) ~
CH 3 -H4 Folat
MS-co(ll)
0
+Ado Met
'L ................................... ..
Our studies have shown that the native 136 kDa MetH enzyme can be cleaved by trypsin
into two fragments, a 98 kDa N-terminal fragment with the cobalamin prosthetic group
noncovalently bound to it that extends from amino acid residues 1-896, and a 37 kDa C-
terminal domain extending from residues 900 to 1227.11 The linker region between these
two fragments contains multiple basic residues and is hypersensitive to cleavage by trypsin,
which cleaves at two closely spaced sites in this region. The location of these domains in the
primary amino acid sequence of the monomeric MetH protein is shown below. If the
prosthetic group is methylated prior to cleavage with trypsin, the isolated 98 kDa fragment is
70.4kDa 37.2kDa
Figure 2. Location of functional domains within the primary amino acid sequence of cobalamin-dependent
methionine synthase.
able to catalyze the methyl transfer from CH3-l4PteGlu1 to homocysteine under anaerobic
conditions. However, enzyme slowly accumulates in the cob(II)alamin form, and can no
longer be activated in the presence of AdoMet and a reducing system. The cobalamin
prosthetic group is bound to a 28 kDa domain that forms the C-terrninal portion of the 98 kDa
fragment. This domain is shaded in the diagram above. The 28 kDa cobalamin binding
domain can be isolated in good yield by more drastic treatment of the native enzyme with
trypsin. This domain is catalytically inactive, but retains noncovalently bound cobalamin. 1
Determination of the x-ray structure of this domain is now in progress.12 The C-terminal
domain is radioactively labeled on irradiation with ultraviolet light in the presence of
[3H-methyl]AdoMet,l and appears to contain the determinants necessary for AdoMet
688
binding. This domain has recently been crystallized by Melinda Dixon in Martha Ludwig's
laboratory. Our results suggest a division of labor between theN- and C-terminal portions of
the protein, with the C-terminal domain required for catalysis of the reductive methyl transfer
from AdoMet to cobalamin, and the N-terminal region required for methyl transfer to
cobalamin and from methylcobalamin to homocysteine.
Each of the methyl transfers catalyzed by MetH is thought to proceed by a bimolecular
nucleophilic displacement (SN2), and thus places severe geometric constraints on the
positioning of the methyl donating or accepting substrate with respect to the cobalamin. In
fact, at different times in the catalytic cycle, methionine, methyltetrahydrofolate and AdoMet
must each place their methyl group in exactly the same position in space, positioned
immediately above the cobalt of cobalamin. We postulate that the unusually large size of this
polypeptide may reflect this necessity to bring each substrate in turn into position for methyl
transfer to or from the cobalamin.
Met H shares the requirement for a reductive activation that involves cleavage of Ado Met
with two other E. coli proteins, pyruvate formate-lyase and the anaerobic ribonucleotide
reductase. In each case, electrons are supplied by NADPH and the electron transfer
associated with activation is mediated by flavodoxin )F protein) and an NADPH-flavodoxin
oxidoreductase (R protein)_l3,14 Both the F protein 5 and the R proteinl6 have now been
cloned and mapped in E. coli. The MetH enzyme activation by AdoMet and the RIF/NADPH
reducing system shows interesting similarities and differences when compared with the
activation of pyruvate formate-lyase and the anaerobic ribonucleotide reductase. In the latter
two cases activation is thought to involve the reductive cleavage of AdoMet to form
5'-deoxyadenosine and methionine, with concomitant formation of a glycyl radical on the
activated protein.l7 ,18,19 While AdoMet serves the function of a radical generator in
Our recent investigations of the mode of inactivation of MetH by nitrous oxide have
provided evidence for a close contact between residue 1177 near the C-terminus of the 37
kDa domain and the cobalamin prosthetic group (Drummond and Matthews, manuscript in
preparation). Our evidence is consistent with the postulate23 that nitrous oxide (N20) is
reduced by enzyme in the cob(I)alamin form, with concomitant generation of N2 and
hydroxyl radical, according to the formula shown below:
Our evidence suggests that hydroxyl radical, generated at the active site of the enzyme, reacts
by a regiospecific hydrogen atom abstraction from Val1177 in the C-terminal domain,
689
although we have not yet characterized the structure of the valyl adduct. These results suggest
that, at some stage in the catalytic cycle of MetH, Val1177 lies very close in space to the
cobalamin prosthetic group in the 28 kDa domain This valyl residue is embedded in a
sequence, VSGWYxxxxPD, with resemblance to the sequences surrounding the glycyl
radicals generated by activation of pyruvate formate-lyase and the anaerobic ribonucleotide
reductase. Our future efforts will be focused on characterizing the chemistry of the reductive
activation of MetH, and exploring the differences and similarities with the reductive
activations of pyruvate formate-lyase and anaerobic ribonucleotide reductase.
The native MetE enzyme can be cleaved by trypsin into two fragments of approximately
equal size. This cleavage is associated with an approximately two-fold decrease in activity.
Examination of the deduced amino acid sequence of the protein provides clear indication of a
two-domain structure in which the two domains are clearly related in sequence and may well
have evolved through a gene duplication event. The two domains do not appear to function
equivalently in catalysis, however, since alkylation of Cys726, in the C-terminal domain,
results in loss of all detectable enzyme activity.6
Met E was initially purified to homogeneity by a procedure that involved crystallization as
the final step. 5 Although it was not determined whether these crystals diffracted, there is the
reasonable possibility that the availability of an efficient expression system for recombinant
MetE9 may permit the determination of the x-ray structure of this protein, and eventually a
comparison of the structure with that of domains of the MetH protein.
If the chemistry of the MetH reaction remains obscure, the chemistry of the MetE reaction
is downright mystifying. While the stereochemistry of the methyl transfer from CH3-
H4PteGlu 1 to homocysteine in the MetH reaction is known to proceed with retention at the
transferred methyl group,24 the stereochemistry of the methyl transfer catalyzed by MetE has
not yet been determined. This determination will be particularly important in defining the
mechanism of catalysis, and is currently in progress in our laboratory. Observation of
inversion at the transferred methyl group would suggest a direct nucleophilic displacement by
the sulfur of homocysteine on the methyl group of CH3-R4PteGlu3, while retention would
suggest the participation of a methylated enzyme intermediate. One way in which the
catalytic mechanisms of the cobalamin-dependent and cobalamin-independent methionine
synthases could be related is if the MetE enzyme provides a strong nucleophile to function
like cob(I)alamin in the MetH protein. Our studies have identified a highly reactive cysteinyl
residue in MetE, Cys726, and shown that alkylation of this residue by chloromethyl ketones
results in apparently complete loss of activity.6 While we are unable to deduce the role of
Cys726 in catalysis at this time, the identification of this reactive residue suggests the
possibility that this thiol may function as an intermediate methyl acceptor in catalysis,
analogous to the role of cobalamin in the reaction catalyzed by MetH.
The turnover number associated with catalysis by MetE of the methyl transfer from
CH3-H4PteGlu1 to homocysteine is 14 min-1, nearly 100 times slower than the turnover
number for the MetH enzyme. Whether MetE catalyzes the displacement of the methyl group
of methyltetrahydrofolate using homocysteine or using a thiolate residue on the protein, one
might expect the enzyme to be relatively inefficient as compared to the MetH enzyme.
Studies of the reactivity of thiolate as compared to cob(I)alamin indicate that thiolate is less
reactive by a factor of 30,000.25 Given this large difference in reactivity, perhaps we should
not be asking why MetE has such a low turnover number, but rather how it has achieved
such a high turnover.
Both MetE and MetH enzymes face the problem of activating the methyl group of a
tertiary amine towards nucleophilic attack, and in both cases the mechanism of such
activation remains the central unsolved mechanistic question associated with the catalytic
reactions.
ACKNOWLEDGEMENTS
Work from our laboratory has been funded in part by NIH Grant R37 GM29408. JTD is a
690
trainee in the Pharmacological Sciences Training Program supported by National Research
Services Award T32 GM07767 and has been an NSF Graduate Fellow.
REFERENCES
1. J.T. Drummond, R. Loo, and R.G. Matthews, 1993, Electrospray mass spectrometric analysis of the
domains of a large enzyme: Observation of the occupied cobalamin-binding domain and redefinition of
the carboxyl terminus of methionine synthase, Biochemistry: submitted for publication.
2. J.H. Mangum and K.G. Scrimgeour, 1962, Cofactor requirements and intermediates in methionine
biosynthesis, Fed. Proc. 21:242.
3. M.A. Foster, M.J. Dilworth, and D.D. Woods, 1964, Cobalamin and the synthesis of methionine by
Escherichia coli, Nature 201:39.
5. C.D. Whitfield, E.J. Steers, Jr., and H. Weissbach, 1970, Purification and properties of 5-methyltetra-
hydropteroyltriglutamate-homocysteine transmethylase, J. Bioi. Chern. 245:390.
6. J.C. Gonzalez, R.V. Banerjee, S. Huang, J.S. Sumner, and R.G. Matthews, 1992, Comparison of
cobalamin-independent and cobalamin-dependent methionine synthases from Escherichia coli: Two
solutions to the same chemical problem, Biochemistry 31:6045.
7. R.V. Banerjee, N.L. Johnston, J.K. Sobeski, P. Datta, and R.G. Matthews, 1989, Cloning and sequence
analysis of the Escherichia coli metH gene encoding cobalamin-dependent methionine synthase and
isolation of a tryptic fragment containing the cobalamin-binding domain, J. Bioi. Chern. 264:13888.
8. I. G. Old, D. Margarita, R.E. Glass, and I. Saint Girons, 1990, Nucleotide sequence of the metH gene of
Escherichia coli K-12 and comparison with that of Salmonella typhimurium LT2, Gene 87:15.
9. E.M. Maxon, B. Redfield, X.-Y. Cai, R. Shoeman, K. Fujita, W. Fisher, G. Stauffer, H. Weissbach, and
N. Brat, 1989, Regulation of methionine biosynthesis in Escherichia coli: effect of the MetR protein in
metE and metH expression, Proc. Nat/. Acad. Sci. U. S. A. 86:85.
10. K. Fujii, and F.M. Huennekens, 1974, Activation of methionine synthetase by a reduced
triphophopyridine nucleotide-dependent flavoprotein system, J. Bioi. Chern. 249:6745.
11. J.T. Drummond, S. Huang, R.M. Blumenthal, and R.G. Matthews, 1993, Assignment of enzymatic
function to specific protein regions of cobalamin-dependent methionine synthase from Escherichia coli,
Biochemistry: submitted for publication.
12. C.L. Luschinsky, J.T. Drummond, R.G. Matthews, and M.L. Ludwig, 1992, Crystallization and
preliminary x-ray diffraction studies of the cobalamin-binding domain of methionine synthase from
Escherichia coli, J. Mol. Bioi. 225:557.
13. H. Vetter, Jr., and J. Knappe, 1971, Flavodoxin and ferredoxin of Escherichia coli, Hoppe-Seyler's Z.
Physiol. Chern. 352:443.
14. J. Harder, R. Eliasson, E. Pontis, M.D. Ballinger, and P. Reichard, 1992, Activation of the anaerobic
ribonucleotide reductase from Escherichia coli by S-adenosylmethionine, J. Bioi. Chern. 267:25548.
15. C. Osborne, L.-M. Chen, and R.G. Matthews, 1991, Isolation, cloning, mapping and nucleotide
sequencing of the gene encoding flavodoxin in Escherichia coli, J. Bacterial. 173:1729.
691
16. V. Bianchi, P. Reichard, R. Eliasson, E. Pontis, M. Krook, H. Jomvall, and E. Hi'tggard-Ljungquist,
1993, E. coli Ferredoxin NADp+ reductase: Activation of E. coli anaerobic ribonucleotide reduction,
cloning of the gene lfpr) and overexpression of the protein. J. Bacterial. 175: in press.
17. J. Knappe, F.A. Neugebauer, H.P. Blaschkowski, and M. Ganzler, 1984, Posttranslational activation
introduces a free radical into pyruvate formate-lyase, Proc. Natl. Acad. Sci. USA 81:1332.
18. A.F.V. Wagner, M. Frey, F.A. Neugebauer, W. Schafer, and J. Knappe, 1992, The free radical in
pyruvate formate-lyase is located on glycine-734, Proc. Nat!. Acad. Sci. USA 89:996.
19. X. Sun, J. Harder, M. Krook, H. Jomvall, B.-M. Sj o berg, andP. Reichard, 1993, A possible glycine
radical in anaerobic ribonucleotide reductase from Escherichia coli: nucleotide sequence of the cloned nrdD
gene, Proc. Natl. Acad. Sci. 90:577.
21. K. Fujii, and P.M. Huennekens, 1979, Methionine synthase: characterization of protein components and
mechanisms for activation and catalysis, in "Biochemical Aspects of Nutrition," K. Yagi, Ed., p. 173,
University Park Press, Baltimore.
22. R.V. Banerjee, S.R. Harder, S.W. Ragsdale, andR.G. Matthews, 1990, Mechanism of reductive
activation of cobalamin-dependent methionine synthase: an electron paramagnetic resonance
spectroelectrochemical study, Biochemistry 29:1129.
23. V. Frasca, B.S. Riazzi, and R.G. Matthews, 1986, In vitro inactivation of methionine synthase by
nitrous oxide, J. Bioi. Chern. 261:15823.
24. T.M. Zydowsky, L.F. Courtney, V. Frasca, K. Kobayashi, H. Shimizu, L.-D. Yuen, R.G. Matthews,
S.J. Benkovic, and H. G. Floss, 1986, Stereochemical analysis of the methyl transfer catalyzed by
cobalamin-dependent methionine synthase from Escherichia coli B, J. Am. Chern. Soc.108:3152.
25. K.L. Brown, 1982, Synthesis of organocobalt complexes, in "B12, Volume 1: Chemistry," D. Dolphin,
Ed., p. 245, Wiley Interscience, New York.
692
FOLATE METABOLITES AS MODULATORS OF ANTITUMOR DRUG
ACTIVITY
INTRODUCTION
METHODS
Cell Culture
694
Table 1. Accumulation of Reduced Folates in Cultured Ovarian Tumor Cells
Following Exposure to 6-CHOFH4, FH4, and 6-CH3FH4. 1
1ovarian tumor cells were maintained in RPMI 1640 media supplemented with 10%
fetal bovine serum for 48 hours before exposure to each reduced folate at 10 !J.M
concentration for 4 hours. Cells were trypsinized, washed twice with cold PBS and
suspended in an extraction buffer which contained 50 mM Tris-HCl (pH 7.4), 50 mM
sodium ascorbate and 1 mM EDTA. Intracellular reduced folates were measured by
the ternary complex-based assay. Total folate is the sum of the four reduced folate
pools. Data represent the mean of five determinations ± SEM.
695
Because 5-CHOFH4 metabolites are active, an alternative potential
metabolite source, folic acid, was investigated. When this vitamin was
administered orally to volunteers at 125 mgjm2, the same metabolites,
5-CH3FH4 and CH2FH4 + FH4, were observed as following 5-CHOFH4
administration. Further, it can be seen in Figure 1 that when total
accumulation of metabolites (AUC) is compared, elevation is the same
following folic acid as after 5-CHOFH4 administration at 125 mg/m2. While
Dose FU Response
(mg/m2) (mg/m2) (%) N1 Ref.
6-CH3FH4
IV 100 500 36 45 24
5-CHOFH4
lY.. 0 370 7 61 25
200 370 33 64
0 500 10 39 26
200 370 35 81
1253 600 45 31 28
_......
.... • 5-CH3FH4
..c
~
E:
u
;:J 1:3 CH2FH4
< +FH4
696
only [S]5-CHOFH4 is active ([R,S]5-CHOFH4 was administered) and thus the
effective dose is 62.5 mg/m2, nevertheless, folic acid is clearly an excellent
source of plasma reduced folate metabolites. Hence, it is predicted to be an
attractive alternative to 5-CHOFH4 therapeutically.
Interestingly. not only is folic acid able to elevate the total reduced
folate metabolite pool, it is particularly effective in elevation of the CH2FH4 +
FH4 pool (Figure 1). If elevation of this pool leads to more extensive
intratumor elevation of CH2FH4 in vivo as suggested by the in vitro study
(Table 1), folic acid could be even more attractive as an agent to potentiate
FU therapeutically.
Acknowledgments
This work was supported by Grants from the USPHS, CA-22754 and
American Cancer Society CH-461.
REFERENCES
1. E. Mini, F. Trave, Y.M. Rustum, and J.R. Bertino, Enhancement of the
antitumor effects of 5-fluorouracil by folinic acid, Pharmacol. Ther. 47:1
(1990).
2. S. Madajewicz, N.J. Petrelli, Y.M. Rustum, J. Campbell, L. Herrera, A.
Mittelman, A. Perry, and P.J. Creaven, A phase I-II trial of high-dose
calcium leucovorin and 5-fluorouracil in advanced colorectal cancer,
Cancer Res. 44:4667 (1984).
3. N.J. Petrelli, Y.M. Rustum, H. Bruckner, and D. Stablein, The Roswell Park
Memorial Institute and Gastrointestinal Tumor Study Group phase III
experience with the modulation of 5-fluorouracil by leucovorin in
metastatic colorectal adenocarcinoma, Adv. Exp. Med. Bioi. 244:143
(1988).
4. L.R., Laufman, K.A. Krzeczowski, R. Roach, and M. Segal, Leucovorin plus 5-
fluorouracil: An effective treatment for metastatic colon cancer, J. Clin.
Oncol. 5:1394 (1987).
5. J.H. Doroshow, L. Leong, K. Margolin, B. Flanagan. D. Goldberg, M. Bertram,
S. Akman, B. Carr, 0. Odujinrin, E. Newman, and T. Lichtfield,
Refractory metastatic breast cancer: Salvage therapy with fluorouracil
and high-dose continuous infusion leucovorin calcium, J. Clin. Oncol.
7:439 (1989).
6. S.M. Swain, M.E. Lippman, E.F. Egan, J.C. Drake, S.M. Steinberg and C.J.
Allegra, Fluorouracil and high-dose leucovorin in previously treated
patients with metastatic breast cancer, J. Clin. Oncol. 7:890 (1989).
7. E.E. Vokes, K.E. Choi, R.L. Schilsky, R.J. Moran, C.M. Guarnieri, R.R.
Weichselbaum, and W.R. Panje. Cisplatin, fluorouracil, and high-dose
leucovorin for recurrent or metastatic head and neck cancer, J. Clin.
Oncol. 6:618 (1988).
8. P.V. Danenberg and K.D. Danenberg, Effect of 5,10-methylenetetrahydrofolate
on the dissociation of 5-fluoro-2'-deoxyuridylate from thymidylate
synthetase: Evidence for an ordered mechanism, Biochemistry 17:4018
(1978).
9. B. Ullman, M. Lee, D.W. Martin, Jr., and D.V. Santi, Cytotoxicity of 5-fluoro-2'-
deoxyuridine: Requirement for reduced folate cofactors and antagonism
by methotrexate., Pro. Natl. Acad. Sci. USA 75:980 (1978).
10. J.A. Houghton, C. Schmidt, and P.J. Houghton, The effect of derivatives of folic
acid on the fluorodeoxyuridylate-thymidylate synthetase covalent
complex in human colon xenografts, Eur. J. Cancer Clin. Oncol. 18:347
(1982).
11. R.M. Evans, J.D. Laskin, and M.T. Hakala, Effect of excess folates and
deoxyinosine on the activity and site of action of 5-fluorouracil, Cancer
Res. 41:3288 (1981).
697
12. D.G. Priest, J.C. Schmitz, M.A. Bunni, and R.K. Stuart, Pharmacokinetics of
leucovorin metabolites in human plasma as a function of dose
administered orally and intravenously, J. Natl. Cancer Inst. 83:1806
(1991).
13. M.M. Bradford, A rapid and sensitive method for the quantitation of microgram
quantities of protein utilizing the principle of protein dye binding, Anal.
Biochem. 72:248 (1976).
14. D.G. Priest and M.T. Doig, Tissue folate polyglutamate chain length
determination by electrophoresis as thymidylate synthase-
fluorodeoxyuridylate ternary complexes, Methods Enzymol. 122:313
(1986).
15. D.G. Priest, C.D. Veronee, M. Mangum, J.M. Bednark, and M.T. Doig,
Comparison of folypolyglutamate hydrolases of mouse liver, kidney,
muscle, and brain, Mol. Cell. Biochem. 43:81, (1982).
16. M.T. Doig, J.R. Peters, P. Sur, M. Dang, and D.G. Priest, Determination of
mouse liver 5-methyltetrahydrofolate concentration and polyglutamate
forms, J. Biochem. Biophys. Methods 10:287 (1985).
17. V. Kesavan, M.T. Doig, and D.G. Priest. A radioenzymatic method for the
determination of tissue 10-formyltetrahydofolate, J. Biochem. Biophys.
Methods 12:311 (1986).
18. D.G. Priest, M.A. Bunni, L.R. Romero-Fredes, J.C. Schmitz, and J.M. Whiteley,
A sensitive radioenzymatic assay for [S]5-formyltetrahydrofolate, Anal.
Biochem. 196:284 (1991).
19. D.V. Santi, C.S. McHenry, and E.R. Perriard, A filter assay for thymidylate
synthetase using 5-fluoro-2'-deoxyuridylate as an active site tirant,
Biochem. 13:467 (1974).
20. R.L. Schilsky and M.J. Ratain, Clinical pharmacokinetics of high-dose
leucovorin calcium after intravenous and oral administrations, J. Natl.
Cancer Inst. 82:1411 (1990).
21. A. Schalhom, M. Kiihl, G. Stupp-Poutot, and V. Niissler, Pharmacokinetics of
reduced folates after short-term infusion of d, 1-folinic acid, Cancer
Chemother. Pharmacal. 25:440 (1990).
22. E. Mini, T. Mazzei, M. Coronnello, L. Criscuoli, M. Gualtieri, P. Periti, and J.R.
Bertino, Effects of 5-methyltetrahydrofolate on the activity of
fluoropyrimidines against human leukemia (CCRF-CEM) cells, Biochem.
Pharmac. 36:2905 (1987).
23. J.A. Houghton, L.G. Williams, S.S.N. DeGraff, P.J. Cheshice, I.W. Waina, P.
Jadand, and P.J. Houghton, Comparision of the conversion of 5-
formyltetrahydrofolate and 5-methyltetrahydrofolate to 5,10-
methylenetetrahydrofolate and tetrahydrofolate in human colon tumors,
Cancer Corum. 1:167 (1989).
24. P. La Ciura, G. La Grotta, and E. Nigra, A. Comandone, G. Grecchi, G. Leria,
and A. Calciati, 5-Methyltetrahydrofolic acid (MFH4): An effective folate
for the treatment of advanced colorectal cancer with 5-FU, Recent
Results in Cancer Res. 110: 219 (1988).
25. C. Erlichman, S. Fine, A. Wong, and T. Elhakim, A randomized trial of
fluorouracil and folinic acid in patients with metastatic colorectal
carcinoma, J. Clin. Oncol. 6:469 (1988).
26. M.A. Poon, M.J. O'Connell, H.S. Wieand, J.E. Krook, J.B. Gerstner, L.K.
Tschetter, R. Levitt, C.G. Kardinal, and J.A. Mailliard, Biochemical
modulation of fluorouracil with leucovorin: Confirmatory evidence of
improved therapeutic efficacy in advanced colorectal cancer, J. Clin.
Oncol. 9:1967 (1991).
27. L.R. Laufman, W.D. Brenckman, Jr., and K.A. Stydnicki, Clinical experience
with leucovorin and 5-fluorouracil, Cancer 63:103 (1989).
28. J.D. Hines, D.J. Adelstein, J.L. Spiess, P. Girowski, and S.G. Carter, Efficacy of
high-dose oral leucovorin and 5-fluorouracil in advanced colorectal
carcinoma, Cancer 63:1022 (1989).
698
MTX DOES NOT AFFECT ENHANCED BIOSYNTHESIS
AND METABOUSM OF S-ADENOSYLMETHIONINE IN
TESTOSTERONE-INDUCED HYPERTROPHIC MOUSE
KIDNEY
INTRODUCTION
Female Swiss mice, receiving ampicillin and streptomycin in the drinking water to
eliminate metabolism of MTX by bacteria present in the gut, were given daily i.p.
injections of MTX (0.35 or 3.5 mg/kg); after 10 days a single s.c. injection of testosterone
(125 mg/kg) was given. Antibiotics and MTX treatments were continued for additional 5
Table 1. MTX levels and dihydrofolate reductase activity in the kidneys and liver of MTX-
treated mice (3.5 mg/kg; 13 days).
MTX DHFR
organ treatment pmoles/g w.w.
nmoles/h/mg protein % inhibition
kidney control 0 404.1 0
MTX 317.2 (2) 25.1 93.8
liver control 0 226.3 0
MTX 1400.8 ± 463.6 (6) 20.6 88.6
700
MTX influenced only to a small extent testosterone-induced renal uptake of
methionine. As shown in Fig. 1, MTX treatment resulted in a slight increase in methionine
accumulation in the kidneys and liver of both control and testosterone-treated mice. These
results point to some differences in this amino acid transport system between mouse
kidneys and mitogen-stimulated human lymphocytes, in which MTX inhibits methionine
uptake11 •
ornithine
decarboxylase 700 163.06 ± 85.91 (4) 163.96 ± 23.52 (5)
AdoMet
decarboxylase 0.22 ± 0.04 (4) 0.23 ± 0.03 (6)
MARKERS OF TESTOSTERONE-INDUCED HYPERTROPHY
cystathionine
synthase 3.4 83.26 ± 13.58 (4) 79.00 ± 7.62 (5)
AdoMet
synthetase 1.2 2.36 ± 0.23 (4) 1.79 ± 0.39 (6)
METHIONINE BIOSYNTHESIS
methionine
synthase 5.22 ± 0.76 (4) 4.67 ± 1.06 (6)
betaine
methyl transferase 1.51 ± 0.76 (4) 0.43 ± 0.96 (6)
% of body weight
relative kidney
weight 1.3 1.50 ± 0.11 (13) 1.52 ± 0.09 (15)
measured in the absence of MTX and compared with controls which received vehicle only. Mice were
treated with MTX for 15 days at a dose 3.5 mglkg. Data represent means ± SD and number of mice
is given in parenthesis.
The results presented herein support our previous results showing that some anabolic
effects of testosterone on female mouse kidneys, such as increased AdoMet levels and
augmented methylation intensity, are fulfilled by enhanced methionine uptake rather than
by its increased biosynthesis. Thus MTX-evoked disturbances in the pool of folate cofactors
had only marginal effects on testosterone-induced renal hypertrophy.
701
dpmx10- 3/100 mg organ weight
200
- control
~ MTX
c=J testosterone
150 W4! MTX • teetoeterone
100
50
0 ...ll:::===
KIDNEY LIVER
Figure 1. Effect of MTX (0.35 mg/kg) and testosterone on radioactivity in the kidneys and liver ot mJce
pulse-labelled with [methyl -14C]methionine (1h).
ACKNOWLEDGMENT
This research was supported by grants statutable to the Nencki Institute and from the
State Committee for Scientific Research No 6 6276 9203.
REFERENCES
1. M. Manteuffel-Cymborowska, W. Chmurzynska, and B. Grzelakowska-Sztabert, Biochim.Biophys.Acta
1116:166 (1992).
2. R.C. Jackson, Pharmacol. Ther. 25:61 (1984).
3. C.J. Allegra, R.L. Fine, J.C. Drake, and B.A. Chabner, J.Biol.Chem. 261:6478 (1986).
4. V. Kesavan, P. Sur, M.T. Doig, K.J. Scanlon, and D.G. Priest, Cancer Lett. 30:55 (1986).
5. A.M. Svardal, P.M. Ueland, R.K. Berge, A. Aarsland, N. Aarsaether, P.E. Lonning, and H. Refsum,
Cancer Chemother.Pharmacol. 21:313 (1988).
6. E.A. Pomfret, K.A. da Costa, and S.H. Zeisel, J.Nutr.Biochem. 1:533 (1990).
7. J.C. Deutsch, and J.F. Kolhouse, Cancer Res. 49:5858 (1989).
8. J.R. Bertino, and G.A. Fisher, Methods Med.Res. 10:297 (1964).
9. K.G. Scrimgeour, and F.M. Huennekens, in: "Handbuch der Physiologisch und Pathologisch Chemischen
Analyse" Springer Verlag, Berlin VIB (1966) p.181.
10. B. Grzelakowska-Sztabert, W. Chmurzyiiska, M. Manteuffel-Cymborowska, and E. Sikora, Cancer Lett.
32:207 (1986).
11. K.J. Scanlon, K. Berkowitz, M.E. Pallai, and S. Waxman, Cancer Treat.Rep. 67:631 (1983).
702
THERMOlABILITY OF RESIDUAL METHYLENE-
TETRAHYDROFOIATE REDUCfASE (MR) ACfiVITY,
METHIONINE SYNTHASE ACfiVITY AND METHYL-
COBALAMIN LEVELS 1N CULTURED FIBROBlASTS
FROM PATIENfS WITH MR DEFICIENCY
MRC Genetics Group, Centre for Human Genetics, The Hess B. and
Diane Finestone Laboratory, Departments of Medicine, Biology, and
Pediatrics, McGill University, Montreal, Quebec, Canada
lNTRODUCfiON
The clinical findings in patients with MR deficiency, the most common inborn
error of folate metabolism, range from death in infancy to asymptomatic homocystinuria
in adulthood (1-8). Patients may have developmental delay, psychiatric manifestations,
and gait abnormalities. The biochemical manifestations include moderate homocystinuria
and homocystinemia. Plasma methionine levels are usually low or normal. In contrast
to patients with functional deficiencies of methionine synthase (cblE, cblG), megaloblastic
anemia is not found. There is a correlation between the proportion of
methyltetrahydrofolate in extracts of cultured fibroblasts, the residual MR activity, and
the clinical severity of the disease (9-11). Genetic heterogeneity of MR deficiency was
suggested when we observed varying patterns of thermostability at 55° in fibroblast
extracts (9).
RESULTS
DISCUSSION
704
Kang in which specific activity is less severely deficient but in which the reductase has
abnormal thermolability at 46° in lymphocyte extracts (16). The variant described by
Kang has been postulated as an independent risk factor for coronary disease (17,18), but
is not associated with the other clinical findings of severe MR deficiency. Both brothers,
one of which being completely asymptomatic as an adult (19), had thermolabile residual
activity. In contrast, the two sisters who (20) were diagnosed in adolescence both have
a thermostable enzyme. There were both thermostable and thermolabile enzyme seen
in patients with onset of disease in infancy.
ACKNOWLEDGEMENTS
The authors want to thank the clinicians who supplied cultured fibroblasts and
clinical summaries on their patients. The results have been summarized from our
previous publication with permission (21).
REFERENCES
1. D.S. Rosenblatt, Inherited disorders of folate transport and metabolism, in: "The
Metabolic Basis of Inherited Disease", C.R. Scriver, AL. Beaudet, W.S. Sly, D.
Valle, eds. McGraw Hill, New York (1989).
2. K. Narisawa, Y. Wada, T. Saito, K. Suzuki, M. Kudo, T.S. Arakawa, N.A
Katsushima, R. Tsuboi, Infantile type of homocystinuria with N5•10-methylene-
tetrahydrofolate reductase defect. Tohoku J Exp Med 121:185 (1977).
3. S.H. Mudd, B.W. Uhlendorf, J.M. Freeman, J.D. Finkelstein, V.E. Shih,
Homocystinuria associated with decreased methylenetetrahydrofolate reductase
activity, Biochem Biophys Res Commun 46:905 (1972).
4. J.M. Freeman, J.D. Finkelstein, S.H. Mudd, Folate-responsive homocystinuria and
"schizophrenia". A defect in methylation due to deficient 5,10-methylenetetra-
hydrofolate reductase activity. N Eng! J Med 292:491 (1975).
5. P.W.K. Wong, P. Justice, M. Hruby, E.B. Weiss, E. Diamond, Folic acid
non-responsive homocystinuria due to methylenetetrahydrofolate reductase
deficiency. Pediatrics 59:749 (1977).
6. E.R. Baumgartner, K. Schweizer, H. Wick, Different congenital forms of defective
remethylation in homocystinuria. Clinical, biochemical, and morphological studies,
Pediatr Res 11:1015 (1977).
7. Y.S. Kanwar, J.R. Manaligod, P.W.K. Wong, Morphologic studies in a patient with
homocystinuria due to 5,10-methylenetetrahydrofolate reductase deficiency,
Pediatr Res 10:598 (1976).
8. J.M. Visy, P. LeCoz, B. Chadefaux, C. Fressinaud, F. Woimant, J. Marquet, J.
Zittoun, J. Visy, J.M. Vallat, M. Haguenau, Homocystinuria due to
5,10-methylenetetrahydro-folate reductase deficiency revealed by stroke in adult
siblings. Neurology 41:1313 (1991).
9. D.S. Rosenblatt, R.W. Erbe, Methylenetetrahydrofolate reductase in cultured human
cells. II. Studies of methylenetetrahydrofolate reductase deficiency, Pediatr Res
11:1141 (1977).
10. D.S. Rosenblatt, B.A Cooper, S. Lue-Shing, P.W.K. Wong, S. Berlow, K. Narisawa,
R. Baumgartner, Folate Distribution in Cultured Human Cells: Studies on
5,10-CH2-H4PteGlu Reductase Deficiency, J Clin Invest 63:1019 (1979).
705
11. E.R. Baumgartner, E.L.R. Stokstad, H. Wick, J.E. Watson, G. Kusano, Comparison
of folic acid coenzyme distribution patterns in patients with methylenetetra-
hydrofolate reductase and methionine synthetase deficiencies, Pediatr Res 19:1288
(1985).
12. B.A. Cooper, D.S. Rosenblatt, Folate coenzyme forms in fibroblasts from patients
deficient in 5,10-methylenetetrahydrofolate reductase. Biochem Soc Trans 4:921
(1976).
13. D.S. Rosenblatt, B.A. Cooper, A. Pottier, H. Lue-Shing, N. Matiaszuk, K. Grauer.
Altered vitamin B12 metabolism in fibroblasts from a patient with megaloblastic
anemia and homocystinuria due to a new defect in methionine biosynthesis. J Clin
Invest 74:2149 (1984).
14. D. Watkins, D.S. Rosenblatt, Genetic heterogeneity among patients with
methylcobalamin deficiency: definition of two complementation groups, cblE and
cblG. J Clin Invest 81:1690 (1988).
15. D. Watkins, D.S. Rosenblatt, Functional methionine synthase deficiency (cblE and
cblG): Clinical and biochemical heterogeneity. Am J Med Genet 34:427 (1989).
16. S.S. Kang, J. Zhou, P.W.K. Wong, J. Kowalisyn, G. Strokosch, Intermediate
Homocysteinemia: A Thermolabile Variant of Methylenetetrahydrofolate
Reductase, Am J Hum Genet 43:414 (1988).
17. S.S. Kang, P.W.K. Wong, J. Zhou, J. Sora, N. Ruggie, G. Grcevich, Thermolabile
methylenetetrahydrofolate reductase in patients with coronary artery disease,
Metabolism 37:611 (1988).
18. S.S. Kang, P.W.K. Wong, A. Susmano, J. Sora, M. Norusis, N. Ruggie, Thermolabile
methylenetetrahydrofolate reductase: An inherited risk factor for coronary artery
disease. Am J Hum Genet 48:536 (1991).
19. J.C. Haworth, L.A. Dilling, R.A.H. Surtees, L.E. Seargeant, H. Lue-Shing, B.A.
Cooper, D.S. Rosenblatt, Symptomatic and asymptomatic
methylenetetrahydrofolate reductase deficiency in 2 adult brothers. Am J Med
Genet 45:572 (1993).
20. J.M. Freeman, J.D. Finkelstein, S.H. Mudd, B.W. Uhlendorf, Homocystinuria
presenting as reversible "schizophrenia": a new defect in methionine metabolism
with reduced 5,10-methylenetetrahydrofolate reductase activity. Pediatr Res 6:423
(1972).
21. D.S. Rosenblatt, H. Lue-Shing, A. Arzoumanian, L. Low-Nang and N. Matiaszuk,
Methylenetetrahydrofolate reductase (MR) deficinecy: Thermolability of residual
MR activity, methionine synthase activity, and methylcobalamin levels in cultured
fibroblasts, Biochem Med Met Bioi 47:221 (1992).
706
ENZYMES FOR SYNTHESIS OF 10-FORMYLTETRAHYDROFOLATE
IN PLANTS. CHARACTERIZATION OF A MONOFUNCTIONAL
10-FORMYLTETRAHYDROFOLATE SYNTHETASE AND COPURIFICATION
OF 5,10-METHYLENETETRAHYDROFOLATE DEHYDROGENASE AND
5,10-METHENYLTETRAHYDROFOLATE CYCLOHYDROLASE ACTIVITIES.
INTRODUCTION
METHODS
Seeds of pea (Pisum sativum L. cv. Homesteader) were germinated and cotyledon
extracts used as an enzyme source. PteGlun (n = 2-5) were from Dr. B. Schircks
Laboratories, Matrex Green A was from Amicon; all other chromatographic media were
Enzyme Assays
RESULTS
708
Table 1. Purification of plant 10-Formyltetrahydrofolate synthetase activity.
709
Table 3. Major Properties of Plant Synthetase and Dehydrogenase/Cyclohydrolase.
Synthetase Dehydrogenase/Cyclohydrolase
Property examined (Step 7 Protein) (Step 6 Protein)
ACKNOWLEDGEMENTS
This work was supported by grants to E.A.C. from the Natural Sciences and
Engineering Research Council of Canada. Professor Jesse Rabinowitz is thanked for the
antibodies to spinach 10-formyltetrahydrofolate synthetase and for valuable discussions.
We also acknowledge Professor Verne Schirch for kindly providing mammalian serine
hydroxymeth yItransferase.
REFERENCES
1. E.A.Cossins. in: The Biochemistry of Plants, Vol2, D.D. Davies, ed., 365. Academic Press, New
York (1980).
2. E.A.Cossins. in: The Biochemistry of Plants, Volll, D.D.Davies, ed., 316. Academic Press, New
York (1987).
3. R.E.MacKenzie. in: Folates and Pterins, Vol1, R.L.Blakley and S.J.Benkovic, eds., 255. Wiley, New
York (1984).
4. J.M.Nour and J.C.Rabinowitz. J.Biol.Chem.266:18363 (1991).
5. J.M.Nour and J.C.Rabinowitz. J.Biol.Chem.267:16292 (1992).
6. D,R.Appling and J.C.Rabinowitz. J.Biol.Chem.260:1248 (1985)
7. N.P.Curthoys, J.M.Scott and J.C.Rabinowitz. J.Biol.Chem.247:1959 (1972).
8. Z.S.de Mata and J.C.Rabinowitz. J.Biol.Chem.255:2569 (1980).
9. U.K.Laemmli. Nature 227:680 (1970).
lO.P.Stover and V.Schirch. Anal.Biochem. 202:82 (1992).
ll.P .Stover and V.Schirch. J.Biol.Chem. 266:1543 (1991).
12.W.B.Strong and V.Schirch. Biochemistry 28:9430 (1989).
13.V.Besson,F.Rebeille,M.Neuburger,R.Douce,and E.A.Cossins. Biochem. J.in press: (1993).
14. V.Schirch and W.B.Strong. Arch.Biochem.Biophys.269:371 (1989).
710
CLONING OF THE GENES ENCODING THE SERINE
HYDROXYMETHYLTRANSFERASES FROM SACCHAROMYCES CEREVISIAE
1Department of Microbiology
University of Toronto
Toronto, Ontario, Canada MSS 1A8
2Biology Department,
York University,
Toronto, Ontario, Canada
INTRODUCTION
The polymerase chain reaction was done in 30 cycles using 2 min at 45° C for
annealing, 2 min at no C for reaction and 1 min at 94° C for denaturation. The yeast
SHM genes were isolated from a genomic library constructed in the shuttle vector
Yep13 (5). DNA manipulations and colony blots were done as described in Sambrook
et al. (6) and all DNA modifying enzymes were utilized following the manufacturer's
instructions. DNA sequencing was done using the Sequenase kit from USB.
RESULTS
8 8g X E Rv E Rv Rv8/S
pSH36
1 kb
Figure 2. Restriction maps of S. cerevisiae DNA in plasmids containing the SHM
genes. pSH36 contains the intact SHMl gene, while pSH3 and pSH2 contain the
SHM2 gene. The open reading frames of the intact genes are indicated by the solid
boxes. Restriction enzyme sites are: B, Bam HI; Be, Bel I; Bg, Bgl II; B/S, Bam HI site
in the vector ligated to a Sau 3AI site in the genomic DNA; E, Eco RI; H, Hind III;
Rv, Eco RV; Sa, Sal I; Sm, Sma I; Sp, Sph I.
712
frames with predicted amino acid sequences homologous to those of known SHMT
enzymes and the corresponding genes were designated SHM1 and SHM2. Probes were
prepared from these cloned fragments and used to screen a yeast genomic library. One
clone, pS36 was found containing the intact SHM1 gene on a 5.6 kbp BamHI-Hindiii
fragment, which was subcloned into pUC19 (see Figure 2). Two clones were found,
pS2 and pS3, containing the SHM2 gene. Clone pS2 contained a large insert of yeast
genomic DNA (> 10 kb). The PCR-amplified DNA probe hybridized to a 1 kbp
Hindiii fragment and a 1.2 kb Sali-EcoRI fragment and these fragments were
subcloned into pUC19 and sequenced. Translation of the sequence at the 5' end of the
Sal I- Eco RI fragment showed the insertion site in the vector followed by sequences
with homology to the amino terminal sequence of SHMT enzymes but lacking the
initiator methionine, indicating that the gene was incomplete. Rescreening of the yeast
genomic library led to the isolation of pS3, which contains the intact SHM2 gene.
Interestingly, when the sequences of the genomic clones were determined in the
regions of the PCR primer, and compared to the sequences of the amplified DNA
fragments, which contain the actual primers, at least one mismatch was found in each
primer and one primer had three mismatches.
Both the SHM1 and SHM2 genes were subcloned into pUC19. The entire pSH36
insert was subcloned into pUC19 in both orientations. These plasmids were unable to
transform the E. coli glyA strain to glycine prototrophy. The pSH3 insert cloned
downstream of the lac was unable to complement the glyA strain but a subclone, in
which the DNA 5' to the Sph I site was deleted, did complement the glyA strain,
indicating that the cloned SHM2 was a functional gene.
J.
1. MFPRASALAKCMATVHRRGLLTSGAQSLVSKPVSEGOPEMFD!LQQERHRQKHS!TL!
2. MPYTLSDAHHKLITSHLVDTDPEVDS!IKDEIERQKHS!DL!
Figure 3. Alignment of the predicted amino acid sequences of the SHM1 (1) and
SHM2(2) gene products. The arrow indicates the predicted cleavage site in the leader
sequence.
DNA sequence determination of the regions encoding the amino terminal regions
of the SHM genes suggested that SHM1 encodes the mitochondrial SHMT and SHM2
encodes the cytosolic enzyme. The amino terminal region of the SHMl product
extends 16 amino acids farther than the SHM2 product when the two sequences are
aligned and the leader sequence has the characteristics of a mitochondrial leader
sequence (Figure 3). The putative leader sequence lacks acidic amino acids or
extensive hydrophobic stretches. In addition, There is a sequence in the leader:
VHRRGL which corresponds well to a consensus recognition sequence proposed for
the protease that cleaves mitochondrial leader peptides (7).
DISCUSSION
The putative mitochondrial gene, SHM1, did not complement the E. coli glyA
strain and does not express SHMT activity in E. coli. It is unlikely that this represents
an inactive or pseudogene in yeast, since repeated PCR amplifications did not yield
sequences homologous to a third gene, representing the active mitochondrial gene but
did consistently amplify the SHM1 gene. The plasmid used for the expression studies
contains 900 bp of yeast DNA between the lac promoter in the vector and the
initiation codon of the SHM1 open reading frame. Yeast non-coding sequences are AT
rich and contain long stretches of consecutive T residues, which may act as termination
713
signals in E. coli. We are deleting some of this intervening sequence to try to obtain
high expression of the enzyme. An alternate explanation for the lack of activity may
be that the mitochondrial leader sequence, which would not be cleaved in E. coli,
interferes with enzyme activity. Expression would then require deletion of the leader
sequence codons and insertion of an ATG codon at the predicted site of cleavage
using in vitro mutagenesis.
We have recently become aware of a report of the sequencing of the gene
corresponding to SHM1 (8). These authors identify the gene as encoding the cytosolic
SHMT because the leader sequence does not correspond to the mitochondrial
consensus. Their sequence differs from ours (unpuplished) by an A residue 81 bp
upstream of our predicted initiation codon, resulting in a 5' extension of the open
reading frame into nonsense sequences.
REFERENCES
1. C.R. Mclung, C. Davis, K. Page and S.A. Denome, Mol. Cell. Biol. 12:1412-1421
(1992).
2. B. Shane, personal communication, J. Biol. Chern, in press (1993).
3. F.B. Martini, B. Maras, P. Tanci, S. Angelaccio, S. Pascarella, D. Barra, F. Bossa
and V. Schirch, J. Biol. Chern. 264: 8509-8519 (1989).
4. F.B. Martini, S. Angelaccio, S. Pascarella, D. Barra, F. Bossa and V. Schirch, J.
Biol. Chern. 262: 5499-5509.
5. J.R. Broach, J.N. S,trathern and J.B. Hicks, Gene 8:121-133 (1979).
6. J. Sambrook, E.F. Fritsch abd T. Maniatis, "Molecular Cloning a Laboratory
Manual" , 2nd ed., Cold Spring Harbor Laboratory Press, Cold Spring
Harbor NY (1989).
7. B.Schmidt, E. Wachter, W. Sebald and W. Neupert, European J. Biochem. 144:581-
588 (1984)
8. F. Doignon, N. Biteau, M. Crouzet and M. Aigle, Yeast 9:189-199 (1993).
714
SERINE HYDROXYMETHYLTRANSFERASE: ROLE OF THE ACTIVE
INTRODUCTION
PURIFICATION PROCEDURE
Growth of E. coli.
The mutant enzymes are expressed from a plasmid containing the glyA gene in the E. coli
strain GS245, which has a deletion of the wild type glyA gene. One liter of 1.5X LB broth
containing 50 Jlg per L ampicillin was inoculated with a single colony of GS245 E. coli
grown overnight at 37 °C on LB agar plates supplemented with 50 Jlg of ampicillin. This
liter of overnight culture was used to inoculate 20 liters 1.5 X LB broth supplemented with
0.5 % glucose and 100 mM potassium phosphate, pH 7 .0. The cells were grown with
aeration at 37 °C until the O.D.6Qo reached 6 to 7 (normally this took 6 hours). The cells
were harvested by centrifugation at 6,000g in a Dupont GSA rotor. Normally 200 to 250 g
of cells were obtained.
716
First hydroxylapetite column
Phenyi-Sepharose column
The yellow protein solution with 40% saturated ammonium sulfate was added to a 4 em
x 12 em column of phenyl Sepharose equilibrated with a 40% saturated ammonium sulfate
solution in 20 mM potassium phosphate and 0.2 mM pyridoxal-P, pH 7.2. A yellow band
formed at the top of the column. The proteins were eluted with a linear gradient (A buffer
was 400 ml of the 40% ammonium sulfate equilibration solution, and the B buffer was 400
ml of 20 mM potassium phosphate, pH 7.2). A yellow band moved down the column and
was eluted at the end of the gradient. A colorless protein was eluted immediately after the
yellow band of protein. Normally, base line resolution was not obtained between these two
proteins. The yellow protein fractions were collected until the absorbance at 278 nm stopped
decreasing. The fractions containing the yellow solutions were pooled and concentrated with
75% ammonium sulfate as described above. The dissolved precipitate was dissolved in a
small volume and dialyzed overnight against 20 volumes of 20 mM potassium phosphate, pH
7.2.
717
precipitation confirmed that the enzyme contained one equivalent of either serine or glycine.
Addition of tetrahydrofolate to the K229Q•SHMT•Ser complex followed by acid precipitation
showed that the one equivalent of serine had been converted to glycine. Likewise, when
CH2-H4PteGlu3 was added to the K229Q•SHMT•Gly complex followed by acid
precipitation, 80% of the glycine had been converted to serine.
K229R SHMT
This mutant enzyme exhibited pyridoxal-P absorption maxima at 332 nm and 390 nm with
the 332 nm band being 1.5-fold higher than the 390 nm band. These two absorption maxima
are close to those of the pyridoxal phosphate aldehyde (388 nm) and its hydrated adduct (330
nm). Saturation of K229R SHMT with serine resulted in a decrease of the 332 nm band and
disappearance of the 390 nm band and the appearance of a new absorption band at 420 nm.
However, rapid removal of the serine by filtration at 4 °C resulted in a return to the original
spectrum within 2 min. These results suggest that this mutant enzyme is purified without
bound amino acid substrates and that the pyridoxal-P is bound as a free aldehyde (390 nm
band) and possibly a hydrated pyridoxal-P (332 nm band). The shift to 420 nm upon the
addition of serine shows that this enzyme can form an external aldimine, but it must be
unstable since removal of serine results in a rapid loss of the bound serine.
K229H SHMT
This mutant enzyme exhibits only a single pyridoxal-P absorption band at 334 nm.
Addition of serine or glycine did not alter the spectrum of the enzyme. Also, changes in pH
or the addition of NaCNBH3 did not alter the spectrum. We conclude that this mutant
enzyme has pyridoxal-P bound in a nonreactive form. No further studies were done with
this mutant enzyme.
CONCLUSIONS
The results with K229Q SHMT indicate that the active site lysine is required to release the
amino acid product, either serine or glycine, as found in other pyridoxal-P enzymes.
However, unlike aspartate aminotransferase, the active site lysine in SHMT does not appear
to be the base which removes the pro2S proton of glycine (alpha proton) to form the
quinonoid complex. This step is essential in the conversion of glycine to serine. The active
site base which accepts this proton is still not known.
ACKNOWLEDGMENT
This research was supported by Grant GM 28143 from the National Institutes of Health.
REFERENCES
718
PURIFICATION OF NEUROSPORA CRASSA CYTOSOLIC SERINE
HYDROXYMETHYLTRANSFERASE
Department of Botany
University of Alberta
Edmonton, Alberta, T6G 2E9, Canada
INTRODUCTION
We report in this study the purification and characterization of cytosolic SHMT from
Neurospora crassa mycelia and compare its properties to the enzymes purified from other
sources.
PURIFICATION PROCEDURE
The enzyme does not appear to be present in high concentrations in wild type N. crass a,
which makes its purification from this strain difficult. However, studies have shown that
The Neurospora crassa methionine auxotroph, met-6 (FGSC no. 1330) was maintained
on agar slants of Vogel's media containing 2% (w/v) sucrose, 2% (w/v) agar, and 1 mM
D, L-methionine. For the purification of SHMT, fresh agar slant cultures of the met-6
mutant were used to inoculate two 1 L sidearm flasks, each containing 1 L of Vogel's media
supplemented with 2% sucrose and 1 mM D,L-methionine. A sterile loop was used to
transfer an inoculum from the agar slants to the 1 L flasks. The 1 L cultures were incubated
at 30 oc with aeration for approximately 24 hours. These cultures were then used to
inoculate a 20 L carboy containing 20 L of Vogel's media supplemented with 2% sucrose, 50
J.LM D,L-methionine, 10 mM glycine, and 0.5 mM pyridoxine. Approximately 50 J.Lg/ml of
ampicillin was also included to prevent bacterial contamination. Each of the 1 L cultures was
poured into the 20 L carboy, which was then incubated at 30 °C with aeration for about 36
hours. Mycelia were harvested by pouring the 20 L culture through a colander. The mycelia
were rinsed thoroughly with distilled water and stored at -70 °C.
DEAE-Sepbadex Column
The pH and conductivity of the supernatant were adjusted to 7.2 and 3000 J.LMHOS,
respectively, and the solution was immediately applied to a DEAE-Sephadex column (7 x 13
em) equilibrated in 20 mM potassium phosphate, pH 7 .2. The column was washed with
equilibration buffer until the absorbance at 280 nm was less than 0.1. The enzyme was
eluted with a linear gradient of 1 L of equilibration buffer and 1 L of 100 mM potassium
phosphate, pH 6.5, containing 400 mM sodium chloride. The eluant was collected in 20 ml
fractions that were assayed for SHMT activity using a coupled enzymatic assay. The SHMT-
catalyzed aldol cleavage of serine with I4PteGlun to glycine and 5,10-CHz-H4PteGlu was
measured at 340 nm by coupling with the 5,10-CHz-tetrahydrofolate dehydrogenase activity
of C1-tetrahydrofolate synthase, which converts NADP+ to NADPH. Fractions containing
activity were pooled, and the protein was precipitated by addition of solid ammonium sulfate
to 75% of saturation (516 g/L). This suspension was centrifuged at 13,000g for 20
minutes, and the pellet was resuspended in equilibration buffer. The solution was then
dialyzed overnight against equilibration buffer.
720
Blue-Sepharose Column
The next day, the dialysate was applied to a Blue-Sepharose column (7 x 4 em)
equilibrated with 20 mM potassium phosphate, pH 7.2. The column was washed with
equilibration buffer until the absorbance at 280 nm was less than 0.1. The enzyme was then
eluted with 20 mM potassium phosphate, pH 7.2 containing 1 M sodium chloride. The
eluant was collected in 20 ml fractions that were assayed for enzyme activity using the
coupled enzymatic assay. Fractions containing SHMT were pooled and ammonium sulfate
was added to 40% of saturation (243 giL). This solution was then centrifuged at 13,000g for
20 minutes at 4 oc and the pellet was discarded.
Phenyi-Sepharose Column
The supernatant from the 40% ammonium sulfate fractionation was immediately applied
to a Phenyl-Sepharose column (3 x 12 em) equilibrated in 50 mM potassium phosphate, pH
7.2, containing 40% ammonium sulfate and 0.1 mM pyridoxal phosphate. The enzyme was
eluted with a linear gradient of 250 ml of equilibration buffer and 250 ml of 20 mM
potassium phosphate, pH 7.2. The enzyme elutes near the end of the gradient. The eluant
was collected in 10 ml fractions that were assayed for activity using the coupled enzymatic
assay. Fractions containing activity were pooled, and the protein was precipitated by the
addition of ammonium sulfate to 75% of saturation. The precipitate was then dissolved in 20
mM N, N-bis-(Hydroxyethyl)-2-aminoethanesulfonic acid (BES), pH 7.2, and exhaustively
dialyzed against this buffer.
Hydroxylapatite Column
The dialyzed enzyme was applied to a hydroxylapatite column (3 x 3 em) equilibrated
with 20 mM BES, pH 7.2. After thoroughly washing the column with equilibration buffer,
the adsorbed SHMT was eluted with a linear gradient of 200 ml of equilibration buffer and
200 ml of 50 mM potassium phosphate, pH 7.2. Fractions containing activity were pooled,
and the enzyme was precipitated by the addition of ammonium sulfate to 75% of saturation.
The precipitate was resuspended and dialyzed against an appropriate buffer.
The enzyme obtained from the hydroxylapatite column is greater than 95% pure based
on SDS-PAGE analysis. The overall purification is 746-fold with a 30% yield (Table I).
Approximately 50 mg of enzyme was obtained from 450 g (wet weight) of mycelia.
Purification Step Vol (ml) mg/ml Total Units Specific Activity Fold %Yield
(Jlmol/min) (Jlmol/min/mg) Purification
*The low activity after this step could be due to high concentrations of sodium chloride.
721
DISCUSSION
The most important question we wished to address was how N. crassa SHMT
compares to the mammalian SHMTs purified and characterized from other organisms. The
overproduction of SHMT by the met-6 mutant of N. crassa allowed for a simple and rapid
purification of the enzyme. Partial sequencing of the pure enzyme was carried out by a group
of collaborators at the University of Rome. However, during this process the sequence for
the cloned N. crassa cytosolic SHMT gene was published.9 Since the partial sequence we
obtained was identical to the published sequence, we concluded that we had purified the
cytosolic form of the enzyme. This sequence was also used to obtain a calculated extinction
coefficient of 37,500 M-lcm-1_10
Like the mammalian enzymes, N. crassa SHMT is a tetramer of identical 54 kDa
subunits. This was determined using SDS-PAGE analysis and agrees with the predicted
amino acid sequence obtained from the cloned cytosolic SHMT gene, which would result in a
protein with a molecular weight of 53 kDa.9 Molecular sieve chromatography experiments
using a TSK G4000 HPLC column result in a native molecular weight value of 230 kDa,
indicating a tetramer of identical subunits. These results are similar to those obtained for the
rabbit isoenzymes which are also tetramers of identical 54 kDa subunits.ll
The bound pyridoxal phosphate of the N. crassa enzyme displays the same spectral
properties as the enzyme from other sources. Furthermore, the enzyme shows the same
reaction specificity, catalyzing the cleavage of serine, allothreonine, and 3-phenylserine, as
well as the transamination of D-alanine. The enzyme also displays absorption maxima at
either 492 nm or 502 nm due to the SHMT•Gly•R4PteGlun and SHMT•Gly•5-CHO-
H4PteGlun ternary quinonoid complexes, respectively. As with the rabbit liver cytosolic
enzyme, N. crass a SHMT is stabilized to heat denaturation by the polyglutamate forms of 5-
CHO-H4PteGlun. Although the dissociation constants for folylpolyglutamate derivatives
have not been determined, these studies indicate that the N. crassa enzyme probably has a
polyglutamate binding site, and thus a much higher affinity for polyglutamate folate
derivatives. Like the rabbit liver enzyme, N. crassa SHMT also catalyzes the synthesis of 5-
CHO-H4PteGlun from 5,10-CH+-H4PteGlun in the presence of glycine. Both enzymes
show biphasic kinetics consisting of a rapid burst phase followed by a much slower rate.
Stopped-flow kinetic studies have shown that 5-CHO-IilPteGlun polyglutamates are slow,
tight-binding inhibitors of the N. crassa enzyme. Therefore, like the rabbit liver enzyme, the
N. crassa enzyme can synthesize its own inhibitor in the presence of glycine.
ACKNOWLEDGMENTS
This work was supported by Grant GM 28143 from the National Institutes of health.
REFERENCES
1. L. Schirch, in "Folates and Pterins: Chemistry and Biochemistry of Folates" (R. L.
Blakley and S. J. Benkovic, eds) Vol. 1, p. 399-432. Wiley-Interscience, New York
(1984).
2. V. Schirch, S. Hopkins, E. Villar and S. Angelaccio, J. Bacterial. 163:1-7 (1985).
3. D. Henricson and I. Ericson, Phys. Plantarum 74:602-606 (1988).
4. M. Sakamoto, T. Masuda, Y. Yanagimoto, Y. Nakano and S. Kitaoka, Agric. Bioi.
Chern. 55:2243-1149 (1991).
5. N. Sukanya, M. Vijaya, H. S. Savithri, A. N. Radhakrishnan and N. A. Rao, Plant
Physiol. 95:351-357 (1991).
6. E. A. Cossins and P. Y. Chan, Phytochemistry 23:965-971 (1984).
7. E. G. Burton and R. L. Metzenberg, Arch. Biochem. Biophys. 168:219-229 (1975).
8. E. A. Cossins, P. Y. Chan and G. Combepine, FEBS Letters 54:286-290 (1975).
9. C. R. McClung, C. R. Davis, K. M. Page and S. A. Denome, Mol. Cell. Bioi. 12:1412-
1421 (1992).
10. H. Edelhoch, Biochemistry 6:1948-1954 (1967).
11. L. Schirch,Adv. Enzymol. Relat. Areas Mol. Biol. 53:83-112 (1982).
722
PURIFICATION AND PROPERTIES OF RABBIT LIVER
5,10-METHENYLTETRAHYDROFOLATE SYNTHETASE
Patrick Stover, Teng Huang, Verne Schirch, Bruno Maras, Sofia Valiante and
Donatella Barra
INTRODUCTION
The only known enzyme to use 5-formyltetrahydrofolate and its polyg1utamate forms (5-
CHO-H4PteGlun) is 5,10-methenyltetrahydrofolate (5,10-CH+-H4PteGlun) synthetase.1,2
This enzyme catalyzes the ATP dependent reaction shown in Equation 1. All attempts to
demonstrate the reverse reaction have failed, suggesting that this reaction is functionally
irreversible. Since 5-CHO-H4PteGlun and 5,10-CH+-H4PteGlun can be reversibly
interconverted nonenzymatically, the role of ATP in this reaction is apparently to shift the
equilibrium far to the right. It has been proposed that methenyl-tetrahydrofolate synthetase is
a salvage enzyme which converts the nonenzymatically formed and nonmetabolically active
5-CHO-R4PteGlun back into the one-carbon donor folate pool.l However, it is also possible
that methenyltetrahydrofolate synthetase is part of a regulation system in the cell in which its
substrate 5-CHO-H4PteGlun plays a role as a regulator of one-carbon metabolism by
inhibiting other folate requiring enzymes.
This enzyme has been purified from both eucaryotic and procaryotic sources, and in
each case is a monomeric protein about 28 kDa in size.l-3 The most extensive studies have
been done with the rabbit liver enzyme. I The properties of this enzyme relate to its putative
function in the cell. Although the enzyme is present in cells at low concentrations, a rapid
purification procedure has been developed which permits obtaining 15 to 20 mg of
homogeneous enzyme from 15 rabbit livers in 3 days. This purification procedure is
different than the published procedure and will be given in detail in the following paragraphs.
A key to the new purification procedure was the observation that the enzyme is stabilized by
non-ionic detergents like Tween-20. The presence of this detergent at concentrations as low
as 0.1% permits long term storage at -70 OC without loss of activity.
Fifteen frozen rabbit livers were broken into small pieces by placing them in a plastic
bag and fracturing with a hammer. After partial thawing the liver pieces were placed in a
blender and homogenized with 1500 ml of homogenization buffer (20 mM dipotassium
phosphate, 20 mM 2-mercaptoethanol, 12% (v/w) polyethylene glycol 3350 (PEG)).
Homogenization was performed for 45 seconds and the resulting slurry centrifuged at
10,000g for 25 min. The pellet was discarded and the volume of the supernatant recorded.
The supernatant was brought from 12% to 40% PEG by the addition of solid PEG. After
stirring for a few min the slurry was again centrifuged for 25 min at 1O,OOOg. The pellet
contains the trifunctional enzyme CHetrahydrofolate synthase, which can be purified to
homogeneity by a previously published procedure. However, the methenyltetrahydrofolate
synthetase activity was in the supernatant. The volume of the supernatant was between 1 and
1.5 L. If lipid debris was floating on the supernatant, it was passed through glass wool.
Hydroxylapetite column
724
This synthetase solution was very dilute and contained both excess 5-CHO-f4PteGlu and
Tween-20. Each of these molecules stabilize the synthetase. Concentration of the dilute
solution can be accomplished by several methods. One method used was to lyophilize the
solution and redissolve the dried paste in a small volume of KBES buffer. The excess 5-
CHO-H4PteGlu and Tween-20 were removed by passing the enzyme solution through a
Sephadex G-25 column (3 em x 20 em) equilibrated with 20 mM potassium phosphate, pH
7 .2, 5 mM 2-mercaptoethanol and 0.1% Tween-20. An alternative method used to
concentrate and remove the excess 5-CHO-H4PteGlu and Tween was to dialyze the dilute
synthetase solution against 20 mM potassium phosphate, pH 7 .2, under a vacuum until the
volume was reduced to less than 15 mi. The enzyme was then further dialyzed to remove
additional5-CHO-R4PteGlu and Tween. However, this final dialysis buffer contained 0.1%
Tween-20. The final enzyme preparation was judged to be pure by SDS-PAGE
electrophoresis. Two closely spaced bands were sometimes found on the stained gel, but
both were due to methenyltetrahydrofolate synthetase.
CONCLUSIONS
Even though cell homogenates of rabbit liver contain only small amounts of
methenyltetrahydrofolate synthetase, the activity of this enzyme is high and can be readily
measured. We first proposed that this enzyme probably served as a salvage pathway for
converting 5-CHO-H4PteGlu back to a metabolically active form of one-carbon folate
compounds. I This is based on the observation that no enzyme has yet been found which
uses 5-CHO-R4PteGlu as a one-carbon donor. The origin of cellular 5-CHO-f4PteGlu was
thought to be the nonenzymatic hydrolysis of 5,10-CH+-H4PteGlu to 5-CHO-H4PteGlu.
However, this is a slow reaction, and with the high activity of the synthetase there should be
no accumulation of 5-CHO-H4PteGlu in the cell. Recently we have shown that serine
hydroxymethyltransferase catalyzes the hydrolysis of S,10-CH+-H4PteGlu to 5-CHO-
725
I4PteGlu in an irreversible reaction.? Together, the methenyltetrahydrofolate synthetase and
serine hydroxymethyltransferase reactions result in a futile cycle in the interconversion of
5,10-CH+-H4PteGlu and 5-CHO-H4PteGlu. Futile cycles are often part of a regulation
mechanism for controlling the cellular level of an important metabolite. Others have shown
that cellular concentrations of 5-CHO-f4PteGlu in mammalian cells represent about 10% of
the total folate pool, and in at least one case, raising this level two-fold results in an 80%
decrease in cell growth.8,9 These observations suggest that 5-CHO-H4PteGlu may be a
regulator of one-carbon metabolism and that methenyltetrahydrofolate synthetase is part of
the regulation system for maintaining its cellular concentration. We have also observed that
5-CHO-H4PteGlun polyglutamates are slow tight binding inhibitors of SHMT and that in
liver the concentration of SHMT is greater than the concentration of 5-CHO-f4PteGlun.10
This suggests that in vivo most of the 5-CHO-f4PteGlun is bound and not readily available
to methenyltetrahydrofolate synthetase as a substrate. This could account for why there is a
pool of 5-CHO-f4PteGlun in most cells.
ACKNOWLEDGMENT
This research was supported by Grant GM 28143 from the National Institutes of Health.
REFERENCES
726
FOLATE METABOLISM IN PREGNANCY
INTRODUCTION
Folate plays a crucial and indispensible role in cell division so it is not
surprising that it is important in pregnancy. This importance was first
highlighted by the historical observation made by Lucy Wills in India 1 that the
latter stages of pregnancy are frequently associated with a megaloblastic anaemia
that is folate responsive, i.e. in pregnancy not only is extra folate needed but it is
frequently lacking. Subsequent studies over the years have found that folate
deficiency in the second and particularly the third trimester is common in some
countries and quite rare in others. The determining feature was found to be
adequate folate nutrition for the mother not only during pregnancy but before the
pregnancy began2. The most often suggested mechanism for folate deficiency in
pregnancy is increased requirement for the rapidly growing fetus and placenta.
However the mechanism is unclear and certainly cannot be accounted for by
transfer of the vitamin to the fetus. One possible explanation is that the events of
fetal/placental growth cause an increase in the rate of catabolism of the vitamin.
Early studies in our laboratory demonstrated that the mechanism of folate
catabolism in the rat was cleavage of the C9-N10 bond with excretion of a mixture
of pteridines and p-aminobenzoylglutamate (pABGlu) with the latter being largely
acetylated to acetamidobenzoylglutamate (apABGlu)3. Subsequent studies by us in
the rat4 and by Krumdieck 5 in man confirmed this mechanism. These studies
used radioactive tracers. They had the disadvantage that they assumed that the
exogenous tracer would equilibrate with the endogenous pool given sufficient
time. In addition while they could be used to compare rates of catabolism in
specific circumstances between animals, say treated with convulsant drugs and
controls 6 , they did not measure true endogenous rates of catabolism.
Furthermore, since they used radioactive tracers they were unsuitable for routine
studies on humans.
MATERIALS
The materials used were as described in the two papers recently published
on the method for analysis of folate catabolism in rat urine 7 and in human
urine 8.
METHODS
Exact details of the HPLC procedures used to quantitate the folate catabolites
in rat urine 7 and human urine8 were as previously described.
In the human studies six normal parous volunteers were followed for their
catabolite excretion from their first booking clinic until post partum. They
consumed a complete liquid enteral feed (Fortisip by Cow and Gate) for an 18 hour
wash out period, followed by a 24 hour collection period. Six non pregnant healthy
women of the same age consuming the same diet were used as controls.
RESULTS
As can be seen from Figure 1, both groups of pregnant rats showed
increases in weight reaching significance just before parturition at 21 days. The
excretion of the folate catabolite apABGlu showed elevation in both pregnant
groups compared to the non pregnant control group (Fig. 2). This was significant
by day 6 in the Pregnant Free-Fed group and by day 12 in the Pregnant Pair-Fed
Group. In both groups the values peaked at day 18 and most importantly fell
before parturition with day 18 being significantly greater than day 20 in both
groups. This drop in the rate of catabolism in late pregnancy (Fig. 2), where
weight continued to increase (Fig. 1), made weight gain alone an improbable
explanation of these results.
To further explore this relationship the weights of these rats were monitored
throughout pregnancy (Fig. 1). Non pregnant rats of equal weight were examined
at these different times to see what level of catabolite they were excreting. These
rats were of course older to achieve a similar weight. This comparison showed a
marginal increase in apABGlu excretion with increasing weight (0. 7 nmol per
lOg increase in weight) in non pregnant animals (Fig. 3).
728
350
PREGNANCY
0 Non·pregnant Fr1HHed
• Pregnam Pa1r-fcd
• Pregnant Free~ led
•• P<0.01
300
§
:c01 250
~
200
150~------~----~----~------~----~
-7 0 7 14 21 28
Days
Figure 1. The increase in weight over the 30 day period of the study in the three groups indicated
60 PRE G NANCY
0 Non-pregnant Free--fed
• Preg.nant Paw·fed
50 • Pregnant Ftee·fed
p <0.05
'0 .. p <0.01
p <0.001
"§
40
'6
E
c:
::J
<.? 30
co
~
a.
ttl
20
10 6 22
-2 2 10 14 18 26 30
Days
Figure 2. The excretion of the folate catabolite apABGlu over the 30 day period of the study in the
three groups indicated.
729
50
-- Pregnant Pa~r·fed
-.- Pregnant Free-led
- - D-- Non-pregnant we1ght matched
30
20
10
200 220 240 260 280 300
Weight (g)
Figure 3. The excretion of the folate catabolite apABGiu over the 30 day period of study in the final
group indicated.
300
• Tot:tl
liD apABGiu
pABGiu
0 folate
200
DAILY FOLATE
BREAKDOWN
(~g fol ate equi\'alents)
100
NON-
I'REG ANT
1st 2nd 3rd I POST
J>ARTUM
TRIMESTERS
Figure 4. The excretion of folate catabolites apABGiu and pABGlu, intake folates added to give total
loss of folate in six pregnant women. Also included are their postpartum excretion rates and
excretion of a group of six normal non pregnant control women.
730
DISCUSSION
The increases shown in folate catabolism would appear to be related to
pregnancy itself and not merely be a reflection of the increase in weight associated
with the latter stages of pregnancy.
In the rat model it was clear that non pregnant rats of weights comparable
to the weights found in late pregnancy excreted far less catabolite than the
pregnant counterpart (Fig. 3). Furthermore in both the rat and the human study
there was a statistically significant reduction in catabolism prior to parturition
(Fig. 2,4). Thus in the face of continuous weight gain at the end of pregnancy the
rate of catabolism actually falls. These decreases coincide in both species with a
time when there is a shift from hyperplastic growth to hypertrophic growth9,IO.
This latter finding may give a clue as to the nature of the increased rate of
catabolism seen in pregnancy. It would appear to be caused by a pregnancy
related event that diminished before parturition. An attractive possibility to
explain the initial increase in catabolism and the drop would be the rate of DNA
biosynthesis. A further attraction of this model is that uniquely amongst all folate
dependent reactions DNA biosynthesis produces the most labile of all of the folate
cofactors, namely dihydrofolate. The increased need to generate this labile species
may have a chemical price for the body, in that it may be more susceptible to
catabolism. Provided adequate dietary folate is available to replace this loss the
animal will suffer no disadvantage. However, should initial stores in pregnancy
be low or the amount recommended for ingestion in pregnancy (RDA) be
inadequate, then damage to the health of the mother and the embryo may ensue.
In this context the levels of inescapable catabolism found in our human subjects
may not be catered for by existing recommendations for pregnancy. These values
for the US call for 400 J.Lg per day in pregnancyll and the EC is shortly to come out
with a similar recommendation (in press). Slightly higher values of 370-470J.Lg
have been recommended by the WHO/FAO (1988)12.
More recent recommendations that have emerged from the U.K. suggesting
that a total intake of 300 J.Lg per day can cater for the increased needs of
pregnancy13 seem seriously low.
Allowing for 50% bioavailability and two standard deviations of the mean
level of catabolism, in excess of 600J.Lg per day would seem more appropriate.
REFERENCES
731
6 Kelly, D., Weir, D.G., Reed, B. and Scott, J.M., 1974, The effect of anticonvulsant
drugs on the rate of folate catabolism in mice. J. Clin. I nuest. 64 : 1089.
7 McNulty, H., McPartlin, J., Weir, D., and Scott, J.M., 1993, Reversed-phase
high-performance liquid chromatographic method for the quantitation of
endogenous folate catabolites in rat urine. J. Chromat. (In Press).
8 McPartlin, J., Courtney, G., McNulty, H., and Weir, D.G., 1992, The
quantitative analysis of endogenous folate catabolites in human urine.
Anal. Biochem. 206: 256.
9 Winick, M. and Noble, A. 1965, Quantitative changes in DNA, RNA and protein
during prenatal and postnatal growth in the rat. Deul. Biol. 12:451.
10 Winick, M., Brasel, J.A., and Rosso, P., 1972, Nutrition and cell growth. In :
Winick M. ed.Nutrition and cell growth, John Wiley, New York.
11 National Research Council, 1989, Recommended dietary allowances. National
Academy Press, Washington, D.C.
12 WHO/FAO 1988, Requirements of Vitamin A, iron, folate and vitamin B12 .
Rome : Food and Agricultural Organisation of the United Nations.
13 COMA, 1991, Dietary reference values for food, energy and nutrients for the
United Kingdom. COMA Report 41 H.M. Stationery Office London.
732
INFLUENCE OF GESTATION AND LACTATION ON THE LEVELS OF
PLASMA FOLATES IN SOWS
INTRODUCTION
Since the folate level decreases in plasma before its depletion, and this decrease in
plasma is paralleled by a reduction in red blood cell folate, the levels in plasma are
important clinical indicators that reflect folate status of the body of many mammalian
species. 1' 2 Pregnancy is one of the important factor that is associated with negative folate
balance, including progressively reduced serum and erythrocyte folate levels, and increased
urinary folate excretion. 1 N5-methyltetrahydrofolic acid (CH3-H4PteGlu) generally
comprises most or all of the plasma folate in many mammalian species. Recently,
however, tetrahydrofolic acid (H4PteGlu) was found to exist as the primary form of folate
in the plasma of pigs,3 suggesting interspecies differences in folate metabolism.
This study was undertaken to investigate the plasma levels of maternal folates during
gestation and lactation in sows. The levels of H4PteGlu and CH3-H4PteGlu were
determined simultaneously by using high-performance liquid chromatography with
electrochemical detection (HPLC-ECD). 4 Then the influence of gestation and lactation on
the levels of plasma folates, and specificity of folate metabolism in pigs will be discussed.
Forty commercial pigs (Large White, body wt 120-150 kg, 2-4 yr old) which were
housed in individual gestational cages with slatted floors on a commercial farm (Miyata
Pig Farm, Asamizodai, Kanagawa, Japan) were used. Pigs were fed daily 2.5 kg of
commercial basal diet which contains folates about 0.5 mglkg feed, as described
previously. 3
Blood was taken from tail vein in EDTA-coated test tubes before and during
gestation, and during lactation. Plasma samples were obtained by centrifugation at 2000
g for 5 min. Sodium ascorbate (3 mglml plasma), an antioxidant, was added to the
Cll
E 10
([)
Cll
0:::
0 30 60 90 120 0 30 60 90 120
Days of gestation
Figure 1. Individual levels of plasma folates (pmoVml) during gestation (day 1 to 117) in 16 sows. Lines
are drawn between the levels of the same animal.
Figure 2. shows plasma levels of H4PteGlu and CH3-H4PteGlu before gestation, early
gestation (day 1 to 60), late gestation (day 61 to 117), and during lactation in sows. As
pregnancy advanced, the levels of H4PteGlu decreased significantly. At the late gestation,
the mean level of H4PteGlu decreased to about 50 % of the level before gestation, which
was contrast to the little changes observed in the levels of CH3-H4PteGlu. During
lactation, plasma level of H4PteGlu was increased but not up to the level before gestation.
In the previous study, 3 most of the examined animals including humans, rats, mice,
horse, dogs and cows had no or trace (less than 1 pmol/ml) amounts of H4PteGlu in
plasma. And only CH3- H4PteGlu was detected in these species, which was quite contrast
to pigs.
734
Decreases of plasma folates during gestation have been reported in several species
including humans,5- 7 rats, 8 guinea pigs,9 and pigs.10 Matte et al. 10 observed a biphasic
decrease of total folates level in serum during gestation in sows. This study also
demonstrated the progressive decrease of plasma H4PteGlu during gestation. However no
statistical significance was observed among the levels of CH3-H4PteGlu throughout the
reproductive cycle. This result highly suggests the specificity of homeostasis of plasma
folates in pigs, since the other species have CH3-H4PteGlu as the principal congener in
plasma and the level is generally considered to decrease during pregnancy. 14
:€0
E
s
u
c
0
(.)
ell
E
~
0::
before early late
gestation gestation gestation lactation
Figure 2. Plasma levels of H4PteGlu and CH3-H4PteGlu before gestation (n=16), early gestation (n=28),
late gestation (n=29), and during lactation (n=15) in sows. Values are presented by mean +standard error.
*:
t,:l: : Significant vs before gestation ( t ; p<O.l, :1: ; p<O.Ol). Significant vs late gestation (p<O.Ol).
735
protein bindings of H4PteGlu in pig plasma.20 Therefore these results also suggest the
specificity in the homeostasis of folate in pigs. Further research is needed for studying this
protein(s) in pig plasma, related to tissue distribution of H4PteGlu. In this respect, we are
now characterizing this high-affinity binding protein(s) in pig plasma.
REFERENCES
736
IDENTIFICATION OF ENDOGENOUS TETRAHYDROFOLATE AND
10-FORMYLTETRAHYDROFOLATE AS MAJOR FOLATES IN RAT BILE
INTRODUCTION
Female Sprague-Dawley rats (about 13 weeks old, Clea Japan Inc., Tokyo, Japan)
were used. The bile sample was collected via bile duct catheter under urethan anesthesia
(intraperitoneal injection, 0.8 - 1.0 g!kg of body weight). The bile samples were collected
into ice-cold test tubes containing 0.5 % sodium ascorbate solution and stored at -80°C
until the HPLC analyses.
Chromatographic analysis was performed using HPLC systems. Analytical detectors
included an electrochemical detector (L-ECD-6A, Shimadzu Co. Kyoto, Japan) and a
photodiode array detector (Multi-340, Jasco, Tokyo, Japan). The mobile phase was a
acetate or phosphate buffer.
For the identification of bile folates, the retention time profiles and electrochemical
The chromatogram of rat bile obtained from HPLC-ECD analysis was shown in Fig.
1. The peaks A and B had the same retention time as those of standard 10-HCO-H4PteGlu
and H4PteGlu, respectively.
I 01 nA
standard
----bile
0 4 8 12 16 20
The consistency of retention time between the substances in bile and standards was
obtained for the various pH values of acetate buffer and for the various concentrations of
AN in the mobile phase (Table 1). This observation indicates that bile substances from
peaks A and B have the same values for the negative logarithm of acid dissociation con-
stant (pKa) and the same lipid solubility with 10-HCO-HlteGlu and H4PteGlu, respec-
tively.
The voltammograms of the bile substances indicating peaks A and B were almost
identical to those of standards including 10-HCO-H4PteGlu and H4PteGlu, respectively
(Fig. 2). This findings indicate that the bile substances have same electrochemical proper-
ties or redox potentials with those of standard folates.
The UV absorbance spectral curves of the bile substances obtained from peaks A and
B were very similar to those of standard 10-HCO-HlteGlu and H4PteGlu, respectively
(Fig. 3). This observation indicates that the bile substances have the same UV absorption
characteristics with those of standard folates.
738
The rates of bile secretion of 10-HCO-HlteGlu, HlteGlu and 5-CH3 -HlteGlu
were 314 ± 181, 321 ± 179 and 449 ± 198 ng!hr (mean± SD), respectively.
It has been suggested that 5-CH3-HlteGlu is the principal folate in rat bile 2 • Howev-
er, this study demonstrated that 10-HCO-HlteGlu and HlteGlu were also secreted as
major folates into bile. These nonmethylated folates may play an important role in the
folate homeostasis through enterohepatic circulation.
100
w
0
z
0
0...
(/)
w
a:
~
:::!
LL
0
~ 0
.0 .1 .2 .3 .4 .0 .1 .2 .3 .4
Figure 2. HPLC-ECD voltammograms of bile folates (solid line) and standards (dotted line).
739
10 -HCO-H 4 PteGiu
w 100
0
z
~
a:
0
(/)
(])
<(
w
>
~
w
a: 0
WAVELENGHTH (nm)
Figure 3. UVabsorption spectra of the bile folates (solid line) and standards (dotted line) obtained from
HPLC-PAD.
REFERENCES
1. S.E. Steinberg, C.L. Campbell, and R.S. Hillman, J. Clin. Invest. 64:83(1979).
2. S.E. Steinberg, Am. J. Physiol. 246:G319(1984).
3. M. Natsuhori, M. Shimoda, E. Kokue, T. Hayama, and Y. Takahashi, Am. J.
Physiol. 261:R82 (1991).
740
DEVELOPMENT OF A SENSITIVE ASSAY FOR DETECTION OF URACIL IN DNA
INTRODUCTION
1
Figure 1. Proposed mechanism for folate
deficiency causing an increased risk of
cancer. Low folate partially inhibits thymidylate tdUTP i ITP
/ ~
synthesis, causing an increase in dUTP levels and a
decrease in TfP. DNA polymerase then incorporates
dU into the DNA. 1 Uracil-DNA glycosylase removes
the uracil and repair enzymes excise several Attempted Repair ,.__.. dU Misincorporation
nucleotides on either side of the lesion. DNA
polymerase may insert another dU as it attempts to 1
fill this gap, resulting in repeated excision and Double Strand DNA Breaks
repair. If several uracils are on opposite strands in
the same vicinity, double strand DNA breaks occur. 5
Chromosome breaks decrease genetic stability and 1
Increased Risk of Cancer
increase cancer risk. 6
The method for quantitation of uracil in DNA is outlined in Figure 2. Briefly, DNA is
isolated from the tissue of interest by phenoVchloroform extraction. Uracil is specifically
removed from the DNA by incubation with 1 unit uracil-DNA glycosylase (UDG). Three
hundred picograms of the internal standard (ISN2-uracil) is then spiked into the sample.
After removing residual proteins and biological polymers with an acetonitrile precipitation,
the sample is derivatized with ditrifluoromethylbenzyl bromide (DTF.MBzBr) in
triethylamine. The sample is then cleaned up by separating excess derivatizing reagent and
other unwanted materials from the compounds of interest with a C-18 solid phase extraction
cartridge. The 100% ethanol eluant from these columns is concentrated under a gentle
stream of nitrogen and injected into a gas chromatograph fitted with a 12 meter DB-5
capillary column. A temperature gradient from 80°C to 280°C at 25°C per minute results in
sufficient resolution of uracil-diDTFMBz from interfering compounds. The uracil-
diDTFMBz and 1sN2-uracil-diDTFMBz are quantified by selected ion monitoring. The
detection limit is 30 picograms of uracil in 100 J..l.gs ofDNA (1 uracil per 106 thymine).
add internal
Ura-DNA-glycosylase standard DTFMBzBr C-18 cleanup
DNA - - - - - - + - - - + Uracil Uracil-diDTFMBz Quantitation
Digestion ACN Derivitization GCMS analysis
precipitation
Samples are analyzed by using electron impact mass spectrometry (El-MS) after the
resolved compounds exit the gas chromatograph. Uracil-diDTFMBz and its stable isotope
internal standard each have unique fragmentation patterns that make El-MS feasible. Figure
3 shows the EI mass spectrum and structure ofuracil-diDTFMBz.
227
100 Uracil-di DTFMBz
MW=564
<!)
80
a
u
CF3 FF
'"~.0~
"0
s::
:s 60
.D 294
<
Hyo
C~J~CH 2 H
<!)
;> 40
-.;:::;
~ 96 268 564
~ 20 177 545
0 I 3f7 l
100 200 300 400 500
Mass/Charge (m/z)
Figure 3. Uracil-diDTFMBz electron impact mass spectrum and structure. Note the
prominent molecular ion at 564. This fragment is monitored later for quantitation of trace amounts
of uracil. The EI mass spectrum of ISN2-uracil-diDTFMBz is identical except 564=566, 545=547,
337=339 & 294=295 as a result of the heavier ISN(s) in the internal standard.
742
We found that the molecular ions of uracil-diDTFMBz (m/z=564) and 15N2-uracil-
diDTFMBz (m/z=566) are the best to monitor for sensitive detection of the two
compounds. Mass 294 is more abundant but it has a lower signal to noise ratio. The
sensitivity of this assay was enhanced by monitoring only mass 564 for uracil detection and
566 for the 15N2-uracil internal standard. A typical chromatogram is shown in Figure 4.
. - 15 N2-Uracil-diDTFMBz
internal standard
Figure 4. Typical ion chromatogram of uracil from DNA as analyzed by our method. In
this example 75 pg of uracil was spiked with 300 pg of internal standard. The upper trace represents
mass 566; the peak at 7.79 minutes is the 15N2-uracil-diDTFMBz internal standard. The lower
trace is mass 564; the peak at 7.79 minutes is uracil-diDTFMBz.
Quantitation is accomplished by integrating the two peaks (such as those in figure 4) and
adjusting the uracil-diDTFMBz according to the amount of internal standard recovered.
The stable isotope labeled uracil has an identical recovery rate as uracil: approximately 60%.
El-MS of these compounds yields identical, linear responses from <10 pg to 5 ng. The
efficacy of the internal standard is demonstrated in figure 5.
. -!!!
2.00
....
.~
= ICIC
a.l
c...,. 1.00
....00
IC
,_,
I(')
...."'
0.00
0 200 400 600
Uracil (pg)
743
RESULTS
We are using this assay to study the effect of an organism's folate status on the uracil
content of its DNA. We induced folate deficiency in Fisher 344 rats either by feeding a
folate deficient diet or injecting methotrexate. These animals were also given a cell
proliferative stimulus (partial hepatectomy) to exacerbate misincorporation of uracil into the
DNA. Seven days after surgery the animals were killed and their entire liver removed.
Uracil content of this hepatic DNA was determined using our method. The following
statistically significant differences are of interest:
1. The methotrexate treated animals had higher levels of uracil in DNA than any other
group.
2. Folate sufficient and deficient animals had the same amounts of uracil in their DNA
before surgery.
3. Folate deficient animals maintained on this diet after surgery had a significant increase
in DNA uracil levels. Folate supplementation after surgery prevented this increase.
CONCLUSIONS
REFERENCES
1. Goulian, M., Bleile, B., & Tseng, B.Y. Proceedings of the National Academy of
Sciences (1980) 77(4): 1956-1960.
2. Reidy, J. Mutation Research (1988) 200: 215-220.
3. Krumdieck, C.L. "Nutritional Factors in the Induction and Maintainence ofMalignancy"
Bristol-Meyers Nutritional Symposia volume 2, pp 225-245, Academic Press, N.Y.
4. MacGregor, J.T., Schlegal, R., Wehr, C.M., Alperin, P. & Ames, B.N. Proceedings of
the National Academy of Sciences (1990) 87: 9962-9965.
5. Dianov, G.L., Timchenko, T.V., Sinitsina, O.I., Kuzminov, A.V., Medvedev, O.A., &
Salganik, R.I. Molecular and General Genetics (1991) 225: 448-452.
6. Croce, C.M. Cell (1987) 49: 155-156.
7. Everson, R.B., Wehr, C.M., Erexson, G.L., & Macgregor, J.T. Journal of the National
Cancer Institute (1988) 80(7): 525-529.
744
5-METHYLTETRAHYDROFOLATE URINARY EXCRETION: MODELING BY
CULTURED HUMAN KIDNEY CELLS
Charleston, SC 29425
INTRODUCTION
METHODS
RESULTS
746
Table 1. Cellular uptake of 5-CH3-THF, inulin and PAH by cultured HPT cells.
........ 1600
N
E
l __l_l
0
*Ill A 8
E
..c 1200
Vl
0
........,
Q)
0
T o-o-o-O
0/ ~ l
T
.L
T T
1 1
c 800
0
......
Ill
0
T/ 1
Til
/1
Ill
0
/
Q)
0::
0
400
·;:
0
0
......
0
0
I
Q)
0
w 0
0 2 3 4 5 6 7 0 30 60 90 120
Days of Culture Time (min)
Figure 1. Panel A shows the development of TER by HPT cells during 7 d of culture in standard growth
medium. Panel B shows the time-dependent recovery of TER at 25°C on d 6 after replacement of
standard growth medium at time 0 with pH 7.4 buffer. Values represent mean net TER (after subtraction
of "TER" values from collagen-coated inserts containing no cells) ± SEM of 4 cell isolates.
To determine whether the abolition of TER was associated with a loss of the
permeability barrier, the AP-BL and BL-AP flux of inulin was studied. Under "open"
conditions (5 min after TER was abolished), inulin flux was substantial in both
directions (AP-BL and BL-AP flux of 5.4 ± 0.5 and 7.0 ± 0.8 nmol/h/cm2). When
studied after recovery of TER ("closed" conditions), the flux was reduced to 0.4 and
0.3 nmol/h/cm2, respectively, suggesting reestablishment of the tight junction barrier.
The transmembrane transfer of 5M was dramatically decreased (100 fold) when
uptake studies were conducted under "closed" conditions, i.e. after recovery of TER.
(Table 2). Transmembrane transfer under these conditions was partly suppressed by
excess 5M, suggesting movement through a specific cellular pathway rather than via
paracellular leakage. Cellular 5M uptake (AP membrane binding and intracellular
transport) occurred by specific processes and was similar whether 5M was applied AP
or BL.
747
Table 2. Folate transport by HPT cells with closed tight junctions.
Initial attempts to model urinary folate reabsorption using cultures of HPT cells
on porous filter inserts produced disappointing results in that large amounts of SM
were transported across the epithelial monolayer in a nonspecific manner. Since the
impermeable molecule inulin was also transported, there apparently existed a
significant leakage pathway in the way that the cultured cells were used for transport
studies. SM was bound to the AP membrane and taken up into the HPT cell by
specific processes, while inulin was excluded, suggesting that the HPT cells were
nevertheless operating functionally. TER values from cultured HPT cells plateaued
at a high level when cells became confluent, suggesting an epithelial layer with
functional tight junctions. However, when growth media were removed and replaced
with transport buffers, there was an immediate loss of TER that fully recovered if the
transport buffers were preincubated for 60 min. Under these conditions, transport
studies showed the expected results - no movement of inulin through the cell layer and
much reduced transfer of folate through the paracellular pathway. These results
suggest that a transient opening of tight junctions occurs when growth media are
replaced with biological buffers (or with fresh growth media), but that recovery of tight
junction function occurs with time.
ACKNOWLEDGEMENTS
REFERENCES
1. R.T. Muldoon, B.E. Eisenga, K.M. Morshed, and K.E. McMartin, J Nutr. 122:2415-23 (1992).
2. K.E. McMartin, K.M. Morshed, D.J. Hazen-Martin, and DA. Sens,Amer! Physiol. 263:F841-8 (1992).
3. J.G. Blackburn, D.J. Hazen-Martin, C.J. Detrisac, and DA. Sens, Kidney Int. 33:508-16 (1988).
4. C.J. Detrisac, MA. Sens, A.J. Garvin, S.S. Spicer, and DA. Sens, Kidney Int. 25:383-90 (1984).
5. B. Gumbiner, Amer J Physiol. 253:C747-58 (1987).
748
CONTRIBUTION OF PLASMA PROTEIN BINDING TO THE STABILITY
OF TETRAHYDROFOLATE IN PIG PLASMA
INTRODUCTION
Plasma folate takes important roles in folate homeostasis in the body 1. The principal
folate in plasma has been recognized to be is 5-methyltetrahydrofolate in many species2•
Recently Natsuhori et al. 3 demonstrated that the principal folate in pig plasma is
tetrahydrofolate (H4 PteGlu). H4 PteGlu is, however, very susceptible to oxidation and
plasma contains oxidizing agents such as oxygen and peroxides. This study examined
stability of HlteGlu in pig plasma with relation to its protein binding.
Blood was obtained from 5 adult Goettingen miniature pigs. The pooled plasma was
adjusted pH to 3.0 with 1 N HCl and kept at 4 °C for 30 min, in order to degrade endoge-
nous H4PteGlu. After adjusting pH to 7.4 with 1 N NaOH, 1 ml aliquots of the treated
plasma were stored at -80 °C until experiment.
After adding HlteGlu into the plasma sample, its stability was monitored using a
reversed phase high-performance liquid chromatography with electrochemical detection 4 •
Sodium ascorbate was added into the sample to stop degradation of H4 PteGlu.
HlteGlu solution and sodium ascorbate solution were added into theylasma sample,
and the mixture was ultrafiltrated with Amicon Micropartition SystenfBJ(Japan Grace,
Tokyo, Japan). Ultrafiltrates were analyzed by the HPLC system and unbound concentra-
150 %binding
E 0 55% •58%
OJ
s D 72% •82%
0
c a 90% 4 96%
0
(.)
ell
E
({)
ell
0::::
0
0 30 60 90 120
Time after addition (min)
Figure 1. Stability of H4PteGlu in pig plasma at various concentrations.
plasma
0 20 40 60
Time after addition (min)
750
In Figure 2 the stability of HlteGlu was compared between plasma and its ultrafil-
trate. In plasma filtrate HlteGlu rapidly degraded with a half-life of about 5 min even at
concentrations less than 35 ng/ml. This result suggests that binding proteins protect
H4PteGlu from degradation in pig plasma.
Binding kinetics of HlteGlu in pig plasma was also examined in this study. As is
shown in Figure 3, Scatchard plot showed 2 kinds of binding protein. Dissociation con-
stant and binding capacity of the high affinity binder were 1.9 x 10-9M (0.86 ng/ml) and
7.5 x 10-8M (33.3 ng/ml), respectively. The low affinity binder showed a linear binding in
the used concentration range (20 - 500 ng/ml).
12
The binding of H4PteGlu was competitively inhibited by folic acid, which indicates
that the binders for H4PteGlu in pig plasma are so called folate binding protein (FBP). As
is shown in Table 1, however, the inhibition was slight at the same concentration with
HlteGlu. Therefore, it is suggested that the high affinity binder in pig plasma has higher
affinity to H4PteGlu than folic acid, although it is generally accepted that high affinity
FBPs in plasma have higher affinity to folic acid than reduced folates such as HlteGlu5 •
751
Since binding kinetics of HlteGlu in this study indicates that almost all HlteGlu in
plasma can bind to the high affinity binder at basal levels of H4PteGlu, this binder may
mainly contribute to the stability of HlteGlu in pig plasma.
REFERENCES
752
LIGAND INDUCED CONFORMATION CHANGE
IN FOLATE BINDING PROTEIN
INTRODUCTION
METHODS
Protein Preparation. FBP was isolated from cow's whey and purified as described1 •
A concentrated stock solution (10 mg!ml) of FBP in 0.2 M acetate buffer, pH 5.0, was
stored frozen until required. Protein concentrations were determined by UV absorbance
using E280 = 6.816 x 104 M-1cm-1• This value is based on a molecular weight of 29,000
da1 •
2 I \
I \
!J \
!J \
w \
<l 0 /---
/
-1 I
I
I
-2 I
~'/
-3
180 200 220 240 260
Wavelength (nm)
Figure 1. Far-UV CD spectra of FBP and FBP-PGA complexes. The spectrum of 25 t-tM unligated FBP
( ) is compared with that of the FBP-PGA complex (25 ~-tM FBP + 25 t-tM folate) in 10 mM
sodium acetate, pH 5.0 (----).Note that 25 t-tM folate per se has no measurable CD spectrum under
these conditions.
G)
C)
~ 200
C)
l:ll
G)
'g
"' 100
~
0 E:::__ __._____::::::::~~Cialao--...l
Wavelength (nm)
Figure 2. Tryptophan emission spectra (excitation 290 nm) of FBP and the effect of folate binding in 10
mM Tris/Cl04-, pH 7.0, at 25 °C. Fluorescence emission spectra for 0.4 t-tM FBP ( ) and the effect
of PGA additions: 0.082 nM ( - - - - ) , 0.166 (-- -), 0.248 (" ....), 0.329 (-·-), 0.410 (-··-),
0.610 ( - - - - --), and 0.807 (- - - ) t-tM.
754
optical density of protein plus solvent was less than 1.0 at 190 run. Typical protein
concentrations were 5 1-1M. All spectra were smoothed with a Fourier transform algorithm
and the appropriate background spectra subtracted. The result, ~E, is based on the molar
concentration of peptide bond. Secondary structures were predicted from 180-260 nm CD
spectra using singular value decomposition combined with variable selection3• For this
purpose, a set of 22 reference proteins with known CD spectra and X-ray structures was
used4•
RESULTS
PGA Induced Changes in Secondary Structure of FBP. Figure 1 shows the far-
UV CD spectrum of 25 1-1M FBP at pH 5. The spectrum shows two negative bands with
the minimum at 209 nm and a shoulder located at 220 run. A positive band shows
maximum at 192 run, and the cross-over point is located at 199 run. Figure 1 also shows
the spectrum of a mixture of 25 1-1M FBP and 25 1-1M PGA at pH 5. As a result of
complex formation, the intensity of the positive band increases and the maximum shifts
to 194-195 nm. The crossover point is red-shifted by 2 run and the relative intensities of
the negative bands at 209 and 220 nm are inverted. Note that 25 1-1M PGA per se has no
measurable CD spectrum at 0.01 em cell pathlength. A secondary structure analysis for
free and ligated FBP showed that complex formation resulted in a loss of 10% antiparallel
B-strand.
755
,......
E 300
0
=
II)
~
200
4)
0
c4)
0
(/) 100
....
4)
0
:::l
~ 0
0 200 400 600 800
[PGA] (nM)
Figure 3. Quench of FBP tryptophan fluorescence as a function of PGA addition at various pH. The protein
concentration was 400 nM, excitation was effected at 290 nm. pH 3 (+), 4 {t.), 5 (0), 6 ( .t. ), 7 (e), 8 (D), and
9 {•).
REFERENCES
1. I. Svendsen, B. Martin, T.G. Pedersen, S.I. Hansen, J. Holm, and J. Lyngbye, Carlsberg Res. Commun.
44, 89. {1979).
2. S.I. Hansen, J. Holm, J. Lyngbye, T.G. Pedersen, and I. Svendsen, Arch. Biochem. Biophys. 226, 636.
(1983).
3. J.P. Hennessey, and W.C. Johnson, Biochemistry 20, 1085. (1981).
4. W.C. Johnson, Proteins 7, 205. (1990).
5. B. Birdsall, R.W. King, M.R. Wheeler, C.A. Lewis, S.R. Groode, R.B. Dunlap, and G.C.K. Roberts, Anal.
Biochem. 132, 353. (1983).
6. S.l. Hansen, J. Holm, and J. Lyngbye, Biochim. Biophys. Acta 535, 309. {1978).
756
THE HIGH-AFFINITY FOLATE BINDING
PROTEIN IN NORMAL AND MALIGNANT
MAMMARY GLAND TISSUE
INTRODUCTION
Human milk contains a soluble 25 kDa folate binding protein (FBP) as well as a
membrane-derived FBP with a hydrophobic glycosyl-phosphatidylinositol tail; the
enzyme phosphatidylinositol specific phospholipase C reduced the apparent size of the
latter FBP from 100 to 25 kDa1• The two FBPs from human milk had identical N-
terminal amino acid sequence for 39 cycles and shared antigenic determinant!1·3 • A high
correlation between the concentrations of FBP and folate in milk suggested the secretion
of a folate mammary FBP complex into milk4• In the present study we have characterized
and compared FBP in the normal mammary gland and mammary tumors.
METHODS
Mammary gland tissue was homogenized in 5 mM Tris/HCl buffer (pH 7.4, 4°C)
containing 5 mM mannitol (5 ml of buffer/g of tissue). Homogenate solubilized (2h, 4°C)
with Triton X-100 (20 gil) was centrifuged (1000 g, 30 min) and the supernatant used for
analysis.
20
10
10
0 0
0 1 2 3 0 1 2 3 4
B nM B nM
Figure 1. Scatchard plots showing high-affinity binding of 3H-folate to normal mammary gland tissue
homogenate (left) and mammary tumor tissue homogenate (right). Each point represents a single result.
Abscissa, bound folate (B). Ordinate, bound/free folate (B;F).
2 3
106
80
49.5
32.5
27.5
18.5
758
In some experiments with normal mammary gland tissue the upper lipid-containing
(triglyceride-rich) layer from 1000 g supernatant was mixed with Triton X-100 (30 gil),
stirred for 90 min and centrifuged (35000 g, 30 min); the pellet was used for analysis. All
tissue preparations were stripped for endogenous folate by dialysis against 0.2 M acetate
of pH 3.5. Binding of 3H-folate was determined by equilibrium dialysis (37°C, pH 7.4f
759
Figure 3. Upper part, immunostaining of mammary tumor sections after exposure to
rabbit anti human milk FBP serum. Lower part, control sections exposed to pre-
-immune rabbit serum.
REFERENCES
1. S.I. Hansen, and J. Holm, Biosci. Rep. 12:87 (1992).
2. I. Svendsen, S.I. Hansen, J. Holm, and J.Lyngbye, Carlsberg Res. Commun. 47:371 (1982).
3. M. H0ier-Madsen, S.I. Hansen, and J. Holm, Biosci. Rep. 7:553 (1987).
4. J. Selhub, R. Arnold, A.M. Smith, and M.F. Picciano, Nutrition Res. 4:181 (1984).
5. J. Holm, S.I. Hansen, M. H0ier- Madsen, and L. Bostad, Biochem. J. 280:267 (1991).
760
DETERGENT-INSOLUBILITY DURING THE BIOSYNTHESIS OF
MEMBRANE FOLATE RECEPTOR-2
INTRODUCTION
Membrane folate recepter (MFR) type 2 is one of the two isoforms originally identified
in human placenta 1.1n the rough Endoplasmic Reticulum MFR-2 is provided with N-linked
oligosaccharide chains and a glycosyl phosphatidylinositol (GPI) membrane-anchor, which
has been shown to serve as a signal for the targeting of proteins to the apical plasma membrane
domain in epithelial cells 2 It has been suggested that GPI-linked proteins are sorted in the Golgi
0
complex into microdomains enriched in glycolipids and cholesterol which leads to directional
transport to the apical domain J,4,so Recently, it has been shown that newly synthesized GPI-
linked proteins have less lateral mobility when they arrive at the plasma membrane as compared
to GPI-linked proteins that were allready present at the cell surface, again suggesting clustering
of GPI-linked proteins at the plasma membrane 6 0
At the plasma membrane, MFR-2 has been implicated in the receptor-mediated uptake of
naturally occurring folates and folate-based chemotherapeutic drugs 7 Specialized structures
0
at the plasma membrane called caveolae have been suggested to be involved in the internalization
ofMFRs 8 and it has been observed that GPI-linked proteins and integral membrane proteins
are internalized via distinct pathways 9 However, the internalization-mechanism has not yet
0
been entirely elucidated and therefore, we are currently studying the biosynthesis, internalization
and intracellular distribution of MFR-2 in KB cells, a human nasopharyngeal cell line
expressing high amounts ofMFR-2 10 0
KB cells were cultured in a 5% C02 atmosphere in RPMI 1640 without folic acid (Gibco),
supplemented with 10% dialyzed fetal calf serum and 1 nM of folinic acid. For metabolic
labeling cells were depleted from methionine and pulse-labeled at 37°C with [3 5S)methionine
for 15 minutes. Cell surface iodination was performed at 0°C using lactoperoxidase and 1251in
the presence of glucose-oxidase and Hp2• Next, the cells were chased at 37°C for the indicated
periods of time. After the chase period cells were occasionally incubated with lOOmU/ml
~e
chase (hours) 0.2% saponin
lysis lcmp. ('C)
lysis rcmp. ('C)
46·
46-
30-
30-
Figure 1. MFR-2 becomes partly insoluble in Triton X -100 during passage ofthe Golgi complex.
KB cells were metabolically labeled with [35S]methionine and chased for the indicated periods of time.
Molecular mass markers (kDa) are indicated on the left.
neuraminidase at 0°C and lysed in PBS containing 1% Triton X-100 and 1 mM PMSF at 0°C.
Next aliquots of the lysates were incubated at either 37°C or ooc in the presence of 0.2%
saponin. Control samples were kept at 0°C. Detergent-insoluble material was subsequently
removed by centrifugation at 10,000 x gat 4°C. Finally MFR-2 was immunoprecipitated and
analyzed on SDS-PAGE or isoelectric focussing gels with a linear pH-range from 4.4 to 8.2.
Iodination of Pte-ASA-LYS was performed using Iodobeads (Pierce) after which Pte-[1251]-
ASA-LYS was purified by thin layer chromatografy.
After pulse-chase labeling MFR-2 was initially detected as a 34 kDa band, which could
be completely solubilized in 1% Triton X-100 at ooc (Figure lA). After 4 hours of chase
(Figure lB) all ofthe protein was converted to the 36-38 kDamature protein, due to conversion
of the high mannose-type N-linked oligosaccharides to the complex-type in the Golgi complex.
Scanning of these bands in a laser densitometer revealed that only 35% of the mature species
could be solubilized at these conditions. Complete solubilization of mature MFR-2 was
observed after incubation of the lysate at 37°C or at 0°C in the presence of 0.2% of the
cholesterol-complexing agent saponin.
This result shows the existence of at least two differently organized pools ofmature MFR-
2 in post-Golgi membranes. Furthermore, cholesterol is probably involved in maintainance of
MFR-2 in Triton X-1 00-insolubl.) clusters. Figure 1C shows the time course ofbiosynthesis of
MFR-2 with respect to the acquisition of Triton X-100 insolubility. Conversion of34 kDa
MFR-2 into the 36-38 kDamatureproteinoccurs just before TritonX-1 00 insolubility ofmature
MFR-2 is initiated (Figure 2; compare chase= 60 and chase= 90 minutes). This indicates that
Triton X-100 insolubility is a late- or post-Golgi phenomenon as was also indicated by
treatment of these samples with endoglycosidase H (not shown). Similar results were obtained
762
A
B 0.2% saponin CEJ
lysis tcmp.(0C) ~
c 10
~ 8 30-
-.:;
tJ
0 6
0 4
E
p.,
2
0
control 0.2 % saponin
- 37 °C
Ftgure 2 Only the pool ofMFR-2 soluble m Tnton X-100 at 0°C IS mtemahzed K.B cells were
cell surface wdmated and chased for 2 or 60 mmutes Next they were mcubated With or Without
neuramtmdase at 0°C and lysed m the absence or presence of 0 2% sapomn MFR-2 was
Immunoprectpttated and analyzed on IEF-gels
for another GPI-lmked protem, placental alkalme phosphatase, m BeWo chonon carcmoma
cells 5 11
Smce MFR-2 IS Implicated to partlctpate m the receptor-medtated uptake of naturally
occurnng folates and folate-based chemotherapeutic drugs the mtemahzatton ofMFR-2 was
0.2% saponin - +
neuraminidase - + - +
chase (min) 0 0 I 60 0 0 I 60
763
studied. KB cells were cell-surface iodinated at 0°C and chased for 1 hour at 37°C. Next, the
cells were incubated at ooc with 100 mU/ml neuraminidase to desialylate all MFR-2 at the cell
surface and lysed in Triton X-100 at 0°C with or without 0.2% saponin. The lysates were
immunoprecipitated for MFR-2 and the immunoprecipitates were analyzed on lD-IEF-gels.
Neuraminidase completely desialylated extracellular MFR-2, thereby increasing its iso-
electric point. During the chase period at 37°C part of the MFR-2 was internalized by the cells,
as is monitored by MFR-2 molecules which were protected from the neuraminidase treatment.
A control experiment showed that all MFR-2 molecules at the cell surface were accessible for
extracellularly added neuraminidase (data not shown). All of the internalized MFR-2 could be
solubilized in Triton X-100 at 0°C. Incubation of the lysate with 0.2% saponin only increased
the solubilized amount ofextracellular MFR-2. This result suggests that only MFR-2 molecules
outside Triton X-100 insoluble clusters are internalized at the plasma membrane.
Finally we determined if both pools ofMFR-2 present at the cell surface were capable of
binding ligand. Therefore, KB cells were washed at 0°C with Na-acetate buffer pH 4.5 to
deplete all extracellular MFR-2 from ligand. Next the cells were incubated with Pte-[l 25 I]-ASA-
Lys (Figure 3A), a photoaffinity analog offolic acid. Next, the cells were washed to remove
excess ofligand, irradiated with UV-light and lysed as in Figure 1. Aliquots of the lysates were
analyzed by SDS-PAGE (Figure 3B) and by gamma-counting (Figure 3C). Pte-[1 251]-ASA-Lys
labeling of MFR-2 was very specific, since only one band corresponding to MFR-2 was
detected after SDS-PAGE (Figure 3B). In Figures 3B and 3C is shown that MFR-2labeled by
Pte-[l 25I]-ASA-Lys has identical solubilization characteristics as in Figures 2 and 3, indicating
both MFR-2 pools present at the plasma membrane exhibit ligand binding activity.
In conclusion the present results show that MFR-2 is organized in at least two different
pools at the plasma membrane, one of which can be solubilized in Triton X-100 at 0°C. The
second pool can only be solubilized at 37°C orin the presence ofcholesterol-complexing agents
such as saponin. This indicates that MFR-2 is not homogeneously distributed at the plasma
membrane and suggests that Triton X-100 insoluble MFR-2 is present in microdomains. As has
been observed in another study 12 , maintainance ofthese microdomains depends on the presence
of cholesterol as was suggested by the facilitated solubilization at 0°C in the presence of
saponin. The insolubility ofMFR-2 in Triton X-100 at 0°C is acquired after its synthesis in the
rough endoplasmic reticulum during passage of the Golgi Complex, probably the trans-Golgi
reticulum. At the plasma membrane internalization ofMFR-2 molecules was only observed for
those which were not localized in Triton X-100 insoluble clusters. Both cell surface pools of
MFR-2 have ligand binding capacity.
Acknowledgements
We thank dr JB Hynes (Univ. ofS. Carolina, Charleston, SC, USA) for providing us with
Pteroyl-N'-(4-azido-salicylyc)-L-Lysine (Pte-ASA-Lys). We thank Tom van Rijn and Rene
Scriwanek for excellent darkroom services. This study was supported by the Dutch Cancer
Society (Grant NKI 92-43).
REFERENCES
1. Ratnam, M., Marquardt, H., Duhring, JL., andFreisheim, JH. Biochemistry 28:8249-8254
(1989).
2. Lisanti, MP., and Rodriquez-Boulan, E. Trends Biochem. Sci. 15:113-118 (1990).
3. Van Meer, G., Stelzer, EH., Wijnaendts-van-Resandt, RW., and Simons, K. J. Cell
Biol. 105:1623-1635 (1987).
764
4. Simons, K., and van Meer, G. Biochemistry 27:6197-6202 (1988).
5. Brown, DA., and Rose, JK. Cell68:533-544 (1992).
6. Haanan, LA., Lisanti, MP., Rodriquez-Boulan, E., and Edidin, M. J. Cell Biol. 120:353-
358 (1993).
7. Jansen, G., Schomage1, JH., Westerhof, GR., Newell, DR., and Jackman, AL. Cancer Res.
50:7544-7548 (1990).
8. Rothberg, KG., Ying, YS.,Kolhouse, JF., Kamen, BA., andAnderson,RGW. J. CellBiol.
110:637-649 (1990a).
9. Bamezai, A., Go1dmacher, VS., and Rock, KL. Eur. J. Immunol. 22:15-21 (1992).
10. Anthony, AC. Blood 79: 2807-2820 (1992).
11. Cemeus, DP, Ueffing, E., Posthuma, G., Strous, GJ., and van der Ende, A. J. Bioi.
Chern. 268: 3150-3155 (1993).
12. Rothberg, KG., Ying, YS., Kamen, BA., and Anderson, RGW. J. Cell Biol. 111:2931-
2938 (1990b).
765
THE REDUCED FOLATE/METHOTREXATE CARRIER AND A MEMBRANE-
INTRODUCTION
768
Table 1. Characteristics of quinazolinone-based antifolate inhibitors of thymidylate synthase; substrate affinity for RFC and mFBP, substrate affinity
for FPGS, inhibition of TS, and growth inhibitory effects.
• Substrate affinity (K.,) for FPGS is indicated as follows; ++++ (K., < 5 ~M), +++ (K., 5-25 ~M), ++ (K., 25-100 ~M), + (K., >100 ~M),
- (no affinity). '>Determined by cross-resistance studies in the L1210:MB3 line that fails to polyglutamate antifolates. Substrate data by Rick Moran.
b Inhibition of RFC-mediated influx of [3H]-MTX by folate analogue inhibitors of TS. The concentration of drug required to inhibit [3H]-MTX
influx in CEM-7A cells by 50% is depicted. Extracellular concentration of [3H]-MTX; 5 ~M. Influx buffer; HEPES buffered saline pH 7.4.
c Relative affinity of MFR for folate analogue inhibitors of TS. The inverse molar ratio of drug required to displace 50% of [3H)folic acid from
the receptor is given as relative affinity. The relative affinity for folic acid is set to 1.
d IC50 is defined as the drug concentration required to inhibit cell growth by 50% as compared to controls.
N.D.; Not determined, LV; leucovorin, FA; folic acid.
$
Regardless of efficient transport via RFC and/or mFBP, compounds which can not be
polyglutamated (J., ,4, 12, 13) or are poor inhibitors of TS (~, Q) were less potent cell
growth inhibitors than compounds which were efficiently polyglutamated (Table 1).
Under conditions of low extracellular concentrations of folates (e.g. 1 nM leucovorin),
mFBP-mediated uptake of compounds 1,2,7-11 seemed to be involved in the potent
growth inhibitory effects. However, in the presence of 20 nM folic, which mimicks a near
physiological concentration of serum folate, only the compounds for which mFBP has a
high affinity or were efficiently polyglutamated (1, 2 and 9) retained their growth
inhibitory potential against mFBP expressing leukemia cells.
In conclusion, a number of antifolate compounds have been identified which may use
either the RFC (MTX), mFBP (2) or both (1,2,1.~,10,11) routes for cellular uptake.
ACKNOWLEDGEMENTS
G. Jansen is a recipient of a fellowship from the Royal Netherlands Academy of Arts and
Sciences.
REFERENCES
1. P.R. Marsham, L.R. Hughes, A.L. Jackman, A.J. Hayter, J. Oldfield, J.M.
Wardleworth, J.A.M. Bishop, B.M. O'Connor, and H.A. Calvert, J. Med. Chern.
34:1594 (1991).
2. R.L. Hagan, D. Duch, G.K. Smith, M.H. Hanlon, B. Shane, J.H. Freisheim, and
J.B. Hynes, Biochem. Pharmacal., 41:781 (1991).
3. A. Rosowsky, R.A. Forsch, R.G. Moran, and J.H. Freisheim, J. Med. Chern., 34:
227 (1991).
4. P.M. Sirotnak, Cancer Res., 45:3992 (1985).
5. A.C. Antony, Blood, 79:2807 (1992).
6. S.D. Weitman, A.G. Weinberg, L.R. Coney, V.R. Zurawski, D.S. Jennings, and
B.A. Kamen, Cancer Res., 52:6708 (1992).
7. I.G. Campbell, T.A. Jones, W.D. Foulkes, and J. Trowsdale, Cancer Res., 51:5329
(1991).
8. G. Jansen, G.R. Westerhof, M.J.A. Jarmuszewski, I. Kathmann, G. Rijksen, and
J.H. Schornagel, J. Bioi. Chern., 265:18272 (1990).
9. G. Jansen, I. Kathmann, B.C. Rademaker, B.J.M. Braakhuis, G.R. Westerhof, G.
Rijksen, and J.H. Schornagel, Cancer Res., 49:1959 (1989).
10. G. Jansen, G.R. Westerhof, I. Kathmann, B.C. Rademaker, G. Rijksen, and J.H.
Schornagel, Cancer Res., 49:2455 (1989).
11. A.L. Jackman, D.R. Newell, W. Gibson, D.I. Jodrell, G.A. Taylor, .T.A. Bishop,
L.R. Hughes, and A.H. Calvert, Biochem. Pharmacal., 42:1885 (1991).
12. A.L. Jackman, G.A. Taylor, W. Gibson, R. Kimbell, M. Brown, A.H. Calvert, I.R.
Judson, and L.R. Hughes, Cancer Res., 51:5579 (1991).
13. F.T. Boyle, A.J. Barker, L.R. Hughes, P.R. Marsham, J.M. Wardleworth, T.C.
Stephens, and A.L. Jackamn, Proc. 7th EORTC/NCI symposium on new drugs in
cancer chemotherapy, Amsterdam 1992 (Abstract 115).
770
IDENTIFICATION OF A REDUCED FOLATE/METHOTREXATE CARRIER IN
HUMAN KB-CELLS EXPRESSING IDGH LEVELS OF MEMBRANE ASSOCIATED
FOLATE BINDING PROTEIN
Dept. of Oncology
1 Dept. of Internal Medicine
2
INTRODUCTION
Membrane transport is an essential step for the delivery of antifolate drugs to their
intracellular targets. At least two structurally unrelated transport systems have been
characterized for their role in the uptake of reduced folate cofactors and antifolate compounds;
the reduced folate/methotrexate carrier (RF/MTX-carrier) (1) and a membrane-associated
folate binding protein (mFBP) (reviewed in 2, 3, and 4). Recent studies have shown that
both proteins can be expressed within the same cell (5).
Based on the high levels of expression of mFBP, human nasopharyngeal KB-cells have
been extensively used as a model system to study the biochemical characteristics of mFBP
and to assess it's potential role in (anti)-folate transport (1, 4, 6, 7). During investigations
with KB cells we were intrigued by observations that these cells were sensitive to growth
inhibition by antifolate compounds for which mFBP has a low afftnity (e.g. the dihydrofolate
reductase (DHFR) inhibitors methotrexate (MTX) and 10-ethyl-10-deazaaminopterin (10-EdAM)
whereas the cells were quite resistant to antifolates for which the mFBP has a high affinity
(e.g. the quinazoline-based inhibitor of thymidylate synthase (TS), N10-propargyl-5,8-
dideazafolic acid (CB3717)) (8). In order to explain this discrepancy we have carried out
a series of experiments which support the hypothesis that KB cells, in addition to high amounts
of mFBP, express functional levels of the RF/MTX-carrier protein.
KB cells have been grown under two conditions; (a) in standard RP:MI medium containing
2 ~-tM folic acid (FA) supplemented with 10% fetal calf serum (FCS), further referred to
as KB cells, and in folate free RP:MI medium supplemented with 10% dialyzed FCS and
1 nM leucovorin (LV) as the sole folate source, further designated as KB-LF cells. Under
both conditions the amount of mFBP did not differ significantly (300-500 pmol [3H]-folic
acid binding/107 cells) except that in contrast to KB-LF cells, all of the folate receptors in
KB cells were saturated with FA. For KB cells and KB-LF cells we have tested the growth-
inhibitory effects of MTX, 10-EdAM and CB3717 (Table 1).
KB KB-LF
Relative Affinity•l RPMI; 10% FCS RPMI-FA; 10% Dial FCS
FA 505
LV 4.5 0.1
•J Relative affinities of the RFC for the (anti)-folate compounds are presented as the concentration
(p.M) necessary to inhibit rHJ-MTX-uptake (extracellular concentration 5 p.M) by 50%. Relative
affinities of the mFBP for these compounds are presented as the inverse molar ratio of compound
that inhibits [3H]-folic acid binding by 50%.
bJ Determined after 72 hrs of continuous exposure to the drug.
The rationale for selecting these compounds is that mFBP has a poor binding affinity
for MTX and 10-EdAM, and a high binding affinity for CB3717, whereas the substrate
affinities of the RF/MTX-carrier for these compounds is just the reverse, a low affinity
for CB3717 and high affinities for MTX and 10-EdAM (Table 1). Therefore, if a high affmity
for either of the two transport systems correlates with drug sensitivity and a poor affinity
with drug resistance, it can be expected that KB cells grown in the presence of 2 ~-tM FA
will be resistent to MTX and 10-EdAM if mFBP is the major transport route for these
compounds (9). In the absence of competing folates for the receptor, however, like for KB-LF
cells, mFBP-mediated uptake of drugs may be more efficient and can lead to growth inhibition.
The results from Table 1 are not consistant with the concept that mFBP is the only route
for antifolate uptake in KB cells, KB cells were fully sensitive to growth inhibition by MTX
and 10-EdAM and resistant to CB3717, an observation which is compatible with RF/MTX-
carrier-mediated drug uptake rather than uptake via the mFBP.
Some additional experiments provide further evidence that KB cells may express functional
772
levels of RF/MTX-canier; (A) Table 1 demonstrates that protection against MTX- and 10-
EdAM-induced cytotoxicity can be achieved by LV, a good substrate for RFC, rather than
by FA for which mFBP has the highest affmity; (B) influx rates and steady state levels for
uptake of rH]-10-EdAM in KB-LF cells were 4-fold higher than for rHJ-MTX and were
much higher than expected if transport was to proceed solely via the mFBP (results not shown);
(C) this uptake was inhibited by LV (Figure 1) or an N-hydroxysuccinimide (NHS)-ester
ofMTX which irreveribly blocks the RF/MTX-carrier (Figure 2). In contrast, uptake was
not inhibited by FA or an NHS-ester of FA (which blocks mFBP but not the RF/MTX-carrier);
(D) polyglutamate forms of fH]-MTX and rHJ-10-EdAM (up to tri-glutamate) were identified
shortly ( < 30 min) after drug incubation (not shown) which is consistant with rapid drug
accumulation via the RF/MTX-carrier, and fmally (E) labeling ofKB-LF cells with an 1251-
labeled photoaffmity analogue ofMTX resulted in the identification of two labeled membrane
proteins of which the molecular weights, 40 kD and 75-85 kD, were in agreement with
those reported for human mFBP and RF/MTX-carrier proteins (10, 11) (not shown).
~ e 100
c c
0
g
- "
Q
0 0 7$
.c..
~
.
so
"'
"
.
~ ~s .; '25
"'• "
.>:
~
~ 0 ii.
:::>
('H)-MTX ('H ]-10EdAM ('H J-MTX {'HJ-1 OEdAM
Fig.llnhibitionoffH]-MTXandfH]-10-EdAM Fig.21nhibitionoffH]-MTXandfH]-JO-EdAM
uptake by FA and LV. KB-LF-cells grown in 9 uptake by NHS-esters ofMTXand FA. N-Hydroxy-
em petri-dishes on RPMI-1640 medium without Succinimide (NHS) esters of MTX and FA were
FA, 10% dialyzed fetal calf serum (80 % confluen- synthesized as described by Henderson et al. (I2).
cy) were incubated with 1 J!M fH]-MTX or f H]- KB-LF-cells grown in petri-dishes (see legend
10-EdAM with or without an excess of 100 f.tM Fig. 1) were washed twice with HBSS pH 7.4,
FA or LV. After 4 hrs of incubation at 37°C. in and incubated with either I f.tM NHS-MTX and
a humidified atmosphere containing 5% C02 , the 2 f.tM FA or 0.3 f.tM NHS-FA and 5 f.tM 10-
cells were washed twice with Hepes buffered EdAM to specifically label the RF/MTX-carrier
saline solution (HBSS: 20 mM HEPES, 107 mM or the mFBP respectively. After 10 min. of
NaCI, 26.2mMNaHC03, 5.3 mMKCl, 1.9mM incubation at 25°C. the cells were washed twice
CaC12 , 1 mM MgC12 and 7mM D-Glucose, pH again with HBSS pH 7.4 and incubated with I
7.4 with NaOH), washed once with HBSS pH f.tM [lH]-MTXor rH]-10-EdAMfor2 hrs. After
3.5 (same as HBSS but without NaHC03, pH 3.5 this, the cells were washed, harvested and
with HCl) to release extracellular bound ligand, analyzed for radioactivity as described the legend
treated with 0. 25% trypsin in phosphate buffered of Fig. 1.
saline (PBS) to harvest the cells after which the
samples were analyzed for radioactivity.
These results demontrate the presence of at least two functional transport routes for
antifolates in KB cells, the mFBP and the RF/MTX-carrier. The relative contribution of
either one of these routes in (anti)-folate transport is dependent on the medium folate status
and the affmity of these proteins for (anti) ·folate compounds.
773
ACKNOWLEDGEMENTS.
This study was supported by Dutch Cancer Society-Grants IKA- 89-34 and NKI 92-43.
G. Jansen is a recipient of a fellowship from the Royal Netherlands Academy of Arts and
Sciences
REFERENCES
1. F.M. Sirotnak, Obligatt: genetic expression in tumor cells of a fetal membrane property mediating
"folate" transport: Biological significance and implications for improved therapy of human
cancer. Cancer Res., 45: 3992 (1985).
2. G.B. Henderson, Folate binding proteins. Ann.Rev.Nutr., 10: 319 (1990).
3. M. Ratnam, and J.H. Freisheim, Proteins involved in the transport of folates and antifolates by normal
and neoplastic cells, in "Folic Acid Metabolism", Wiley-Liss, Inc., 91 (1990).
4. A. C. Antony, The biological chemistry of folate receptors. Blood, 79: 2807 (1992).
5. G.R. Westerhof, G. Jansen, N van Emmerik, I. Kathmann, G. Rijksen, A.L. Jackman, and J.H.
Schomagel, Membrane transport of natural and antifolate compounds in murine L1210 leukemia
cells: Role of carrier- and receptor-mediated transport systems. Cancer Res., 51: 5507 (1991).
6. J.C. Deutsch, P.C. Elwood, R.M. Portillo, M.G. Macey, and J.F. Kolhouse, Role of the membrane-
associated folate binding protein (folate receptor) in methotrexate transport by human KB cells.
Arch.Biochem.Biophys., 274: 327 (1989).
7. P.C. Elwood, M.A. Kane, R.M. Portillo, and J.F. Kolhouse, The isolation, characterisation, and
comparison of the membrane- associated and soluble folate-binding proteins from human KB
Cells. J.Biol.Chem., 261: 15416 (1986).
8. T.R. Jones, A.H. Calvert, A.L. Jackman, S.J. Brown, M. Jones, and K.H. Harrap, A potent
antitumor quinazoline inhibitor of thymidylate synthetase: synthesis, biological properties and
therapeutic results in mice. Eur.J.Cancer, 17: 11 (1981).
9. G. Jansen, J.H. Schomagel, G.R. Westerhof, G. Rijksen, D.R. Newell, and A.L. Jackman, Multiple
membrane transport systems for the uptake of folate-based thymidylate synthetase inhibitors.
Cancer Res., 50: 7544 (1990).
10. M. Ratnam, H. Marquardt, J.L. Duhring, and J.H. Freisheim, Homologous membrane folate binding
proteins in human placenta: Cloning and sequence of a eDNA. Biochemistry, 28: 8249 (1989).
11. J.H. Freisheim, M. Ratnam, T.P. McAlinden, K.M.R. Prasad, F.E. Williams, G.R. Westerhof,
J.H. Schomagel, and G. Jansen, Molecular events in the membrane transport of methotrexate in
human CCRF-CEM leukemia cells. Adv.Enz.Regul., 32: 17 (1992).
12. G.B. Henderson, and E.M. Zevely, Affinity labeling of the 5-methyltetrahydrofolate/methotrexate
transport protein of L1210 cells by treatment with an N-hydroxysuccimide ester of rH]metho-
trexate. J.Biol. Chem., 259, 4558-4562 (1984).
774
ALTERED TRANSPORT OF FOLIC ACID AND ANTIFOLATES THROUGH
THE CARRIER MEDIATED REDUCED FOLATE TRANSPORT SYSTEM IN A
HUMAN LEUKEMIA CELL LINE RESISTANT TO (6R) 5,10-
DIDEAZATETRAHYDROFOLIC ACID (DDATHF)
INTRODUCTION
5,10-Dideazatetrahydrofolic acid is a potent antiproliferative agent in vitro and in
vivo, arresting or delaying the proliferation of tumor cells in a number of murine and human
xenografts models 1,2. In contrast to classical antifolates, (dihydrofolate reductase
inhibitors), DDATHF blocks de novo purine biosynthesis as the result ofa potent inhibition
of both glycinarnide ribonucleotide (GAR) and arninoimidazole carboxarnide ribonucleotide
(AICAR) transformylases.
DDATHF has been described to be an excellent substrate for folylpolyglutamate
synthetase (FPGS), which readily converts DDATHF to higher polyglutamates that are
retained intracellularly 3. Polyglutamylation is recognized to be an essential step in the
activation of DDATHF. Decreased formation of polyglutamates reduces the effectiveness of
DDATHF, since the poly glutamate forms are more potent inhibitors of both GAR and
AICAR transformylases than the monoglutamate form 4.
DDATHF shares the reduced folate transport system with natural folates and classical
antifolates and also utilizes the high affinity low capacity folate binding protein 5. A number
of DDATHF resistant cell lines were developed by continuous exposure of CCRF-CEM
human T-lymphoblastic leukemia cells to increasing concentration of the antifolate. We
describe in this report a DDATHF resistant subpopulation of CCRF-CEM cells able to
proliferate in the presence of 1 f..LM DDATHF. We define the multimodal mechanism of
resistance to DDATHF including impaired polyglutamylation, altered transport and increased
reduced folate pools.
....
c
81
0
Glu 1 Glu 2 Glu 3 Glu 4 Glu 5 Glu 6 Glu 7
Fig .1. Polyglutamates accumulation after a 24 hour incubation with l!J.M (6R)DDATHF. Cells were
incubated with l!J.M [3H]-(6R)DDATHF, after 24 hrs. cells were harvested and washed twice in
PBS. The HPLC analysis was perforfermed as described in Reference 3.
776
1000
CCRF-CEM CCRF-CEMR16
600 +
600
• • 6 7 8
E
+
400 + + + + + + ++
Q.
u + + + • 7 •
200
0
0 10 20 30 40 so 60 70 80 0 10 20 30 40 so 60 70 80
Fraction Number
Fig.2. Folate polyglutamates distribution in sensitive and resistant CCRF-CEM cells. Folate depleted
cells were incubated for a 24 hour period in 2.2 J1M [3H]-Folic acid. Cells were then harvested,
washed and analyzed as described in Reference 6.
Surprisingly, together with this noticeable shift toward shorter polyglutamate chain
lengths in the resistant cells, we observed a 3-4 fold increase in the total accumulation of
reduced folates. The analysis of individual reduced folate pools revealed that the overall
increase was almost entirely due to the accumulation of 10-formyl-tetrahydrofolate in the
resistant cell line (Fig. 3). This reduced folate is the natural substrate for both GAR and
AICAR transformylases and increases in its intracellular level could certainly contribute to
deazatetrahydrofolate resistance.
This data led us to carefully investigate the transport characteristics of the resistant
cell line compared to the parental CCRF-CEM cells. As shown in Table 2 the resistant
subpopulation CCRF-CEM R16 presented a slightly increased Km for the diffe;rent substrate
used. However there was a 3-4 fold elevation in Vmax for folic acid and a 2 fold increase in
20 ~ lHF
II 10 formyl TiiF
D 5 formyl TiiF
0 15 ~ Folic Acid
>
Iii 5 methyl TiiF
~
<.J
10
-2-
0
e
Q,
5
0
CCRF-CEM CCRF-CEM Rl6
Fig. 3. Reduced folates formation after a 24 hour incubation with [3H]-Folic Acid. Folate depleted cells were
incubated in 2.2 JlM [3H]-Folic acid, after 24 hrs. cells were harvested. washed and ana!Y2ed as
described in Reference 7.
777
Table 2. Transport parameters of different folates and antifolates in CCRF-CEM cells
sensitive and resistant to (6R)DDATHF.
Vmax for both (6R)DDATHF and methotrexate.The increment in Vmax was associated with
a 2 fold increase in the number of binding sites for the resistant cells.
The possible contribution to folate and (6R)DDATHF incorporation via potocytosis
was investigated in both cell lines and did not reveal any significant involvement.
We conclude that resistance to (6R)DDATHF in CCRF-CEM R16 cells is due to a
series of different mechanisms including impaired polyglutamylation due to diminished
FPGS activity and accumulation of reduced folates, especially 10-formyl-tetrahydrofolate,
possibly related to an altered reduced folate transport system with different kinetic properties
toward both folates and antifolates.
REFERENCES
1. R.G. Moran, E.C. Taylor, and G.P. Beardsley. 5:10-Dideaza-5,6.7,8-Tetrahydrofolate:
a potent antifolate inhibitory to de novo purine synthesis, Proc. Am. Assoc. Cancer
Res. 26:231 (1985)
2. G.P. Beardsley, E.C. Taylor, B.A. Moroson, and R.G. Moran. 5,10-Dideaza- 5,6,7,8-
Tetrahydrotolate: an exceptionally potent inhibitor of de novo purine synthesis. J.
Bioi. Chern. 264:328-333 (1989)
3. G. Pizzorno, J.A. Sokoloski, A.R. Cashmore, B.A. Moroson, A.D. Cross and G.P.
Beardsley: Intracellular metabolism of 5,10-Dideazatetrahydrofolic Acid in human
leukemia cell lines. Mol. Pharm. 39:85-89 (1990)
4. G. Pizzorno, 0. Russello, A.R. Cashmore, B.A. Moroson, A.D. Cross, M. Coronnello,
and G.P. Beardsley. Polyglutamylation: an essential step in the activation of 5,10-
Dideazatetrahydrofolic Acid. Proc. Am. Assoc. Cancer Res. 31: 2005 (1990)
5. G. Pizzorno, A.R. Cashmore, B.A. Moroson, A.D. Cross, A.K. Smith, M. Marling-
eason, B.A. Kamen and G. P. Beardsley: 5,10-Dideazatetrahydrofolic Acid
(DDATHF) transport in CCRF-CEM and MA104 cell lines J. Biol. Chern.
268:1017-1023 (1993)
6. C.J. Allegra, R.L. Fine, J.C. Drake and B.A. Chabner. The effect of methotrexate on
intracellular folates pools in human MCF-7 breast cancer cells: evidence for direct
inhibition of purine synthesis. J. Bioi. Chern. 261:6478-6485 (1986)
7. G. Pizzorno, E. Mini, M. Coronnello, J.J. McGuire, B.A. Moroson, A.R. Cashmore,
R.N. Dreyer, J.T. Lin, T. Mazzei, P. Periti and J.R. Bertino. Impaired
polyglutamylation of methotrexate as a cause of resistance in CCRF-CEM cells after
short-term, high-dose treatment with this drug. Cancer Res. 48:2149-2155 (1988)
778
TRANSFORMATION OF AN L-CELL LINE WITH THE DNA CODING FOR
THE REDUCED-FOlATE/METHOTREXATE TRANSPORTER PROTEIN
FROM A CCRF-CEM HUMAN LEUKEMIA CELL LINE
2Department of Oncology
INTRODUCTION
Murine fibroblast Ltk cells were cotransfected with the plasmid pDG510
containing the herpesvirus thymidine kinase gene and genomic DNA from CCRF-
CEM-7A cells. HAT selection was carried out in folate free IMDM media with 10
nM folinic acid as the only source of folate. As shown in Table 1, out of a possible
75,000 clones on 75 plates screened, 5 cell clones were identified that were capable of
growing under the selection pressures. This could be considered a high transfection
frequency if compared to other published frequencies using Ltk cells7, and could
represent a situation where multiple copies of the gene are present in CCRF-CEM-
7A cells. The 5 established cell clones (L!7A 1-5) are capable of growing at
concentrations of folinic acid that would be lethal to the parent Ltk cells.
Cells Growing in 10 nM
Transfection Number Positive PlatesLiotal FHJ IX+ Cells
1 1/15 1/15,000
2 1/15 1/15,000
3 1/20 1/20,000
4 1/25 2/25,000
The cell clones were then partially characterized by Southern blot to establish
that human DNA had been transferred, by uptake assays with 3H-MTX to show that
there was an increase in reduced transporter function, and by labelling studies with an
iodinated photoprobe (APA-1251-ASA-lys) to see if a protein of similar size to the
human reduced folate/MTX transporter was being produced by the new cell clones.
The genomic DNA from the L/7A cell clone, L/7A1, was digested with EcoRI
and run on a 0.8% agarose gel along with equally treated genomic DNA from human
spleen, CCRF-CEM-7A cells, L1210 cells, and Ltk cells. The DNA was blotted by
method of Southern, and probed with the labelled human Alu sequence probe,
pBLUR2. The resultant autoradiogram indicated that the L/7A1 cell clone did have
human DNA in its genome (Figure 1).
HUMAN SPLEEN/ECORI
CCRF-CEM-7A/ECORI
L121 0/ECORI
U7A1 /ECORI
Ltk-/ECORI
Ftgure 1. Autoradiogram or a Southern blot showing introduction o[ human DNA into L{IAl clone. Genomic DNAs were
cut with EcoRI. The probe [or the Southern blot was pBLUR2 containing human Alu sequences. Lane 1, human spleen
DNA; Lane 2, CCRF-CEM-7A DNA; Lane 3, Ll210 DNA; Lane 4, L{IAl DNA; Lane 5, Ltk- DNA
780
The L/7Al and L/7A3 clones were tested for uptake of 3H-MTX and compared
with Ltk cells and L1210R81 cells. Cells were harvested, washed and resuspended in
HBSS buffer, and given 3H-MTX for 5 minutes at 37°C. The cells were then
centrifuged, washed, and resuspended in scintillation cocktail. The data in Table 2
suggest that the L/7A clones exhibit 1.5-2X the uptake found in Ltk" cells. Also
shown is that L1210R81 cells and a no cell control exhibited no 3H-MTX uptake in
these experiments.
Uptake of 3H-MTX
Cell Line I!molL107 cellsLS min. % of Wildty~
Ltk 20 100
LnAt 30 150
LnAJ 33 165
L1210R81 0.7 <5
no cells 0.9 <5
Cells from the L/7Al cell clone were exposed to the iodinated photoprobe APA-
1251-ASA-lys both in the presence and absence of 1 mM cold MTX in order to identify
any proteins that the probe would bind to specifically. As shown in Figure 2, a
protein of an approximate molecular weight of 75-80 kDa was labelled by the
photoprobe in L/7Al cells. This is approximately the correct molecular weight for the
human reduced folate carrier, whereas the mouse protein is approximately 46 kDa in
size. The 75-80 kDa protein was protected from labelling by incubation with 1 mM
cold MTX. This protein was not labelled in the parent Ltk cells (data not shown).
205
-
97
69
46
30
23
Figure 2. A 75-80 kDa protem from L/7Al cells bmds to the photoprobe APA-125!-ASA-lys L/7Al cells were exposed to the
photoprobe m the presence and absence of 1 mM cold MTX at 4°C Membrane protems were prepared, run on SDS-PAGE,
and subjected to autoradiography Arrow pomts to a protem ol 75 80 kDa that IS labelled m L/7Al cells (Lane 1) and
protected from labellmg With 1 mM cold MTX (Lane 2)
781
Taken together this data suggests that we have established mouse cell lines that
express a human protein that is approximately 75-80 kDa in size that is responsible
for increased uptake of 3H-MTX and viability in nM concentrations of folinic acid as
the only source of folates. Each piece of data supports this point. The Southern blot
shows a transfer of human DNA to the cell clones. The increase in 3H-MTX uptake,
although not great could be explained by a doubling of the amount of the reduced
folate carrier. This possibility is supported by the iodinated photoprobe binding and
identification of a 75-80 kDa protein that is specifically bound by the photoprobe that
is not seen in Ltk cells. This is the postulated size of the human reduced folate/MTX
carrier protein leading us to believe that we have isolated this protein away from the
CCRF-CEM-7A cells. Using these cell clones, and after further characterization, we
may be able to answer some preliminary questions about the regulation of this
protein.
REFERENCES
782
DETERMINANTS OF THE DISPARATE ANTITUMOR EFFECTS OF (6R)5,10-
DIDEAZA-5,6, 7,8-TETRAHYDROFOLATE AND METHOTREXATE TOWARD
METHOTREXATE RESISTANT CCRF-CEM CELLS, CHARACTERIZED BY
SEVERELY IMPAIRED ANTIFOLATE MEMBRANE TRANSPORT
INTRODUCTION
Chemicals. Unlabelled and (benzoyl carboxyl- 14C) ( 6R)D D ATHF ( 13.01 p. Ci/ mg) were
provided by Lilly Research Laboratories. Unlabelled MTX and (6R,S)5-formyltetra-
hydrofolate were obtained from the Drug Development Branch, National Cancer Institute.
[3' ,5' ,7-3H]MTX was purchased from Moravek Biochemicals.
Cell Culture. The CCRF-CEM human T -cell leukemia and a MTX resistant sub line
(CEM/MTX6) were gifts from Dr. Andre Rosowsky. Cells were cultured as described
earlier. Drug cytotoxicity assays were detailed in our earlier report5•
RESULTS
Although CEM/MTX cells were highly resistant to MTX (243-fold), they were only
3.6-fold resistant to (6R)DDATHF (IC50s of 16.2 nM and 59 nM for parental and
CEM/MTX cells, respectively). The possibility that differences in membrane transport
between DDATHF and MTX might account for the disparate sensitivities of the
CEM/MTX line to these agents was examined. As depicted in Figure 1 (left panel),
initial uptakes of both 3H-MTX and 14C-DDATHF (at 2 ~tM) were significantly impaired
(95-97%) in CEM/MTX cells. For MTX, this was reflected in a reduced Vmax (0.78
versus 4.56 pmol/mg/min for the parent) and an increased Kt (12.57 versus 3.86 ~tM).
However, decreased DDATHF uptake was entirely due to a reduced Vmax (0.17 versus
3.22 pmol/mg/min). Interestingly, the affinity of the CEM/MTX carrier for DDATHF
was higher (Kt=0.16 ~tM) than in parental cells (Kt=0.47 ~tM).
Uptake of 14C-DDATHF in parental cells was inhibited by MTX (Ki = 4.7 ~tM),
(6R,S)5-formyl tetrahydrofolate (Ki = 2.2 ~tM), and folic acid (Ki = 148 ~tM). While
14C-DDATHF uptake into CEM/MTX cells was likewise inhibited, significant differences
were measured not only in the binding of MTX, as described above, but also for folic
acid (Ki=8.9~tM) and (6R,S)5-formyl tetrahydrofolate (Ki=0.73~tM). The MTX Ki was
11.9 ~tM, approximating the Kt for 3H-MTX uptake in CEM/MTX cells.
Unlike MTX, 14C-DDATHF continued to accumulate in CEM/MTX cells over an
extended interval (Fig. 1, right panel). After 4 h, the intracellular DDATHF level
was 62% of that in parental cells. Total DDATHF accumulations by this time exceeded
those for MTX by 5.4- (parent) and 7.9-fold (CEM/MTX).
For both lines, the intracellular drug forms from 14C-DDATHF were mostly
polyglutamates. Five DDATHF polyglutamates (PG1-5 in Table 1) could be resolved
by HPLC. This metabolism was extensive and nearly identical between the lines (Fig.
2, main graph). After 4 hours, 53% (parent) and 71% (CEM/MTX) of the intracellular
32 ~----·----·----·
.f
./
24 J -~-~-------0
16 ----~6----
~,,"'
8 ...Li • :&
(J /::,. /::,.••• -----/::,.
0 6:/::,.--·- -------- -------
0 60 120 180 240 300 0 2 4
Seconds Hours
Figure 1. Uptake of 14C-DDATHF and 3H-MTX in Parental CCRF-CEM (solid lines) and CEM/MTX
Cells (broken lines). The left panel shows the initial drug influx whereas the right panel illustrates drug
uptake over a 4 hour interval. The symbols are as follows: MTX, triangles; DDATHF, circles.
784
'%-a 0
4
2 ......-·---::-~,.......~~i
" .• «•"
Q ......... ..& ••••• ~-•••·•
0 4
24
s
Ol
"0
sP. 16
0 2 3 4
Hours
drug was polyglutamyl DDATHF. The distributions of the individual DDATHF forms
at 4 h are compared in Table 1. Slightly different polyglutamate distributions were
found, with PG4 predominating in parental cells (29.5% of the total drug), and PG5 the
major form in CEM/MTX cells (51% of the total drug).ThreeMTXpolyglutamates(di-
through tetraglutamates) were detected in parent cells incubated 4 h with 2 ~M MTX;
30% of the intracellular MTX was polyglutamylated (Figure 2, inset). For CEM/MTX
cells, 2.5% of the intracellular radiolabel was polyglutamyl MTX (diglutamate only).
After 4 h, net accumulations of DDATHF polyglutamates in parental and CEM/MTX
lines exceeded those for MTX by 8.4- and 237-fold, respectively,
DISCUSSION
785
Table 1. Distribution of DDATHF Polyglutamates in Parental and CEM/MTX Cells.
Cell Line Total DDATHF POl P02 P03 P04 P05 Total POl-5
(All fQIIJJS)
pmol/mg pmol/mg
Cells were incubated for 4h with 2~M radiolabeled DDATHF. Drug quantitation and HPLC
analysis are described in Materials and Methods. PO 1·5 correspond to the DDATHF polyglutamates
with increasing glutamate chain' lengths. HPLC retention times are as follows: POl (15.3 min);
P02 (13.5 min); P03 (12 min); P04 (11.1 min); P05 (10.2 min); DDATHF (18.3 min.)
preserves high levels of antitumor activity. An analogous effect might be expected for
other antifolates which are polyglutamylated to high levels, and for other tranport-
impaired cells with adequate drug influx to sustain polyglutamate synthesis, and for
which folylpolyglutamate synthesis is largely intact.
ACKNOWLEDGEl\.fENT
We thank Dr. Andre Rosowsky for the gifts of the CCRF-CEM and CEM/MTX
lines and Drs. Chuan Shih and Gerald Grindey for providing the unlabelled and 14C -
labelled (6R)DDATHF. This work was supported by grants from the Public Health
Service (CA-53535) and the American Cancer Society (DH-30C). L.H. Matherly is a
recipient of a Scholar Award from the Leukemia Society of America, Inc.
REFERENCES
1. R.G. Moran, S.W. Baldwin, B.C. Taylor, and C.J. Shih, J. Biol. Chern. 264:21047
(1989).
2. G. Pizzorno, A.R. Cashmore, B.A. Moroson, A.D. Gross, A.K. Smith, M.
Marling-Cason, B.A. Kamen, and G.P. Beardsley, J. Biol. Chern. 268:1017 (1993).
3. F.M. Sirotnak, G.M. Otter, J.R. Piper, and J.I. DeGraw, Biochem. Pharmacol. 37:
4775 (1988).
4. G. Jansen, G.R. Westerhof, I. Kathmann, G. Rijksen, and J.H. Schornagel, Cancer
Chern. Phannacol. 28: 115 (1991).
5. L.H. Matherly, S.M. Angeles, and C.A. Czajkowski, J. Bioi. Chern. 267: 23253
(1992).
6. A. Rosowsky, H. Lazarus, G.C. Yuan, W.R. Beltz, L. Mangini, H.T. Abelson,
E.J. Modest, and E. Frei, Biochem. Phannacol. 29: 648 (1980).
7. D.W. Fry, J.C. Yalowich, and I.D. Goldman, J. Biol. Chern. 257: 1890 (1982).
8. G. Pizzorno, J.A. Sokoloski, A.R. Cashmore, B.A. Moroson, A.D. Cross, and G.P.
Beardsley, Mol. Phannacol. 39: 85 (1991).
9. S.W. Baldwin, A. Tse, L.S. Gossett, E. C. Taylor, A. Rosowsky, C. Shih, and R.G.
Moran, Biochemistry 30: 1997 (1991).
786
UP-REGULATED TRANSPORT OF METHOTREXATE AND 5-METHYL-
TETRAHYDROFOLATE IN A HUMAN BREAST CANCER CELL LINE
Frederika Mandelbaum-Shavit
Department of Bacteriology
Hebrew University-Hadassah Medical School
Jerusalem, Israel
INTRODUCTION
MCF-7 MCF-7FLN
Compound Km (J.i.M) Vmax (pmol/min Km (J.i.M) Vmax(p1mVmin
mg protein) mg protein)
Exponential cultures at almost confluency in 35x10 mm dishes were washed with a transport buffer
(HBSS) 4 containing: 107 mM NaC!, 20 mM Hepes, 26.2 mM NaHCo 3. 5.3 mM KC!, 1.9 mM CaCI,,
1.0 mM MgC1 2 and 7.0 mM glucose, pH 7.2 with NaOH. ['HJ MTX, sodium salt, sp. act. 250
mCi/mmol and 5-[ 14 CJ-methyltetrahydrofolate, barium salt, sp. act. 58 mCi/mmol, both from
Amersham, England, were purified and quantitated by spectrophotometryl 2• The labeled compound
was added in 1 ml of transport buffer and the dishes were incubated at 37" C. The uptake was
terminated by rapid washes with an ice-cold phosphate-buffered saline. Further cell processing for
radio-activity and protein quantitation was as described previously 13• Initial uptake kinetics were
determined in cells incubated for 1 min with various concentrations of the compound examined (at
a range from 0.5 to 20 ~M).
" Mean ± S.E. of three experiments in triplicate.
788
reversed the uptake capacity to that of the parental cells (not shown). A markedly
decreased transport capacity was also achieved by relatively short incubation (2 h) of
the MCF-7FLN cells in a medium with 50 nM 5-HCO-H4PteGlu. As depicted in Fig.
1, the accumulation of MTX at the steady state decreased 4.6-fold in these cells as
compared to the untreated controls. Similar phenomenon was also found in human
CCRF-CEM leukemia cells6•
400
c
·a;
0
Q.
Ol
300
_§
0
EQ.
200
Q)
c;;
X
~
0
.r;
Q) 100
::;;;
30
789
ec
0
(.)
10 100 1000
Methotrexate ( nM )
Figure 2. Inhibition of growth ofMCF-7 and MCF-7FLN cells by MTX. MCF-7 and MCF-7FLN cells
were cultivated in a standard RPMI 1640 and a folate-free medium containing 1 nM 5-HCO-
H4PteGlu, respectively. Cells (3x10 3) plated in 96-well plates were incubated for 24 h in a humidified
5% C0 2 atmosphere at 37° C. MTX was added in 20 ~1 medium and the cultures were incubated for
additional 72 h. Cell growth was measured hy a MTT colorimetric assay 14 • MCF-7 cells (I), MCF-
7FLN cells (0). Points represent the mean value of three experiments in triplicate with S.E. within
the symbols.
REFERENCES
790
PARTICIPANTS
791
Dr. Charles Barnett Dr. Timothy R. Billiar
Lilly Research Laboratories University of Pittsburgh
Eli Lilly and Company 497 Scaife Hall
Lilly Corporate Center Pittsburgh, PA 15261
Indianapolis, IN 46285-4813 USA
USA FAX: 1-412-648-9551
FAX: l-317-276-4507 Phone: 1-412-648-9862
Phone: l-317-276-4521
Dr. Raymond L. Blakley
Dr. Gertrud Cremer-Bartels Dept Biochem & Clin. Pharm.
Augenklinik St. Jude Children's Res Hospital
Westflilische Wilhelms Universitat 332 North Lauderdale, PO Box 318
Domagkstrasse 15 Memphis, TN 38101-0318
D-4400 Miinster USA
Germany FAX: 1-901-521-1668
FAX: 49 251 836960 Phone: 1-901-522-0359
Phone: 49 251 836040
Dr. Nenad Blau
Dr. Charles M. Baugh Univ. of Ziirich, Dept. of Ped.
College of Medicine Division of Clin. Chemistry
University of South Alabama Steinwiesstrasse 75
Mobile, AL 36688 CH-8032 Ziirich
USA Switzerland
FAX: 1-205-460-6798 FAX: 41 1 266 7171
Phone: 1-205-460-7189 Phone: 41 1 266 7544
792
Michael P. Brand Dr. Srinivas Chunduru
Institute of Child Health Dept. of Pharmacology
University of London St. Jude Children's Res. Hosp.
30 Guilford Street 332 N. Lauderdale
London WC1N 1EH Memphis, TN 38105
United Kingdom USA
FAX: 44 71 831 0488 FAX: 1-901-521-1668
Phone: 44 71 242 9789 Phone: 1-901-522-0449
Dr. Claudette M. Briand Dr. Joanna Ciesla
Lab. de Physique Pharmaceutique New York State Dept. of Health
Faculte de Pharmacie Wadsworth Ctr. for Labs & Res.
27 bd Jean Moulin Albany, NY 12201-0509
F-13385 Marseille Cedex 5 USA
France FAX: 1-518-473-2900
FAX: 33 91 80 26 12 Phone: 1-518-486-2567
Phone: 33 91 78 20 24
Dr. Stephen Clarke
Dr. Gene Brown 15 Cotswold Rd, Block E
Department of Biology 16-512C Belmont, Sutton
Massachusetts Inst of Tech. Surrey SM2 5NG
77 Massachusetts Ave. United Kingdom
Cambridge, MA 02139 FAX: 44 81 770 7885
USA Phone: 44 82 6438901 ext. 9320
FAX: 1-617-253-8699
Phone: 1-617-253-0882 Dr. Vivian Cody
Medical Foundation of Buffalo
Dr. Marlene Bunni 73 High Street
Dept. of Biochemistry Buffalo, NY 14203
Medical Univ. of South Carolina USA
171 Ashley Ave FAX: 1-716-852-4846
Charleston, SC 29425 Phone: 1-716-856-9600
USA
FAX: 1-803-792-4322 Dr. Robert J. Cook
Phone: 1-803-792-2331 Dept. of Biochemistry
Vanderbilt University Med. School
Dr. Hilary Calvert Nashville, TN 37232
Division of Oncology USA
Newcastle General Hospital FAX: 1-615-322-4349
Westgate Road Phone: 1-615-322-6330
Newcastle Upon Tyne NE4 6BE
United Kingdom Dr. Bernard Cooper
FAX: 44-91-226-1170 Hematology Department
Phone: 44-91-273-8811 ext.22655 Royal Victoria Hospital, Rm. A 202
687 Pine Ave. West
Robert Carr Montreal, Quebec H3A 1A1
Department of Chemistry Canada
Pennsy~vania State Univ FAX: 1-514-842-8459
415 Wartik Laboratory Phone: 1-514-843-1558
University Park, PA 16802
USA Dr. Edwin A. Cossins
FAX: 1-814-865-2973 Department of Botany
Phone: 1-814-865-2882 University of Alberta
B414 Biological Sci. Ctr.
Linda H. Chen Edmonton, Alberta T6G 2E9
Univ. of California, Berkeley Canada
119 Morgan Hall FAX: 1-403-492-9457
Berkeley, CA 94720 Phone: 1-403-492-3991
USA
FAX: 1-510-642-0535 Dr. Richard G.H. Cotton
Phone: 1-510-642-0750 The Murdoch Institute
Royal Children's Hospital
Yun-jung Choi Flemington Rd., Parkville
Univ. of California, Berkeley Melbourne, Victoria 3052
119 Morgan Hall Australia
Berkeley, CA 94720 FAX: 61-3-348-1391
USA Phone: 61-3-345-5045
FAX: 1-510-642-0535
Phone: 1-510-642-0750
793
Dr. Gale Craviso Dr. John Donlon
Phannacology Dept. Department of Biochemistry
Univ. of Nevada Sch. of Med. University College Galway
Howard Bldg., Rm. 219 National Univ. of Ireland
Reno, NV 89557 Galway
USA Ireland
FAX: 1-702-784-1620 FAX: 353-91-25700
Phone: 1-702-784-4118 Phone: 353-91-24411 ext. 2412
Dr. H.-Ch. Curtius James T. Drummond
Univ. of Ziirich, Dept. of Ped. University of Michigan
Division of Clin. Chemistry Biophysics Research Division
Steinwiesstrasse 75 1240 IST
CH-8032 Ziirich 2200 Bonisteel Blvd.
Switzerland Ann Arbor, M1 48109
FAX: 41 1 266 7171 USA
Phone: 41 1 266 7544 FAX: 1-313-764-3323
Phone: 1-313-747-1829
Dr. Colette Daubner
Dept. of Biochemistry/Biophysics Dr. David Duch
Texas A&M University Burroughs Wellcome Company
College Station, Texas 77843-2128 The Wellcome Res. Labs.
USA 3030 Cornwallis Road
FAX: 1-409-845-9274 Research Triangle Park, NC 27709
Phone: 1-409-845-6832 USA
FAX: 1-919-248-8375
Dr. Thomas J. Delia Phone: 1-919-248-4363
Dept. of Chemistry
Central Michigan University Michelle Duffourc
Mt. Pleasant, M1 48859 University of South Alabama
USA Phannacology Dept., MSB 3130
FAX: 1-517-774-7106 College of Medicine
Phone: 1-517-774-3981 Mobile, AL 36688
USA
Anjali Desai FAX: 1-205-460-6798
Department of Biochemistry Phone: 1-205-460-6063
College of Medicine
University of South Alabama Dr. Jolanta Dzik
Mobile, AL 36688 Nencki Inst. of Exp. Biology
USA 3 Pasteur St.
FAX: 1-205-460-6127 PL-02-093 Warszawa
Phone: Poland
FAX: 48-22-22-53-42
Dr. Inderjit Dev Phone: 48-2-659-85-71 ext.297
Wellcome Research Labs.
3030 Corwallis Road Dr. Patrick Elwood
Research Triangle Park, NC 27709 Medicine Branch
USA National Cancer Institute
FAX: 1-919-248-8375 Bldg. 10
Phone: 1-919-248-4314 Bethesda, MD 20892
USA
Rajesh Devraj FAX: 1-301-402-0172
Duquesne University Phone: 1-301-496-6035
School of Phannacy
Pittsburgh, PA 15282 Todd Engle
USA Baylor Univ. Med. Center
FAX: 1-412-434-5130 3812 Elm Street
Phone: 1-412-434-5006 Dallas, TX 75226
USA
Shirley Dillard FAX: 1-214-820-4952
Dept. of Phannacology Phone: 1-214-820-2687
College of Medicine
University of South Alabama Emine Ercikan
Mobile, AL 36688 Memorial Sloan-Kettering Ctr.
USA Mol. Phann. and Therapeutics
FAX: 1-205-460-6798 1275 York Ave., Box 78
Phone: 1-205-460-6063 New York, NY 10021
USA
FAX: 1-212-639-2767
Phone: 1-212-639-8235
794
Dr. G. Werner-Febnayer Laura Gahn
Inst. Fiir Med. Chemie und Biochemie Dept. of Biochem. & Mol. Biology
Universitiit Innsbruck LSU Medical Center
Fritz Pregl Str. 3 1100 Florida Ave.
A-6020 Innsbruck New Orleans, LA 70119
Austria USA
FAX: 43-512-507-2279 FAX: 1-504-942-8341
Phone: 43-512-507-2298 Phone: 1-504-948-8568
795
Christopher Greene Dr. Steen Ingemann Hansen
Dept. of Biology Dept. of Clin. Chemistry
Box 870344 Central Hospital Hilleroed
Univ. of Alabama DK-3400 Hilleroed
Tuscaloosa, AL 35487 Denmark
USA FAX: 45 48 24 00 67
FAX: 1-205-348-1786 Phone: 45 42 261500 ext. 2298
Phone: 1-205-348-9810
Dr. Toshie Harada
Dr. Roger Griffm Dept. of Medical Chemistry
Dept. of Chemistry Osaka Medical College
Bedson Building 2-7 Daigakumachi
Univ. of Newcastle upon Tyne Takatsuki, Osaka 569
Newcastle upon Tyne, NE1 7RU Japan
United Kingdom FAX: 81 726 81 3723
FAX: 44-91-222-6929 Phone: 81 726 83 1221 ext. 2453
Phone: 44-91-222-8591
Dr. Larry Hardy
Dr. Steven S. Gross Biotech 2 I Molecular Medicine
William Harvey Research Inst. Univ. of Massachusetts Medical Center
St. Bartholomew's Hospital 373 Plantation St.
Medical College Worcester, MA 01605
Charterhouse Square USA
London EC1M 6BQ FAX: 1-508-856-4900
United Kingdom Phone: 1-508-856-4289
FAX: 44-71-251-1685
Phone: 44-71-982-6119 Dr. Peter G. Hartman
F. Hoffmann-La Roche Ltd.
Dr. Nathan Grossowicz Preclinical Research, Bldg. 70
Dept. Bacteriology CH-4002 Basel
Hebrew Univ. Switzerland
Hadassah Medical School FAX: 41 61 688 2729
Bin Kerem Phone: 41 61 688 7563
Jerusalem 91010
Israel Dr. Hiroyuki F.asegawa
FAX: 972-2-784010 Dept. of Eioscience
Phone: 972-2-42-82-43 Nishi-Tokyo University
2525 Uenohara
Dr. Alfred Gut Yamanashi 409-01
Dr. B. Schircks Laboratories Japan
Buechstrasse 17a FAX: 81 554 63 4431
CH-8645 Jona Phone: 81 554 63 4411
Switzerland
FAX: 41 55 28 29 54 Dr. K. Hatakeyama
Phone: 41 55 28 28 40 Dept. of Medical Chemistry
Osaka Medical College
Dr. Markus Giitlich 2-7 Daigakumachi
Inst. Exp. ffiimatologie der GSF Takatsuki, Osaka 569
Marchioninistr. 25 Japan
D-8000 Miinchen 70 FAX: 81 726 81 3723
Germany Phone: 81 726 83 1221 ext. 2453
FAX: 49 89 7099 200
Phone: 49 89 7099 222 Dr. Simon J.R. Heales
Institute of Child Health
Dr. Jan Haavik University of London
Department of Biochemistry 30 Guilford St.
University of Bergen London WC1N 1EH
Arstadveien 19 Uniteri Kingdom
N-5009 Bergen FAX: 44 71 831 0488
Norway Phone: 44 71 242 9789
FAX: 47-5-206400
Phone: 47-5-206432 Dr. Robert N. Henrie
FMC Corporation
Mary Hanlon Agricultural Chemical Group
Burroughs Wellcome Company PO Box 8
3030 Cornwallis Rd. Princeton, NJ 08543
Research Triangle Park, NC 27709 USA
USA FAX: 1-609-951-3835
FAX: 1-919-248-8375 Phone: 1-609-951-3468
Phone: 1-919-248-4427
796
Joan M. Revel Dr. Donald W. Horne
College of Pharmacy Research Service (151)
University of Michigan VA Medical Center
428 Church Street Nashville, 1N 37212
Ann Arbor, MI 48109-1065 USA
USA FAX: 1-615-321-6305
FAX: 1-313-763-2022 Phone: 1-615-327-4751 ext. 5474
Phone: 1-313-747-2221
Dr. Masaaki Hoshiga
Charlie Hill Dept. of Medical Chemistry
Dept of Biochemistry Osaka Medical College
Medical Univ. of South Carolina 2-7 Daigakumachi
171 Ashley Ave Takatsuki, Osaka 569
Charleston, SC 29425 Japan
USA FAX: 81 726 81 3723
FAX: 1-803-792-4322 Phone: 81 726 83 1221 ext. 2453
Phone: 1-803-792-2331
Dr. Elizabeth Howell
Dr. James Hilton University of Tennessee
Dept. of Biochemistry Department of Biochemistry
Duke University Medical Center M407 Walters Life Bldg.
Box 3711 Knoxville, 1N 37996-0840
Durham, NC 27710 USA
USA FAX: 1-615-974-6306
FAX: 1-919-684-5470 Phone: 1-615-974-4507
Phone: 1-919-684-3120
Dr. Ying Hu
Dr. Richard H. Himes Dept. of Cancer & Biology Res.
University of Kansas Lilly Research Labs.
Department of Biochemistry Lilly Corporate Center
Lawrence, KS 66045-2106 Indianapolis, IN 46285-1523
USA USA
FAX: 1-913-864-5321 FAX:
Phone: 1-913-864-3813 Phone: 1-317-276-1519
Dr. Kei Hirayama Teng Huang
Room 2309 Scott Hall Box 614 MCV Station
Wayne State University Dept. of Biochemistry
540 East Canfield Richmond, VA 23298
Detroit, MI 48201 USA
USA FAX: 1-804-786-1473
FAX: 1-313-993-4269 Phone: 1-804-786-9482
Phone: 1-313-577-5632
Dr. Keith Hyland
Dr. George H. Hitchings Baylor Univ. Med. Center
Burroughs Wellcome Co. 3812 Elm Street
3030 Cornwallis Road Dallas, TX 75226
Res. Triangle Park, NC 27709 USA
USA FAX: 1-214-820-4952
FAX: 1-919-248-8349 Phone: 1-214-820-2687
Phone: 1-919-248-4162
Dr. John B. Hynes
Dr. Bernhard Hoffmann Pharmaceutical Sciences
Milupa Scientific Dept Medical University of S.C.
Bahnstr. 14-30 171 Ashley Ave.
D-6382 Friedrichsdorf!faunus Charleston, SC 29425
Germany USA
FAX: 49 6172 99 1595 FAX: 1-803-792-0759
Phone: 49 6172 99 0 Phone: 1-803-792-8642
Dr. Jan Holm Dr. Teruhiko Iino
Dept. of Clinical Chemistry Dept. General Education
Central Hospital Nihon University
Nykobing Falster Sakurajosui 3-25-40, Setagayaku
DK-4800 Tokyo 156
Denmark Japan
FAX: 45 54 8533 94 FAX: 81-3-3303-9899
Phone: 45 54 8530 33 Phone: 81-3-3329-1151 ext. 368
797
Dr. Takuji Imamura Dr. Georg Johnen
Osaka City Univ. Med. School National Inst. of Mental Health
Dept. of Pediatrics Bldg. 36., Room 3D-30
1-5-7 Asahimachi, Abeno-Ku 9000 Rockville Pike
Osaka 545 Bethesda, MD 20892
Japan USA
FAX: 81 6 646 5862 FAX: 1-301-496-9935
Phone: 81 6 645 2126 Phone: 1-301-496-6881
798
Dr. Setsuko Katoh Dr. Devanand Kowlessur
Department of Biochemistry National Inst. of Mental Health
Meikai Univ. School of Dentistry Bldg. 36., Room 3D-30
1-1 Keyakidai 9000 Rockville Pike
Sakado. Saitama 350-02 Bethesda, MD 20892
Japan USA
FAX: 81-492-87-6657 FAX: 1-301-496-9935
Phone: 81-492-85-5511 ext. 457 Phone: 1-301-496-6881
799
Stephen Lentz Dr. Frank Maley
Psychiatry Dept. N.Y. State Dept. of Health
Wayne State University Wadsworth Ctr. for Labs & Res.
540 East Canfield Empire State Plaza, Box 509
2309 Scott Hall Albany, NY 12201-0509
Detroit, MI 48201 USA
USA FAX: 1-518-473-2900
FAX: 1-313-993-4269 Phone: 1-518-474-4184
Phone: 1-313-577-5949
Dr. John H. Mangum
Dr. Robert A. Levine 692 WIDB
Director, William T. Gossett Neurology Brigham Young University
Labs. of Henry Ford Hospital Provo, UT 84602
Metropolitan Center for High Technology USA
2727 Second Avenue, Room 302 FAX: 1-801-378-5474
Detroit, MI 48201 Phone: 1-801-378-4114
USA
FAX: 1-313-963-4021 Dr. Fabrizio Marazza
Phone: 1-313-963-4020 c/o SAPEC SA
CH-6903 Lugano-Barbengo
Innina Lewandowska Switzerland
Inst. of Biochemistry & Biophysics FAX: 41 91 556325
Rakowiecka 36 Phone: 41 91 556414
PL-02-532 Warszawa
Poland Dr. Michael Marietta
FAX: 48-22-22-53-43 College of Pharmacy
Phone: 48-2-659-85-71 University of Michigan
428 Church Street
Dr. Walter M. Levenberg Ann Arbor, MI 48109-1065
Marion Merrell Dow Research Institute USA
2110 E. Galbraith Road FAX: 1-313-763-2022
Cincinnati, OH 45215 Phone: 1-313-764-2442
USA
FAX: 1-513-948-7472 Dr. Masahiro Masada
Phone: 1-513-948-7168 Dept. of Agricultural Chemistry
Fac. of Horticulture
Dr. Joseph A. Maddry Chiba Univ. Matsudo 648
Bio-Organic Chemistry Division Chiba Prefecture 271
Southern Research Institute Japan
2000 Ninth A venue, South FAX: 81-473-63-1497
PO Box 55305 Phone: 81-473-63-1221 ext. 346
Birmingham, AL 35255-5305
USA Dr. Larry H. Matherly
FAX: 1-205-581-2877 Michigan Cancer Foundation
Phone: 1-205-581-2748 110 E. Warren Ave.
Detroit, MI 48201
Dr. Josef Maier USA
Inst. Fiir Chemische Pflanzenphysiol. FAX: 1-313-831-8714
Universitat Tiibingen Phone: 1-313-833-0710
Corrensstr. 41
D-7400 Tiibingen 1 Dr. Christopher Mathews
Germany Dept. of Biochemistry & Biophys
FAX: 49 7071 87815 Oregon State University
Phone: 49 7071 296399 2011 AG/Life Sciences Bldg.
Corvallis, OR, 97331-7305
Dr. Gladys Maley USA
N.Y. State Department of Health FAX: 1-503-737-0481
Wadsworth Ctr for Labs & Res. Phone: 1-503-737-1865
Empire State Plaza- Box 509
Albany, NY, 12201-0509 Dr. Rowena G. Matthews
USA Univ. of Michigan
FAX: 1-518-473-2900 Biophysics Research Division
Phone: 1-518-474-9623 2200 Bonisteel Blvd.
Ann Arbor, MI 48109-2099
USA
FAX: 1-313-764-3323
Phone: 1-313-764-9459/8154
800
Farahnaz Mavandadi Dr. Nobuo Nakanishi
Duquesne University Meikai Univ. Sch. of Dentistry
School of Pharmacy Dept. of Biochemistry
Pittsburgh, PA 15282 1-1 Keyaki-Dai
USA Sakado, Saitama 350-02
FAX: 1-412-434-5130 Japan
Phone: 1-412-434-5006 FAX: 81-492-87-6657
Phone: 81-492-85-5511 ext. 280
Dr. John J. McGuire
Roswell Park Memorial Inst. Dr. Takayuki Nakano
666 Elm Street Dept. Biochem & Clin Pharm.
Buffalo, NY 14263 St. Jude Children's Res Hospital
USA 332 North Lauderdale, PO Box 318
Fax: 1-716-845-8857 Memphis, TN 38101-0318
Phone: 1-716-845-8249 USA
FAX: 1-901-521-1668
Dr. Kenneth E. McMartin Phone: 1-901-522-0449
Pharmacology Dept. PO Box 33932
Louisiana State Univ. Med Ctr. Dr. Masahiro Natsuhori
1501 King's Highway Lab. Veterinary Pharmacology
Shreveport, LS 71130-3932 Tokyo Univ. of Agr. & Technol.
USA Fuchu, Tokyo 183
FAX: 1-318-674-7857 Japan
Phone: 1-318-674-7871 FAX: 81 423-61-0034
Phone: 81 423-64-3311 ext.361
Dr. Peter W. Melera
Dept. of Biochemistry Dr. Wendi Neckameyer
School of Medicine Dept. of Pharmacol. & Physiol. Sci.
Univ. of Maryland St. Louis Univ. Sch. of Medicine
108 North Greene St. 1402 S. Grand Blvd.
Baltimore, Maryland 21201 St. Louis, MO 63104
USA USA
FAX: 1-410-706-4037 FAX:
Phone: 1-410-706-7731 Phone:
801