Sei sulla pagina 1di 361

UNIVERSIDAD DE SAN CARLOS DE GUATEMALA

FACULTAD DE ARQUITECTURA

0$18$/'($3/,&$&,1'(/',%8-2(1
,1*(1,(5$

PRESENTADA A LA JUNTA DIRECTIVA POR


JULIO ROBERTO CAMPOS VELA
Para optar al WtWXORGH:
Arquitecto

Guatemala, Agosto 2010


JUNTA DIRECTIVA DE LA FACULTAD
Decano: Arq. Carlos Enrique Valladares Cerezo
Vocal I: Arq. Sergio Mohamed Estrada Ruiz
Vocal II: Arq. (IUDtQGH-HV~V$PD\DCaravantes
Vocal III: Arq. Carlos Enrique Martini Herrera
Vocal IV: Maestra Sharon Yanira Alonzo Lozano
Vocal V: Br. Juan Diego Alvarado Castro
Secretario: $UT$OHMDQGUR0XxR]&DOGHUyQ

TRIBUNAL EXAMINADOR
Decano: Arq. Carlos Enrique Valladares Cerezo
Examinador: Arq. Edwin 5HQpSantizo Miranda
Examinador: Arq. Juan Alberto Ortiz (VWXUEiQ
Examinador: Arq. Allen Eduardo 5DPtUH]
Secretario: Arq. $OHMDQGUR0XxR]&DOGHUyQ

$VHVRU$UT(GZLQ5HQp6DQWL]R Miranda
,0350$6(

DECANO: Arquitecto Carlos Enrique Valladares Cerezo

$6(625$UTXLWHFWR(GZLQ5HQp6DQWizo Miranda

ESTUDIANTE: Julio Roberto Campos Vela


ACTO QUE DEDICO:
AL ARQUITECTO DEL ESPACIO INFINITO: DIOS

Quien ha permitido que todo esto suceda y quien me ha dado la mayor


riqueza del mundo: Mis padres, mi familia, mis amigos y el conocimiento.

A MIS PADRES

Por brindarme el apoyo y amor incondicional a lo largo de mi carrera. Por


VXV FRQVHMRV \ IRUPDFLyQ GH YDORUHV D OR ODUJR GH WRGD PL YLGD < SRU
EULQGDUPHODPHMRUKHUHQFLDGHWRGDVODHGXFDFLyQ

A MIS HERMANOS

Por su amistadFDULxR\DSR\REULQGDGRV

A MIS AMIGOS

A quienes agradezco a la vida por haberlos conocido y que han influido,


GH XQD X RWUD IRUPD HQ ORV p[LWRV GH PL YLGD \ TXLHQHV FX\D DPLVWDG
sincera han DOLPHQWDGRHVWHFRUD]yQ

$0,6&203$f(526'((678',2

PorquH QXHVWUD FRPSDxtD \ YDOLRVD D\XGD PXWXD QRV OOHYy a lograr


DOFDQ]DUXQREMHWLYRFRP~Q

$0,3$S GUATEMALA

Para la que espero ser un buen colaborador y parte de su desarrollo,


aportando esa Arquitectura que se PHUHFHHVWHEHOORSDtV

A MI BELLA ANTIGUA GUATEMALA

A la que respeto y quiero mucho, desde sus calles empedradas hasta la


punta de sus volcanes.
AGRADECIMIENTOS ESPECIALES:

A MI MADRE: DORA NIDIA VELA

3RUVHUPLLQVSLUDFLyQ\HMHPSORGHTXHWRGRHVIXHU]RHVUHFRPSHQVDGRHQ
grande.

A MI PADRE: WILLY CAMPOS

3RU ORV UHFXUVRV TXH PH KD EULQGDGR < VXV FRQVHMRV \ VX VDELGXUtD TXH
compartimos diariamente.

AL ARQUITECTO EDWIN SANTIZO MIRANDA

PRU VX YDOLRVD DVHVRUtD \ HO FRQRFLPLHQWR FRPSDUWLGR para la correcta


UHDOL]DFLyQ GH HVWD WHVLV. < TXH FRQ REMHWLYLGDG SXOLy HO SUHVHQWH WUDEDMR,
esperando tener el mejor de los resultados.

A LOS DOCENTES Y AMIGOS '(/5($'(7eCNICA COMPLEMENTARIA

$UTXLWHFWRV -XDQ $OEHUWR 2UWL] $OOHQ 5DPtUH] \ 0DQXHO $UpYDOR SRU VX
valioso apoyo, su importante conocimiento compartido, su apreciada
DPLVWDG\SRUFRQILDUHQPtHQORVPRPHQWRVPiVGLItFLOHV

$0,6$0,*26'(/5($'(7eCNICA COMPLEMENTARIA

Por haber compartido momeQWRV LQROYLGDEOHV < D TXLHQHV SRU VX FDULxR
DPLVWDG\DSR\RQXQFDROYLGDUp
,1752'8&&,1

En el presente trabajo VHDVSLUDIRUWDOHFHUODHQVHxDQ]D-aprendizaje del estudiante


HQHOiUHDGHOGLEXMRDWUDYpVGHXQGRFXPHQWRTXHVLUYDGHDSR\RDORVGRFHQWHVTXH
LPSDUWHQ HO FXUVR GH 7pcnica Complementaria, brindando una PDWUL] GH RUJDQL]DFLyQ \
HYDOXDFLyQ GH ORV HMHUFLFLRV SDUD OD HQVHxDQ]D-aprendizaje, por medio de textos y
JUiILFDVTXHD\XGHQDXQDPHMRUFRPSUHQVLyQSDUDHODOXPQR\SXHGDDVtWHQHUXQDXWR-
aprendizaje con la ayuda del documento.

Al elaborar este documeQWR WHyULFR-SUiFWLFR se desea facilitar el aprendizaje de


conceptos y el desarrollo de habilidades en el dibujo, logrando aumentar el rendimiento
DFDGpPLFR GH ORV DOXPQRV DVt FRPR WDPELpQ desarrollar habilidades y destrezas en la
H[SUHVLyQ LQWHUSUHWDFLyQ y definicLyQ GH GLEXMRV FRQVWUXFWLYRV y objetos. Asimismo
incrementar la habilidad en el manejo de instrumentos de dibujo y rotulado. Y con todo
HVWR HVWDQGDUL]DU ORV FULWHULRV PHWRGROyJLFRV GH HQVHxDQ]D \ HYDOXDFLyQ HPSOHDGRV SRU
ORVFDWHGUiWLFRVVLUYLHQGRFRPRJXtDSDUDHOGHVDUUROORGHORVFXUVRV



NDICE GENERAL

3GINA

,1752'8&&,1
&DStWXOR*HQHUDOLGDGHV 1

1.1 OEMHWLYRVJHQHUDOHV\HVSHFtILFRV 2

1.2 Marco Conceptual 3


Antecedentes del problema 3
Importancia del problema 7
Planteamiento del problema 7
Alcances y limitaciones 8

0DUFR7HyULFR 9
/DHGXFDFLyQ\VXVHOHPHQWRV 9
7HRUtD&UtWLFDGHODHQVHxDQ]D 11
/DFRPXQLFDFLyQ 12
0pWodos de ensexDQ]D 13
/DHYDOXDFLyQGHODSUHQdizaje de los alumnos 13
DLGiFWLFDHQHOFXUVRGH7pFQLFD&RPSOHPHQWDULD 15
&RQWHQLGRGHOFXUVRGH7pcnica Complementaria 2 17
PURSXHVWDGLGiFWLFDHQHOFXUVR 19
PropueVWDGHHYDOXDFLyQ 20
Cuadro de cronograma de actividades 20

1.4 0DUFR0HWRGROyJLFR 21
+LSyWHVLVYariables y sujetos 21
(OGLVHxR\SURFHGLPLHQWRGHLQYHVWLJDFLyQ 21

1.5 Resultados 22

PROPUESTA DE DESARROLLO DEL PROGRAMA DEL CURSO

&DStWXOR3ULQFLSLRVIXQGDPHQWDOHV 26
2.1 Los formatos 27
2.1.1 Los formatos y sus dimensiones 27
2.1.2 'REOH]\SUHVHQWDFLyQGHORVIRUPDWos 29
2.2 Escalas 32
2'HILQLFLyQ\uso de las escalas 32
2.2.2 Conversiones entre escalas 34
2/DDFRWDFLyQR VLVWHPDGHPHGLFLyQ 37
2.3.1 Las partes de una cota 37
2.3.2 Tipos de acotamiento 39
2.4 AOIDEHWRGHOtQHDV 39



&DStWXOR 5HSUHVHQWDFLyQJUiILFDGHORVREMHWRV 43
3.1 Vistas principales de un objeto 44
36LPERORJtD 50
3.3 Texturas 68
3.4 Dimensiones de blocks y ladrillos 70

&DStWXOR 4 Primicias en el desarrollo de un proyecto 73


4.1 Desarrollo y planificDFLyQGHun proyecto 74
41RUPDVGHFRQVWUXFFLyQ 76
43ODQRGHXELFDFLyQ\ORFDOL]DFLyQ 79
4.4 Planos de Arquitectura 82
4.4.1 ,QWHUSUHWDFLyQGHSUR\HFWRVGHyPiVQLYHOHV 83
4.4.2 Planta matriz o machote 85
4.4.3 Plano amueblada 89
4.4.4 Planta acotada 97
4.4.5 Planta de acabados 103
4.4.6 Elevaciones y secciones 103
Escaleras o gradas 103
Procedimiento para el trazo de gradas 111
4.4.6.1 Elevaciones 115
4.4.6.2 Secciones o cortes 119

&DStWXOR3ODQRVGHLQVWDODFLRQHV 133
5. Planos de instalaciones 134
5.,QVWDODFLRQHVKLGUiXOLcas o agua potable 134
5.2 Instalaciones de aguas negras y pluviales 151
5,QVWDODFLRQHVHOpFWULFDV ,OXPLQDFLyQ\IXHU]D  169

&DStWXOR Planos de estructuras 187


6.1 &RQFHSWRVEiVLFRV 188
6.2 Plano de ciPHQWDFLyQ\FROXPQDV 189
6.2.1 Detalle de columnas 195
6.2.2 Detalle de cimiento corrido y zapatas 196
6.3 Plano de armado de losas 201
6.3.1 Armado de losa tradicional 201
6.3.2 Armado de losa prefabricada 209
6.4 Detalles de vigas 221
6.5 Cortes de muros 231
6.6 Detalle de gradas 237
6.7 &DMHWtQ 241

PROPUESTA DE PRUEB$67(5,&$6<35&7,&$6'85$17((/
DESARROLLO DEL CURSO 242

NDICE DE PLANOS

Plano matriz 91
Planta amueblada 93
Planta acotada 99
Planta de acabados 105
(OHYDFLyQ 117



6HFFLyQ$- 121
6HFFLyQ%- 125
Plano de instaODFLyQGHDJXDSRWDEOH 139
,VRPpWULFRGHLQVWDODFLyn y detalle de cisterna 147
3ODQRGHLQVWDODFLyQGHDguas negras y pluviales 155
3ODQRGHLQVWDODFLyQHOpFWULFD ,OXPLQDFLyQ 175
3ODQRGHLQVWDODFLyQHOpFtrica (fuerza) 181
Plano de cLPHQWDFLyQ\FROXPQDV 191
PODQRGHGHWDOOHVGHFLPHQWDFLyQ 197
Plano de detalles de columnas 199
Plano de armado de losa tradicional 203
Plano de armado de losa prefabricada 211
Plano de detalle de remates 217
Plano dHGHWDOOHGHSpUJROD 219
Plano de detalle de viga V-1 223
Plano de detalle de vigas V-2 y V-3 225
Plano de detalle de vigas V-4 y V-5 227
Plano de detalle de viga V-6 229
Plano de cortes de muro 233
Plano de detalle de gradas 239

EJERCICIOS

Rotulado 245
Escalas 247
Escala y vistas principales de un objeto 253
Vistas principales de un objeto 255
rboles en planta 259
UEROHVHQHOHYDFLyQ 261
Texturas 263
Plano matriz planta baja 267
Plano matriz planta alta 269
Planta amueblada planta baja 271
Planta amueblada planta alta 273
Planta acotada planta baja 275
Planta acotada planta alta 277
Planta de acabados planta baja 281
Planta de acabados planta alta 283
Planilla de puertas y ventanas 285
ElHYDFLyQIURQWDO\6HFFLyQ$- 287
6HFFLyQ%- 289
Planta de drenajes planta baja 293
Planta de drenajes planta alta 295
Planta de techos 297
Plano de iluminaciyQSODQWDEDMD 301
Plano de ilXPLQDFLyQSODQWDDOWD 303
Plano de unidades de fuerza 305
Plano de unidades de fuerza 307
3ODQWDGHFLPHQWDFLyQ\FROXPQDV planta baja 311
3ODQWDGHFLPHQWDFLyQ y columnas planta alta 313
DetDOOHVGHFLPHQWDFLyQ 315
Detalle de columnas 317



Plano de armado de losa tradicional 321


Plano de armado de losa prefabricada 323
Detalle de cortes de muro 325
Detalle de viga V-1 327

Conclusiones 331
Recomendaciones 332
%LEOLRJUDItD 333


W1dh>K 1
GENERALIDADES

1


1.1 OBJETIVOS
Objetivos Generales

(ODERUDU XQ GRFXPHQWR WHyULFR-SUiFWLFR SDUD HOiUHD GH 7pFQLFD &RPSOHPHQWDULD


GH OD )DFXOWDG GH ,QJHQLHUtD GH OD 8QLYHUVLGDG GH 6DQ &DUORV GH *XDWHPDla, que
GHVDUUROOH XQ PpWRGR GLGiFWLFR TXH IDFLOLWH HO DSUHQGL]DMe de conceptos y que
contribuya DGHVDUUROODUKDELOLGDGHVHQODHMHFXFLyQHLQWHUSUHWDFLyQGHODH[SUHVLyQ
JUiILFD XQD WpFQLFD TXH WRGR LQJHQLHUR GHEH VDEHU HQ VXV FRQFHSWRV EiVLFRV \
que eVWHGRFXPHQWRSXHGDVHUXWLOL]DGRHQHOFXUVRGH7pFQLFD&RPSOHPHQWDULD
GHOSHQVXPGHOD)DFXOWDGGH,QJHQLHUtD

4XH HVWH GRFXPHQWR VLUYD GH FRQVXOWD \ JXtD SDUD ORV docentes que imparten el
FXUVRGH7pFQLFD&RPSOHPHQWDULD

Facilitar la autoformaciyQGel estudiante al orientarlo DXWLOL]DUXQDJXtDRPDQXDOGH


apoyo.

2EMHWLYRV(VSHFtILFRV

(VWDQGDUL]DU ORV FULWHULRV PHWRGROyJLFRV GH HQVHxDQ]D \ HYDOXDFLyQ HPSOHDGRV SRU


ORVFDWHGUiWLFRVGHOiUHDGH7pFQLFD&RPSOHPHQWDULD

&UHDUXQDJXtDSDUDHVWDQGDUL]DUODHYDOXDFLyQ

'HVDUUROODUFRQDPSOLWXGWRGRVORVFRQWHQLGRVGHOFXUVRGH7pFQLFD&RPSOHPHQWDULD
2.

2


1.2 MARCO CONCEPTUAL


ANTECEDENTES DEL PROBLEMA

'HQWURGHOD)DFXOWDGGH,QJHQLHUtDGHOD8QLYHUVLGDGGH6DQ&DUORVGH*XDWHPDOD
existe el iUHD GH 7pFQLFD &RPSOHPHQWDULD OD FXDO VH HQFDUJD GH OD IRUPDFLyQ de los
estudiantes en ODEXHQDLQWHUSUHWDFLyQ\UHDOL]DFLyQGHSODQRVFRQVWUXFWLYRVhechos a mano
(de forma tradicional), logrando aVt habilidades y destrezas en el campo del lenguaje
JUiILFR. Se espera que estudiante al terminar estos cursos HVWpHQFDSDFLGDGGH concebir,
inWHUSUHWDU HQWHQGHU \ H[SUHVDU GH IRUPD JUiILFD ORV REMHWRV TXH OH rodean, objetos tanto
DUTXLWHFWyQLFRV FRPR HVWUXFWXUDOHV SDUD SRGHU WHQHU XQD FRUUHFWD SODQLILFDFLyQ GH los
mismos, utilizando una de las herramientas que ha sido de vital importancia en cualquier
SUR\HFWRKR\HQGtDOos planos constructivos.

$ OR ODUJR GH OD SUHSDUDFLyQ SURIHVLRQDO GHO HVWXGLDQWH GH ,QJHQLHUtD VH OH SUHVHQWDQ
diversos factores que LQIOX\HQHQHOUHQGLPLHQWRDFDGpPLFRHQHVWDiUHDORVFXDOHVVRQ

Factores Sociales:
R Cargas familiares
R Poca disponibilidad de Tiempo

)DFWRUHV$FDGpPLFRV
R 3RFDH[SHULHQFLDHQHOiUHDGHOGLEXMR
R )DOWDGHELEOLRJUDItDDGHFXDGDDOFXUVR
R Diversidad de criteriRVGHORVFDWHGUiWLFRVDOPRPHQWRGHLPSDUWLUORV
cursos
R Diversidad de criteULRVHQHOPpWRGRGH HYDOXDFLyQ
R 3RFRLQWHUpVHQHOGLEXMR
R 3RFDDVHVRUtDSHUVRQDOL]DGD

/D PD\RUtD GH HVWRV IDFWRUHV Pencionados se pueden minimizar D WUDYpV GH XQ
GRFXPHQWR WHyULFR-SUiFWLFR TXH VHD GH DSR\R DO HVWXGLDQWDGR \ DO JUXSR GH GRFHQWHV
TXH LPSDUWHQ GLFKRV FXUVRV UHGXFLHQGR OD SUREOHPiWLFD HQ XQ EXHQ SRUFHQWDMH \
DXPHQWDQGRHOQLYHODFDGpPLFRGHOHVWXGLDQWHDWUDYpVGHODXWR-aprendizaje.

$FRQWLQXDFLyQVHSUHVHQWDQORVVLguientes cuadros para analizarlos, en los cuales se


GHWDOODHOUHQGLPLHQWRDFDGpPLFRFRPSUHQGLGRHQWUHORVSHUtRGRVDFDGpPLFRVGHORVDxRV
2003 al 2008.

3


dE/KDW>DEdZ/
JORNADA MATUTINA-VESPERTINA
REGISTRO DE RENDIMIENTO HK
^ A B C D F G H J N P Q
Asignados 13 72 12 110 15 81 26
Con derecho a zona 13 40 12 88 15 37 20
Sometidos a examen final 13 40 12 88 15 37 20
Aprobados 13 40 12 88 15 37 20
Total reprobados 0 32 0 22 0 44 6
Examinados reprobados 0 0 0 0 0 0 0
100,00 55,56 100,00 80,00 100,00 45,68 76,92
% Aprobados/Asignados % % % % % % %
100,00 100,00 100,00 100,00 100,00 100,00 100,00
% Aprobados/examinados % % % % % % %
44,44 20,00 54,32 23,08
% Total Repro./Asignados 0,00% % 0,00% % 0,00% % %
%Examinados reprob.
/Examinados 0,00% 0,00% 0,00% 0,00% 0,00% 0,00% 0,00%

dE/KDW>DEdZ/
JORNADA MATUTINA-VESPERTINA
REGISTRO DE RENDIMIENTO HK
^n A B C D F G H J N P Q
Asignados 96 11 153 19 15 72 23 12
Con derecho a zona 81 7 131 17 10 68 17 8
Sometidos a examen final 81 7 131 17 10 68 17 8
Aprobados 67 7 117 15 10 68 17 6
Total reprobados 29 4 36 4 5 4 6 6
Examinados reprobados 14 0 14 2 0 0 0 2
69,79 63,64 76,47 78,95 94,44 73,91 50,00
% Aprobados/Asignados % % % % 66,67% % % %
82,72 89,31 88,24 100,00 100,00 100,00 75,00
% Aprobados/examinados % 100% % % % % % %
30,21 36,36 23,53 21,05 26,09 50,00
% Total Repro./Asignados % % % % 33,33% 5,56% % %
%Examinados reprob. 17,28 10,69 11,76 25,00
/Examinados % 0,00% % % 0,00% 0,00% 0,00% %

4


dE/KDW>DEdZ/
JORNADA MATUTINA-VESPERTINA
REGISTRO DE RENDIMIENTO HK
^n A B C D F G H J N P Q
Asignados 15 101 115 14 50 16 12
Con derecho a zona 13 80 102 11 36 11 6
Sometidos a examen final 13 80 102 11 36 11 6
Aprobados 13 70 92 7 31 8 5
Total reprobados 2 31 23 7 19 8 7
Examinados reprobados 0 10 10 4 5 3 1
69,31 80,00 50,00 62,00 50,00 41,67
% Aprobados/Asignados 86,67% % % % % % %
100,00 87,50 90,20 63,64 86,11 72,73 83,33
% Aprobados/examinados % % % % % % %
30,69 20,00 50,00 38,00 50,00 58,33
% Total Repro./Asignados 13,33% % % % % % %
%Examinados reprob. 12,50 36,36 13,89 27,27 16,67
/Examinados 0,00% % 9,80% % % % %

dE/KDW>DEdZ/
JORNADA MATUTINA-VESPERTINA
REGISTRO DE RENDIMIENTO HK
^n A B C D F G H J N P Q
Asignados 12 47 80 15 16 11 14
Con derecho a zona 7 34 63 7 8 6 9
Sometidos a examen final 7 34 63 7 8 6 9
Aprobados 4 31 56 4 8 6 4
Total reprobados 8 16 24 11 8 5 10
Examinados reprobados 3 3 7 3 0 0 5
33,33 65,96 70,00 26,67 28,57
% Aprobados/Asignados % % % % 50,00% 54,55% %
57,14 91,18 88,89 57,14 100,00 100,00 44,44
% Aprobados/examinados % % % % % % %
66,67 34,04 30,00 73,33 71,43
% Total Repro./Asignados % % % % 50,00% 45,45% %
%Examinados reprob. 42,86 11,11 42,86 55,56
/Examinados % 8,82% % % 0,00% 0,00% %

5


TE/KDW>DEdZ/
JORNADA MATUTINA-VESPERTINA
REGISTRO DE RENDIMIENTO HK
^n A B C D F G H J N P Q
Asignados 99 11 151 37 103 38 25
Con derecho a zona 78 7 113 23 74 17 19
Sometidos a examen final 78 7 113 23 74 17 19
Aprobados 73 7 108 21 63 15 14
Total reprobados 26 4 43 16 40 23 11
Examinados reprobados 5 0 5 2 11 2 5
73,74 71,52 56,76 61,17 39,47 56,00
% Aprobados/Asignados % 63,64% % % % % %
93,59 100,00 95,58 91,30 85,14 88,24 73,68
% Aprobados/examinados % % % % % % %
26,26 28,48 43,24 38,83 60,53 44,00
% Total Repro./Asignados % 36,36% % % % % %
%Examinados reprob. 14,86 11,76 26,32
/Examinados 6,41% 0,00% 4,42% 8,70% % % %

dE/KDW>DEdZ/
JORNADA MATUTINA-VESPERTINA
REGISTRO DE RENDIMIENTO HK
^n A B C D F G R J N P Q
Asignados 11 76 102 12 10 24 17
Con derecho a zona 8 65 81 7 6 19 9
Sometidos a examen final 8 65 81 7 6 19 9
Aprobados 8 63 79 6 6 18 9
Total reprobados 3 13 23 6 4 6 8
Examinados reprobados 0 2 2 1 0 1 0
82,89 77,45 50,00 75,00
% Aprobados/Asignados 72,73% % % % 60,00% % 52,94%
100,00 96,92 97,53 85,71 100,00 94,74 100,00
% Aprobados/examinados % % % % % % %
17,11 22,55 50,00 25,00
% Total Repro./Asignados 27,27% % % % 40,00% % 47,06%
%Examinados reprob./ 14,29
Examinados 0,00% 3,08% 2,47% % 0,00% 5,26% 0,00%

)XHQWH,QIRUPHVREUHUHQGLPLHQWRDFDGpPLFRGHHVWXGLDQWHVGDWRVREWHQLGRVHQODRILFLQDGHOirea
GH 7pFQLFD &RPSOHPHQWDULD )DFXOWDG GH ,QJHQLHUtD Usac. $xRV  DO 

6


Analizando los cuadros anteriores y discutienGRFRQORVFDWHGUiWLFRVGHHVWHFXUVR, se


GHWHFWy XQ EDMR UHQGLPLHQWR DFDGpPLFR HQ FXDQWR D OD FRQFHSWXDOL]DFLyQ H[SUHVLyQ H
inteUSUHWDFLyQGH IRUPDVWULGLPHQVLRQDOHV\SODQRVFRQVWUXFWLYRVORTXHFRQVWLWX\HXQGpILFLW
para la forPDFLyQSURIHVLRQDOGHOHVWXGLDQWH \DTXHODUHDOL]DFLyQGHSODQRVHV uno de los
medios en que todo planificador de proyectos se basa para una adecuada plDQLILFDFLyQ
en especial VL HV HQ HO iUHD GH FRQVWUXFFLyQ AsiPLVPR D SDUWLU GHO DxR  OD SREODFLyQ
HVWXGLDQWLO GLVPLQX\y SRU LPSOHPHQWDFLyQ GHO FXUVR OLEUH GH DXWRFDG DYDQ]DGR TXH HV
HTXLYDOHQWHFRQ7pFQLFD&RPSOHPHQWDULD(VWR~OWLPR ha contribuido a que el alumno deje
a un lado los conceptos fundamentales del dibujo como la mano alzada, los bosquejos y
cualquier otro medio que le permita comunicarse JUiILFDPHQWH sin depender de un
computador.

IMPORTANCIA DEL PROBLEMA

Es de vital importancia aumentaUHOUHQGLPLHQWRDFDGpPLFRGHOos estudiantes para


DVt IRUmar profesionales creativos capaces de HQIUHQWDU ODV SUREOHPiWLFDV TXH VH OH
SUHVHQWHQ D OR ODUJR GH OD FDUUHUD SURIHVLRQDO DVt FRPR DXPHQWDU la efectividad de la
HQVHxDQ]D-DSUHQGL]DMH D WUDYpV GH OD LQWHUSUHWDFLyQ HIHFWLYD GH OD SUiFWLFD \ WHRUtD
estimulando en el esWXGLDQWH OD DXWRIRUPDFLyQ DXWRaprendizaje y desarrollo de juicios y
valores.

El objetivo general del cuUVR GH 7pFQLFD &RPSOHPHQWDULD  Promover en el


estudiante el sentido de obsHUYDFLyQ \ HO LQWHUpV SRU HO PHGLR TXH OR URGHD \ DGTXLULU
confianza en su propia habilidad. Que el estudiante desarrolle sus habilidades manuales y
espaciales, bidimensionales y tridimensionales, DVt FRPR GHVDUUROODU VXV KDELOLGDGHV \
destrezas de expresiyQ LQWHUSUHWDFLyQ \ GHILQLFLyQ D WUDYpV GHO GLEXMR SDUD DVt PHMRUDU VX
rendLPLHQWRDFDGpPLFR
Incrementar sus habilidades en el manejo de instrumentos de dibujo, rotulado,
XWLOL]DFLyQGHOtQHDVDVtFRPRUHSUHVHQWDUJUiILFDPHQWHREMHWRVHQGRV\WUHVdimensiones .1.
Y el objetivo genHUDO GHO FXUVR GH 7pFQLFD &RPSOHPHQWDULD  es
UHSUHVHQWH JUiILFDPHQWH D WUDYpV GHO GLEXMR ODV GLIHUHQWHV IDVHV ,QVWDODFLRQHV HVWUXFWXUDV
SHUILOHV HWF   8VDGDV HQ ORV SUR\HFWRV GH ,QJHQLHUtD 4XH FRQRzca el mobiliario, equipo y
DFFHVRULRV TXH VH DSOLFD HQ OD UHSUHVHQWDFLyQ GH SODQRV FRQVWUXFWLYRV DVt FRPR VXV
PHGLGDVHQSODQWDVHFFLyQ\HOHYDFLyQ4XHSXHGDUHSUHVHQWDUJUiILFDPHQWHODVSODQWDV
HOHYDFLRQHV\VHFFLRQHVGHXQSUR\HFWR\DVtWDPELpQGDU al estudiante los fundamentos de
2.

PLANTEAMIENTO DEL PROBLEMA

LD IDOWD GH XQ PDQXDO WHyULFR-SUiFWLFR KDFtD TXH OD RUJDQL]DFLyQ HYDOXDFLyQ \
SURJUDPDFLyQGHlos cursos muchas veces creara cierta incertidumbre, ya que los docentes

1
Wd&/h^
Guatemala, 2008.
Wd&/h^
2

Guatemala, 2008.

7


LPSDUWtDQ \ RUJDQL]DEDQ FDGD XQR XQ PpWRGR GLIHUHQWH Asimismo, OD SRFD DVHVRUtD
personalizada QR FXEUtD OD QHFHVLGDG GHO DOXPQDGR, en cuanto a respuesta de las
interrogantes que los mismos se hactDQ para mejorar sus habilidades.

Con el desarrollo de un documento GLGiFWLFR WHyULFR-SUiFtico, loVGRFHQWHVSRGUiQ


WHQHUXQIDFLOLWDGRUHQHOGHVDUUROORGHOFXUVRFRPRXQFRPSOHPHQWRGHOFDWHGUiWLFR para
impartir la clase, asimismo con el uso del manuscrito el estXGLDQWH SRGUi DXWRevaluarse,
consultando el manual. Es de suma importancia brindar apoyo al estudiantado, los cuales
HQVXPD\RUtD QRSRVHHQXQEXHQUHVSDOGRHQHOiUHDGHOGLEXMR\VXLQWHUSUHWDFLyQ y sus
habilidades necesitan ser reforzadas. El maQXDOGLGiFWLFR OHEULQGDUiXQD H[SOLFDFLyQFODUD
D WUDYpV GH JUiILFDV \ WH[WR TXH SDVR D SDVR OH GHVFULELUi ODV Wpcnicas de dibujo,
PHMRUDQGRDVt el rendimiento y minimizando el porcentaje de alumnos repitentes.

Todo estudiante debe saber FyPR se elaboran e interpretan los planos, ya que al
momento de estar ejerciendo como profesional, y tenga en su oficina personal para la
HODERUDFLyQGHSODQRVGHEHUiHVWDUFDSDFLWDGRSDUDLQWHUSUHWDUORVPLVPRV\ DVtVDEHU VL
son o no correctos.

Alcances y Limitaciones

Alcances

Elaborar XQ GRFXPHQWR GLGiFWLFR SDUD TXH ORV HVWXGLDQWHV GH 7pFQLFD
&RPSOHPHQWDULD  OR XWLOLFHQ FRPR JXtD \ ORV FDWHGUiWLFRV GH GLFKR FXUVR FRPR
consulta y apoyo para impartir clases.

El contenido de este documentR VH IXQGDPHQWy HQ HO SURJUDPa del curso de
7pFQLFD&RPSOHPHQtaria 2.

Con el uso de este manual de apoyo se pretende incrementar el rendimiento


DFDGpPLFR \D TXH HO HVWXGLDQWH GH 7pFQLFD &RPSOHPHQWDULD  FRQWDUi con un
GRFXPHQWRGHFRQVXOWDTXHFRQWULEXLUiDTXHGHVDUUROOHVXVKDELOLGades manuales y
HVSDFLDOHVELGLPHQVLRQDOHVWULGLPHQVLRQDOHV\UHSUHVHQWHJUiILFDPHQWHDWUDYpVGHO
GLEXMRODVGLIHUHQWHVIDVHVXVDGDVHQORVSUR\HFWRVGH,QJHQLHUtD

Limitaciones

EstH GRFXPHQWR VH XWLOL]DUi H[FOXVLYDPHQWH SDUD HO FXUVR GH 7pFQLFD
ComplemHQWDULDGHOD)DFXOWDGGH,QJHQLHUtDGHOD8QLYHUVLGDGGH6DQ&DUORVGH
Guatemala.

(VWHGRFXPHQWRVRORSRGUiVHUXWLOL]DGRFRPRGRFXPHQWRGHDSR\RHQODGRFHQFLD
SDUDLPSDUWLUORVFXUVRVQRSRGUiVXVWLWXLUDOFDWHGUiWLFR.

8


1.3 0$5&27(5,&2
La EducaciyQ

HGXFDFLyQ YLHQHGHOODWtQHGXFDUHTXHVLJQLILFDFULDU
DOLPHQWDUQXWULUTXHVHUiWDQWRFRPRLQVWUXLURVHDHQVHxDU\WUDQVPLtir conocimientos a una
persona. 3WDPELpQHVXQHOHPHQWRTXHWLHQHGLYHUVDVUHDFFLRQHVVREUHel ser humano:

+HWHURHGXFDFLyQ rna que configura al individuo


TXLHUHGHFLUTXHHOHVWXGLDQWHUHFLEHXQHVWtPXORH[WHUQR

$XWRHGXFDFLyQ dividuo se
configure a VtPLVPR el estudiante tiene la inquietud de
autoformarse.

$XWRIRUPDFLyQ

para aplicar lo aprendido.

(OHPHQWRVGHOD(GXFDFLyQ

GHHOPyYLOIXQGDPHQWR o parte integrante de una cosa; para nosotros los


elementos en general son las partes TXH FRPSRQHQ HO WRGR \ HQ HGXFDFLyQ OD SDUWHV
fundamentales del 4

Los elementos son:

Educando

Es el sujeto que es objeto de la HGXFDFLyQODSHUVRQDTXHUHFLEHORVEHQHILFLRVGH


ODDFFLyQHGXFDWLYDLa persona que es modificada por el predominio del educador.

Educador

(V HO TXH SURYRFD HO HVWtPXOR GH PRGLILFDFLyQ GH FRQGXFWD GH GHWHUPLQDGD
persona. El educador es un emisor del coQWHQLGRHGXFDWLYRFRQHO ILQGHFUHDUSHUVXDVLyQ
en la conducta del educando.

3
>>Wd&^
'W
KW
4

9


Materia

(O HGXFDGRU HPLWH PHQVDMHV D VX UHFHSWRU HGXFDQGR R VXMHWR GH HGXFDFLyQ , lo
FXDOHVHOFRQWHQLGRHGXFDWLYR\HVWH~OWLPRVHLGHQWLILFDDWUDYpVGHXQWHPDGHHVWXGLo o
asignatura seleccionada por el educador para transmitir el mensaje. 7DPELpQ HV XQ
HOHPHQWRGHUHODFLyQHQWUHHOSURIHVRU\HODOXPQR

/D(QVHxDQ]D

Se
acciones que requierHQ LQWHQFLRQDOLGDG \ UHODFLyQ GH FRPXQLFDFLyQ HQVHxDU HV XQ DFWR
comunicativo, un acto por el cual el docente pone de manifiesto los objetivos de
FRQRFLPLHQWRDWUDYpVGHODDSRUWDFLyQGHQXHYDVVLJQLILFDFLRQHV 5

Por ello, es de vital importancia que exLVWD XQD EXHQD FRPXQLFDFLyQ HQWUH HO
FDWHGUiWLFR \ HO HVWXGLDQWH \ TXH HVWH ~OWLPR D WUDYpV GH HMHUFLFLRV FRPSOHPHQWH VX
IRUPDFLyQSRUPHGLRGHODSUiFWLFD

El Aprendizaje

ello; es el proceso de adquirir o desarrollar una nueva conciencia y conocimiento; en otras


6 Existen tres clases de aprendizaje: la

DGTXLVLFLyQ GH FRQRFLPLHQWRV GH GHVWUH]D \ GH DFWLWXGHV HO FRQRFLPLHQWR HV un dato, la
7.

Podemos decir entonces que, en el proceso en que uno aprende determinada materia, va
adquiriendo conocimientos e ideas, y a esto, un cambio de actitud.

'LYHUVDVWHRUtDVQRVD\XGDQDFRPSUHQGHUSUHGHFLU\FRQWURODUHOcomportamiento
humano y tratan de explicar FyPR los sujetos acceden al conocimiento. Su objeto de
estudio se centra en la adquisiciyQGHGHVWUH]DV\KDELOLGDGHVHQ HOUD]RQDPLHQWR\ HQOD
DGTXLVLFLyQGHFRQFHSWRV 8

Igualmente, el aprendizaje del dibujo es cuando el estudiante adquiere todos los


conceptos relacionados al dibujo, despliega destrezas y habilidades para representar
JUiILFDPHQWH, D WUDYpV GH SODQRV, las diferentes fases usadas en los proyectos DVt PLVPR
DGTXLHUHORVIXQGDPHQWRVGHODWpFQLFDGHGLEXMRTXHOHSHUPLWDLQLFLDUse en los trabajos de
dicha ciencia, y tiene un cambLRGHDFWLWXGKDFLDODDGTXLVLFLyQGHQXHYRVFRQRFLPLHntos.

'W
5
6
>>Wd&<W
208
/W
7

'dd
8

10


/$7(25$&57,&$'(/$(16(f$1=$

WRGDV DTXHOODV FRQVLGHUDFLRQHV TXH HVWiQ UHODFLRQDGDV FRQ HO SURFHVR GH HQVHxDQ]D
WRPDQGRFRPRYiOLGDVDTXHOODVTXHIDYRUHFHQHOSURFHVRGHaprendizaje y HGXFDFLyQ, de
KDELOLGDGHV \ FDSDFLGDGHV UHFKD]iQGose las que interfieren, de una u otra forma, con el
desarrollo de los mismos. Es, en su esencia, una LQWHJUDFLyQ de todos los factores que
influyen positivamente en la HYROXFLyQ de la actividad cognoscitiva del ser humano, en su
SUiFWLFDGHE~VTXHGDKDFLDHOHQFXHQWURGHORVFULWHULRVGHYHUGDG\GHDSOLFDELOLGDGHQHO
complejo SURFHVRGHWUDQVIRUPDFLyQGHODUHDOLGDGHQFRUUHVSRQGHQFLDFRQODVSULRULGDGHV
determinadas por los intereses y motivaciones del sujeto cognoscente y del medio social en
que se desenvuelve.

En resumen, HQODWHRUtDFUtWLFDGHODHQVHxDQ]DTXHGDGHELGDPHQte aclarado que


conocer no es adivinar, que el conocimiento no es un producto autoengendrado al cual se
accede de manera improvisada, sino recorriendo los caminos de la disciplina intelectual
GRQGH HO VXMHWR FRJQRVFHQWH VH DSURSLD GH XQ UHIOHMR OyJLFR GH OD UHDOLGad objetiva
mediante una serie de procedimientos R DFWLYLGDGHV DUPyQLFDPHQWH FRQFDWHQDGRV TXH
en su LQWHJUDFLyn 9

Podemos decir que HQVHxDQ]D HV WRGR SURFHVR TXH D\XGD HQ HO GHVDUUROOR GHO VHU
KXPDQR HQ FXDQWR DO SURJUHVR GH VX QLYHO LQWHOHFWXDO EULQGiQGROH DO LQGLYLGXR
conocimiento, habilidades y capacidades para dominar determinado tema de estudio.
Para que el educando se nutra del conocimiento, se debe someter a la disciplina de cierto
SURFHVRRPpWRGRSDUDLUDGTXLULHQGR\GRPLQDQGRVXQRFLyQ

(QODSVLFRORJtDHGXFDWLYDVHKDFUHDGRXQVLVWHPDGHLQVWUXFFLyQFRQRFLGRFRmo
DSUHQGL]DMH FRQWURODGR TXH VH EDVD HQ OD FUHHQFLD GH TXH OD PD\RUtD GH ORV HVWXGLDQWHV
SXHGHQDOFDQ]DUQRWDEOHp[LWRVLVLJXHQFLHUWRVSURFHGLPLHQWRVHQWUHHOORV

(O SURJUDPD VH GLYLGH HQ VXFHVLYDV XQLGDGHV HVWUXFWXUDGDV GH XQD IRUPD OyJLFD
estructurada en un tiempo prudencial.

Desarrollo desglosado de cada uno de los ejemplos de los temas. Cada ejercicio
GHEHHVWDUHMHPSOLILFDGR\GHVDUUROODGRSDVRDSDVRSDUDVXPHMRUFRPSUHQVLyQ

(MHUFLFLRV SUiFWLFRV SDUD TXH HO HVWXGLDQWH SXHGD HODERUDUORV HQ FDVa y clase.
Pueden ser desarrollados por el estudiante siguiendo los pasos de los ejemplos.

Los eVWXGLDQWHVVXVWHQWDQDOILQDOGHFDGDXQLGDGXQDSUXHEDSUiFWLFD\WHyULFD/R
FXDO GDUi XQD YLVLyQ DO FDWHGUiWLFR VREUH ORV FRQRFLPLHQWRV TXH DGTXLULy HO
estudLDQWH\VLVHQHFHVLWDUHIRU]DUDOJ~QWHPD

+D\VXILFLHQWHVRSFLRQHVSDUDODHQVHxDQ]D\ODHYDOXDFLyQFRQHOREMHWRGHTXHORV
estudiantes puedan elevar su rendimiento durante el transcurso de la materia. El

^Z//'Wd>/d
9

dW

11


FXUVRVHGLYLGLUiHQYDULDVIDVHVGHHYDOXDFLyn, para que el alumno pueda recuperar


su rendimiento durante el transcurso de la materia.

0DWUL]GHHYDOXDFLyQHQFDGDXQRGHORVHMHUFLFLRV(VWDPDWUL]VHUiHODERUDGDFRQ
EDVH HQ HO DQiOLVLV GH ORV FULWHULRV GHO FDWHGUiWLFR SDUD HYDOXDU FDGD WHPD HVWR
a\XGDUi DO HVWXGLDQWH D FRQRFHU TXp IDFWRUHV OH HVWDUiQ HYDOXDQGR \ HVPHUDUVH
10

/$&2081,&$&,1

El diccionario define la palabra &RPXQLFDFLyQ


FRPXQLFDU DOJR 7UDWR HQWUH GRV SHUVRQDV &RPXQLFDFLyQ de masas, proceso de
11

PtQLPR DOJXLHQ TXH HQVHxH \ DOJXLHQ TXH DSUHQGD VH UHDOL]D VLHPSUH HQ VLWXDFLyQ VRFLDO
ya sea que se trate de sistemas individualizados. Y toda situaFLyQ VRFLDO SUHVXSRQH XQD
LQWHUDFFLyQ PHQWDO \ VRFLDO TXH SUHH[LJH FRPXQLFDFLyQ 6HJ~Q OD GHILQLFLyQ FRUULHQWH OD
FRPXQLFDFLyQ HV XQ SURFHVR GH WUDQVPLVLyQ GH LGHDV 6LQ HPEDUJR HV SUHFLVR FRQVLGHUDU
TXH PXFKDV YHFHV OD FRPXQLFDFLyQ WRFD OD VHQVLELOLGDG, procurando formar actitudes y
12

/RVHOHPHQWRVGHOSURFHVRGHFRPXQLFDFLyQ

FUENTE CODIFICADOR MENSAJE


&DWHGUiWLFR  /HQJXDMHWpFQLFR  &RQWHQLGR3UR\HFWR 

CANAL DESCIFRADOR
(Medio) (Si se comprende)
RECEPTOR
(El estudiante)
(Q OD FRPXQLFDFLyQ XQ PHQVDMH HV WUDQVPLWLGR PHGLDnte un canal, de una fuente
emisora a un receptor (es preciso que alguien emita un mensaje, y que alguien lo reciba,
SDUD TXH KD\D FRPXQLFDFLyQ  /D IXHQWH WLHQH XQ REMHWLYR (VWH HV WUDGXFLGR HQ XQ
OHQJXDMHRFyGLJRSRUXQFRGLILFDGRUWUDQVIRUPiQGRVHHQ mensaje. A la vez, es necesario
que haya en el otro polo un descifrador para que el mensaje sea captado en forma
adecuada por el receptor.

'ddW
10

>/^sW
11

Mello Carvalho, Irene. El p<W


12

12


0e72'26'((16(f$1=$

decir o hace 13

(OWHUPLQR PpWRGR GHULYD GHO ODWtQ PHWKRGXV TXH D VX YH]SURYLHQH GH GRV voces
griegas: meta, fin, 14

objetivo, o como deWHUPLQDGR SURFHGLPLHQWR SDUD RUGHQDU OD DFWLYLGDG (O PpWRGR
XQLYHUVDOGHFRQRFLPLHQWRHVODGLDOpFWLFDPDWHULDOLVWDVXVSULQFLSLRVVRQFRPXQHVDWRGRV

constituye VXEDVHILORVyILFDFRP~Q\VHSUHVHQWDHQFDOLGDGGHLQVWUXPHQWRGHOFRQRFHUHQ
WRGDVODVHVIHUDV6REUHHVWDEDVHFDGDFLHQFLDHQSDUWLFXODUHODERUDVXVSURSLRVPpWRGRV\
15

(O PpWRGR WLHQH LPSRUWDQFLD FDSLWDO en el quehacer humano, porque contribuye a


OD HFRQRPtD GH WLHPSR GH HQHUJtD \ GH UHFXUVRV DVt FRPR DO ORJUR GH ILQHV SUHYLVWRV HO
PpWRGR HV XQD DFWLYLGDG LQWHOLJHQWH TXH VyOR UHDOL]D OD HVSHFLH KXPDQD SRU FXDQWR
LPSOLFD OD UHODFLyQ R XQLyQ FXLGDGRVD VHJ~Q VH GLMR GH EDVHV \ GH ILQHV GHQWUR GH
circunstancias determinadas.

/$(9$/8$&,1'(/$35(1',=$-('(/26$/80126

6LHPSUHTXHVHWUDEDMDHQHOSURFHVRGHHQVHxDQ]DVHTXLHUHVDEHUHOUHVXOWDGRGHO
mismo, tanto el educador como el educando, necesitan saber todos los aspectos
FXDQWLWDWLYRV \ FXDOLWDWLYRV GH OR DSUHQGLGR HQ HO DXOD 3DUD HOOR H[LVWHQ PpWRGRV GH
Evaluar significa valorar los resultados de una
DFFLyQ (Q HO FDVR GH OD DFFLyQ HGXFDWLYD VH HYDO~a lo que los alumnos han aprendido
(resultados del aprendizaje) y las actividades que se realizan para que aprendan
16

(QWRQFHVSRGHPRVGHFLUTXHHOREMHWLYRSULPRUGLDOGHODHYDOXDFLyQHVFRQGXFLUGH
una mejor manera el proceso en que se educa, para que el alumno reciba el conocimiento
QHFHVDULR\VHDDFRJLGRIiFLOPHQWHSRUHOHGXFDQGR

mejorar los resultados del aprendizaje.


tiene un caUiFWHU FRQWLQXR VH HYDO~D DO PLVPR WLHPSR TXH VH YD SURGXFLHQGR HO
DSUHQGL]DMHSDUDFRQRFHUFyPRVHSURGXFHpVWH
3DUDUHDOL]DUODHYDOXDFLyQVHXWLOL]DQWpFQLFDVLQVWUXPHQWRV\FULWHULRVTXHSHUPLWHQ
recoger toda OD LQIRUPDFLyQ TXH VH SUHFLVD \ DSUHFLar si el aprendizaje que se ha
producido es el adecuado.
/DHYDOXDFLyQHVUHDOL]DGDSRUHOHTXLSRGHSURIHVRUHV

>/^sW
13

>>Wd&^ricana. 1ra.
14

'W
15
Zd/h^&
W
:/
16



13


/RV UHVXOWDGRV R FRQFOXVLRQHV GH OD HYDOXDFLyQ VH H[SUHVDQ PHGLDQWH ODV
17

(OFDUiFWHUIRUPDWLYRGHODHYDOXDFLyQSUHWHQGHTXHODYDORUDFLyQQRVHDVRODPHQWH
XQVLVWHPDGH PHGLFLyQSDUDVDEHU FXiQWR KDDSUHQGLGRHODOXPQRVLQRTXHWDPELpQ
FXPSOD FRQ OD IXQFLyQ GH GHWHFWDU GXUDQWH HO SURFHVR GH HQVHxDQ]D ORV SUREOHPDV
durante el aprendizaje, y evaluar FyPR VROXFLRQDU pstos, para conseguir mejores
resultados en el proceso.

(O FDUiFWHU FRQWLQXR GH OD HYDOXDFLyQ HV HO TXH SHUPLWH FRQRFHU HO GHVDUUROOR GHO
aprendizaje en el alumno, es decir, nos permite ver como el alumno va adquiriendo sus
habilidades y destrezas y como los conceptRV\WpFQLFDVGHOGLEXMRYDQHYROXFLRQDQGR
D OD YH] TXH HMHFXWD OD HODERUDFLyQ GHO SODQR IRUPDWR  (O SURIHVRU SXHGH HVWDEOHFHU
modificaciones durante la foUPDFLyQ GHO DOXPQDGR SDUD TXH pVWRV ~OWLPRV DSUHQGDQ
mejor.

/D&DOLILFDFLyQ

/DHYDOXDFLyQGHXQSHULRGRGHDSUHQGL]DMHWHUPLQDFRQODYDORUDFLyQTXHKDFHHO
SURIHVRU GHO DSURYHFKDPLHQWR GHO DOXPQR (VWD YDORUDFLyQ VH H[SUHVD HQ IRUPD GH XQ
FyGLJRRFDOLILFDFLyQ

WpUPLQRVVHDQ XQDPLVPDFRVD/DHYDOXDFLyQFRQVLVWHHQUHFRJHULQIRUPDFLyQDQDOL]DUOD\
YDORUDUOD FRPSDUDU ODV FRQFOXVLRQHV GH HVH DQiOLVLV FRQ OD PHWD D OD TXH VH SUHWHQGtD
OOHJDU \ SURQXQFLDUVH VREUH HO JUDGR GH FRQVHFXFLyQ GH HVD PHWD &DOLILFDU HV H[SUHVDU
mediDQWH XQ FyGLJR HVWDEOHFLGR GH DQWHPDQR OD FRQFOXVLyQ D OD TXH VH OOHJD WUDV HVH
18

6HDSOLFDPHGLGDVGHUHIXHU]RHGXFDWLYRDORVHVWXGLDQWHVTXHVHJ~QODFDOLILFDFLyQ
obtenida, no hayan aprobado el curso, como lo son, las pruebas de UHFXSHUDFLyQHWF

El Refuerzo Educativo

DSOLFDDDTXHOORVDOXPQRVTXHHQXQPRPHQWRFRQFUHWRSUHVHQWDQSHTXHxDV dificultades
para seguir el desarrollo ordinario de las clases.

$OJXQRV HMHPSORV GH 5HIXHU]R (GXFDWLYR VRQ OD H[SOLFDFLyQ LQGLYLGXDO HQ XQ
PRPHQWR GHWHUPLQDGR DQWHV GXUDQWH R GHVSXpV GH OD FODVH  OD RUJDQL]DFLyQ PiV

17
:/

: /
18



14


pautada del trabajo que debe realizar el alumno en el aula o en su casa, la entrega de un
material complementario para afianzar aprendizajes 19

A todo esto podemos afirmar que HO PDWHULDO FRPSOHPHQWDULR VHUtD XQ PDQXDO
GLGiFWLFRTXHDX[LOLHHO DSUHQGL]DMHHLQFHQWLYHODDXWR-IRUPDFLyQHQHO DOXPQRORJUDQGR
DVt XQ PD\RU UHQGLPLHQWR HQ pO FRQYLUWLpQGRVH pVWH en un refuerzo educativo. La
H[SOLFDFLyQLQGLYLGXDOVHUiHMHFXWDGDDWUDYpVGHORVFDWHGUiWLFRVGHOFXUVR

','&7,&$(1(/&8562'(7e&1,&$&203/(0(17$5,$

para
UHSURGXFLUHQIRUPDJUiILFDFXDOTXLHUWLSRGHDPELHQWHTXHQRVURGHD\TXHWHQHPRVDQWH
QXHVWURV RMRV DEDUFDQGR OLQHDPLHQWRVGH GLVHxR \ DEDUFDQGR WDPELpQ FRQFHSWRV VREUH
generalidades de dibujo constructivo y dibujo de instalaciones, siguiendo una secuencia
OyJLFD VH GDQ FRQFHSWRV DFHUFD GH SODQWDV VHFFLRQHV HOHYDFLRQHV QRPHQFODWXUDV
20

/D SUiFWLFD HV IXQGDPHQWDO HQ HO DSrendizaje del alumno, para ello HO FDWHGUiWLFR
GHEHUiUHDOL]DUYDULRVHMHUFLFLRVTXHD\XGHQD TXHHOHVWXGLDQWHYD\DDGTXLULHQGRQRFLyQ
/DWHRUtD\ODSUiFWLFDGHEHQHVWDUOLJDGDVGXUDQWHHOSURFHVRGHHQVHxDQ]DXQDVLQODRWUD
no funcionan.
2EMHWLYRVGHHQVHxDQ]D

/RV REMHWLYRV GHO SURJUDPD GHO FXUVR GH 7pFQLFD &RPSOHPHQWDULD  VRQ 4XH HO
estXGLDQWH UHSUHVHQWH JUiILFDPHQWH D WUDYpV GHO GLEXMR ODV GLIHUHQWHV IDVHV (Instalaciones,
HVWUXFWXUDVSHUILOHVHWF XVDGDVHQORVSUR\HFWRVGHLQJHQLHUtD4XH&RQR]FDHOPRELOLDULR
HTXLSR \DFFHVRULRVTXH VHDSOLFDHQODUHSUHVHQWDFLyQGH SODQRVFRQVWUXFWLYRVDVtFRPR
VXV PHGLGDV HQ SODQWD VHFFLyQ \ HOHYDFLyQ 4XH SXHGD UHSUHVHQWDU JUiILFDPHQWH ODV
SODQWDV HOHYDFLRQHV \ VHFFLRQHV GH XQ SUR\HFWR \ DVt WDPELpQ GDU DO HVWXGLDQWH ORV
IXQGDPHQWRVGHODWpFQLFDGHGLEXMRTXHOHSHUPLWDLQLFLDUVHHQORVWUDEDMRVGHLQJHQLHUtD

0HWRGRORJtD

El cuUVR GH 7pFQLFD &RPSOHPHQWDULD  IXQFLRQD VREUH OD EDVH GH XQDLQWHJUDFLyQ
GH OD WHRUtD \ OD SUiFWLFD GH ODV XQLGDGHV HQ GRQGH VH H[SRQHQ ORV FRQFHSWRV
IXQGDPHQWDOHVVHDFODUDQGXGDV\VHH[SOLFDODWpFQLFDGHGLEXMo para trazar los diferentes
SODQRV FRQVWUXFWLYRV \ DVSHFWRV TXH FDGD XQR GHEH OOHYDU 6H GDUiQ ODV LQVWUXFFLRQHV
GHWDOODGDV UHODWLYDV D ODV XQLGDGHV SUiFWLFDV HQ ODV FODVHV WHyULFDV SDUD TXH HO HVWXGLDQWH
pueda representar los planos de un proyecto de ingHQLHUtD

19
:/

Wd &/h^
20

Guatemala. 2008.

15


/D FRQVWDQWH SUiFWica del dibujo en el estudiante GDUi FRPR UHVXOWDGR TXH
LQFUHPHQWH VXV KDELOLGDGHV \ GHVWUH]DV HQ FXDQWR D OD HMHFXFLyQ GH OD UHSUHVHQWDFLyQ
JUiILFDGHXQREMHWR/DWHRUtDH[SUHVDGDSRUFDGD FDWHGUiWLFR VHUHDOL]DUiQRVRODPHQte
al princLSLR GH FODVH VLQR TXH WDPELpQ durante el proceso en que el alumno realiza su
SUiFWLFD SDUD LU GHVDUUROODQGR GH PHMRU PDQHUD VX DSUHQGL]DMH DVt HQWRQFHV cumplimos
con una de las funciones priQFLSDOHVGHODHYDOXDFLyQTXHpsta sea continua.

3DUDTXHHOPpWRGRVHDHIHFWLYR es necesario que el ejecutor de este, el educador,


sea el responsable de que durante el proceso se alcancen los objetivos.

(O PpWRGR GH HQVHxDQ]D VHUi HO PpWRGR DFWLYR SDUD TXH HO DOXPQR SDUWLFLSH
tenga la inquietud de saber de GyQGH vienen las cosas y por TXpDVt HOHVWXGLDQWH SRGUi
hacer juLFLRV \ YDORUHV LGHQWLILFDU FXiQGR XQ GLEXMR HVWi PDO UHSUHVHQWDGR (VWH PpWRGR
D\XGD D TXH HO HGXFDQGR SURIXQGLFH HQ ORV FRQFHSWRV FUHDQGR SDUWLFLSDFLyQ \
dinamismo en cada clase, FRQ HO ILQ GH GHVSHUWDU HO LQWHUpV particular de cada uno por
autoHGXFDUVH \ EXVFDU HO FRQRFLPLHQWR $Vt SXHV VH FUHD XQ SURFHVR GH DSUHQGL]DMH
EDVDGRHQODKHWHUHRHGXFDFLyQDXWRHGXFDFLyQ\FRQILJXUDFLyQ

(O&DWHGUiWLFRHMHFXWDUiODDFFLyQHGXFDWLYDDO estudiante con el fin de:

'DUDFRQRFHUORVFRQFHSWRVGHOOHQJXDMHJUiILFR
Desarrollar habilidades manuales y espaciales
5HSUHVHQWDUJUiILFDPHQWHORVSUR\HFWRVGHLQJHQLHUtD
&RQRFHUGLPHQVLRQHVHVWiQGDUHVGHPRELOLDULR\HTXLSR
Aplicar e interpretar la sLPERORJtDHQORVSODQRVFRQVWUXFWLYRV
Formar criterio del uso de escalas
)RUPDUFULWHULRHQHOXVRGHORVGLIHUHQWHVWDPDxRVGHIRUPDWR
&RQRFHUODUHSUHVHQWDFLyQJUiILFDGHORVGLIHUHQWHVPDWHULDOHVGHFRQVWUXFFLyQ

(OHVWXGLDQWHDOFDQ]DUiHODSUHndizaje del curso cuando obtenga los siguientes objetivos:

&RQR]FDORVIXQGDPHQWRVGHODWpFQLFDGHOGLEXMR
'RPLQHODLQWHUSUHWDFLyQGHSODQRVGHXQSUR\HFWRGHLQJHQLHUtD
Manifieste criterio propio
$SOLTXHVLPERORJtDV\WH[WXUDVDGHFXDGDV
Maneje diferentes tipos GHWDPDxRGHIRUPDWRV
Aplique escalas adecuadas
0DQLILHVWHGRPLQLRHQODUHSUHVHQWDFLyQJUiILFDGHGHWDOOHVFRQVWUXFWLYRV

16


(OFDWHGUiWLFRGHEHUiHODERUDUHMHUFLFLRVPHGLDQWHORVFXDOHVel estudiante:

1. 'RPLQH OD LQWHUSUHWDFLyQ GH SODQRV GH XQ SUR\HFWR GH LQJHQLHUtD HQ VXV GLIHUHQWHV
fases
2. Manifieste su criterio
3. (MHUFLWHODUHSUHVHQWDFLyQJUiILFDGHVLPERORJtDV
4. (MHUFLWHODUHSUHVHQWDFLyQJUiILFDGHWH[WXUDVGHPDWHULDOHVGHFRQVWUXFFLyQ
5. Manifieste el criterio para el uso de tipos de formatos adecuados a determinado
proyecto
6. Manifieste el criterio para el uso de adecuadas escalas
7. (MHUFLWHODUHSUHVHQWDFLyQJUiILFDGHGHWDOOHVFRQVWUXFWLYRV
8. (MHUFLWHODUHSUHVHQWDFLyQJUiILFDGHGHWDOOHVHVWUXFWXUDOHV

(/HGXFDQGRGHEHUiGHUHFRUUHUGXUDQWHHOSHUtRGRGHOFXUVRGRVHWDSDVHQVXIRUPDFLyQ

1. Etapa de proceso de reforzamiento de habilidades espaciales, bidimensionales y


tridimensionales, el uso adecuado de los formatos y sus diferentes dimensiones, al
LJXDOTXHHOXVRGHHVFDODV(VWRVHUi XQEUHYH UHSDVo de lo aprendido en el curso
GH 7pFQLFD &RPSOHPHQWDULD  SDUD TXH SXHGD UHIRU]DU VXV FRQRFLPLHQWRV HQ OD
UHSUHVHQWDFLyQJUiILFDGHXQSUR\HFWRHQVXVYLVWDVRUWRJRQDOHV\D[RQRPpWULFDV

2. (WDSDGHSURFHVRGHDGTXLVLFLyQGHORVIXQGDPHQWRVGHODWpFQLFDGH dibujo que le


SHUPLWD LQLFLDUVH HQ ORV WUDEDMRV GH LQJHQLHUtD HQ GRQGH LQFUHPHQWDUi VXV
FRQRFLPLHQWRVHQODUHSUHVHQWDFLyQJUiILFDGHHOHPHQWRVFRQVWUXFWLYRVHVWUXFWXUDV
PDWHULDOHVFRQVWUXFWLYRVDWUDYpVGHWH[WXUDVUHSUHVHQWDFLyQGHVLPERORJtDVSDUD la
FRUUHFWD LQWHUSUHWDFLyQ PRELOLDULR \ HTXLSR TXH VH DSOLFD HQ OD UHSUHVHQWDFLyQ GH
SODQRV FRQVWUXFWLYRV DVt FRPR VXV PHGLGDV HQ SODQWD VHFFLyQ \ HOHYDFLyQ
UHSUHVHQWDU JUiILFDPHQWH \ DGHFXDGDPHQWH XQ GHWDOOH FRQVWUXFWLYR $Vt FRQ WRGR
lo anteriormentH PHQFLRQDGR SRGHU UHSUHVHQWDU JUiILFDPHQWH ODV SODQWDV
elevaciones y secciones de un proyecto.

&RQWHQLGRGHOFXUVRGH7pFQLFD&RPSOHPHQWDULD

, las cuales se dividen


HQXQLGDGHVWHyULFDV \SUiFWLFDVGHWDOPDQHUDTXHDFDGDXQLGDGWHyULFDFRUUHVSRQGDQ
YDULDV XQLGDGHV SUiFWLFDV VHJ~Q VHFXHQFLD GH HMHUFLFLRV TXH YDQ GHVDUUROODQGR HO
conocimiento y habilidad del estudio; OD HQWUHJD GH ODV IDVHV GH WUDEDMR VHUi HQ IHFKDV
claves, el estudiante GHEHUiDSUHQGHUDSODQLILFDUVXWLHPSR\FRRUGLQDUVXWUDEDMR

17


UNIDAD CONTENIDO ENTREGA FECHA


1 3UHVHQWDFLyQGHSURJUDPDMXHJRGHSODQRV Inicio de 1ra. Semana
semestre
2 3ODQR GH ORFDOL]DFLyQ \ XELFDFLyQ tQGLFHV 2da. Semana
HYROXFLyQXUEDQD
3 Trazo de plano matriz. 3ra. Semana
4 Plano de planta amueblada. 4ta. Semana
5 Plano de plata Acotada. 5ta. Semana
6 Plano de elevaciones y secciones. 6ta. Semana
7 Plan de acabados. 7ta. Semana
8 3ODQRGHLQVWDODFLyQGHGUHQDMHV $JXDV negras y Fase 1 8va.. Semana
pluviales)
9 3ODQRGHLQVWDODFLyQGHDJXDSRWDEOH 9na.. Semana
10 3ODQR GH LQVWDODFLyQ HOpFWULFD ,OXPLQDFLyQ \ 10ma. Semana
fuerza)
11 3ODQRGHFLPHQWDFLyQ\FROXPQDV 11va. Semana
12 Plano de armado de losa tradicional + planta de 12va. Semana
techos.
13 Plano de armado de losa prefabricado. 13va. Semana
14 Modulo de gradas + detalles. 14va. Semana
15 ([SOLFDFLyQGHSUR\HFWRILQDO Fase 2 15va. Semana
16 $VHVRUtDGHSUR\HFWRILQDO Fase 3 16va. Semana
17 Entrega de proyecto final 18va. Semana

(YDOXDFLyQ

/DHYDOXDFLyQGHOFXUVRVHKDFHSRUIDVHVOD]RQDVHFDOFXODSURPHGLDQGRODVWUHV
fases entregadas, en su correspondiente fecha.

FASE 1 30%
FASE 2 30%
FASE 3 15%---------- 75%
EXAMEN FINAL 25%-----------25%
TOTAL 100%

18


35238(67$','&7,&$(1(/&8562'(7e&1,&$&203/(0(17$5,$

LD SURJUDPDFLyQ RILFLDO GHO FXUVR describe la asignatura diciendo


nHFHVDULR VDEHU \ FRQRFHU FRQ SUHFLVLyQ HO XVR FRUUHFWR GH ORV REMHWRV HQ OD ,QJHQLHUtD,
SDUDHQWHQGHUFyPRHVWiQKHFKRV\QRVDEHUFyPR HVWiQUHDOL]DGRV, por tanto deberemos
El curso abarca
conceptos sobre generalidades de dibujo constructivo y dibujo de instalaciones, siguiendo

7RPDQGRHQFRQVLGHUDFLyQORVDVSHFWRVDQWHULRUHV\EDViQGRQRVHQODH[SHULHQFLD del
cuerpo docente, es necesario definir los aspectos en los que se puede fortalecer el
contenido del curso. Como se puede observar en el cuadro de contenido del programa
oficial del curso, se abarcan conceptos de dibujo constructivo y de instalaciones de un
proyecto de vivienda, el cual es necesario que el IngeQLHURHQIRUPDFLyQFRQR]FD\VHSD
interpretar, pero dentro de los diferenteVSUR\HFWRVGHLQJHQLHUtDQRVyORHVWiQORVSUR\HFWRV
GHYLYLHQGDVLQRWDPELpQSUR\HFWRVGHFRQVWUXFFLyQFLYLO como puentes, introducciones de
agua, carreteras, estructuras, etc., en los cuales el estudiante WDPELpQ GHEHUi saber y
conocer la UHSUHVHQWDFLyQGHpstos DWUDYpVGHOGLEXMR El dibujo se puede aprender siempre
TXHHOFDWHGUiWLFRUHDOLFHHMHUFLFLRVTXHSDXODWLQDPHQWHDXPHQWHQODKDELOLGDGPDQXDO\
TXH WDPELpQ FRQWULEX\D al desarrollo de habilidades espaciales, por medio de la
LQWHUSUHWDFLyQGHILJXUDVWULGLPHQVLRQDOHV

La propuesta de contenido es la siguiente:

1. 7DPDxRGHORVIRUPDWRVHOXVRGHHVFDODV
2. Vistas principales y secciones de un objeto
3. (OSODQRGHORFDOL]DFLyQ\XELFDFLyQ
4. 6LPERORJtDV
5. Mobiliario y equipo
6. Texturas de materiales
7. Planos de Arquitectura de una vivienda
8. Detalles constructivos de una vivienda
9. Instalaciones de una vivienda
10. Estructura de una vivienda
11. Detalles estructurales

(YDOXDFLyQ

Es necesario GHILQLUORVDVSHFWRVHQTXHVHHYDOXDUipara que el educando mejore


VXDSUHQGL]DMHGXUDQWHHOSURFHVRHQTXHYDDGTXLULHQGRQRFLyQ3DUDHOORODDSUHFLDFLyQ
VH KDUi SRU IDVHV OD ]RQD VH FDOFXODUi SURPHGLDQGR ODV WUHV IDVHV HQWUHJDGDV HQ VX

19


correspondiente fecha. (VWDVIDVHVVHUiQHMHUFLFLRVTXHD\XGHQDGHVDUUROODUODVKDELOLGDGHV


y destrezas de cada alumno en particular.

3DUD TXH OD HYDOXDFLyQ DGTXLHUD XQ FDUiFWHU FRQWLQXR FDGD IDVH SUiFWLFD HVWDUi
OLJDGDDXQDSUXHEDWHyULFDGHFRQFHSWRVUHODFLRQDGRVDORTXHVHHYDO~DHQFDGDIDVH
&DGD IDVH VHUi XQ LQGLFDGRU GH FyPR FDGD DOXPQR YD DGTXLULHQGR ORV IXQGDPHQWRV GHO
dibujo D OD YH] TXH SRQH HQ SUiFWLFD OR DSUHQGLGR (O HYDOXDGRU LGHQWLILFDUi D WUDYpV GH
cada fase, los temas en los que cada estudiante en particular presenta cierta dificultad.

35238(67$'((9$/8$&,1

358(%$7(5,&$ 10%
FASE 1 20%
358(%$7(5,&$ 05%
FASE 2 10%
358(%$7(5,&$ 10%
FASE 3 20%-------75%
EXAMEN FINAL 25%-------25%
TOTAL 100%

CRONOGRAMA DE ACTIVIDADES PARA IMPARTIR EL CURSO

UNIDAD CONTENIDO ENTREGA FECHA


1 Origen de los formatos, el uso de Inicio de 1ra. Semana
escalas, vistas principales y secciones semestre
de un objeto.
2 6LPERORJtDVPRELOLDULR\HTXLSR 2da. Semana
3 Texturas de materiales 3ra. Semana
4 (OSODQRGHORFDOL]DFLyQ\XELFDFLyQ 4ta. Semana
5 Planos de Arquitectura de una vivienda: 5ta. Semana
El machote
6 Planta amueblada 6ta. Semana
7 Planta acotada 7ma. Semana
8 Planta de acabados 8va. Semana
9 Elevaciones y Secciones 9na. Semana
10 Instalaciones de una vivienda: Agua Fase 1 10ma.
potable Semana
11 Instalaciones de una vivienda: Drenajes 11va. Semana

20


12 Instalaciones HOpFWULFDVde una vivienda: 12va. Semana


,OXPLQDFLyQ\IXHU]D
13 3ODQRGHFLPHQWDFLyQ\FROXPQDV Fase 2 13va. Semana
14 Plano de armado de losa tradicional 14va. Semana
15 Plano de armado de losa prefabricada 15va. Semana
16 0ydulo de gradas y detalles 16va. Semana
17 ([SOLFDFLyQGHOSUR\HFWRILQDO Fase 3 17va. Semana
18 Entrega del proyecto final 18va. Semana

1.4 0$5&20(72'2/*,&2

+,37(6,6
&RQHOGHVDUUROOR\XVRGHXQGRFXPHQWRGLGiFWLFRWHyULFR-SUiFWLFRFRUUHFWDPHQWH
mediado, los alumnos, que cursaQ OD DVLJQDWXUD GH 7pFQLFD &RPSOHPHQWDULD  GH OD
)DFXOWDGGH,QJHQLHUtD8QLYHUVLGDGGH6DQ&DUORVDFUHFHQWDUiQVXVKDELOLGDGHVPDQXDOHV\
espaciales, SDUD OD FRUUHFWD LQWHUSUHWDFLyQ \ UHSUHVHQWDFLyQ JUiILFD de proyectos de
ingeniHUtD\GHHVWDPDQHUDDXPHQWDUiQVXUHQGLPLHQWRDFDGpPLFR

VARIABLES

Dependiente

(O GHVDUUROOR \ XVR GH XQ GRFXPHQWR GLGiFWLFR WHyULFR-SUiFWLFR FRUUHFWDPHQWH


mediado.

Independiente

Desarrollar habilidades manuales espaciales.


$XPHQWDUUHQGLPLHQWRDFDGpPLFR
Estandarizar loVFULWHULRVGHHQVHxDQ]D\HYDOXDFLyQ

LOS SUJETOS

Este estudio se reali]DUi FRQ HVWXGLDQWHV GH OD )DFXOWDG GH ,QJHQLHUtD de la
UnivHUVLGDGGH6DQ&DUORVGH*XDWHPDODTXHHVWiQFXUVDQGR7pFQLFD&RPSOHPHQWDULa 2 y
TXHLQJUHVDURQHQHODxR.

EL DISEf2<352&(',0,(172'(,19(67,*$&,1

$ FRQWLQXDFLyQ Ve somete a FRPSUREDFLyQ HO PpWRGR, D WUDYpV GH UHVXOWDGRV H


indicadores, para identificar el rendimiento de los estudiantes.

21


3DUD HOOR VH UHFXUUH D OD LQYHVWLJDFLyQ H[SHULPHQWDO, la cual se basa en causa y
efectR GH GHWHUPLQDGD DFFLyQ HQ HVWH FDVR XQD DFFLyQ FRQ XQ ILQ HGXFDWLYR \
GHWHUPLQDU D OD YH] TXp efecto producen dos acciones diferentes. En este caso, una
SULPHUDDFFLyQVHUtDHOLQWURGXFLUXQGRFXPHQWRWHyULFR-SUiFWLFRDXQGHWHUPLQDGRQ~PHro
GHDOXPQRVTXLHQHVFXUVDQ7pFQLFD&RPSOHPHQWDULD\ODVHJXQGDDFFLyQVHUiODGHXQ
VHJXQGR JUXSR TXH WDPELpQ FXUVD GLFKD DVLJQDWXUD SHUR VLQ FRQWDU FRQ HO DSR\R del
documento, y posteriormente identificar los resultados que generaron cada uno de los
grupos o, en otras palabras, la causa de introducir un documento de apoyo a un grupo de
estudiantes, para ver TXp efecto produce dicha causa, si se compara con otro grupo que
no hizo uso del documento de apoyo.

1.5 RESULTADOS

Objetivo

Establecer el nivHODFDGpPLFRGHORVHVWXGLDQWHVGH7pFQLFD&RPSOHPHQWDULD en
el segundo semestre del 2008.

Fecha
Octubre de 2008

1~PHURGHOJUXSR
40 Estudiantes

3URFHGLPLHQWR 6HOHFFLRQDPRV  JUXSRV GH  HVWXGLDQWHV GHO FXUVR GH 7pFQLFD
Complementaria 2 del segundo semestre de OD)DFXOWDGGH,QJHQLHUtDde la Universidad de
San Carlos de Guatemala, con uno de estos dos grupos experimentaremos su rendimiento,
SHUPLWLpQGROHV KDFHU XVR GHO PDQXDO WHyULFR-SUiFWLFR extrayendo del mismo solo un
fragmento del documento, mientras HO VHJXQGR JUXSR QR KDUi XVR GH QLQJ~Q PDQXVFULWR.
Recibieron la parte del curso que trata sobre la estructura de una vivienda.

6H OHVDSOLFD XQD SUXHED SUiFWLFD D DPERV JUXSRV /D SUXHED TXH VH DSOLFy UDGLFD HQOR
siguiente: Proyectar sobre el plDQR PDFKRWH TXH VH OH SUHVHQWD D FRQWLQXDFLyQ, los
GLIHUHQWHVSODQRVHVWUXFWXUDOHVGHODYLYLHQGD 3ODQRGHFLPHQWDFLyQ\FROXPQDVHQWUHSLVRV
estructura del techo y detalles constructivos), GHEHUiWRPDUFULWHULRSURSLRHQHOXVRGHOWLSR
de formato y escalas.

22


(QODHYDOXDFLyQVHWRPDURQHQFXHQWDORVVLJXLHQWHVDVSHFWRV

([SUHVLyQJUiILFD 30 pts.
$FRWDFLyQ\GHWDOOHV 20 pts.
&DOLGDGGHOtQHD 15 pts.
Uso apropiado de la escala 15 pts.
Rotulado 10pts.
Limpieza 10pts.
__________
Total 100 pts.

6HWRPDFRPRDFHSWDEOHHOHVWXGLDQWHTXHSUHVHQWHXQDFDOLILFDFLyQDUULEDGH
puntos.

Resultados:
Los resultados de las pruebas, se colocaron en los siguientes cuadros:

Cuadro No. 1
Resultados de la prueba del grupo sin uso de documento.

Rango Alumnos Porcentaje


0 20 4 20%
21 40 11 55%
41 60 4 20%
61 80 1 5%
81 100 ----------- -------------
Total 20 100 %

Cuadro No. 2
Resultados de la prueba del grupo con documento de apoyo.

Rango Alumnos Porcentaje


0 20 1 5%
21 40 8 40%
41 60 8 40%
61 80 3 15%
81 100 ----------- -------------
Total 20 100 %

23


Resultados de la prueba del grupo sin uso de documento.

Rango

Resultados de la prueba del grupo con documento de apoyo.

Rango

$QDOL]DQGR ORV UHVXOWDGRV TXH VH REWXYLHURQ VH OOHJD D OD FRQFOXVLyQ GH TXH ORV
estudiantes del grupo que no hicieron uso de un documento de apoyo su rango de notas
HVWi comprendido entre 21 y 60 puntos. El grupo que hizo el uso de un documento de
apoyo su rango de notas HVWi comprendido entre 21 y 80 puntos, lo cual indica que el
UHQGLPLHQWRDXPHQWyQRHQRUPHPHQWHSHURHVXQLQGLcador que los alumnos necesitan un
documento que los ayude a profundizar en los temas de estudio.

24


PROPUESTA DE DESARROLLO
DEL PROGRAMA DEL CURSO

25


W1dh>K 2
PRINCIPIOS FUNDAMENTALES

LOS FORMATOS
LAS ESCALAS
/$$&27$&,126,67(0$'(0(',&,1
$/)$%(72'(/1($6

26


2.1 LOS FORMATOS

2.1.1Dimensiones de los formatos

/DV GLPHQVLRQHV GH ORV IRUPDWRV HVWiQ regidas por las normas estipuladas por el
Instituto CentroameriFDQRGHLQYHVWLJDFLyQ7HFQROyJLFD,QGXVWULDO ,&$,7,  Todo formato
YLHQH GH OD GHULYDFLyQ GH XQ IRUPDWR RULJHQ HO IRUPDWR RULJHQ SRVHH XQD VXSHUILFLH GH 
M2.

([LVWHQ ODV VHULHV GHQRPLQDGDV $ \ ODV VHULHV GHQRPLQDGDV % \ & (Q HVWH FDStWXOR
describiremos solamente las series A.

6HJ~Q OD QRUPD 1.1.1 se deducen los formatos de la serie A partiendo sucesivamente por
GRVHOIRUPDWRRULJHQ/DUHODFLyQGHVXSHUILFLHHVSRUWDQWR. Por ejemplo:

FORMATO A0: Sus dimensiones son:


118.9 cm X 84.10 cm = 1m2
FORMATO A1: Sus dimensiones son:
84.10 cm X 59.40 cm = 0.50 M2.
(Ver figura 2.1 y 2.2)

27


FORMATO ORIGEN A0
DIMENSIONES: 118.9 CMS. X 84.1 CMS. AREA: 1M2.

Figura 2.1 5HODFLyQGHVXSHUILFLHSDUWLHQGRGHVGH el formato origen A0.

Figura 2.2 La hipotenusa de los lados igual a Y, es igual a la longitud del lado X.

28


$ FRQWLQXDFLyQ VH SUHVHQWD XQ FXDGUR FRQ ODV GLPHQVLRQHs de los formatos de la
serie A y algunas de sus aplicaciones.

TIPO FORMATO DIMENSIONES


Plano Macro- A0
uUEDQtVWLFR 841 X 1189 mm.
Mapas
Planos Proyecto Constr. A1 594 X 841 mm.
Planos Proyecto Constr. A2 420 X 594 mm.
Planos Proyecto Constr. A3 297 X 420 mm.
Planos de registro A4
Planos de
DHVPHPEUDFLyQ 210 297 mm.
3ODQR/RFDOL]DFLyQ
3ODQRGH8ELFDFLyQ

2.1.2 'REOH]\3UHVHQWDFLyQGHORVIRUPDWRV

Es importante conocer la forma de doblar y presentar los formatos ya que


DGHPiVGHVHUXQDFRQGLFLyQOHJDOGHSUHVHQWDFLyQGDQDVXYH]DOSUR\HFWRXQD
DSDULHQFLDWpFQLFDGHHVWpWLFDSURIHVLRQDO

FORMATO A1. DIMENSIONES: 84.1 CMS. X 59.4 CMS.


$5($0

29


)250$72$,620e75,&2

FORMATO A2.
DIMENSIONES: 59.4 CMS. X 42 CMS.
$5($0

30


)250$72$,620e75,&2

FORMATO A3
DIMENSIONES: 42 CMS. X 29.7 CMS.
AREA: 1/8 M2.

FORMATO A3. ,620e75,&2

31


Considerar siempre los siguientes puntos:

1. /DURWXODFLyQRFDMHWtQGHLQIRUPDFLyQGHEHUiTXHGDUVLHPSUHYLVLEOH
2. Para el doblez de los formatos A0 A3VHKDUiHOSULPHU doblez marcando el ancho
de 210 PP\SDUDHOORVHXWLOL]DUiXQDKRMD$FRPRSODQWLOOD
3. A partir del formato A00 $VHGREODUiXQWUD]RWULDQJXODUKDFLDDWUiVFRQHOILQGH
que al momento de agujerar el formato, la parte superior del plano no quede
agujerada y al momento de fijar en la carpeta, el plano quede libre para ser
GHVGREODGRIiFLOPHQWH
4. (O DQFKR ILQDO VH SOHJDUi VLPSOHPHQWH HQ GRV GH WDO PDQHUD TXH OD URWXODFLyQ
quede inmediatamente visible.
5. Utilizar una hoja como plantillDSDUDREWHQHUHOGREOH]TXHGDUiHODOWR6HXWLOL]DUiHO
WDPDxRTXHPiV convenga, puede ser A4 con 297 mm de alto, una hoja carta con
280 mm o una hoja oficio con 330 mm de alto.
6. Para que no se desgarren los formatos por la parte agujerada, se recomienda utilizar
protectores circulares de papel, vinyl, etc.
7. No es recomendable archivar en carpetas planos mayores que el A1.
8. Tener siempre cuidado al momento GH GREODU XQ IRUPDWR \D TXH Vylo se cuenta
con un primer doblez. Si se dobla mal, luego se desdobla y se dobla de la forma
FRUUHFWD ORV GREOHFHV HUUyQHRV TXHGDUiQ PDUFDGRV \ HVWR QR GDUi XQD EXHQD
DSDULHQFLDWpFQLFDGHHVWpWLFDSURIHVLRQDO

2.2 LAS ESCALAS

2.2.1 La Escala

La escala nos ayuda a realizar dibujos que sean proporcionales y disminuirlos o


acrecentarlos para posteriormente colocarlos en un determinado espacio. La escala es la
UHODFLyQ HQWUH OD ORQJLWXG GHO VHJPHQWR GLEXMDGR \ OD ORQJLWXG SRU pO UHSUHVHQWDGR /D
WpFQLFD GH HVFDOD OD ULJHQ SULQFLSDOPHQWH ODV QHFHVLGDGHV GH H[DFWLWXG \ UDSLGH] Un
objeto se puede dibujar DWDPDxRD, de su WDPDxRQDWXUDOHWF

El uso de la escala

(Q HO GLEXMR HV LPSRUWDQWH HO KiELWR GH OD H[DFWLWXG \ HV HVHQFLDO SDUD HO p[LWR HQ
cXDOTXLHU WUDEDMR WpFQLFR (O XVR FRUUHFWR GHO HVFDOtPHWUR QRV GDUi FRPR UHVXOWDdo un
dibujo preciso.

/DV GLPHQVLRQHV QR VH GHEHUiQ WRPDU GLUHFWDPHQWH GH OD HVFDOD FRQ HO FRPSiV R
FXDOTXLHURWURREMHWR\DTXHQRVKDUiHOWUDEDMRPiVOHQWR3DUDPHGLUGHEHPRVVLHPSUH
FRQVWUXLU XQD UHFWD \ VREUH HVWD PHGLU FRQ HO HVFDOtPHWUR KDFLHQGR XQD SHTXHxD PDUFD
FRQXQOiSL]RPLQDELHQDILODGD1RVHGHEHXWLOL]DUHOHVFDOtPHWURSDUDWUD]DUOtQHDV.

32


/DV(VFDODVPiVFRPXQHV

/DVHVFDODVPiVFRPXQHVVRQ

1:100, 1:125, 1:20, 1:25, 1:50, y 1:75

$ FRQWLQXDFLyQ VH PXHVWUD OD UHODFLyQ GH SURSRUFLyn entre cada una, con una
escaODJUiILFD/DVLJXLHQWHILJXUD muestra la longitud de 1Mt. en sus diferentes escalas y su
equivalente en cms.

/DVLJXLHQWHILJXUDPXHVWUDODUHSUHVHQWDFLyQJUiILFDGHXQFXERGH0WGH
ancho x 1Mt. de alto x 1Mt. de profundidad, en diferente escala.

33


$O GHFLU TXH GHWHUPLQDGR GLEXMR HVWi D HVFDOD  HVWDPRV GLFLHQGR TXH HO
REMHWR VH GLEXMy GLVPLQX\pQGROR SURSRUFLRQDOPHQWH  YHFHV FRQ UHODFLyQ D VX WDPDxR
natural. Igualmente con la escala 1:25, se disminuye proporcionalmente 25 veces su
WDPDxRUHDO<DVtVXFHVLYDPHQWHFRQODVHVFDODV\FRPRORPXHVWUDOD
siguiente figura:

2.2.2 Conversiones entre escalas

Podemos disminuir o acrecentar cualquier objeto a la escala que queramos


haciendo uso de un HVFDOtPHWUR SHUR HQ GHWHUPLQDGDs ocasiones tendremos que realizar
GLEXMRVFRQHVFDODVSRFRFRPXQHVRTXHQRHVWiQGHQWURGHOHVFDOtPHWUR (Utilizar este tipo
de escalas no es lo PiV recomendable). Para ello, rHFXUULPRVD VXFRQYHUVLyQHTXLYDOHnte
en centtPHWURVXWLOL]DQGRODVLJXLHQWHIyUPXOD

(Medida real ; (VFDODDXVDUHQODFRQYHUVLyQ


Escala pedida

Si TXHUHPRVVDEHUODPHGLFLyQGH0WVD escala 1:8 hacemos lo siguiente:

3 X 100 = 37.5 cms.


8

34


7HQHPRVHQWRQFHVTXHXQDOtQHDTXHPLGDFPV. HVHTXLYDOHQWHDXQDOtQHDGH
3 Mts., en escala 1:8.

PRGHPRVFRPSUREDUHVWDIyUPXODFRQODHVFDODJUiILFDDQWHULRU. Por ejemplo:

1Mt. a escala 1:50 1 X 100 = 2 cms.


50

Escalas proporcionales

Podemos utilizar las escalas comunes para hacer mediciones a otras escalas
agregando o quitando un cero a la escala con la cual mediremos, es decir, se hace la
PHGLFLyQ FRQODPLVPDHVFDODHQHOHVFDOtPHWUR\DTXHODSURSRUFLyQHVODPLVPD

Por ejemplo, con la escala 1:100 podemos hacer mediciones a escala 1:10, 1:1000 y
1:10000, etc. (Ver Tabla 2.1)

ESCALAS QUE PODEMOS OBTENER CON LA ESCALA 1:100

Medidas Escala
0 0.01 0.02 0.03 0.04 0.05 0.06 0.07 0.08 0.09 0.01 1:1
0 0.1 0.2 0.3 0.4 0.5 0.6 0.7 0.8 0.9 1.0 1:10
0 1 2 3 4 5 6 7 8 9 10 1:100
0 10 20 30 40 50 60 70 80 90 100 1:1000
0 100 200 300 40 500 600 700 800 900 100 1:10000

7DEOD7RGDVODVPHGLGDVHVWiQGDGDVHQPHWURV

Como se puede observar, una unidad de metro lineal, en la escala 1:100, es equivalente a 1
cm. en escala 1:1, 10 cms. en escala 1:10, 10 Mts. en escala 1:1000 y 100 Mts. en escala
1:10000. Veamos ODVVLJXLHQWHVEDUUDVPLOLPHWUDGDV&DGDXQLGDGHVXQFHQWtPHWUR

35


$Vt SXHV SRGHPRV REWHQHU PiV HVFDODV WDPELpQ FRQ ODV GHPiV HVFDODV FRPXQHV
agregando o quitando siempre una cifra. Es decir, si queremos trazar un objeto cualquiera a
escala 1:5, utilizamos la escala 1:50. Para saber, si en este caso agregamos o quitamos una
FLIUD Vylo basta con saber si la escala a utilizar posee unidades, decenas o centenas.
Ejemplo:

/D HVFDOD  Vylo posee unidades, (5 unidades) como posee una cifra menor que
50, (50 contiene decenas) restamos una cifra a cada metro. Entonces 1 metro a escala 1:50
es equivalente a (1 corremos una cifra hacia la izquierda = 0.1) 0.1 metros a escala 1:5.

1.00 = 0.10

Ahora veamos con la escala 1:500. 500 posee centenas y la escala con la que
mediremos, que es la escala 1:50, tiene Vylo decHQDVHVGHFLUFRQWLHQHXQDFLIUDPiV
que 50 (posee centenas), por lo tanto sumamos una cifra a cada metro. Por lo que tenemos
que 1 metro en la escala 1:50 es equivalente a (1 corremos una cifra hacia la derecha = 10)
10 metros.

1.00 = 10.00
<DVt sucesivamente con el resto de escalas comunes: 1:75, 1:20, 1:25 y 1:125.

36


2.3 /$$&27$&,126,67(0$'(0(',&,1

'HVFULSFLyQ completa de los objetos

hacer el objeto repreVHQWDGR H[DFWDPHQWH FRPR OR SUR\HFWy HO GLEXMDQWH R HO
GLVHxDGRU GHEH GHFLU GRV KLVWRULDV FRPSOHWDV /DV GHEH GHFLU PHGLDQWH   ODV YLVWDV
TXHGHVFULEHQODIRUPDGHOREMHWR\  ODVGLPHQVLRQHV\QRWDVGDQGRWDPDxRV\RWUD
LQIRUPDFLyQ GH WDOOHU (O GLbujo muestra al objeto en su estado completo y, tanto si las
YLVWDVVHGLEXMDQDWDPDxRQDWXUDORDHVFDODODVGLPHQVLRQHVGHEHQVHUODVUHDOHVTXH
21

$OPRPHQWRGHFRQVWUXLUGHWHUPLQDGRREMHWRVHHODERUDUiWRPDQGRFRPRJXtDORV
SODQRV UHDOL]DGRV VL pstos mismos contienen errores en sus mediciones, el objeto se
HGLILFDUi HUUyQHDPHQWH3RUORWDQWRHVGH VXPDLPSRUWDQFLDTXHODDFRWDFLyQHQXQ
GLEXMRVHDORPiVFODUD\SUHFLVD

2.3.1 Las partes de una cota

/tQHDV GH UHIHUHQFLD 6RQ ODV OtQHDV SHUSHQGLFXODUHV D OD OtQHD SRU DFRWDU eVWDV
LQGLFDQGHGynde a GyQGHVHHVWiPLGLHQGR(VWDVOtQHDVWLHQHQXQDORQJLWXGGH
a 15 mm.

/tQHD GH FRWD (V OD OtQHD SDUDOHOD D OD OtQHD SRU DFRWDU \ HQ VXV GRV H[WUHPRV VH
HQFXHQWUDQ ODV OtQeas de referencia. /D VHSDUDFLyQ HQWUH HVWD OtQHD \ OD OtQHD SRU
acotar es de 9 a 12 mm.

6tPERORV(QORVH[WUHPRVGHODOtQHDGHFRWDGRQGHVHLQWHUFHSWDQHVWD~OWLPDFRQ
ODVOtQHDVGHUHIHUHQFLDVHFRORFDXQVtPERORTXHLQGLFDGHGyQGHDGynde se esti
PLGLHQGR/RVVtPERORVDXWLOL]DUVRQHOSXQWRODIOHFKD\ODWDUMDFRQXQDLQFOLQDFLyQ
de 45 grados.

El dato escrito $O FHQWUR GH OD OtQHD GH FRWD se coloca un dato o texto, el cual
SURSRUFLRQDLQIRUPDFLyQGHODPHGLGDGHODOtQHDSRUDFRWDU(VWHGato debe estar
VHSDUDGRGHODOtQHDGHFRWDGHD mm, y tener una altura de 3 a 5 mm.

Spencer, Henry Cecil y Dygdon , John Thomas. d


21

D&W

37


Figura 1.3 Partes de una cota

Puntos de raSLGygrafo a utilizar

38


2.3.2 Tipos de acotamiento

Existen varios sistemas de acRWDFLyQ R PHGLFLyQ (O VLVWHPD TXH PiV VH XWLOL]D HV HO
VLVWHPDGHDFRWDFLyQHQFDGHQDHVWHVLVWHPa se basa en buscar la parte interior del objeto
y a una distancia de 10 mm se colocan las cotas formando una cadena, es decir, donde
WHUPLQDXQDPHGLFLyQGH XQDFRWDHPSLH]DODRWUD\DVtVXFHVLYDPHQWH /XHJo, arriba de
psta, se encuentra la cota total que es la que da la suma de todas. Al utilizar este sistema
de cotas totales y subtotales, se obtienen mediciones PiV precisas.

(O VLVWHPD GH DFRWDFLyQ HQ FDdena es el que se utiliza para acotar planos
FRQVWUXFWLYRV SRU OR WDQWR HQ HVWH FDStWXOR QRV OLPLWDUHPRV D H[SOLFDU VRODPHQWH este tipo
GHVLVWHPDGHPHGLFLyQ.

Cuando acotamos un determinado dibujo con cotas en cadena, se tienen


diferentes niveles de cotas, las cuales son: cotas totales a rostro, cotas totales a ejes, cotas
subtotales a ejes, cotas subtotales a rostros, cotas parciales y cotas interiores. ((QHO&DStWXOR
3, en planta acotada, se exSOLFDWRGRHVWRFRQPiVGHWDOOH

2.4 $/)$%(72'(/NEAS

QRVGHILQHODYROXPHWUtDGHXQREMHWRVLHOSODQRHVVyOLGRRYDFtRODSURIXQGLGDGTXHWLHQH
respecto a un plano; todo esto dependiendo del peso visual de los tipRV GH OtQHDV
22

7LSRVGHOtQHDVXWLOL]DGDV

/tQHD GH FRQWRUQR JHQHUDO (V XQD OtQHD FRQWLQXD \ VH XWLOL]D FRPR OR GLFH VX QRPEUH
SDUDUHVDOWDUHOFRQWRUQRRHQPDUFDUREMHWRV6HXWLOL]DHQFDMHWLQHVPiUJHQHVGHIRUPDWRV
y para resaltar el volumen de un objeto. El punto de UDSLGyJUDIR a emplear es el 1.00, 1.2 y
1.4.

K:d/&
22

'W

39


/tQHDGHFRQWRUQRSULQFLSDO (VXQDOtQHDFRQWLQXD\VHXWLOL]DSDUDUHVDOWDUSDUWHVGHXQ
objeto que sean importaQWHV \ WDPELpQ SDUD GHILQLU TXp superficies fueron afectadas al
momento de realizar un corte imaginario. El punto de UDSLGyJUDIR a emplear es el 0.5 0.8.
Se utiliza FXDQGRVHGHILQHQiUHDVDIHFWDGDVHQXQFRUWH

/tQHD JXtD (VWH WLSR GH OtQHD VH XWLOL]D FRPR OR GLFH VX QRPEUH SDUD JXLDUQRV DO
momentR GH FRQVWUXLU GHWHUPLQDGD SUR\HFFLyQ GH XQ REMHWR (VWH WLSR GH OtQHD GHEH VHU
SiOLGDSDUDQRERUUDUODVGHVSXpVGHKDEHUWHUPLQDGRHOGLEXMR La mina a utilizar es la 2H.

/tQHD GH SHUILO RFXOWR R SUR\HFFLyQ Se utiliza para representar contornos que se
HQFXHQWUDQGHWUiVGHXQSODQRRVXSHUILFLH\Tue no son visibles en su plano. RapidyJUDIRD
utilizar 0.2.

/tQHD GH FRUWH R VHFFLyQ 6H XWLOL]D SDUD UHSUHVHQWDU SRU GRQGH VH UHDOL]y XQ FRUWH
imaginario de un determinado objeto. Su grosor es el mismo TXHHOGHODOtQHDGHFRQWRUQR
JHQHUDO (VWD OtQHD HVWi FRPSXHVWD SRU XQD OtQHD KRUL]RQWDO GH  PP GH ODUJR \ GRV
SHTXHxDV OtQHDV GH  mm de longitud. En los extremos lleva una flecha que indica hacia
donde debemos observar la parte seccionada. 5DSLGyJUDfo a utilizar 0.8 1.2.

/tQHD GH UXSWXUD Esta se utiliza cuando no es necesario mostrar el dibujo de un


objeto en su totalidad, entonces interrumpimos el objeto haciendo uso de este tipo de
OtQHDPRVWUDQGRVylo una parte del objeto. 5DSLGyJUDfo a utilizar 0.2.

40


/tQHDGHHMHRFHQWUR Se utiliza para definir los centros o ejes de un objeto, ya sea el


FHQWUR GH XQ FtUFXOR HO HMH GH XQ HQJUDQDMH GH XQ PXUR HWF (VWD OtQHD HVWi FRPSXHVWD
por una OtQHDGH mm de largo y luego, con una sHSDUDFLyQGHPLOtPHWURVHFRORca un
SXQWRXRWUDOtQHDGH mm de largo. 5DSLGyJUDIRDXWLOL]DU 0.2.

$ FRQWLQXDFLyQ VH PXHVWUD XQ HMHPSOR GH FyPR VH XWLOL]D HVWH OHQJXDMH GH OtQHDV
aplicado a un determinado objeto.

41


42


&$378/2 3
5(35(6(17$&,1*5),&$'(/262%-(726

VISTAS PRINCIPALES DE UN OBJETO


6,0%2/2*$<7(;785$6 DE MATERIALES

43


3.1 VISTAS PRINCIPALES DE UN OBJETO

SISTE0$'(352<(&&,1

(QGRQGHODSUR\HFFLyQHVODUHODFLyQHQWUHXQSXQWRHQHOHVSDFLR\VXUHSUHVHQWDFLyQHQ
23

Los WLSRVGHSUR\HFFLyQPiVXWLOL]Ddos son: Proyecciones Ortogonales y Proyecciones


$[RQRPpWULFDV

Proyecciones Ortogonales:
Son proyecciones que nos muestran dos dimensiones en cada una de las 6 vistas de
un objeto. (Vista superior o planta, vista lateral o perfil izquierdo y derecho, vista frontal, vista
posterior y vista inferior o planta inversa.)

3DUDHQWHQGHUPHMRUODVSUR\HFFLRQHVRUWRJRQDOHVLPDJLQpPRQRVFRORFDUXQREMHWR
dentro de un cubo de vidrio. El cubo, como bien se sabe, contiene 6 caras o superficies, en
cada superficie se reflejaran las 6 diferentes vistas del objeto, como lo muestra la siguiente
figura.

,PDJLQHPRV TXH FDGD SUR\HFFLyQ TXHGR LPSUHJQDGD HQ FDGD FDUD GHO FXER
transparente y ahora despleguemos el cubo, similar a cuando desarmamos una caja de
FDUWyQ9HUILguras 3.1 y 3.2.
Vista superior

Vista frontal Vista Lateral

Figura 3.1

K:d/&
23

'W

44


<GHHVWDIRUPDTXHGDUiQSUR\HFWDGDVODVYLVWDVRUtogonales del objeto. Observe


Fymo se emplea el XVRGHODOIDEHWRGHOtQHDVSDUDLQWHUSUHWDUFDGDSUR\HFFLyQ Ver figura
3.3.

Figura 3.2

Figura 3.3

45


comprender un objeto cualquiera HVQHFHVDULRWHQHUODLQIRUPDFLyQH[DFWDHQ


cuanto a su forma y dimensiones. Como no hay una forma de dibujar el objeto, en donde
nos presente sus tres dimensiones principales: longitud, DOWXUD\SURIXQGLGDGVLQTXHpste se
GLVWRUVLRQH HV QHFHVDULR HPSOHDU GLEXMRV GH SUR\HFFLRQHV P~OWLSOHV TXH IDFLOLWHQ OD
FRPSUHQVLyQGHPiVGHGRVY 24

$O PRPHQWR HQ TXH SUR\HFWDPRV XQ REMHWR D WUDYpV GHO GLEXMR WpFQLFR HVWDPRV
WUDWDQGRGHFRPXQLFDULQIRUPDFLyQVXILFLHQWHSDUDTXHHO que el que la recibe, comprenda
HOREMHWRHQVXWRWDOLGDGIRUPDWDPDxRmateriales, etc. Por ello es importante que nuestro
GLEXMRVHDFODUR\SUHFLVR\HQWUHPiVYLVWDVGLEXMHPRVPiVLQIRUPDFLyQEULQGDPRV0XFKDV
YHFHV QR HV QHFHVDULR GLEXMDU ODV  YLVWDV GHO SUR\HFWR \D TXH VL HO SUR\HFWR HV SHTXHxR
con solo las 3 vistas; 3ODQWDHOHYDFLyQ\SHUILO VHUiVXILFLHQWH

3UR\HFFLRQHVD[RQRPpWULFDV

(VWH WLSR GH SUR\HFFLyQ QRV EULQGD LQIRUPDFLyQ GH WUHV GLPHQVLRQHV GHO REMHWR
ancho, alto y profundidad. Es decir, se proyecta el objeto con el fin de mostrar su volumen.
GHFLU TXH OD SUR\HFFLyQ $[RQRPpWULFD HV OD UHSUHVHQWDFLyQ de un solo plano
FRPR VXSHUILFLH GHO GLEXMR  GH XQ REMHWR WULGLPHQVLRQDO FRORFDGR FLHUWR iQJXOR UHVSHFWR
25

ExistHQ GLYHUVDV SUR\HFFLRQHV D[RQRPptricas. Por los fines del programa del curso,
QRVOLPLWDUHPRVDWUHVWLSRVGHSUR\HFFLyQ

1. ,VRPpWULFD
2. Militar
3. Caballera

,VRPpWULFD
7UHVHMHVUHFWDQJXODUHVIRUPDQGRiQJXORVLJXDOHVFRQHOSODQRGHOGLEXMRLVRPpWULFR
Sus tres superficies visibles tienen la misma importancia.

K:d/&
24

'W
/W
25

46


Militar:
(VWDHVXQDSUR\HFFLyQD[RQRPpWULFDGLPpWULFD\DTXHDGLIHUHQFLDGHODDQWHULRU
HVWDSRVHHiQJXORVLJXDOHVFRQHOSODQRHQGRVGHORVWUHVHMHV7LHQHXQSXQWRGHYLVWDPiV
DOWRTXHODLVRPpWULFD

Caballera:
(VWDHVXQDSUR\HFFLyQD[RQRPpWULFDWULPpWULFD\DTXHsus tres HMHVIRUPDQiQJXORV
desiguales con el plano. Una de sus tres superficies es un plano vertical que permanece
paralelo a la superficie del dibujo. A la profundidad real, se le resta el 25%.

47


6(&&,12&257(,0$*,1$5,2'(812%-(72

(Q PXFKDV RFDVLRQHV FXDQGR WUDWDPRV GH WUDQVPLWLU LQIRUPDFLyQ GH XQ REMHWR
necesitamos mostrar el interior del mismo. Para ello, realizamos cortes imaginarios, utilizando
ODOtQHDGHFRUWHFRPRSRGHmos observar en la siguiente figura. Vemos que indica que el
FRUWH VH UHDOL]y HQ OD YLVWD VXSHULRU \ VHFRUWy por lD PLWDG /DVIOHFKDV LQGLFDQ FXil de las
dos partes debemos visualizar.

48


2WURHMHPSORVHUtD que imaginamos que una guillotina pasa dividiendo el objeto por
la mitad, luego separamos las dos partes y vemos hacia donde indican las flechas en la
vista superior.

Vista Superior

49


Cuando se UHDOL]DQ ORV SODQRV GH  XQ SUR\HFWR GH FRQVWUXFFLyQ GHSHQGHUi GHO
proyectista KDFHU XVR GH ORV GLIHUHQWHV PpWRGRV GH SUR\HFFLyQ PHQFLRQDGRV
DQWHULRUPHQWH FRQ HO ILQ GH EULQGDU LQIRUPDFLyQ ~WLO QHFHVDULD  H LPSRUWDQWH DO PRPHQWR
GHODHMHFXFLyQ

3.2 SLPERORJta

Hasta ahora hemos visto un recordatorio de las proyecciones que nos ayudan a
interpretar un determinado objeto. Al momento en que concebimos un proyecto de
FRQVWUXFFLyQGHXQDYLYLHQGDQHFHVLWDPRVH[SUHVDUDWUDYpVGHOGLEXMRWLSRVGHPDWHULDles
GHFRQVWUXFFLyQWH[WXUDVYHJHWDFLyQPRELOLDULRHWF

&DGD GLEXMDQWH WLHQH XQ HVWLOR SURSLR SDUD UHSUHVHQWDU PXHEOHV iUEROHV\ WH[WXUDV
Del proyectista depende en TXp grado de nivel de detalle se dibujen, siempre y cuando
pstos no carguen el dibujo, ya quHHVWDVVLPERORJtDVQRGHEHQcompetir con el resto. Todo
PRELOLDULRVHGLEXMDFRQOtQHDGHOJDGD8WLOL]DUUDSLGyJUDIRyPP

Mobiliario y Equipo:

(V LPSRUWDQWH FRQRFHU ODV GLPHQVLRQHV HVWiQGDU GH FDGD XQR GH ORV PXHEOHV GH
una casa y los accesorios a utilizar.

Mobiliario de dormitorios
$OPRPHQWRGHGLVHxDUHODPELHQWHGHXQGRUPLWRULRVHGHEHFRQVLGHUDUHOPRELOLDULRD
utilizar. Existen diversidad de dimensiones de camas \ pVWDV GHSHQGHUiQ GHO WDPDxR GHO
DPELHQWH VHJ~Q ODV QHFHVLGades de la persona. $ FRQWLQXDFLyQ VH presentan tres de los
WDPDxRVPis usados.

50


El dibujo anterior muestra las dimensiones de una cama imperial, una cama semi-
matrimonial, una cama matrimonial, closet y escritorio. Como podemos observar, pstas son
vistas superiores, \ SDUD HQWHQGHU PHMRU OD VLPERORJtD GH HVWH WLSR GH PXHEOHV VH WUD]DQ
detalles, como la almohada, el doblez de OD VDEDQD FRQ XQ SHTXHxR WULingulo y una
OiPSDUD HQ OD PHVD de noche. 3DUD DGRUQDU OD FXEUHFDPD VH WUD]DQ OtQHDV R alguna
textura en particular.

Al momento de dibujar un closet, se dibujan las puertas corredizas y el cerchero


como se muestra en la figura. Lo anterior, no lleva XQDPHGLGDHVSHFtILFD\DTXHpstos son
VLPEyOLFRV R UHSUHVHQWDWLYRV Lo importante al momento de trazar diferentes tipos de
mobiliario, es dibujarlos con sus dimensiones respectivas. Los detalles OH GDUiQ D FDGD
PXHEOHHQSDUWLFXODUXQDPHMRUSUHVHQWDFLyQ

Mobiliario de Sala y Comedor

Un amueblado de sala, al igual que los muebles en un dormitorio, YDUtD en su forma y


WDPDxR 3RU HOOR XWLOL]DPRV ODV GLPHQVLRQHV HVWiQGDUHV GH FDGD XQR DO PRPHQWR GH
GLEXMDUORV /DV GLPHQVLRQHV HVWiQGDUHV GH XQ DPXHEODGR GH VDOD y su arreglo espacial, se
presentan en la siguiente figura. El amueblado del comedRU WDPELpQ HV YDULDEOH HQ VXV
GLPHQVLRQHV \DTXHGHSHQGHUiGH ODFDQWLGDGGHVLOODVTXHVHQHFHVLWHQ /DV PHVDVPiV
comunes son las rectangulares y las circulares. Podemos aplicar textura a la mesa y sillas,
como madera, vidrio, etc.

51


Al VRIi\GHPiVVLOORQHV SRGHPRVGLEXMDUOHDOJ~QWLSRGHWH[WXUD(QODVHVTXLQDVVH
FRORFDQ PHVLWDV OLEUHUDV R FXDOTXLHU RWUR PXHEOH ~WLO $ HVWRV PXHEOHV WDPELpQ SRGHPRV
WUD]DUOH DOJ~Q WLSR GH WH[WXUD FRPR PDGHUD HWF Recordemos que estas texturas son
opcLRQDOHV \ VHUi FULWHULR GHO GLEXMDQWH UHDOL]DUODV \D TXH PXFKDV YHFHV pstas cargan
demasiado el dibujo entonces no siempre es recomendable.

Mobiliario de Cocina

(ODPXHEODGRGH XQDFRFLQDHVWiFRPSXHVWR FRPR PtQLPRGH HVWXIDUHIULJHUDGRUD


lavatrasWRV JDELQHWHV EDMRV \ DpUHRV /DV GLPHQVLRQHV GH HVWRV PXHEOHV VRQ diversas,
GHSHQGLHQGR HQ GRQGH VH FRPSUHQ DVt FRPR WDPELpQ OD QHFHVLGDG GHO FOLHQWH VL OD
FRFLQD HV PtQLPD R OXMRVD FRQ HVSDFLRV DPSOLRV \ PRELOLDULR GH JUDQGHV GLPHQVLRQHV $
continuaciyQ VH SUHVHQWDQ ODV GLPHQVLRQHV HVWiQGDU GH FDGD XQR DVLmismo, sus vistas
SULQFLSDOHV\DTXHHVWH WLSRGHPRELOLDULRHVILMR\VHGHEHUiQ de dibujar en las secciones
donde estos muebles se manifiesten.

Refrigeradora Lavatrastos

52


Estufa

2EVpUYHVH ORV GHWDOOHV HQ FDGD XQD GH VXV YLVWDV (VWRV GHWDOOHV VH GHEHUiQ dibujar
FRPRPtQLPR

0RELOLDULRGHODYDQGHUtD

Pila

53


Lavadora y secadora

Mobiliario de servicios sanitarios

Los artefactos XVDGRV HQ ORV VHUYLFLRV VDQLWDULRV YDUtDQ VHJ~Q HO GLVHxR GHO DPELHQWH
7DPELpQODVLPERORJtDDXWLOL]DUHVYDULDGD$FRQWLQXDFLyQVHSUHVHQWDQORVPiVFRPXQHV\
VXVGLPHQVLRQHVHVWiQGDU

Tipos de InoGRURV $ FRQWLQXDFLyQ VH SUHVHQWDQ WUHV tipos de inodoro. Estos podemos
HQFRQWUDUORV HQ SODQWLOODV R ELHQ GLEXMDU HO SULPHUR HO FXDO HV HO PiV VHQFLOOR \ UiSLGR de
trazar, con menos detalle que los otros.

54


Al momento de dibujar un lavamanos, se deben dibujar los detalOHVGH pVWH~OWLPR


como lo muestran las figuras.

Lavamanos ODYDPDQRVWLSRRYDOtQ

55


'LVWULEXFLyQWtSLFDGHXQVHUYLFLRVDQLWDULR

56


6LPERORJtDGHSXHUWDV

En un proyecto de vivienda se dLEXMDQ ODV SXHUWDV HQ WUHV YLVWDV SODQWD HOHYDFLyQ \
VHFFLyQ$FRQWLQXDFLyQYHUHPRVFyPR se dibujan e interpretan.

Procedimiento para dibujar puertas

Al momento de trazar una puertaGHEHPRVKDFHUXVRGHOFRPSiV\DTXHpste nos


ayudDUiDWUD]DUHODUFRGHODEDtimiento FRQPiVH[DFWLWXG

(QODSODQWLOODGHFtUFXORVFDGDFtUFXORWLHQHLQGLFDGRVXFXDGUDQWH$OPRPHQWRGH
GLEXMDUHODEDWLPLHQWRVHXWLOL]DGHOFtUFXORFRPRORPXHVWUDODVLJXLHQWHILJXUD

57


6H UHDOL]DQ HVWDV WUHV YLVWDV SODQWD HOHYDFLyQ \ VHFFLyQ  para brindar toda la
LQIRUPDFLyQGHGHWHUPLQDGDSXHUWD3RUHMHPplo, la vista superior o planta nos determina el
DQFKRGHOYDQR\KDFLDGynde es el abatimiento de la puerta. La altura, forma y detalles, lo
GHWHUPLQDQODHOHYDFLyQ\VHFFLyQ 8WLOL]DUUDSLGyJUDIR 0.1 mm en elevaciones.

Tipos de puertas

El abatimiento de las puertas en su YLVWDVXSHULRUQRVLQGLFDUiTXp tipo de puerta se


HVWiXWLOL]DQGR(MHPSOR

Puerta abre 90 grados Puertas plegables

58


3XHUWDYDLYpQR Puertas dobles Puerta corrediza


de golpe abren 180 grados

(QODYLVWDIURQWDORHOHYDFLyQGHGHWHUPLQDGDSXHUWDVHGLEXMDHOPDWHULDOGHpsta
~OWLPD DVt FRPR WDPELpQ Getalles de acabado, etc. Existe en el mercado variedad de
HVWLORV IRUPDV \ PDWHULDOHV $ FRQWLQXDFLyQ VH SUHVHQWDQ ODV PiV FRPXQHV XWLOL]DGDV HQ ORV
planos.

3XHUWDV GH PDGHUD estas se fabrican con varios tipos de madera (Caoba, cedro,
pino, plywood, etc.).

Puerta con visor: Puerta Plywood:


Se utiliza en cocinas. Se utiliza en ambientes interiores.

59


Puertas con tableros:

Se utilizan en entradas principales.


/D  SRVLFLyQ GH OD FKDSD HQ HOHYDFLyQ WLHQH TXH FRLQFLGLU con el abatimiento en la vista
superior.

Puertas de metal: Por lo general, estas puertas se utilizan en ambientes que dan hacia el
exterior. Al igual que las puertas de madera, podemos encontrar en el mercado variedad
GHGLVHxRVGHSXHUWDVGHPHWDO

P-1 P-2 P-3

60


3XHUWDV GH DOXPLQLR 3RGHPRV HQFRQWUDU WDPELpQ YDULHGDG GH GLVHxR GH SXHUWDV KHFKDV
de aluminio y vidrio.

P-1 P-2 P-3

Portones: Los portones se utili]DQ HQ ODV HQWUDGDV DO JDUDMH estos pueden ser de
madera o metal. (ODQFKRYDUtDVHJ~QHOGLVHxRGHOYDQRGRQGHVHLQVWDOH

3RUWyQGHKRMDV 3RUWyQKRMDVFRUUHGL]R 3RUWyQKRMDVSOHJDEOH

61


6LPERORJtDGHYHQWDnas

/DV YHQWDQDV VRQ HO HOHPHQWR TXH SURSRUFLRQD LOXPLQDFLyQ \ YHQWLODFLyQ D XQ
determinado ambiente. ([LVWHQGLYHUVLGDGGHIRUPDV\GLVHxRVGHYHQWDQHUtD/RVHOHPHQWRV
PiVFRPXQHV TXH FRPSRQHQ XQD YHQWDQD VRQ (O YDQR R GLPHQVLyQ GH OD DEHUWXUD HQ HO
mXURPDUFRRHVWUXFWXUDGHODYHQWDQD\SRU~OWLPRHOYLGULR $FRQWLQXDFLyQVHSUHVHQWDQ
las vistas principales de una ventana.

Vista en planta

Vista de corte 9LVWDHQHOHYDFLyQ

62


Ventana vista en planta

9HQWDQDYLVWDHQHOHYDFLyQ

3DUD HO WUD]DGR GH OD YHQWDQD VH XWLOL]D UDSLGyJUDIR  PP 6H WUD]DQ OtQHDV
delgadas de 45 grados encima del vidrio para dar el efecto del brillo. No dibujar muy ancho
el marco de la ventana. Utilizar como base el ejemplo de arriba.

63


9HQWDQDYLVWDHQVHFFLyQRFRUWH

Tipo de ventanas

Ventana V-1 Ventana V-2

64


(OGLVHxRGHODVYHQWDQDVFDVLVLHPSUH VRQYDULDGRV \DTXH WRGR GHSHQGHGHOGLVHxR


GH OD FDVD SRU OR WDQWR ODV GLPHQVLRQHV GHO VLOODU GLQWHO \ DQFKR GHO YDQR YDUtDQ (VWR
GHSHQGHWDPELpQGHOUHJODPHQWRGHFRQVWUXFFLyQTXHGLFHTXHHOiUHDGHLOXPLQDFLyQGH
XQDPELHQWHFRUUHVSRQGHHOGHOiUHDWRWDOGHOSLVR\HO iUHDGHYHQWLODFLyQGHEHVHUHO
GHOiUHDGHLOXPLQDFLyQ

6LPERORJtDGHiUEROHV\YHJHWDFLyQ

([LVWHQ YDULRV WLSRVGH VLPERORJtD SDUD UHSUHVHQWDU iUEROHV R DOJ~Q WLSRGH YHJHWDFLyQ
WDQWR HQ SODQWD FRPR HQ HOHYDFLyQ $ FRQWLQXDFLyQ VH SUHVHQWDQ ORV PiV XWLOL]DGRV DVt
FRPRWDPELpQORVSDVRVSDUDSRGHUWUD]DUORV

$O PRPHQWR GH GLEXMDU XQ iUERO YLVWR HQ SODQWD VH XWLOL]D OD SODQWLOOD GHFtUFXORV VH
WUD]DHOFtUFXORTXHVHUiHOWDPDxRGHODFRSDGHOiUEROOuego se traza a mano las ramas,
partiendo del ceQWURGHOFtUFXOR\KDFLDDIXHUDcRPRORPXHVWUDODVLJXLHQWHJUiILFD Utilizar
UDSLGyJUDIR 0.2 mm.

3RGHPRVFRPELQDUWLSRVGHiUEROHVGHGLIHUHQWHVWDPDxRV\WUD]DUWH[WXUDVGHWLHUUD
piedras, etc., para representar jardines.

65


UEROHVHQHOHYDFLyQ

(OWUD]RGHODVLPERORJtDGHiUEROHVWDQWRHQSODQWDFRPRHQHOHYDFLyQVHGLEXMDQ
a mano alzada. Se recomienda hacer varios ejercicios. Tome como ejemplo los que se le
presentan. Utilizar UDSLGygrafo 0.1 0.2 mm.yPLQDK.

La altura depende dHODOWRGHODYLYLHQGD\DTXHpste no debe competir con esta


~OWLPD

66


67


3.3 Texturas y materiales

Cuando dibujamos un objeto cualqXLHUD \ TXHUHPRV LQGLFDU GH TXp PDWHULDO HVWi
hecho, se utilizan texturas que lo simbolizan. $ FRQWLQXDFLyQ VH PXHVWUDQ ODV WH[WXUDV PiV
FRPXQHVXWLOL]DGDVHQORVSODQRVGHFRQVWUXFFLyQ

Block Ladrillo

Repello + cernido Piedra laja

68


Piedra bola Tierra

Piedra Concreto

69


3LVRFHUiPLFR Madera

Grama Piedra de cantera

7RGDVHVWDVWH[WXUDVVHGLEXMDQDPDQRDO]DGDDH[FHSFLyQGHOEORFN\HO ladrillo. Se
deben realizar a una escala proporcional a la superficie donde se aplique. Utilizar
rapLGyJUDIR PPyPLQDh yI.

3.4 Dimensiones de block y ladrillos

Generalmente y dependiendo del proyecto, para los muros de una vivienda se


utilizan blocks o ladrillos. Es importaQWH FRQRFHU ODV GLPHQVLRQHV GH pstos, ya que al
PRPHQWRGHGLEXMDUODVSDUHGHVHQSODQWDHOHYDFLyQ\FRUWHVHGHEHWRPDUHQFXHQWDODV
medidas TXHpstos poseen, VHJ~QODSRVLFLyQHQODTXHVHHQFXHQWUDQ

70


Blocks dHSyPH]
6RQ PiV SHVDGRV \ JUDQGHV TXH HO ODGULOOR WD\X\R ([LVWHQ HQ HO PHUFDGR GH
diferentes medidas.

Block de 0.20 Mts. Mitad Block de 0.15 Mts. Mitad

Block de 0.10 Mts. Mitad

Ladrillos
Son bORTXHVKHFKRVGHEDUURFRFLGReVWRVVHIDEULFDQHQYDULRVWDPDxRV\PHGLGDV
$FRQWLQXDFLyQVHSUHVHQWDQORVPiVFRPXQHV.

Ladrillo tayuyo Ladrillo tubular Fachaleta

71


Como podemos oEVHUYDU HO ODGULOOR WD\X\R HV XQ EORTXH VyOLGR (O ODGULOOR WXEXODU
FRQWLHQH GRV SHUIRUDFLRQHV HQ ODV FXDOHV LUiQ SLQHV GH KLHUUR (VWRV VH XWLOL]DQ FXDQGR VH
QHFHVLWDUHIRU]DUXQPXURGH ODGULOOR <SRU~OWLPRODIDFKDOHWDGH ODGULOORVH XWLOL]DFXDQGo
queremos cubrir una pared de block o bien columnas, simulando que son de ladrillo.

Levantado de paredes de ladrillo o aparejos

6HJ~QODSRVLFLyQHQTXHVHDFRORFDGRVHOHGDXQQRPEUHHVSHFtILFR.

Levantado de soga Levantado de punta Levantado de canto

72


&$378/2 4
PRIMICIAS EN EL DESARROLLO DE UN PROYECTO

'(6$552//2<3/$1,),&$&,1'(81352<(&72
1250$6'(&216758&&,1
PLANO DE UB,&$&,1</2&$/,=$&,N
PLANOS DE ARQUITECTURA

73


4'(6$552//2<3/$1,),&$&,1'(81352<(&72

4.1.1 Actores que participan en el desarrollo de un proyecto

&XDQGR VH OOHYD D FDER XQ SUR\HFWR GH FRQVWUXFFLyQ H[LVWHQ YDULDV SHUVRQDV \
profesionales que inWHUYLHQHQSDUDTXHpste sea desarrollado. $FRQWLQXDFLyQVHSUHVHQWDQ
algunos y ORVPiVLPSRUWDQWHV

Inversionista

26.
Este ente es el que proporciona el
presupuesto necesario para el desarrollo del proyecto. Para ello recurren a profesionales de
ODFRQVWUXFFLyQSDUDREWHQHUXQDSURSXHVWD

Profesionales con grado universitario:

A) Arquitecto
3URIHVLRQDO GH OD FRQVWUXFFLyQ TXH WLHQH HVWXGLRV HVSHFtILFRV HQ HO GLVHxR GH
relaciones espaciales, circulaciones y vestibulaciones para determinar el espacio que se
UHTXLHUH HQ HO SUR\HFWR iUHDV WDQWR LQWHULRUHV FRPR H[WHULRUHV SHQVDQGR HQ XQD FLHUWD
OyJLFDHVWUXFWXUDOIXQFLRQDO\HVWpWLFD del conjunto.

B) Ingeniero Civil
3URIHVLRQDO GH OD FRQVWUXFFLyQ TXH WLHQH HVWXGLRV HVSHFtILFRV HQ HO iUHDGH FiOFXOR
HVWUXFWXUDO SDUD GHWHUPLQDU ODV FDUJDV TXH DFW~DQ HQ FXDOTXLHU WLSR GH FRQVWUXFFLyQ D
partir dHOGLVHxRSURSRUFLRQDGRSRUHODrquitecto.

Dibujante
Es la persona encargada de desarrollar los planos del proyecto, con toda la
LQIRUPDFLyn que el arquitecto y el ingeniero efectuaron, bDMRODVXSHUYLVLyQGHpVWRV~OWLPRV.

Contratista
3URIHVLRQDOGHODFRQVWUXFFLyQTXHWLHQHH[SHULHQFLDHQOD forma de construir. Tiene
a su cargo aOHTXLSRGHDOEDxLOHV\D\XGDQWHV(VWDPELpQOODPDGRHO0DHVWURGH2EUDV

43ODQLILFDFLyQGHXQSUR\HFWR

HMHFXWDGRGHODIRUPDPiV conveniente. Involucra ODRUJDQL]DFLyQ\VLVWHPDWL]DFLyQGHORV

W^h^'d/
26

milagro, Zacapa. P

74


HOHPHQWRV TXH GH DOJXQD X RWUD IRUPD SDUWLFLSDQ HQ OD HMHFXFLyQ ILQDO (Q JHQHUDO ORV
27

Fases de un proyecto

Necesidad de crear un espacio para determinada actividad


,QYHVWLJDFLyQSDUDFXEULUODQHFHVLGDG
Anteproyecto y presupuesto aproximado
,QYHUVLyQ
(ODERUDFLyQGHSODQRV
(MHFXFLyQGHODREUD

$QWHSUR\HFWR (V HO GLVHxR SUHOLPLQDU TXH VH UHDOL]D SRVWHULRU D OD LQYHVWLJDFLyQ /RV
SODQRV GH XQ DQWHSUR\HFWR HVWiQ FRQIRUPDGRV JHQHUDOPHQWH SRU SODQWDV HOHYDFLRQHV
secciones, apuntes interiores y exteriores del proyecto y maquetas. Son bastante
ambientados y con colores, para tener una mejor SUHVHQWDFLyQ\DVtSRGHUH[SRQHU la idea
del proyecto.

&RQ OD DSUREDFLyQ SRU SDUWH GHO LQYHUVLRQLVWD GH OD SURSXHVWD SODQWHDGD HQ HO
DQWHSUR\HFWRVHSURVLJXHFRQODHQWUHJDGHODLQYHUVLyQQHFHVDULDSDUDSRGHUUHDOL]DUORV
SODQRVGHILQLWLYRV\ODHMHFXFLyQGHODREUD

4.1.3 Contenido del juego de planos

'HVSXpVGHVHUDSUREDGRHODQWHSUR\HFWRVHSURVLJXHDUHDOL]DUHOMXHJRGHSODQRV
GHILQLWLYRVORVFXDOHVVHUYLUiQGHJXtDSDUDODHMHFXFLyQGHODREUD(VWRVSODQRVFRQWLHQHQ
GHWDOOHVHVSHFLILFDFLRQHVWpFQLFDVHWFWRGDODLQIRUPDFLyQnecesaria para poder ejecutar
el proyecto.

El contenido del juego de planos de un proyecto de vivienda se divide en tres fases:

1. Fase de Arquitectura
2. Fase de Instalaciones
3. Fase de Estructuras

Contenido de los planos de la Fase de Arquitectura

Plano matriz o machote


Planta de techos
Planta Amueblada
Planta Acotada

W^h^'d/
27

W

75


Elevaciones y secciones
Planta de acabados

Contenido de los planos de la Fase de Instalaciones

3ODQWDGHLQVWDODFLyQKLGUiXOLFD
3ODQWDGHLQVWDODFLyQGHGUHQDMHV
3ODQWDGHLQVWDODFLyQHOpFWULFa, luz y fuerza
3ODQWDGHLQVWDODFLRQHVHVSHFLDOHV WLPEUHWHOpIRQRFDEOHHWF

Contenido de los planos de la Fase de Estructuras

3ODQWDGHFLPHQWDFLyQ\FROXPQDV
Planta de armado de entrepisos y cubiertas y detalles de vigas
Secciones de muros y detalles estructurales

4.2 1250$6'(&216758&&,1

Cuando se realL]D XQ SUR\HFWR GH FRQVWUXFFLyQ se deben tomar en cuenta los
reglamentos que lo rigen. Es importante conocer las normas establecidas por la
municipalidad para evitar problemas al momento de presentar los planos. 6HJ~Q la
0XQLFLSDOLGDG GH *XDWHPDOD pstos son algunos de los reglamentos que se deben
cumplir:

4.2.1 UHDs libres


7RGD HGLILFDFLyQ GHEH GH FRQWDU FRQ iUHDV OLEUHV HQWLpQGDVH MDUGLQHV \ SDWLRV /D
municipalidad ha establecido 2 tipos de QRUPDVSDUDHVSDFLRVOLEUHVORVFXDOHVVRQtQGLFH
GHFRQVWUXFFLyQHtQGLFHGHRFXSDFLyQ

(O iUHD SHUPLVLEOH SDUD OD FRQVWUXFFLyQ GH iUHDV UHVLGHQFLDOHV GH HUD < GD
&DWHJRUtDde viviendas unifamiliares son:

QGLFHGHFRQVWUXFFLyQ 
QGLFHGHRFXSDFLyQ 

3DUDFDOFXODUORVGLIHUHQWHVtQGLFHVVHUHDOL]DQODVVLJXLHQWHVRSHUDFLRQHV

QGLFHGHFRQVWUXFFLyQ UHDWRWDOGHFRQVWUXFFLyQ
UHDWRWDOGHOORWH

QGLFHGHRFXSDFLyQ UHDGHWHFKRV
UHDWRWDOGHOORWH

76


4.2.2 'LPHQVLRQHVPtQLPDVGHSDWLRVLQWHULRUHV

3DUDXQDYLYLHQGDGHXQSLVRHOSDWLRLQWHULRUVHUiGH[0WV
3DUDXQDYLYLHQGDGHGRVSLVRVHOSDWLRLQWHULRUVHUiGH[0WV

4.2.3 'LPHQVLRQHVPtQLPDVDOIRQGR\ORVODGRVGHYHQWDQDVTXHGHQhacia
las colindancias.

Para una vivienda de un piso VH SRGUi FRORFDU YHQWDQDV EDMDV TXH GHQ KDFLD
FROLQGDQFLDV VL HVWiQ VHSDUDGDV GHO PXUR GH FROLQGDQFLD FRPR PtQLPR  0WV 6L ODV
ventanas son altas, y sirven para ventilar ambientes no habitables (enWLpQGDVH FRFLQD
VHUYLFLRV VDQLWDULRV ODYDQGHUtD \ SDVLOORV  OD VHSDUDFLyQ GHO PXUR FROLQGDQWH VHUi FRPR
PtQLPRGHPW

3DUD XQD YLYLHQGD GH GRV SLVRV VH SRGUi FRORFDU YHQWDQDV EDMDV TXH GHQ KDFLD
FROLQGDQFLDV VL HVWiQ VHSDUDGDV GHO PXUR GH FROLQGDQFLD FRPR PtQLPR  0WV 6L ODV
YHQWDQDV VRQ DOWDV \ VLUYHQ SDUD YHQWLODU DPELHQWHV QR KDELWDEOHV OD VHSDUDFLyQ GHO PXUR
FROLQGDQWHVHUiFRPRPtQLPRGH0WV

4.2.4 $OLQHDFLyQRUHWLURPXQLFLSDO

El retiro lo determina la municipalidad. En estos retirRV REOLJDWRULRV VyOR VH SRGUiQ


colocar jardines o car-SRUWVLHPSUH\FXDQGRpVWHVHDPHQRUGHOGHOiUHDGHOMDUGtQ

6HGHEHUiQFRQVLGHUDURWUDVQRUPDVFRPR)+$&RJXDQRU3RW,VRDOPRPHQWRGH
SODQLILFDUXQSUR\HFWRGHFRQVWUXFFLyQ

77


78


(MHPSORGHXQDFDVDYLVWDGHVGHDUULED(OiUHDGHWHFKRVHQHVWHFDVRVHUiHO
iUHDGHFRQVWUXFFLyQPiVHOiUHDTXHRFXSDHOYRODGL]R

4.3 3/$126'(8%,&$&,1</2&$/,=$&,1

Cuando se desea construir una vivienda, se debe solicitar una licencia de


FRQVWUXFFLyQ3DUDWUDPLWDUHVWDVROLFLWXGDSDUWHGHO juego de planos, deben ir los planos de
XELFDFLyQ\ORFDOL]DFLyQGHODREUD

(VWRV SODQRV VH GLEXMDQ HQ KRMDV WDPDxR RILFLR 'LEXMDGRV \ ILUPDGRV pstos se
fotocopian y se adjuntan al inicio del expediente del juego de planos.

,QIRUPDFLyQTXHGHEHUiFRQWHQHUHOSODQRGHORFDOL]DFLyQ

Dimensiones totales del lote (acotar sus dimensiones)


,QGLFDFLyQ GH FDOOHV \ DYHQLGDV VREUH ODV TXH HVWi ORFDOL]DGR HO ORWH DVt
FRPRODDFRWDFLyQDODHVTXLQDPiV SUy[LPDDODTXHVHHQFXHQWUDpste.
,QGLFDFLyQ GHO QRUWH FRQ XQD IOHFKD WRPDU FRPR UHIHUHQFLD HO LQJUHVR GHO
lote).
Rotular la informaFLyQSURSRUFLRQDGDHQHOSODQRGHORFDOL]DFLyQ

,QIRUPDFLyQTXHGHEHUicontener el pODQRGHXELFDFLyQ

Dibujar todo el iUHDGHOWHUUHQRLQGLFDQGRHQpVWHODXELFDFLyQGHODViUHDV


DFRQVWUXLU\ODViUHDVTXHTXHGDUiQOLEUHV SDWLRVRMDUGLQHV 
$FRWDU H LQGLFDU FODUDPHQWH HO iUHD D FRQVWUXLU DVt FRPR WDPELpQ SDWLRV R
jardines.
Ashurar o XWLOL]DUDOJ~QWLSRGHVLPERORJtDSDUDLQGLFDUiUHDVDFRQVWUXLU
Rotular la informaFLyQSURSRUFLRQDGDHQHOSODQRGHXELFDFLyQ

7RGD OD LQIRUPDFLyQ YHUWLGD HQ HVWRV SODQRV VRQ VHJ~Q UHTXLVLWR GH OD
Municipalidad de Guatemala.

79


80


81


4.4 PLANOS DE ARQUITECTURA

Son los que nos dan OD LQIRUPDFLyQ GH FyPR TXHGDUi OD REUD WHUPLQDGD VXV
dimensiones, alturas, materiales, tipos de ventana y puertas, acabados finales, etc.

6H XWLOL]D HO VLVWHPD GH SUR\HFFLyQ RUWRJRQDO SDUD UHSUHVHQWDU ODV YLVWDV SULQFLSDOHV
de la vivienda, sobre las cuales LUiWRGDODLQIRUPDFLyQQHFHVDULDSDUDODHMHFXFLyQfinal de
la casa.

Vista Frontal

82


Antes de trazar las elevaciones, necesitamos saber sus dimensiones en planta, y


posteriormente definir alturas en las elevaciones.

2EVpUYHVH HO JURVRU R FDOLGDG GH OtQHD SDUD UHSUHVHQWDU HU SODQR., 2do. plano y
tercer plano.

4.4.1 ,QWHUSUHWDFLyQGHSUR\HFWRVGHyPiV niveles

Para interpretar una casa de dos niveles, dividiremos imaginariamente la casa en


tres partes; primer nivel o planta baja, segundo nivel o planta alta y planta de techos, y
luego se proyectan por separado.

83


En este caso, llamaremos planta a la vista seccionada de la casa y mirando hacia


abajo, es decir, seccionamos la casa para poder extraer el techo y ver en su interior. Se
estima una altura del observador de 1.20 metros sobre el nivel de piso terminado Ejemplo:

84


Vista superior
Planta Baja. Ver plano matriz

4.4.2 Plano matriz o machote

Es el pODQR EDVH GHO SUR\HFWR \D TXH pste se repite en todas las fases, colocando
toda la informaciyQTXHVHQHFHVLWH al momento de la HMHFXFLyQ. Para ello, se sacan varias
copias del machote, paUD OXHJR GLEXMDU VREUH pste, ODV GHPiV SODQWDV. Es decir, la planta
amueblada, acotada, de instalaciones, estructuras, etc.

3ULQFLSLRVEiVLFRVSDUDHOWUD]RGel Plano matriz o machote


1. Al momento de trazar las plantas del proyecto, debemos acomodar el dibujo dentro
del formato, de la siguiente manera: Formato A-1

85


2. 'HVSXpVGHDFRPRGDUHOGLEXMRGHQWURGHOIRUPDWRVHSURFHGHDWUD]DU utilizando
OD OtQHD JXtD OD SODQWDR SODQWDV GHO SUR\HFWR VL IXHUD HO FDVR GH XQD YLYLHQGD GH
GRVQLYHOHV 3DUDHOORWUDFHSULPHURORVHMHV /XHJRGHWUD]DGRVORVHMHVFROyTXHOHV
VX UHVSHFWLYR Q~PHUR R OHWUD TXH OH FRUUHVSRQGH D FDGD XQR para no perderse.
Trazar los muros midiendo del eje la mitad del muro para cada lado. Si el muro es de
HVSHVRU0VHPHGLUi5 de cada lado del eje.

3. Trazar corrido las paredes horizontales y verticales, luego marcar los vanos de
puertas y ventanas. Luego de medirlos, se borran estos espacios.

86


6LODHVFDODGHOSUR\HFWRHVPX\SHTXHxDWUDFHSULPHURHOJURVRUGHORVPXURV\OXHJR
mida los rostros interiores para verifiFDU VX WUD]R (VWR VH GHEHUi hacer, ya que resulta
complicado medir 0.075 Mts.

Recomendaciones y notas importantes

$OWHUPLQDUHOWUD]RJXtDUHYLVDUGHQXHYRHVSHVRUHVGHPXURV\PHGLGDVJHQHUDOHV
Se debe ser cuidadoso y preciso al momento de trazar el espesor de los muros con el
HVFDOtPHWUR6HGHEHUi KDFHUHOWUD]RH[DFWDPHQte encima de las marcas; ya que
GHORFRQWUDULRVHGLEXMDUiQXQRVPXURVPiVDQFKRVTXHRWURV(MHPSOR

1. 0DOWUD]R/DVOtQHDVHVWiQIXHUDGHORVSXQWRVGHPHGLGD

2. 0DOWUD]R/DVOtQHDVHVWiQDGHQWURGHORVSXQWRVGHPHGLGD

3. Buen trazo: Las ltQHDVHVWiQH[DFWDPHQWHHQFLPDGHORVSXQWRVGHPHGLGD

87


'LVWULEXFLyQGHEjes o centros de muros

En las plantas de una vivienda de dos niveles existen muros que se repiten en ambos
piVRV3RUORWDQWRORVHMHVGHpVWRVVHUHSHWLUiQHQDPEDV SODQWDV([LVWHQWDPELpQSDUHGHV
en el primer nivel que no se repiten en el segundo y viceYHUVD /RV FHQWURV GH pstos se
WUD]DUiQ~QLFDPHQWHHQODSODQWDGRQGHVHPDQLILHVWHQ(MHPSOR

En el segundo nivel tenemos


os
los ejes del 6 al 7 y
del 7 al 8.

Los ejes: A, B, C,
9 y 8, se repiten
en ambas
plantas, por lo
tanto, se copian
En el primer nivel tenemos y se acotan los
los ejes de los muros 6 y 8. mismos. En el
Por lo tanto, Vylo se acotan segundo nivel
pVWRV~OWLPRV. Podemos colocar se encuentra el

HVDOtQHDLUiXQPXUR de este al eje


en el segundo nivel. SUy[LPR

En el primer nivel
se encuentran los
ejes 7 y 8, por lo
tanto se acota la
distancia entre
pstos.

88


La nomenclatura de los ejes horizontales al plano GHEHUi VHU distribuida de abajo


KDFLD DUULED HQ IRUPD DVFHQGHQWH < ORV YHUWLFDOHV DO SODQR GHEHUiQ VHU GLVWULEXLGRV GH
L]TXLHUGD D GHUHFKD 6H KDFH XVR GH ORV Q~PHURV HQ HO ODGR GHO SUR\HFWR Gonde se
maniILHVWHODPD\RUtD (Ver Plano matriz).

(OSODQRPDFKRWHGHEHUiFRQWHQHUODVLJXLHQWHLQIRUPDFLyQ

Trazar los muros techados o seccionados


7UD]DUORVPXURVTXHHVWiQPiVEDMRVFRQOtQHDGHOJDGDyPP
3UR\HFFLyQGHWHFKRV\YRODGL]RVFRQUDSLGyJrafo 0.2 mm.
No rotular el nombre de los ambientes ni el nivel de piso, ya que puede interferir al
momento de dibujar la planta amueblada.
SHLQGLFDODGLUHFFLyQGHOQRUWHHQODSDUWHVXSHULRUGHUHFKDGHOIRUPDWR
Rotular en la parte de abajo de cada planta VL HV SODQWD DOWD R EDMD DVt FRPR
WDPELpQODHVFDODDODTXHHVWiQGLEXMDGDV
Dibujar las ventanas. No se dibujan las puertas.
No se dibujan los muebles fijos (servicios sanitarios, pilas, etc.)
7UD]DUPydulo de gradas si existieren
Se proyectan ambas plantas, trazando primero la planta baja.
8WLOL]DUORVGLIHUHQWHVSXQWRVGHUDSLGyJUDIRTXHVHOHSUHVHQWDQDFRQWLQXDFLyQHQHO
plano machote.

4.4.3 Planta amueblada

(VWH SODQR PXHVWUD OD IRUPD LGHDO GH FyPR VH DPXHEODUi OD FDVD 3DUD HOOR
utilizamos una de las copias del pODQR PDWUL] R PDFKRWH \ VREUH pste se dibujan los
PXHEOHV5HFRUGHPRVTXHHOSODQRPDWUL]HVODSUR\HFFLyQVXSHULRUGHOa casa, mostrando
VXLQWHULRUSRUORWDQWRVHGLEXMDQORVPXHEOHVYHJHWDFLyQ\WH[WXUDVHQVXYLVWDVXSHULRUFRQ
sus dimensiones esWiQGDUHVYLVWDVHQHOFDStWXOR. (Ver plano A1 y A2: Planta amueblada).
,QIRUPDFLyQ\UHFRPHQGDFLRQHVGHODSODQWDDPXHEODGD

Utilizar una FRSLDGHOSODQRPDWUL]\VREUHpste dibujar los muebles


7UD]DUORVPXHEOHVFRQOtQHDGHOJDGDUDSLGygrafo 0.2 mm.
'LEXMDUWH[WXUDGHOSLVRVLHVFHUiPLFRSDUTXHWHWF8WLOL]DUUDSLGyJUDIRPP
Dibujar materiales y texturas
Rotular HOQRPEUHGHFDGDDPELHQWHDVtFRPRWDPELpQsus niveles
Acotar a ejes parciales y totales.
IndicDUiUHDVGHMDUGtQ\YHJHWDFLyQXWLOL]DQGRODVGLIHUHQWHVVLPERORJtDV
6H SXHGHQ GLEXMDU GHWDOOHV FRPR DOIRPEUDV OiPSDUDV HWF VLHPSUH \ FXDQGR QR
cargue demasiado el dibujo.
Trazar puertas.
Indicar elevaciones y secciones de la vivienda

89


90


4.4.4 Planta acotada

Contiene la vista en planta de la vivienda mostrando el interior de la misma, dando


LQIRUPDFLyQ D WUDYpV GHO VLVWHPD GH PHGLFLyQ GH ODV GLPHQVLRQHV GH ORV GLIHUHQWHV
ambientes que conformaQ HO SUR\HFWR DVt FRPR WDPELpQ grosores de muros, anchos de
puertas y ventanas, etc.

El tipo de acotamiento a utilizar en un proyecto de vivienda, es el acotado en


FDGHQD(VWHWLSRGHDFRWDPLHQWRFRQWLHQHQLYHOHVGHPHGLFLyQ/RVFXDOHV son:

1. Cotas totales a rostros exteriores: Muestra las medidas de los rostros totales de los
PXURV(VWDVFRWDVWDPELpQQRVLQGLFDQHOWDPDxRGHODFDVD

2. Cotas totales a ejes: Es la cota que nos indica la sumatoria total de todos los ejes.

3. Cotas subtotales a ejes: Nos indican la medida que hay entre eje y eje.

4. Cotas subtotales a rostros: Nos indican generalmente, las dimensiones de cada


DPELHQWHDVtFRPRWDPELpQHOJURVRUGHORVPXURV

5. Cotas parciales: Son las que indican las medidas de vanos de puertas y
ventanas.

Todas las cotas anteriores GHEHUiQLUDIXHUDGHODSODQWDGHODFDVD5HFXHUGHTXH


la distancia del objeto por acotar a la primera cota es de15 mm., y la distancia entre cada
una HVGHPP6HGHEHUiDFRWDUHQHOLQWHULRUFXDQGRHVWRVQLYeles no sean suficientes
SDUD GDU WRGD OD LQIRUPDFLyQ QHFHVDULD Si en alguno de los lados, la cota se repite,
SRGHPRV RPLWLUOD &XDQGR QR H[LVWD QLQJXQD FRWD SDUFLDO R YDQRV TXH PHGLU HQ DOJ~Q
muro, se puede medir en el interior y jalar la cota, con el fLQGHTXHODLQIRUPDFLyQTXHGH
afuera de la planta. (Ver plano A3 y A4: Planta acotada).

,QIRUPDFLyQPtQLPD\UHFRPHQGDFLRQHVSDUDUHDOL]DUODSODQWDDFRWDGD
1. $FRWDUIXHUDGHODSODQWDVylo si es necesario se acota en el interior.
2. No dibujar ninguna textura de piso u otro material.
3. Indicar los diferentes niveles de piso que posee el proyecto.
4. Indicar las elevaciones y secciones de la vivienda. (Si no se hizo en la planta
amueblada)
5. 7HQHUVLHPSUHFXLGDGRTXHODLQIRUPDFLyQQRVHWUDVODSH
6. Acotar siguiendo VLHPSUHORVQLYHOHVGHDFRWDFLyQ
7. Se utiliza una copia del plano matriz \ VREUH pste se acota todas las medidas del
proyecto.

97


98


4.4.5 Planta de acabados

(V HO SODQR TXH FRQWLHQH OD LQIRUPDFLyQ GHO DFDEDGR ILQDO TXH VH OH GDUi DO
proyecto; tipo de puertas, ventanas, tipo de piso, acabado en muros, techos, etc.

6H GHEHUi UHDlizar una planilla de tipo de puertas, ventanas, closets si hubieren, y
XQD VLPERORJtD SDUD UHSUHVHQWDU ORV GLIHUHQWHV DFDEDGRV GHO SUR\HFWR FRQ WRGD OD
inforPDFLyQTXHVHQHFHsite. 'HVSXpVGHGHILQLUXQDQRPHQFODWXUDy/RVLPERORJtDSDUDORV
materiales, se toma una cRSLD GHO SODQR PDFKRWH \ VREUH pste se coloca la infRUPDFLyQ
(Ver plano A5, A6 y A7).
Los datos de las dimensiones de puertas y ventanas GHEHUiQ coincidir con las
planillas, la planta acotada, el plano de detalles, secciones y elevaciones.

4.4.6 Elevaciones y secciones

Estos planos contienen ODLQIRUPDFLyQGHDOWXUDV y niveles que contiene el proyecto.


Estos datos se definen con mayor detalle, en las secciones o cortes imaginarios. Por ello, se
recomienda primero trazar las secciones, antes de las fachadas, para una mejor
LQWHUSUHWDFLyQGHpVWDV~OWLPDV

$QWHVGHFRQRFHUODLQWHUSUHWDFLyn de fachadas y cortes, veremos el elemento que


se utiliza en las FDVDVGHyPiVSLVRVSDUDXQLUVXVGLIHUHQWHVQLYeles, el cual es HOPyGXOR
de gradas o escaleras.

Escaleras:

(Q XQ SUR\HFWR GH  y PiV QLYHOHV GHEHPRV WUD]DU OD XELFDFLyQ del
28

Pydulo de gradas$FRQWLQXDFLyQYHUHPRVFyPR se dibujan e interpretan.

Partes de una escalera

'tD
28

'Wg. 6

103


104


Escaleras vistas en planta

(QXQDSUR\HFFLyQHQSODQWDGHXQDHVFDOHUDVHWUD]DUiQORVHOHPHQWRVGHpsta que
se visualizan. En este caso, los anchos de las huellas, las dimensiones del descanso y el pasa-
manos si existiere. Ejemplo:

3UR\HFFLyQHQHOHU1LYHO 3UR\HFFLyQHQHOGR1LYHO

$O PRPHQWR GH GLEXMDU HO PyGXOR GH JUDGDV VH GHEHUi LQGLFDU VLHPSUH KDFLD
donde es el sentido, es decir, por donde se sube o se baja. En el primer nivel o planta baja,
VHLQGLFDUiHQTXp sentido se sube, y en el segundo nivel o planta alta, por donde se baja.

La gradas en el primer nivel no se dibujan en su totalidad, sino se interrumpe el dibujo


FRQODOtQHDGHUXSWXUDFRPRVHPXHVWUDHQODJUiILFDanterior.

/DSUR\HFFLyQGHODVJUDGDVHQHOHYDFLyQRSHUILO EULQGDLQIRUPDFLyQDFHUFDGHODV
dimensiones de la huella y contrahuella. Siendo las GLPHQVLRQHVUHFRPHQGDEOHVSDUDpstas
ODVVLJXLHQWHV+XHOODPtQLPRFPV\Pi[LPRFPV\la contrahuella, PtQLPRcms. y
Pi[LPRFPV

Procedimiento para trazar las gradas

Las dimensioneVGHODVJUDGDVYDUtDQ\DTXHpstas dependen de la altura que exista


GH XQ QLYHO D RWUR 6HJ~Q VHD OD FRWD GH SLVR D SLVR \ OD  DOWXUD TXH VH OH DVLJQH D OD
contrahueOODDVtVHUiHOQ~PHURGHHVFDORQHVDUHDOL]DU(MHPSOR

Se tiene que la altura del piso del primer nivel al segundo nivel, es de 3.00 Mts. Trazar
HOPyGXORGHJUDGDV

111


Para ello, realizamos los siguientes pasos:

1. Se divide la altura de piso a piso, dentro de una altura de contrahuella que HVWp
GHQWUR GHO UDQJR DFHSWDEOH \ QRV GDUi OD FDQWLGDG GH contraKXHOODV TXH GHEHUi
tener para comunicar ambos pisos.

Altura de piso a piso = 3 = 20 Contrahuellas.


Contrahuella = 0.15

Altura de piso a piso = 3 = 17 Contrahuellas.


Contrahuella = 0.177

Altura de piso a piso = 3 = 18 Contrahuellas.


Contrahuella = 0.165

Como podemos observar, podemos utilizar cualquiera de estas tres opciones. Ahora
WRGR GHSHQGHUi GHO HVSDFLR TXe se tiene para poder colocar el PyGXOR de gradas con
FLHUWDFDQWLGDGGHKXHOODV8WLOLFHPRVODVHJXQGDRSFLyQDKRUDHORWURSDVRHVHOVLJXLHQWH

2. Teniendo la cantidad de huellas necesarias, se realiza el trazo con la altura de la


FRQWUDKXHOOD HOHJLGD HQ HVWH FDVR  0WV FRPR HV GLItFil dividir esta cantidad
en una determinada escala, se realiza lo siguiente:

Tomar el escDOtPHWUR HQ FXDOTXLHU HVFDOD H inclinarlo hasta unir ambos niveles en 17
unidades como se ve en la figura. Luego vamos marcando cada unidad.

112


Trazar ltQHDV JXtDV 3RVWHULRUPHQWH FRPHQ]DPRV D GLEXMDU ORV HVFDORQHV GDQGR VLHPSUH
una huella de 25 a 30 cms. El descanso por lo general, se ubica a la mitad de la altura.

Y de esta manera, se obtiene el trazo de la escalera con los escalones requeridos y


las dimensiones adecuadas, comunicando ambos niveles. /DFDQWLGDGGHJUDGDVGHEHUiQ
coincidir con la vista en planta.

113


En muchas ocasiones, las secciones pasan cortando el primer tramo de las gradas,
por lo que este se proyectaUi FRQ OtQHDV GH FRQWRUQR SULQFLSDO  PP  \ VL VH GHVHD
DVKXUDQGRHOiUHDDIHFWDGD

En los ambientes interiores, que se proyecten por medio de secciones, VH GHEHUi
LQGLFDUHOQLYHOTXHpVWRVSRVHHQ(QODVHOHYDFLRQHVVHLQGLFDUiQGHVQLYHOHVHQHO exterior si
existieren.

Niveles
Para indicar los cambios de nivel de piso que contiene el proyecto, VHSRGUiutilizar
FXDOTXLHUDGHODVVLJXLHQWHVVLPERORJtDV:

6HGHILQLUiVLHPSUHHOQLYHO6LH[LVWHXQFDPELRGHDOWXUDGHFHQWtPHWURV por
deEDMRGHOQLYHOVHLQGLFDUi con el signo -\VLVHHQFXHQWUDXQQLYHOPiVDOWRSRU
HMHPSORFHQWtPHWURVVHLQGLFDUiFRQHOVLJQR

Sanitarios debajo de las gradas

En las gradas, debajo del primer


tramo queda un espacio. En muchas
viviendas, se aprovecha este espacio y se
instala un servicio sanitario. Esta
SUR\HFFLyQ VH KDUi GH OD VLJXLHQWH
manera:

2EVHUYH TXH VH XWLOL]D OD OtQHD GH


ruptura para interrumpir la secuencia de
JUDGDV \ PRVWUDU HO EDxR TXH HV
encuentra debajo de pste.

114


4.4.6.1 Elevaciones

'HODPLVPDPDQHUDHQTXHVHSUR\HFWDQORVFRUWHVVHSUR\HFWDUiQODVHOHYDFLRQHV
comenzando desde el nivel 0.00 hacia arriba. Las elevaciones muestran FyPR TXHGDUiOD
obra finalizada, indicando acabados finales, tipo de ventanas, puertas, etc.

Procedimiento para trazar elevaciones o fachadas

1. Trace una horizonWDOODFXDOVHUiHOQLYHO GHHVWDOtQHDPLGDKDFLDDUULEDOD


altura de piso a cielo, el espesor de losa y el nivel de piso terminado del segundo
nivel, luego WUDFH OtQHDV JXtDV KRUL]RQWDOHV VREUH HVWRV SXQWRV GH PHGLGD
Seguidamente, mida la altura de piso a cielo del segundo nivel, el espesor de
ORVD\HOOHYDQWDGR$KRUDWUDFHOtQHDVJXtDVKRUL]RQWDOHV

2. 7UDVODGDU PHGLGDV H LQIRUPDFLyQ GH OD SODQWD a la fachada, como ventanas y


SXHUWDV TXH VH HQFXHQWUHQ HQ ORV PXURV GH OD HOHYDFLyQ TXH VH HVWi
SUR\HFWDQGR $O LJXDO TXH ORV FRUWHV ODV IDFKDGDV VH GHEHUiQ SUR\HFWDU WDO \
FRPR VHUi HO SUR\HFWR OD SODQWD DOWD VREUH OD SODQWD EDMD XELFDQGR HMH VREUH
eje.

115


3. &XDQGR VH WHQJD WHUPLQDGD OD HOHYDFLyQ UHYLVH GH QXHYR WRGD OD LQIRUPDFLyQ
como sillares, dinteles, puertas, alturas, cambios de nivel, cotas, etc., antes de
aplicar tinta.

4. Luego de revisar la fachada, aplique tinta uWLOL]DQGR ORV JURVRUHV GH OtQHD SDUD
LGHQWLILFDU SODQRV TXH HVWpQ PiV FHUFD R PiV OHMRV GHO SXQWR GH REVHUYDFLyQ
Aplique texturas de materiales, ejes de muros y detalles en las puertas y
ventanas. (Ver plano A8(OHYDFLyQIURQWDO 

116


InforPDFLyQPtQLPDTXHGHEHUiQ contener las elevaciones

,QGLFDUHQFDGDHOHYDFLyQTXp WLSRGHHOHYDFLyQHVVLHVHOHYDFLyQIURQWDOODWHUDO
HOHYDFLyQQRUWHHOHYDFLyQSULQFLSDOHWF
Indicar la escala a la que fue dibujada.
Colocar ejes de los muros importantes, y los muros que se repiten en ambas plantas.
1RVHFRORFDQLQJ~QWLSRGHFRWDKRUL]RQWDO
Dibujar textura de materiales.
Cotas verticales, indicando alturas de sillares, dinteles, jardineras, puertas, alturas de
piso a cielo, muros, etc.
,QGLFDFLyQ Ge niveles exteriores y nombre de ambientes que se visualizan en la
HOHYDFLyQ
Indicar tipo de acabado en muros, columnas, etc.
7LSRGHSXHUWDV\YHQWDQDVeVWDVGHEHUiQFRLQFLGLUVXVGLPHQVLRQHVFRQODSODQWDGH
acabados, acotada y la planilla de puertas y ventanas.
/DHVWUXFWXUD\PDWHULDOGHODFXELHUWDDVtFRPRVXSRUFHQWDMHGHLQFOLQDFLyQ\FLHOR
falso si hubiere.
Si se dLEXMD XQ GHWDOOH FRQVWUXFWLYR pVWH VH LQGLFDUi HQ OD HOHYDFLyQ DVt FRPR
WDPELpQHQTXHKRMDHVWiGLEXMDGRGLFKRGHWDOOH
Indicar ORVQLYHOHVGHSLVRWHUPLQDGR\JURVRUHVGHORVDFRQOtQHDVGHSHUILORFXOWR

4.4.6.2 Secciones o cortes

De la misma manera en que seccionamos cualquier objeto para mostrar su interior,


se secciona una vivienda con el fin de comunicar los diferentes niveles y alWXUDV TXH psta
posee.

1. Se secciona la casa imaginariamente 9HU VHFFLyQ $-


amueblada).

119


2. 6H VHSDUDQ DPEDV SDUWHV \ VH YLVXDOL]D KDFLD GRQGH ODV IOHFKDV GH OD OtQHD GH
corte indican 9HUSODQR$6HFFLyQ$- ).

120


&XDQGRUHDOL]DPRVXQFRUWHpVWHDIHFWDUiODYLYLHQGDGHVGHHOWHFKRKDVWDHOSLVR
GHO SULPHU QLYHO 3DUD PiV GHWDOOH HO FRUWH OOHJDUi KDVWD ORV FLPLHQWRV GHO SUR\HFWR $O
momento de efectuar seccioQHVHQFDVDVGHQLYHOHVVHGHEHUiGHGLEXMDUWDO\FRPRHV
HOSUR\HFWRHOVHJXQGRQLYHOVREUHHOSULPHUR(QODVSUR\HFFLRQHVHQSODQWDVHLQGLFDUiQ
los cortes en el mismo lugar en ambas. (Ver planta amueblada).

Es significativo que al momento de reDOL]DU FRUWHV VH UHDOLFHQ HQ iUHDV GRQGH VH
EULQGHLQIRUPDFLyQLPSRUWDQWH8QFRUWHVXEVWDQFLDOVLHPSUHVHUi HQGRQGHVHXELTXHQODV
gradas. El orden que se toma para ir indicando los diferentes cortes son: A- - -
HWFVHJ~QVHDHOQ~PHURGHForte.

Existen dos tipos de cortes, los cuales son:

&RUWH 7UDQVYHUVDO (VWH FRUWH VH HIHFW~D D OR DQFKR GHO SUR\HFWR R HQ HO ODGR PiV
corto de la planta, como lo muestran los dibujos anteriores.

&RUWHORQJLWXGLQDO(VWHFRUWHVHHIHFW~DDORODUJRGHO SUR\HFWRRHQHOODGRPiVODUJRGH
la planta. 9HUVHFFLyQ%-

123


<OXHJRYHPRVKDFLDGRQGHQRVLQGLFDQODVIOHFKDVGHODOtQHDGHFRUWHXELFDGDVHQ
la planta amueblada. (Ver Plano A106HFFLyQ%-

([LVWHQGLIHUHQWHVIRUPDVGHUHSUHVHQWDUORVFRUWHV$FRQWLQXDFLyQVHSUHVHQWDQDOJXQDVGH
ODVVLPERORJtDVXWLOL]DGDVHQORVSODQRV

124


/D LQIRUPDFLyQ GDGD HQ DPEDV SODQWDV, como niveles, ventanas, muros, etc.,
GHEHUiQ FRLQFLGLU FRQ OD VHFFLyQ UHDOL]DGD 'HEHUi WDPELpQ FRLQFLGLU FRQ OD SODQWD GH
techos.

Procedimiento para trazar las secciones o cortes

1. 7UD]DUXQDOtQHDKRUL]RQWDOODFXDOVHUiHOQLYHO$SDUWLUGHHVWDOtQHDPLda
KDFLDDUULEDODDOWXUDGHSLVRDFLHORHVGHFLUODDOWXUDTXHWHQGUiHOWHFKRGHO
SULPHUQLYHO0HGLGDODDOWXUDWUDFHRWUDOtQHDKRUL]RQWDO

2. De esta ~OWLPD OtQHD PLGD KDFLD DUULED HO HVSHVRU GH OD ORVD OXHJR GH HVWD
medida, mida el espesor del piVR \ WUDFH ODV GRV OtQHDV KRUL]RQWDOHV FRQ OtQHD
JXtD

127


3. Ahora, del nivel de piso hacia arriba, mida la altura de piso a cielo, el espesor de
OD ORVD \ HO OHYDQWDGR TXH WHQGUi HQ ODV RULOODV /XHJR WUDFH OtQHDV JXtDV
horizontales sobre estos puntos de medida.

4. Es importante observar bien por donde pasa el corte en la planta, para luego
tomar medidas de muros interiores, desniveles, ventanas, puertas, que sean
DIHFWDGDV\WUD]DUORVHQODVHFFLyQ

128


5. Cuando se traza un corte GHEHUi REVHUYDU DO PLVPR WLHPSR ODV WUHV SODQWDV
(planta alta, planta baja y planta de techos), para poder dibujar correctamente
ODVHFFLyQ

6. Revisar en ambas plantas los niveles. Recuerde que del nivel 0.00 baje o suba los
diferentes niveles indicados en la planta.

7. Proyectar voladizos, aleros, balcRQHVHWFVLpstos existieren.

8. $QWHVGHDSOLFDUWLQWDDODVHFFLyQUHYtVHODQXHYDPHQWHFRPSDUiQGROD con las


tres plantas. Luego aplique tinta, teniendo en cuenta siempre, el grosor de la
OtQHDSDUDLGentificar los diferentes planos, (1ero.2do.3er plano, etc.) \FRQOtQHD
GHFRQWRUQRSULQFLSDO JURVRUyPP los muros que fueron afectados por el
corte. (Ver planos A8 y A9: SHFFLyQ$- -

,QIRUPDFLyQPtQLPDTXHGHEHOOHYDUFDGDVHFFLyQ

RotXODU TXp VHFFLyQ HV \D VHD SRU 6HFFLyQ $- -


longitudinal.
La escala a la que fue trazada.
Indicar los ejes de los diferentes muros que fueron afectados al momento del corte.
1RVHFRORFDQLQJ~QWLSRGHFRWDKRUL]RQWDO
Dibujar texturas de materiales
Cotas de todo tipo de alturas, jardineras, sillares, dinteles, muros, alturas de piso a
cielo, etc.
,QGLFDUORVQLYHOHVHQFDGDDPELHQWHDVtFRPRWDPELpQURWXODUHOQRPEUHGHFDGD
uno.
Si se manifiestan en los cortes, elevDFLRQHVGHSXHUWDVLQGLFDUTXp tipo de puerta es;
si P-1, P-HWFDVtFRPRWDPELpQWLSRVGHYHQWDQD
/DHVWUXFWXUDGHODFXELHUWD\VXSRUFHQWDMHGHLQFOLQDFLyQ
,QGLFDU DOJ~Q WLSR GH GHWDOOH LPSRUWDQWH \ HQ TXp Q~PHUo de hoja se encuentra
dibujado.
Cuando cualquier parte de la vivienda no sea afectada por el corte, y se visualiza al
IRQGRVHGHEHUiWUD]DU
Dibujar mobiliario fijo (inodoros, lavamanos, pilas, etc.) donde estos se manifiesten y
tener en cuenta el espesor de relleno que lleva un servicio sanitario, el cual se utiliza
para poder introducir ODWXEHUtDGHGUHQDMH(MHPSOR

129


Existen dos formas de dibujar los cortes y elevaciones /D SULPHUD OOHYDUi WRGD OD
LQIRUPDFLyQ QHFHVDULD SDUD OD FRQVWUXFFLyQ HQ REUD \ SDUD ORV WUiPLWHV GH OD OLFHQFLD GH
FRQVWUXFFLyQ/DVHJXQGDHVWDUiQDPELHQWDGDVFRQPXHEOHVILJXUDKXPDQDYHJHWDFLyQ
etc., todo esto para poder presentar y explicar al cliente el proyecto. Ejemplo:

130


(OHYDFLyQ WLSRSUHVHQWDFLyQ

1yWHVH FyPR VH DPELHQWD HO GLEXMR FRQ ILJXUD KXPDQD iUEROHV YHJHWDFLyQ
muebles, HWFWDPELpQDOGLEXMRVHOHDSOLFDQFRORUHV\VRPEUDVEn planos constructivos no
VH GHEHUiQ GLEXMDU ORV HOHPHQWRV PHQFLRQDGRV DQWHULRUPHQWH \D TXH REVWUXLUtD OD
LQIRUPDFLyQ\FDUJDUtDGHPDVLDGRHOGLEXMR

131


6HFFLyQ WLSRSUHVHQWDFLyQ

132


&$378/2 5
Planos de instalaciones
3ODQRVGHLQVWDODFLyQKLGUiXOLFD
Planos dHLQVWDODFLyQde aguas negras y pluviales
3ODQRVGHLQVWDODFLyQHOpFWULFD
133


5. PLANOS DE INSTALACIONES

&RPR VX QRPEUH OR LQGLFD VRQ SODQRV TXH FRQWLHQHQ LQIRUPDFLyQ DFHUFD GH OD
GLVWULEXFLyQ \ FRORFDFLyQ GH ODV GLIHUHQWHV LQVWDODFLRQHV que contiene una vivienda,
asiPLVPRORVPDWHULDOHVDXVDULQGLFDFLyQGHGLiPHWURVGHWXEHUtDSHQGLHQWHVHWF

Dentro de los planos instalaciones tenemos los siguientes:

3ODQRVGHLQVWDODFLyQKLGUiXOLFDRDJXDSRWDEOH
(VWH SODQR PXHVWUD OD LQIRUPDFLyQ GH FyPR VH GLVWULEXLUi OD WXEHUtD HQ HO
SUR\HFWR DVt FRPR WDPELpQ HO WLSR GH PDWHULDO GLiPHWURV \ DOWXUD GH WRPDV GH
agua para cada artefacto.

3ODQRVGHLQVWDODFLyQGHDJXDVQHJUDV\SOXYLDOHVRDJXDVVHUYLGDV
0XHVWUDLQIRUPDFLyQGHFyPRVHGHEHUiFRORFDUODUHGTXHFRQGXFLUiODVDJXDV
QHJUDVGHFDGDDUWHIDFWRKDFLDODFDQGHODPXQLFLSDOLQGLFDQGRGLiPHWURVGH
OD WXEHUtD PDWHULDOHV D XWLOL]DU SHQGLHQWHV \ DFFHVRUios. Dentro de este mismo
plano se coloca la red que conduce las aguas de lluvia que caen en la
cubierta.

PlaQRVGHLQVWDODFLyQHOpFWULFD
eVWH VH GLYLGH HQ GRV ,OXPLQDFLyQ \ IXHU]D (O SULPHUR LQGLFD OD GLVWULEXFLyQ \
FRORFDFLyQGHODVOXPLQDULDVTXHDEDVWHFHUiQGHOX]DUWLILFLDODFDGDDPELHQWH
LQGLFDQGRORVGLIHUHQWHVFLUFXLWRV\HODODPEUDGRTXHLUiGHQWUR GHODWXEHUtD(O
VHJXQGRLQGLFDODGLVWULEXFLyQ\FRORFDFLyQGHODVWRPDVGHFRUULHQWHLQGLFDQGR
voltaje y el alambrado.

Planos de instalaciones especiales:


(VWRV SODQRV FRQWLHQHQ LQIRUPDFLyQ GH LQVWDODciones que no comprenden los
VHUYLFLRV EiVLFRV FRPR por ejemplo: aire acondicionado, elevadores, escaleras
HOpFWULFDVSLVFLQDVVLVWHPDVGHERPEHRHWF
3RUFRQWHQLGRGHOFXUVRHQHVWHPDQXDOVHRPLWLUiQHVWRVSODQRV

5.1 IQVWDODFLRQHVKLGUiXOLFDVRDJXDSRWDEOH

En eVWH SODQR VH GHEHUi trazar toda la LQVWDODFLyQ WDQWR HQ SODQWD FRPR HQ
LVRPpWULFR SDUD DSUHFLDU HO UHFRUULGR GHO DJXD GLEXMDQGR GHsde la acometida y el
FLUFXLWRFHUUDGRKDVWDORVGHSyVLWRV\WRPDVGHORVDUWHIDFWRVVDQLWDULRV

Antes de saber FyPR se traza el plano de agua potable, se debe conocer las
GLIHUHQWHV VLPERORJtDV TXH VH XWLOL]DQ SDUD UHSUHVHQWDU DFFHVRULRV OODYHV YiOYXODV HTXLSR
etc.

134


Accesorios:
/RVDFFHVRULRVPiVXWLOL]DGRVHQXQDLQVWDODFLyQKLGUiXOLFDVRQORVFRGRV\ODVteces a
90 grados. Lo importante al momento de trazar los accesorios en planta, es saber FXiO es su
SRVLFLyQHVGHFLUVLHVWRVVHHQFXHQWUDQKRUL]RQWDORYHUWLFDOPHQWH(MHPSOR

Codo a 90 grados

3RVLFLyQKRUL]RQWDO 3RVLFLyQYHUtical

1. 2. 3. 1. 2. 3.
3RGHPRV XWLOL]DU FXDOTXLHUD GH HVWDV VLPERORJtDV SDUD UHSUHVHQWDU OD SRVLFLyQ GHO
accesorio. DepeQGHUi WDPELpQ si la escala a la que se traza, nos permite un mayor
JUDGRGHGHWDOOHHQFDVRFRQWUDULRVHXWLOL]DUiODVRSFLRQHV\
6LVHXWLOL]DODRSFLyQVHDSOLFDUiWLQWDFRQUDSLGyJUDIR 0.2 mm., y si se utiliza la
RSFLyQ\VHDSOLFDUiWLQWDFRQUDSLGyJUDIR 0.6 mm.

3RVLFLyQYHUWLFDO

Te

3RVLFLyQYHUWLFDO 3RVLFLyQKRUL]RQWDO

1. 2. 1. 2. 1. 2.
3RVLFLyQKRUL]RQWDO 3RVLFLyQYHUWLFDO 3RVLFLyQYHUWLFDO

135


&XDQGR VH GLEXMH OD SRVLFLyQ YHUWLFDO  VH GHEHUi LQGLFDU TXH HV XQD te, ya que
SXHGHFUHDUFRQIXVLyQGHTXHHVXQFRGRHQSRVLFLyQYHUWLFDO

Detalle de acometida de agua potable

Entre la red de agua municipal y el circuito de agua de la vivienda, existe una caja
de concreto en la cual se encuentran YDULDV YiOYXODV \ HO FRQWDGRU GH DJXD &DGD XQR
FXPSOHFRQXQDIXQFLyQHVSHFtILFD9HUILJXUD

Figura 5.1

136


Llave paso: Esta llave sirve para cerrar el paso de agua a la vivienda. Esta es la llave
que se cierra por falta de pago del servicio a la municipalidad.

Contador de agua: Mide la cantidad GH DJXD TXH VH KD XWLOL]DGR 6HJ~Q OD
FDQWLGDGGHDJXDLQGLFDGDHQHOFRQWDGRUDVtVHUiHOSDJRDUHDOL]DU

/ODYH GH FRPSXHUWD &XDQGR VH QHFHVLWH UHDOL]DU DOJXQD UHSDUDFLyQ GH OD WXEHUtD
VHXWLOL]DHVWDYiOYXODSDUDFHUUDUHOSDVRGHDJXDDODFDVD

&KHTXH (VWD YiOYXOD SHUPLWH HO SDVR GHO DJXD D OD YLYLHQGD HQ XQ VROR VHQWLGR
evitando que el agua regrese.

&XDQGR UHDOL]DPRV HO WUD]R GH OD WXEHUtD GH DJXD SRWDEOH GHO SUR\HFWR GHEHPRV
LQGLFDUODSRVLFLyQGHHVWDVYiOYXODV&RPRQRSRGHPRVUHDOL]DUun grado de detalle como
HQODILJXUDVHXWLOL]DODVLJXLHQWHVLPERORJtDHQSODQWD

8WLOL]DUUDSLGyJUDIR PPSDUDODVOODYHV3DUDODWXEHUtDXWLOL]DUUDSLGyJUDIR
0.6 mm.

137


Procedimiento para trazar un plano de agua potable

1. 'DGR HO GLVHxR GH OD GLVWULEXFLyQ GH OD WXEHUtD SULPHUR VH saca una copia del
SODQRPDFKRWH\VREUHpste se traza la acometida de agua con sus respectivas
YiOYXODV

2. /XHJR VL KXELHVH VH GLEXMDUi OD XELFDFLyQ GHO WDQTXH FLVWHUQD \ OD ERPED
hLGURQHXPiWLFD

3. 3RVWHULRUPHQWHGLEXMDU HOFLUFXLWRGHDJXD IUtD \VL KXELHVHHOFLUFXLWRGHDJXD


caliente, con sus respectivos accesorios, (codos, teces, grifos, etc.) ubicar las
VXELGDVGHDJXDKDFLDHOVHJXQGRQLYHO\ODSRVLFLyQGHOFDOHQWDGRU

4. RotuODUFRQEXHQDOHWUDGLiPHWURV\PDWHULDOGHODWXEHUtDVLHV39& FORUXURGH
SROLYLQLOR &39& SDUDDJXDFDOLHQWH +* +LHUURJDOYDQL]DGR R&8 WXEHUtDGH
cobre), DVt FRPR WDPELpQ SRU GRQGH VXEH OD WXEHUtD DO VHJXQGR QLYHO \ el
cuadro con el significDGRGHFDGDVLPERORJtD

5. 3RU ~OWLPR WUD]DU HO LVRPpWULFR GH WRGD OD LQVWDODFLyQ detalles y notas, como
altura de tomas de los diferentes artefactos y detalle del tanque cisterna.

Observar el plano I1 e I2: Agua PRWDEOH este GHEHUi FRQWHQHU WRGD HVWD
iQIRUPDFLyQFRPRPtQLPR

8WLOL]DU UDSLGyJUDIR  PP SDUD HO URWXODGR \   PP SDUD OD WXEHUtD \
accesorios.

138


143


144


6H GHEHUi WUD]DU HO GHWDOOe de la altura de tomas de agua de cada uno de los
GLIHUHQWHV DUWHIDFWRV \ WRPDU HQ FXHQWD HVWDV DOWXUDV DO PRPHQWR GH GLEXMDU HO LVRPpWULFR
GHODLQVWDODFLyQKLGUiXOLFD

,VRPpWULFRGHLQVWDODFLyQKLGUiXOLFD

$ FRQWLQXDFLyQ en el plano I3 ,VRPpWULFR GH LQVWDODFLyQ \ GHWDOOH GH FLVWHUQD se


PXHVWUDHOLVRPpWULFRGHWRGDODLQVWDODFLyQGHOSUR\HFWR. Esta proyecciyQVHUHDOL]DFRQHO
fin brindar XQDPHMRULQWHUSUHWDFLyQGHFyPRVHGLVWULEXLUiWRGDODWXEHUtD

7RGRODWXEHUtDDVtFRPRORVDFFHVRULRVVHOHVDSOLFDUiWLQWDFRQHOUDSLGyJUDIRy
0.6 mm. Indicar toda la informaFLyQFRPRORPXHVWUDHOHMHPSORXVDQGRFULWHULRSURSLRHQ
ODDOWXUDGHOURWXODGR$HVWHVHOHDSOLFDUiWLQWDFRQHOUDSLGyJUDIRPP

145


146


De esta manera se acomoda toda la LQIRUPDFLyQGHQWURGHOIRUPDWR El detalle de


la cisterna o cualquier otro detalle GH LQVWDODFLyQ VH SRGUiQ UHDOL]DU HQ XQ IRUPDWR SRU
separado.

5.2 Instalaciones de aguas negras y pluviales

Al momento de trazar el plano del sistema de drenajes, cada tipo de agua a servir,
WHQGUiVXSURSLDWXEHUtDHVGHFLU XQDUHGGHWXEHUtDSDUDODVDJXDVSOXYLDOHV\ RWUDSDUD
las aguas negras.

Toda la red, lleva el agua hacia el colector o candela municipalXQLILFiQGRVH al final la


red de aguas negras y pluviales por medio de una caja unificadora, antes de llegar a la
candela.

Accesorios

/RVDFFHVRULRVPiVXWLOL]DGRVHQXQDLQVWDODFLyQGHGUHQDMHVVRQOD te, el codo a HO


FRGR D  VLIyQ UHGXFLGRU EXVKLQJ OD \H \ OD \H GREOH $O LJXDO TXH OD WXEHUtD GH DJXD
potable, debemos saber trazar e interpretar cada uno, y saber en TXp posicLyQ VH
encuentran en la vista de planta del proyecto. Ejemplo:

151


Te &RGRD &RGRD

Horizontal Vertical Vertical 2 Horizontal Vertical Bajada vertical Horizontal

6LIyQ reducidor bushing Ye D Ye DGREOH

Horizontal Horizontal Horizontal Horizontal

/D WXEHUtD GH DJXDV QHJUDV GHEHUi GLIHUHQFLDUVH GH OD WXEHUtD GH DJXDV SOXYLDOHV
ashurando el tubo de la siguiente manera:

6L OD WXEHUtD VH FUX]D XQD FRQ RWUD VH GHEHUi WUD]DU OD WXEHUtD GH DJXDV SOXYLDOHV
HQFLPDGHODWXEHUtDGHDJXDVQHJUDV

152


Detalle de cajas

En un sistema de aguas servidDVVHXWLOL]DQFDMDVestas pueden ser de ladrillo tayuyo,


de concreto, prefabricadas o pvc, y se utilizan SDUDXQLUYDULDVWXEHUtDVRSDUDUHDOL]DUuna
GHWHUPLQDGDIXQFLyQ(VWDVFDMDVVRORSRGUiQFRQVWUXLUVHHQHOSULPHUQLYHO3DUDHOVHJXQGR
\GHPiVQLYHOHVVHXWLOL]DQDFFHVRULRV. En el plano: Detalle de cajas, se presentan las cajas
PiVFRPXQHVXWLOL]DGDVHQORVSODQRV

Para realizar el detalle de cajas, se utilizan las escalas 1:10 o 1:12.5. Observe que en
los dibujos existen cuatro WLSRVGHJURVRUGHOtQHD8WLOL]DUORV rapidografos 0.1 mm, 0.2 mm.,
0.3 mm., y 0.4 mm., DO PRPHQWR GH DSOLFDU WLQWD 3DUD XQD PHMRU LQWHUSUHWDFLyQ OD
SUR\HFFLyQHQSODQWDGHODFDMDVHGLEXMDVLQVXUHVSHFWLYDWDSDGHUD

Proyecte los ladrillos y los tubos con sus dimensiones respectivas, a la escala que se
HVWi trabajDQGR ,QGLFDU HO QRPEUH GH FDGD SUR\HFFLyQ VL HV SODQWD R VHFFLyQ DVt FRPR
WDPELpQLQGLFDUHOWLSRGHFDMD/DDOWXUDGHOURWXODGRTXHGDDFULWHULRSURSLRVLHQGRpste,
legible y WHQLHQGRFXLGDGRTXHQRVHWUDVODSHODLQIRUPDFLyQ. (Ver planos: I9, I10 e I11).
$O PRPHQWR GH GLEXMDU OD WXEHUtD GH GUHQDMH SDUD HO LQRGRUR VH GHEHUi FRORFDU
separado del muro a la siguiente distancia:

Procedimiento para trazar un plano de drenajes sanitarios

1. 'DGRHOGLVHxRGHODLQVWDODFLyQGe aguas negras y pluviales del proyecto, dibuje


primero las diferentes bajadas de agua pluvial y aguas negras. En las tres plantas
(planta baja, planta alta y planta de techos), indicar las bajadas de agua de
lluvia.

153


2. Dibujar primero la red de aguas pluviales, con sus respectivas cajas y accesorios.
Dibujar las cajas a escala, viendo las dimensiones de cada uno, en el plano de
detalle de cajas.

3. Dibuje la red de aguas negras con sus respectivas cajas y accesorios. Recuerde
colocar sifones en duchas. Revisar que todos los artefactos posean su respectiva
WXEHUtD\GLIHUHQFLDUHOWXERGHDJXDVQHJUDVFRQHOGHDJXDVSOXYLDOHV

4. Rotule con buena letra indicaciones de bajadas de aguas negras y pluviales,


tipo de caja, GLiPHWURWLSR\ sentido de la pendiente de FDGDWXEHUtDindicar
reducidores\SRU~OWLPRDOILQDOGHODWXEHUtDLQGLFDUTXHYDKDFLDODFDQGHODR
colector municipal.

5. (Q OD SODQWD GH WHFKRV VH GHEHUi LQGLFDU ORV SDxXHORV R GLIHUHQWHV SHQGLHQWHV
TXH WHQGUi OD FXELHUWD GH OD ORVD SDUD FRQGXFLU las aguas de lluvia hacia las
distintas bajadas de agua pluvial.

6. (QHOHVSDFLRGHOODGRGHUHFKRWUD]DUHOFXDGURGHVLPERORJtDGHGUHQDMHVDVt
FRPR WDPELpQ DOJXQD QRWD X REVHUYDFLyQ Tome como ejemplo las siguientes
plantas para realizar el plano de drenajes.

$FRPRGDUODLQIRUPDFLyQGHQWURGHOIRUPDWRGHODVLJXLHQWHPDQHUD

154


159


160


165


166


5.3 ,QVWDODFLRQHVHOpFWULFDV ,OXPLQDFLyQ\IXHU]D

$OLJXDOTXHVHXVDQFRQGXFWRVRWXEHUtDVSDUDFRQGXFLUHODJXDDXQGHWHUPLQDGR
OXJDU HQ ORV SODQRV GH LQVWDODFLyQ HOpFWULFD WDPELpQ VH XWLOL]DQ GXFWRV R WXEHUtDV SDUD
distribuir el alambrado que conduce la electricidad a diferentes puntos, en este caso, a
XQLGDGHVGHLOXPLQDFLyQ\ tomacorrientes.

'LVWULEXFLyQGHOVLVWHPDHOpFWULFR

Para interpretar correctamente un plano de electricidad, se necesita comprender


Fymo se distribuye todo el sisWHPD HOpFWULFR DVt FRPR WDPELpQ OD VLPERORJtD TXH VH
utiliza para poder representar cada uno de los accesorios. (Ver planos I15 e I18:
VLPERORJtDGHLOXPLQDFLyQ\IXHU]D 

/RVFRQGXFWRUHVROtQHDVVRQORVGLIHUHQWHVWLSRVGHDODPEUHVTXHOOHYDUin la enHUJtD
DORVGLIHUHQWHVDFFHVRULRVHOpFWULFRV

&RQGXFWRU SRVLWLYR R OtQHD YtD (V HO DODPEUH TXH FRQGXFH OD FDUJD SRVLWLYD GH XQ
circuito determinado.

&RQGXFWRUQHXWURROtQHDQHXWUDO(VHODODPEUHTXHFRQGXFHODFDUJDQHJDWLYDGH
un circuito determinado.

/tQHD GH UHWRUQR (V HO DODPEUH TXH VH XWLOL]D SDUD FRQHFWDU R XQLU HO IRFR FRQ HO
interruptor.

/tQHD GH SXHQWH 6RQ GRV DODPEUHV TXH XQHQ GRVLQWHUUXSWRUHV HQ XQ VLVWHPDWKUHH
way.

&LUFXLWRHOpFWULFR(VWiFRQIRUPDGRGH 12 unidades de focos o tomacorrientes.


&DGD FLUFXLWR VH LGHQWLILFD FRQ XQD OHWUD PD\~VFXOD DO LJXDO TXH FDGD IRFR R
tomacorriente.

(QWXEDGR (O FLUFXLWR HOpFWULFR VH XQH SRU PHGLR GH WXEHUtD TXH FRQGXFH ORV
GLIHUHQWHVDODPEUHVROtQHDV

Alambrado: Luego de trazado el circuito y unido por el entubado, se identifica TXp


OtQHDVLUiQGHQWURGHOWXERXWLOL]DQGRODVLPERORJtDTXHFRUUHVSRQGHDFDGDXQR

169


(MHPSORGHXQFLUFXLWRHOpFWULFR

',675,%8&,1 ENTUBADO ALAMBRADO

Al momento de identificar cada XQLGDG\DVHDIRFRVRWRPDFRUULHQWHVVHGHEHUiQ


LGHQWLILFDUpVWRVGHPDQHUDRUGHQDGDVLJXLHQGRODGLUHFFLyQGHOHQWXEDGR

3DUDFRPSUHQGHUPHMRUFRPRIXQFLRQDHOVLVWHPDHOpFWULFRGHLOXPLQDFLyQ\IXHU]D
VHSUHVHQWDDFRQWLQXDFLyQODSUR\HFFLyQLVRPpWULFDGHOFLUFXLWRDQWHULRU 2EVHUYHFymo a
FDGDXQDGHODVXQLGDGHVGHLOXPLQDFLyQOOHJDODOtQHDQHXWUDO\GHODGHWHUPLQDGDXQLGDG
VDOHODOtQHDGHUHWRUQRKDFLDHOLQWHUUXSWRU

170


En el dibuMR DQWHULRU VH SXHGH REVHUYDU Fymo las unidades de iOXPLQDFLyQ $ \ $
son controladas cada una, por un interruptor simple. Las luminarias A3, A4 y A5, son
controladas por un solo interruptor simple, esto quiere decir que cuando se manipule el
LQWHUUXSWRUODVWUHVOXPLQDULDVVHHQFHQGHUiQ\DSDJDUiQDOPLVmo tiempo. A este sistema de
FRQWURODUYDULDVXQLGDGHVFRQXQ~QLFRERWyQVHOHGHQRPLQDVLVWHPDHQVHULH2EVHUYHTXH
ODOtQHDGHUHWRUQRXQLILFDODVWUHVXQLGDGHV

171


En muchas ocasiones, se necesita controlar un foco o focos desde dos diferentes


puntos, es decir, accionar el encendido en un punto determinado de la vivienda, y poder
DSDJDUORHQRWURSXQWRVLQQHFHVLGDGGHUHJUHVDUDOSXQWRGRQGHVHHQFHQGLyRYLFHYHUVD
El alambrado del three way utiliza un puente o dos alambres que une ambos
LQWHUUXSWRUHV $ XQ LQWHUUXSWRU OOHJDUi OD OtQHD GH UHWRUQR GH OD OXPLQDULD R OXPLQDULDV
PLHQWUDVTXHDORWURLUiODOtQHDDFWLYD(MHPSOR

El sistHPDHOpFWULFR\VXGLVWULEXFLyQ se componen de la siguiente manera:

1. En cada vivienda se coloca la acometida, la cual UHFLEHODVOtQHDVTXHHQWUDQGH


ORV FDEOHV H[WHULRUHV GH OD HPSUHVD HOpFWULFD GH *XDWHPDOD DO FRQWDGRU GH OD
casa.

2. 'HO FRQWDGRU HOpFWULFR VH GLULJHQ ODV WUHV OtQHDV GH HOHFWULFLGDG QHXWUDO \ GRV
OtQHDs activas 120), al tablero general y luego, al tablero GH GLVWULEXFLyQ GH
FLUFXLWRV eVWH ~OWLmo FRQWURODUi HO HQFHQGLGR \ DSDJDGR GH ORV GLIHUHQWHV
circuitos.

172


3. Del tablero de circuitos de la planta baja, suben hacia el segundo nivel las tres
OtQHDV TXH SUHYHUiQ GH HQHUJtD D XQ VHJXQGR WDEOHUR GH FLUFXLWRV HO FXDO
FRQWURODUiORVGLIHUHQWHVFLUFXLWRVXELFDGRVHQHOVHJXQGRQLYHO

4. (QORVSODQRVLUiWUD]DGRODGLVWULEXFLyQGHORVGLIHUHQWHVFLUFXLWRV$%&HWF

5. 7RGRV ORV FLUFXLWRV LUiQ XQLGRV SRU OD WXEHUtD TXH FRQGXFH HO DODPEUDGR KDFLD
cada una de las diferentes unidades. El entubado LUi FRQ OtQHD SXQWHDGD R
VyOLGDLQGLFDQGRVLHOWXERLUiLQVWDODGRHQODORVDSDUHGRGHEDMRGHOSLVR 9HU
VLPERORJtD 

6. &DGD FLUFXLWR WHQGUi GH  08 unidades (fRFRV OiPSDUDV UHIOHFWRUHV


WRPDFRUULHQWHV HWF  6H GHEHUi SUHYHU SRVLEOHV DPSOLDFLRQHV (O Q~PHUR GH
unidades depende del calibrH GHO DODPEUH DVt FRPR WDPELpQ GH XQ FiOFXOR
HOpFWULFR \D TXH QR WRGDV ODV XQLGDGHV GH LOXPLQDFLyQ FRQVXPLUiQ OD PLVPD
enHUJtDHVGHFLUH[LVWLUiQIRFRVROiPSDUDVGHZDWWVHWF\FDGDFDOLEUH
de alambre tiene una cierta capacidad de conducir una determinada cantidad
de corriente.

3URFHGLPLHQWRSDUDWUD]DUXQSODQRGHLQVWDODFLyQHOpFWULFD

1. Trazar en cada planta GHOPDFKRWHODXELFDFLyQGHODVGLIHUHQWHVXQLGDGHVGH


LOXPLQDFLyQ\IXHU]DXWLOL]DQGRODVLPERORJtDGHFDGDXQR$VtFRPRWDPELpQOD
XELFDFLyQ GHO FRQWDGRU ORV WDEOHURV GH GLVWULEXFLyQ HQ FDGD SODQWD \ OD
XELFDFLyQGHORVLQWHUUXSWRUHVGHFDGDOXPLQDria.

2. 'HVSXpV GH GLEXMDGRV WRGRV ORV DFFHVRULRV VH SURFHGH D GHWHUPLQDU TXp


XQLGDGHV IRUPDUiQ ORV GLIHUHQWHV FLUFXLWRV URWXODQGR H LGHQWLILFDQGR FDGD XQR
Ejemplo: A1, luminaria o luminarias manipula
determinado interruptorDVtFRPRWDPELpQVLHVVLPSOHGREOHWKUHHZD\etc.

3. 3RVWHULRUPHQWH GLEXMDU HO HQWXEDGR TXH XQLUi FDGD XQD GH ODV GLIHUHQWHV
XQLGDGHV IRUPDQGR HO FLUFXLWR 6H GHEHUi WHQHU FXLGDGR TXH DO momento de
WUD]DUHOHQWXEDGRpste no se cruce con otro, y que lleve un orden, pensando en
ODPHMRUIRUPDSDUDODLQVWDODFLyQGHODWXEHUtD

4. Dibujar el alambrado que iri HQ FDGD WXEHUtD LQGLFDQGR TXp WLSR GH OtQHD HV
neutral, retorno, activo, etc.

5. Terminado el alambrado de los circuitos de la primera planta, se procede a


trazar los circuitos de la segunda planta, siguiendo los pasos anteriores. Trazar el
SODQRGHLOXPLQDFLyQ\IXHU]DSRUVHSDUDGR

173


6. Se recomienda que cada planta posea un tablero de circuitos, es decir, el


tablero de circuitos del primer nivel, FRQWURODUi ~QLFDPHQWH ORV FLUFXLWRV GHO
SULPHU SLVR \ HO VHJXQGR WDEOHUR FRQWURODUi ORV FLUFXLWRV GHO VHJXQGR SLVR \ DVt
VXFHVLYDPHQWH\DTXHGHQRKDFHUORDVtSRGUtDRFXUULUFDtGDGHWHQVLyQ

El GLiPHWUR GH OD WXEHUtD GH HOHFWULFLGDG GHSHQGHUi GH OD cantidad de alambres
TXH SDVHQ GHQWUR GH pVWD $ FRQWLQXDFLyQ VH PXHVWUD XQ FXDGUR FRQ OD WXEHUtD
recomendable a utilizar dependLHQGRGHODFDQWLGDGGHOtQHDV\HOFDOLEUHGHODVPLVPDs.

Fuente: Curso de instalaciones 2. Facultad de ArTXLWHFWXUD86$&$UT9LQLFLR*RQ]iOH]

174


179


180


185


186


&$378/2 6 Planos de Estructuras


&RQFHSWRVEiVLFRV
3ODQRGHFLPHQWDFLyQ\FROXPQDV
Cortes de muros
Plano de losa tradicional y prefabricada
Plano de detalles de vigas
Plano de detalle de gradas
&DMHWtQ

187


6.1 &21&(3726%6,&26

Es importante conocer los elementos que componen la estructura de una vivienda y


TXp IXQFLyQSRVHHFDGDXQRHQSDUWLFXODU $FRQWLQXDFLyQVHPXHVWUDFRQXQDSUR\HFFLyQ
LVRPpWULFD ORV FRPSRQHQWHV GH XQD HVWUXFWXUD GH PDPSRVWHUtD GH EORFN \ FRQFUHWR
reforzado.

188


Muros o paredes: Existen dos tipos de muros, el muro de carga y el muro tabique. Los
muros de carga VRQ ORV TXH VRSRUWDUiQ XQD SDUWH GHO SHVR TXH WUDQVPLWH HO WHFKR \ HO
HQWUHSLVR GH OD YLYLHQGD /RV PXURV WDELTXH SRU HO FRQWUDULR QR FDUJDQ QLQJ~Q SHVR VLQR
~QLFDPHQte sirven para dividir el espacio.

Concreto: Mezcla compuesta poU FHPHQWR DUHQD GH UtR JUDYD R SLHGUtQ \ DJXD
TXH DO PRPHQWR GH PH]FODUVH HVWRV PDWHULDOHV FRPLHQ]D XQD UHDFFLyQ TXtPLFD TXH YD
HQGXUHFLHQGR OD FRPSRVLFLyQ KDVWD SRQHUVH UtJLGD FRPR XQD Siedra. La resistencia que
REWHQGUiGHSHQGHUiGHODVFDQWLGDGHVGHFDGDXQRGHVXVGLIHUHQWHVFRPSRQHQWHV

&RQFUHWR UHIRU]DGR )XQGLFLyQ GH FRQFUHWR HO FXDO OOHYDUi UHIXHU]RV GH YDULOODV GH
acero.

Hierros o varillas: Son elementos de acero, maleables y sROGDEOHVVLQDOWHUDFLyQGHVXV


FDUDFWHUtVWLFDVPHFiQLFDV

&LPLHQWRFRUULGR(OHPHQWRFRORFDGRHQSRVLFLyQKRUL]RQWDOHOFXDOWUDQVPLWHSDUWH
GHOSHVRWRWDOGHWRGDODHGLILFDFLyQDOVXHOR

Zapatas: Elemento horizontal hecho de concreto reforzado, el cual transmite las


cargas de las columnas principales al suelo.

Columnas: Elemento vertical hecho de concreto reforzado, el cual transmite las


FDUJDV GHO WHFKR \ HQWUHSLVR D OD ]DSDWD 'HSHQGLHQGR GH XQ FiOFXOR HVWUXFWXUDO OD
FROXPQDSRGUiWUDQVPLWLUODFDUga al cimiento corrido.

Soleras: Elementos horizontales, hechos de concreto reforzado, los cuales transmiten


las cargas de los muros hacia las columnas.

(VWULERV &LQFKRV GH KLHUUR TXH VH XWLOL]DQ SDUD DPDUUDU  y PiV YDULOODV GH XQD
columna o solera.

EVODEyQ &LQFKR GH KLHUUR TXH VH XWLOL]D SDUD DPDUUDU  y PiV YDULOODV GH XQD
columna, solera o cimiento corrido.

6.2 Plano de cimentDFLyQ\FROXPQDV

&RPRVXQRPEUHORLQGLFDHVWHSODQRHVHOTXHEULQGDLQIRUPDFLyQDFHUFDGHFyPR
LUiQ GLVWULEXLGRV ORV HOHmentos horizontales (Cimientos: Cimiento corrido y zapatas) y los
elementos verticales (Columnas).

189


190


Para indicar los diferentes tipos de columnas se utiliza la siguiente nomenclatura,


indicando a la par o con una flecha a la columna, si es columna C-1, C-2, C-3, etc. (Ver
SODQRFLPHQWDFLyQ\FROXPQDV).

Para indicar HOFLPLHQWRFRUULGRpVWHVHGLEXMDUiSRUGHEDMRGHORVPXURs, trazando


su ancho respectivo \DVKXUiQGRORFRQXna textura diferente a la de las zapatas.

Para indicar las zapatDV pVWDV VH GLEXMDUiQ SRU GHEDMR GHO FLPLHQWR FRUULGR
WUD]iQGRODVDHVFDODFRQVXVGLPHQVLRQHVUHVSHFWLYDVVHJ~QHOWLSRGH]DSDWD\DVKXUDQGR
HOiUHDFRQXQDWH[WXUDTXHODVGLIHUHQFLHGHl cimiento corrido.

Para indicar soleras de amarre (soleras cuya funcionalidad son de amarrar


HOHPHQWRVYHUWLFDOHV pVWDVVHWUD]DUiQFRQXQWLSRGHOtQHD

/RV FRUWHV GH PXUR GHEHUiQ LU LQGicados en este plano. Ver plano E1 y E2:
FLPHQWDFLyQ\FROXPQDV

6.2.1 Detalle de columnas

(Q ODV SODQWDV GH FLPHQWDFLyQ \ FROXPQDV VH LQGLFD D TXp WLSR GH FROXPQD
pertenece cada uno. LDGLIHUHQFLDHQWUHFDGDXQDHVWi en el armado y el grosor o seFFLyQ
Cada columna se acota en sus lados e indicado el tipo de varillas y cinchos a utilizar.

LQGLFDUSRUPHGLRGHOQ~PHURGHRFWDYRVTXHHVWDWHQga. Ejemplo:

'LiPHWUR GH OD 1~PHUR GH RFWDYRV


varilla en pulgadas que posee

195


Por lo tanto, podemos utilizar cualquiera de estas dos formas para indicar TXp tipo
GHYDULOODVHXWLOL]DUi(MHPSOR

@ 0.20 M.

(/DQWHULRUHMHPSORVHOHHGHODVLJXLHQWHPDQHUDYDULOODVGHKLHUURGHGLiPHWURGH
s pVWRV ~OWLPRV a cada 20 cms. (O VtPEROR #,
TXLHUHGHFLUDTXp diVWDQFLDVHFRORFDUiFDGDHVWULER. (Ver plano E4).

Recomendaciones al momento de trazar el detalle de una columna

6.2.2 Detalle de cimiento corrido y zapatas

Para indicar los detalles constructivos de los cimientos se realiza, en un plano aparte,
el dibujo del cimiento corrido o cimientos corridos dependiendo de si existen varios tipos, las
]DSDWDV\HODQFODMHGHODFROXPQDURWXODQGRLQIRUPDFLyQGHGLPHQVLRQHVWLSRVGHKLHUURs
y detalles de armado. (Ver plano E3).

RecomHQGDFLRQHVHLQIRUPDFLyQSDUDHOWUD]RGHOSODQRGHGHWDOOHGHFLPLHQWRV\]DSDWDV

$FDGD]DSDWDVHOHUHDOL]DXQFRUWHSDUDYHUHODUPDGRHQHOHYDFLyQ
3RUGHWDOOHVHWUD]DVLPERORJtDGHWLHUUDUHOOHQR\QLYHOGHSLVRWHUPLQDGR
Se debe acotar las dimHQVLRQHVGHOD]DSDWDDVtFRPRWDPELpQ la profundidad de
psta y la distancia de las varillas.
5RWXODUFRQEXHQDOHWUDHOWLSRGH]DSDWD\ODHVFDODDODTXHHVWiGLEXMDGD

196


Si existen zapatas y columnas del mismo tiSR \ FRQ OD ~QLFD GLIHUHQFLD GH TXH OD
FROXPQDQRHVWiHQHOFHQWURVLQRFRUULGDVHGHEHUiUHDOL]DURWURGHWDOOH\DTXHHO
DQFODGRVHUiGLIHUHQWH9HUORVGHWDOOHVGHODVGHPiV]DSDWDV
3DUDHOWUD]RXWLOL]DUHOUDSLGyJUDIR 0.3 mm para las varillas, para las texturas 0.1
0.2 mm y para indicar el volumen de concreto afectado por el corte, con grosores
0.3 0.5 mm.

2EVHUYHTXHHQHOSODQRGHFLPHQWDFLyQ de la planta baja, se indica dynde


se ubiFDUiQODV]DSDWDV\TXpWLSRHVFDGDXQD

Es importante mencionar que todas las especificaciones WpFQLFDVGHORVFLPLHQWRV\


columnas, como el tipo de hierro a utilizar y la SURSRUFLyQGHODPH]FODGH concreto, son en
EDVHDXQFiOFXOR realizado por un especialista en la rama de estructuras.

6.3 Plano de losa tradicional y prefabricada

(VWRV SODQRV VRQ ORV TXH PXHVWUDQ LQIRUPDFLyQ DFHUFD GH TXp WLSR GH FXELHUWD \
HQWUHSLVR VH XWLOL]DUi HQ HO SUR\HFWR \D VHD ORVD GH DUPDGR WUDGLFLRQDO R FRQ HOHPHQWRV
prefabricados, siendo la losa prefabricada PiV UiSLGD HQ su construccLyQ \ FRQ
FDUDFWHUtVWLFDVWHUPRDF~VWLFDV

6.3.1 Armado de losa tradicional

201


Veamos ahora un corte de losa tradicional

Las distancias entre varillas HVWDUiQLQGLFDGDs en la planta de losa. Esta distancia lo


GHWHUPLQDXQFiOFXORHVWUXFWXUDO(QHVWHFDVROas tensiones, rieles y bastones HVWiQ#
Mts.

El largo de los bastones WHQGUiXQDORQJLWXGGHGHODOX]DFXEULU\HOGREOH]GH


ODWHQVLyQVHUiGHXQ5. Ejemplo:

Los bastones, rieles y tensiones se colocan a una determinada distancia, en ambos


VHQWLGRV GH OD ORVD 6REUH HO PDFKRWH GHO SUR\HFWR VH WUD]D OD VLPERORJtD GH OD ILJXUD
DQWHULRU\VHDFRWDHOODUJRGHORVEDVWRQHV\HOGREOH]GHODVWHQVLRQHVDVtFRPRWDPELpQD
TXp GLVWDQFLD VH FRORFDUiQ 9eamos el armado en los planos E5 y E6: Armado de losa
tradicional.

202


207


208


Recomendaciones al momento de trazar los planos de armado de losa tradicional

Se utilizan refuerzos por temperatura HQ iUHDV SHTXHxDV D FXEULU IRUPDQGR XQD
parrilla en un sentido
Trazar las varillas utilizando rap. 0.5 mm.
En lD SODQWD GH ORVD VH GHEHUi LQGLFDU SRU Gynde pDVDQ YLJDV \ D TXp tipo
pertenece $O LJXDO TXH ODV FROXPQDV pVWDV VH SXHGHQ LGHQWLILFDU FRQ XQ Q~PHUR R
letra; V-1, V-y9-A, V-B, etc. 8WLOL]DUUDSLGyJUDIRPP<DVKXUDGRFRQPPR
OiSL]
&RORFDUWRGDODLQIRUPDFLyQEULQGDGDHQHOSODQR$UPDGRGHORVDWUDGLFLRQDO

6.3.2 Armado de losa prefabricada

Existen en el mercado viguetas y bovedillas de diferentes dimensiones. Al momento de


UHDOL]DU OD PRGXODFLyQ R DUPDGR GH OD ORVD SUHIDEULFDGD VH GHEHUi FRQRFHU ODV
dimensiones de estos elementos. Para el proyecto de la vivienda que se ha venido
mostrando, se utilizan viguetas de 0.15 Mts. De ancho y bovedillas de 0.52 Mts., y
profundidad de 0.20 Mts. Con estas medidas se ha modulado la losa final o cubierta.

209


210


215


216


Al momento de reDOL]DUODPRGXODFLyQGHODORVD VHSDUWLUiVLHPSUHHQHOVHQWLGRPiV


largo. Ver plano: Armado de losa prefabricada. ObVHUYHTXHGRQGHH[LVWHQYDQRVpstos se
cierran y se ashura R HQWLQWD HO iUHD LQGLFDQGR TXH por arriba SDVDUi OD VROHUD FRURQD R
solera final. 9HUVLPERORJtDHQKRMD1R( 

Por lo general, se necesitan remates finales DOILQDOGHOPRGXODGR\DTXHTXHGDUiQ


ciertos espacios. Para ello VH UHDOL]DQ GHWDOOHV  GH FyPR VH DQFODUiQ R WHUPLQDUi OD
PRGXODFLyQ HQ FLHUWR SXQWR. En la planta (Ver planos E8 y E9: Armado de losa
prefabricada VHLQGLFDHOQ~PHURGHOGHWDOOH9HDPRVDKRUDFymo debe quedar el trazo
GHFDGDGHWDOOH\ODLQIRUPDFLyQPtQLPDTXHGHEHOOHYDUFDGDXQR (Ver plano E11: Detalle
de remates).

7RGRVHVWRVGHWDOOHVVHGHEHUiQWUD]DUDHVFDOD:10, en el espacio libre que queda


GHOODGRGHUHFKRGHODVSODQWDVGHOSODQRPDFKRWHDVt FRPR HOFXDGURGHODVLPERORJtD
utilizada.

1.1 Detalle de vigas

Las vigas son elementos estructurales de forma rectangular hechos de concreto y


varillas corrugadas. Al igual que los PXURV GH FDUJD \ ODV FROXPQDV pstas reciben
determinado peso que transmite la losa. Cada una transmite estas cargas hacia sus
extremos, en los cuales, se cRORFDQFROXPQDVSULQFLSDOHV\pVWDV~OWLPDVdescargan el peso
a cada zapata, para luego, terminar al suelo.

Las vigas son utilizadas en espacios abiertos o espacios donde no existan muros de
FDUJDRDOJ~QRWURHOHPHQWR de apoyo. Ejemplo:

Vista Frontal
352<(&&,1,620eTRICA
DETALLE DE VIGA DE CONCRETO ARMADO

221


([LVWHQGRVWLSRGHDUPDGRGHYLJDVODSULPHUDXWLOL]DXQDWHQVLyQFRPRORPXHVWUD
la figura anterior, y la otra utiliza bastRQHV \ ULHOHV (VWH DUPDGR OR GHFLGLUi HO SURIHVLRQDO
HQFDUJDGRGHOFiOFXORHVWUXFWXUDO

En la planta (Plano de armado de losa) se indica por donde pasan vigas de


FRQFUHWR \ D TXp WLSR GH YLJD SHUWHQHFH FDGD XQD $O PRPHQWR GH WUD]DU Oas diferentes
vigas, se utilizan dos distintas escalas en el mismo dibujo, una escala para los trazos
horizontales y otra para los trazos verticales. Esto se realiza para ocupar menos espacio
DFRUWDQGR OD YLJD HQ VX ORQJLWXG 3DUD HOOR VH XWLOL]DUi XQD HVFala horizontal menor a la
HVFDOD YHUWLFDO YLpQGRVH HO WUD]R GHO GLbujo, desproporcionado. Ver plano E13: Detalle de
viga.
El detalle de la viga V-1 VH WUD]y FRQ XQD HVFDOD KRUL]RQWDO  \ D HVFDOD YHUWLFDO
(VWDVHVFDODVVRQODVPiVXWLOL]DGDVDOmomento de dibujar el detalle de una viga. Para
FDGDYLJDVHGHEHUiUHDOL]DUXQDVHFFLyQFRPRPtQLPRFRQHOILQGHGDULQIRUPDFLyQGHO
DOWR\DQFKRGHODYLJD$ODOWRGHODYLJDVHOHFRQRFHWDPELpQFRPRSHUDOWH/DVHFFLyQ
VHGHEHUi realizar a escala 1:10.

222


Recomendaciones al momento de trazar el plano de detalle de vigas

2EVHUYH TXH WDQWR OD SUR\HFFLyQ IURQWDO FRPR OD VHFFLyQ de la viga HVWiQ
WUD]DGDVFRQOtQHDV de grosor fino.
Para el contorno de ambas proyecciones VHXWLOL]DXQDOtQHDGHJURVRUGH 0.4
0.5 mm. Para los hierros corridos, se pueden rHOOHQDU ORV GLiPHWURV R utilizar
un grosor GHOtQHD de 0.3 - 0.4 mm.
Aplicar textura de concreto
7UD]DU OR KLHUURV FRQ GREOH OtQHD R OtQHD VyOLGD WUD]iQGRORV D HVFDOD VHJ~Q
GLiPHWURLQGLFDGR
&DGDGREOH]GHKLHUURVHGHEHUiWUD]DUFXUYR
5RWXODUHOWLSRGHYLJD\VHFFLyQ\ODHVFDODDODTXHHVWiQGLEXMDGDV
5RWXODUWRGDODLQIRUPDFLyQEULQGDGDHQHl plano de detalle de vigas
2EVHUYHTXHFDGDYLJDSDVDSRUGRV DSR\RV RYDULRVHMHV(VWRVVHGHEHUiQ
LQGLFDQHQHOGHWDOOHSDUDXQDPHMRULQWHUSUHWDFLyQ

1.2 Cortes de muros

Para mostrar los detalles constructivos de los muros se realizan cortes en muros WtSLFRV
RLPSRUWDQWHVLQGLFDGRVHQODSODQWDGHFLPHQWDFLyQ\ columnas6HOHGHEHUiEULQGDUDO
contrDWLVWDHVWRVGHWDOOHVSDUDTXHpl mismo interprete correctamente las diferentes alturas
del proyecto.

5HFRPHQGDFLRQHVHLQIRUPDFLyQTXHGHEHUiFRQWHQHU los cortes de muro

,QIRUPDFLyQ FRPR HO Q~PHUR GH KLODGDV GH EORFN R ODGULOOR HOHPHQWRV
horizontales como soleras, refXHU]RV\WLSRVGHYDULOODVTXHpVWRVSRVHHUiQGHWDOOH
del cimiento corrido, indicando dimensiones y tipos de hierro.
Al momento de trazar los cortes GHPXURVHGHEHFRQRFHUTXp DOWXUDVHOHGDUi
a cada block, si es y0WV\GHMDUXQDVisa entre cada block de 1 cm.
(Q FDGD FRUWH VH GHEHUi DFRWDU OD DOWXUD GH FDGD KLODGD \ OD DOWXUD GH FDGD
solera y las alturas totales de piso a cielo, grosores de losa, y piso, hasta llegar a
ODORVDILQDORWHFKR&DGDFRUWHVHGHEHUiVHUWUD]DGRDHVFDOD:12.5. Veamos
DFRQWLQXDFLyQFymo se representan los cortes de muro indicados en la planta.
Ver planos E17 E19: Cortes de muro.

Se recomienda utilizaUUDSLGygrafos finos para trazar todos los detalles del corte.
&RPRHVXQDVHFFLyQODs partes afectadas por el corte, como cimientos, soleras,
losas y techos, VHOHVDSOLFDUiWLQWDFRQOtQHDVGHJURVRUPP

$SOLFDU UDSLGyJUDIR  PP D las hiladas de block. Las sisas se les aplica un
JURVRUGHOtQHDGHPPROiSL]

231


232


1.3 Plano de detalle de gradas

5HFRPHQGDFLRQHVHLQIRUPDFLyQPtQLPDTXHGHEHUiFRQWHQHUHOGHWalle de gradas

(Q XQ SODQR DSDUWH VH WUD]DQ ORV GHWDOOHV GHO DUPDGR TXH OOHYDUi HO PyGXOR GH
gradas, que comunica DPERVQLYHOHVGHOSUR\HFWR(QpVWH VHGHEHUiGLEXMDUFRPR
PtQLPROD SODQWD\XQDRGRVVHFFLRQHVeVWDV~OWLPDV QRVLQGLFDUiQHl armado de los
tramos. Ver plano E19: Detalle de gradas.
2EVHUYHTXHHQODSODQWDVHFRORFDQORVHMHVGHORVPXURVGRQGHVHXELFDHOPyGXOR
de gradas.
6H GHEHUi DFRWDU WRGDV ODV GLPHQVLRQHV GH ODV JUDGDV DQFKR GH WUDPRV
dimensiones del descanso y medidas de las huHOODV 3DUD XQD PHMRU LQWHUSUHWDFLyQ
VHHQXPHUDFDGDFRQWUDKXHOODGHODSULPHUDKDVWDOD~OWLPD
([LVWHQGLIHUHQWHVDUPDGRVeVWRVGHSHQGHQGHXQFiOFXORHVWUXFWXUDO (OPyGXORGH
gradas SRGUiLUDPDUUDGRDXQDVROHUDGHDPDUUHRDXQFLPLHQWR
En un detalle de gradas VHGHEHUiLQGLFDUHOQ~PHURGHYDULOODV\VXVGLVWDQFLDVDVt
FRPR WDPELpQ VH GHEHUi DFRWDU DOWXUDV GH SLVR D SLVR GHO GHVFDQVR \ pste a piso
del segundo nivel, alturas de contrahuellas e indicar los niveles de piso del primer
nivel, del descanso y del segundo nivel.

Detalle de gradas que van hacia el nivel del servicio sanitario ubicado por debajo
del descanso. (Q RFDVLRQHV KDEUi TXH UHDOL]DU GHWDOOHV FRQVWUXFWLYRV GH FLHUWRV HOHPHQWRV
DUTXLWHFWyQLFRV GHO SUR\HFWR eVWRV VH GHEHUiQ UHDOL]DU FRQ XQD DGHFXDGD H[SUHVLyQ
JUiILFDHLQIRUPDFLyQVXILFLHQWH9HUHMHPSORDFRQWLQXDFLyQ\HQSODQR(

237


238


1.4 &DMHWtQ

(O FDMHWtQ HV XQ URWXOR GH LGHQWLILFDFLyQ HO FXDO FRQWLHQH WRGD OD LQIRUPDFLyQ GH OD
empresa o personas ejecutantes del proyecto.

/DV GLPHQVLRQHV YDUtDQ \ FDVL VLHPSUH VRQ D FULWHULR GH OD HPSUHVD X RILFLQD GH
GLEXMRVLHPSUH\FXDQGROOHYHQFRPRPtQLPRODLQIRUPDFLyQTXHVHSUHVHQWDHQHVWRVGRV
ejemplos. Las iniciales, U, A, E, I, significan el tipo de plano, si es urbanismo, arquitectura,
estructuras e instalaciones.

241


PROPUESTA DE EJERCICIOS
DURANTE EL DESARROLLO
DEL CURSO

242


EJERCICIOS DE REPASO DEL USO DE ESCALAS Y VISTAS PRINCIPALES Y SECCIONES DE UN


OBJETO
EJERCICIO No. 1

7tWXOR
Rotulado

Materiales
5DSLGyJUDIRVVREUHIRUPDWRGHSDSHOPDQWHTXLOODRFDOFRWDPDxR$

Procedimiento
'LYLGLUHOiUHD~WLOHQSDUWHVLJXDOHVGHMDQGRXQHVSDFLRGHFPentre cada cuadrante y
WUD]DUFRQOtQHDVJXtDVUHQJORQHV\HQHOSULPHUFXDGUDQWHSRVWHULRUPHQWHUHDOLFHHO
DEHFHGDULR\Q~PHURVGHFPVGHDOWR(QHOVHJXQGRFXDGUDQWHURWXODGRGHFPGH
DOWR \ VHSDUDFLyQ GH  HQ HO WHUFHUR URWXODGR GH  FPV GH DOWR \ VHSDUDFLyQ GH 
FPV\SRU~OWLPRURWXODGRGHFPVGHDOWR\VHSDUDFLyQGHFPVFRPRORPXHVWUDHO
ejercicio No. 1.

EJERCICIO No.2

7tWXOR
Escalas

7pFQLFD
7LQWDVREUHIRUPDWRGHSDSHOPDQWHTXLOODRFDOFRWDPDxR$

Procedimiento
Represente 5 metros lineales o cualquier medida, en 10 escalas diferentes. Acote cuanto
UHSUHVHQWDHQFPV\DVKXUHHOiUHDFRPRORPXHVWUDHOHMHPSOR8WLOLFHHVFDODVFRPXQHV\
poco comunes.

EJERCICIO No. 3

7tWXOR
Escalas

7pFQLFD
Tinta sobrHIRUPDWRGHSDSHOPDQWHTXLOODRFDOFRWDPDxR$

Procedimiento
7UDFHXQKH[iJRQRLQVFULWRGHQWURGHXQFtUFXORGHUDGLR 0WVHQWUHVHVFDODVGLIHUHQWHV
3RVWHULRUPHQWHWUDFHXQHQHiJRQRLQVFULWRGHQWURGHXQFtUFXORGHGLiPHWUR 0WV8WLOLFH
treVJURVRUHVGHOtQHDFRPRORPXHVWUDHOHMHPSOR

243


244


245


246


247


248


249


250


EJERCICIO No. 4

7tWXOR
Escala y vistas principales de un objeto

7pFQLFD
7LQWDVREUHIRUPDWRGHSDSHOPDQWHTXLOODRFDOFRWDPDxR$

Procedimiento
Dado el trazo de la figura en dos escalas diferentes, extraiga sus medidas haciendo uso del
HVFDOLPHWUR \ WUiFHOD GHQWUR GHO IRUPDWR D GRV HVFDODV GLIHUHQWHV D OD GHO HMHPSOR
seguidamente, realice en otro formato sus tres vistas principales.

EJERCICIO No. 5

7tWXOR
Vista principales de un objeto

7pFQLFD
7LQWDVREUHIRUPDWRGHSDSHOPDQWHTXLOODRFDOFRWDPDxR$

Procedimiento
'DGD OD ILJXUD WUDFH VXV YLVWDV SULQFLSDOHV D HVFDOD  \ VX SUR\HFFLyQ LVRPpWULFD a una
escala a criterio. Resuelva la proyecFLyQODWHUDOGHUHFKD

251


252


253


254


255


256


FASE 1: PLANOS DE ARQUITECTURA


EJERCICIO No. 6

7tWXOR
Planos de registro

7pFQLFD
7LQWDVREUHIRUPDWRGHSDSHOPDQWHTXLOODRFDOFRWDPDxRRILFLR

Procedimiento
7UD]DU HO SODQR GH ORFDOL]DFLyQ \ XELFDFLyQ \ URWXODU ORV GDWRV TXH FRQOOHYD FDGD XQo de
HOORV (Q HO SODQR GH ORFDOL]DFLyQ GLEXMDU XQ WHUUHQR FRQ GLPHQVLRQHV GH  ;  0WV /D
QRPHQFODWXUDXUEDQD\HOQRUWHORLQGLFDUiHOSURIHVRU

EJERCICIO No. 7, 8 y 9

7tWXOR
6LPERORJtDVPRELOLDULR\HTXLSR

7pFQLFD
Tinta sobre formato de papel mDQWHTXLOODRFDOFRWDPDxR$

Procedimiento
5HDOLFH OD VLPERORJtD PiV FRP~Q XWLOL]DGD HQ ORV SODQRV SDUD UHSUHVHQWDU YHJHWDFLyQ
'HEHUiWUD]DUHQXQIRUPDWR$WLSRVGHYHJHWDFLyQHQSODQWDXWLOL]DQGRODVGLPHQVLRQHV
que se le presentan en el ejemplo, DORODUJR\DQFKRGHODPLWDGGHOiUHD~WLOGHOIRUPDWR
(QHOUHVWRGH HVSDFLRUHDOL]DU GHIRUPDOLEUHFRPELQDFLRQHVGHYHJHWDFLyQ\VLPERORJtD
de grama, piedras, etc., con el fin de representar jardines.
En un formato A2, dibujar de 8 WLSRVGHirboles proyectados HQHOHYDFLyQ

En un formato A2, trazar las tres vistas principales del mobiliario que se utiliza en cada
ambiente que comprende una vivienda, camas, inodoro, lavamanos, estufa, etc., y
WUiFHORVDHVFDOD

EJERCICIO No. 10 y 11

TtWXOR
Texturas

7pFQLFD
7LQWDVREUHIRUPDWRGHSDSHOPDQWHTXLOODRFDOFRWDPDxR$

257


258


259


260


261


262


263


264


Procedimiento
5HSUHVHQWH D WUDYpV GH OD VLPERORJtD GH WH[WXUDV PXURV GH EORFN ODGULOOR \ DFDEDGR GH
cernido vertical, asiPLVPRWH[WXUDVGHSLHGUDODMDEROD\GRVWLSRVGHVLPERORJtDGHWLHUUD
Trace los recuadros y la escala de los muros, con las medidas indicadas en el ejercicio No.
10.

En un formato A2, trace 6 tipos de texturas diferentes a las del ejercicio anterior.

EJERCICIO No. 12

7tWXOR
El plano matriz

7pFQLFD
7LQWDVREUHIRUPDWRGHSDSHOPDQWHTXLOODRFDOFRWDPDxR$

Procedimiento
Trazar el plano matriz de la vivienda que se le presenta, a escala 1:50. Dentro del proyecto,
existen muros de 0.10 Mts., VLHQGRODPD\RUtDGH0WVGHDQFKR

EJERCICIO No. 13

7tWXOR
Planta amueblada

7pFQLFD
7LQWDVREUHIRUPDWRGHSDSHOPDQWHTXLOODRFDOFRWDPDxR$

Procedimiento
Realizar una copia al plano machote, y sobre este, trazar el mobiliario de cada ambiente. El
SODQRGHEHUiFRQWHQHUODLQIRUPDFLyQPtQLPDTXHGHEHOOHYDUXQSODQRDPREODGR

EJERCICIO No. 13

7tWXOR
Planta acotada

7pFQLFD
7LQWDVREUHIRUPDWRGHSDSHOPDQWHTXLOODRFDOFRWDPDxR$

Procedimiento
Realizar una copia al plano machote, y sobre este, acotar el proyecto siguiendo los niveles
GHDFRWDFLyQ5HFXHUGHTXHVLXQDFRWDVHUHSLWDHQDPERVODGRVSRGUiRPLWLUVH

265


266


EJERCICIO No. 15

7tWXOR
Elevaciones

7pFQLFD
7LQWDVREUHIRUPDWRGHSDSHOPDQWHTXLOODRFDOFRWDPDxR$

Procedimiento
Termine el trazo de la elHYDFLyQ SULQFLSDO R IURQWDO FRQ WRGD OD LQIRUPDFLyQ PtQLPD TXH
debe llevar, a escala 1:50.

'LEXMDUODHOHYDFLyQWUDVHUDRSRVWHULRU

EJERCICIO No. 16

7tWXOR
Secciones

7pFQLFD
7LQWDVREUHIRUPDWRGHSDSHOPDQWHTXLOODRFDOFRWDPDxR$

Procedimiento
TrDFHORVFRUWHVTXHVHOHSUHVHQWDQDHVFDODHLGHQWLILTXHSRUGRQGHSDVDODOtQHDGH
corte de cada uno, en la planta amueblada o en la planta acotada.

Realice un segundo FRUWHORQJLWXGLQDODOSUR\HFWR\WUiFHOR

EJERCICIO No. 17

7tWXOR
Planta de acabados

7pFQLFD
7LQWDVREUHIRUPDWRGHSDSHOPDQWHTXLOODRFDOFRWDPDxR$

Procedimiento
Sobre la copia del plano matriz realice la planta de los diferentes acabados finales que
SRVHHUi HO SUR\HFWR DVt FRPR WDPELpQ VX UHVSHFWLYR FXDGUR LQGLFDQGR HO VLgnificado de
FDGDVLPERORJtD 6LH[LVWLHUHYHQWDQDVRSXHUWDVFRQXQGHWDOOHHVSHFLDOVHGHEHUiUHDOL]DU
un plano aparte, indicando detalles de cada uno, como tipo de chapa, dimensiones,
materiales, etc.

279


280


358(%$7(5,&$)$6(

1. &XiOHVHORULJHQGHORVIRUPDWRV"

2. Grafique el doblez de un formato A1.

3. 4XpVLJQLILFDFXDQGRGHFLPRVTXHXQREMHWRHVWiGLEXMDGRDHVFDOD"

4. $TXHQRVUHIHULPRVFXDQGRGHFLPRVTXHXQREMHWRHVWiWUD]DGRFRQXQD
SUR\HFFLyQLVRPpWULFD"

5. Mencione el nombre que se le da a cada una de las 6 vistas de un objeto.

6. 'HTXpSODQRVHVWiFRPSXHVWD la fase de arquitectura?

7. &XiOHVODLQIRUPDFLyQTXHQRVEULQGDQORVSODQRVGHDUTXLWHFWXUDHQXQSUR\HFWR"

8. 0HQFLRQHFXiles son ORVQLYHOHVGHDFRWDFLyQ\TXp elementos del proyecto acota


cada nivel.

9. Grafique la distriEXFLyQWtSLFDGHXQVHUYLFLRVDQLWDULR

10. 'LEXMHDPDQRDO]DGDODVGLPHQVLRQHVHVWiQGDUTXHFRPSRQHXQPRELOLDULRGH
sala

&XDGURGHHYDOXDFLyQ

No. CONTENIDO VALOR


01 Ejercicios de rotulado y escalas 05
02 Vistas principales de un objeto 05
03 6LPERORJtDGHYHJHWDFLyQ 2.5
04 6LPERORJtDGHPRELOLDULR 05
05 Texturas 2.5
06 3ODQRGHXELFDFLyQ\ORFDOL]DFLyQ 05
07 Plano matriz 10
08 Planta amueblada 20
09 Planta acotada 15
10 Planta de acabados 10
11 Elevaciones 10

291


12 Secciones 10
13 Total 100 /20%
14 3UXHEDWHyULFD 100 /10%

FASE 2: PLANOS DE INSTALACIONES

EJERCICIO No. 18

7tWXOR
3ODQWDGHLQVWDODFLyQGHDJXDSRWDEOH

7pFQLFD
Tinta sobre formato de SDSHOPDQWHTXLOODRFDOFRWDPDxR$

Procedimiento
SobUHODFRSLDGHOSODQRPDWUL]UHDOLFHFRQD\XGDGHOSURIHVRUODSURSXHVWDGHLQVWDODFLyQ
GHDJXDSRWDEOHeVWHGHEHUiOOHYDUWRGDODLQIRUPDFLyQPtQLPDUHTXHULGD

Dentro del mismo formato trace el cuDGUR GH VLPERORJtD FRQ XQ URWXODGR GH DOWXUD
FRQVLGHUDEOH DVt FRPR WDPELpQ OD SUR\HFFLyQ LVRPpWULFD GH WRGR HO FLUFXLWR FRn toda la
LQIRUPDFLyQQHFHVDULDSDUDHOORutilice una escala a criterio.

EJERCICIO No. 19

7tWXOR
3ODQWDGHLQVWDODFLyQGHGUHQDMHs

7pFQLFD
7LQWDVREUHIRUPDWRGHSDSHOPDQWHTXLOODRFDOFRWDPDxR$

Procedimiento
Sobre la copia del plano matriz trace la instDODFLyQ GH OD UHG GH GUHQDMHV eVWH GHEHUi
FRQWHQHU WRGD OD LQIRUPDFLyQ PtQLPD UHTXHULGD Resuelva las instalaciones de los servicios
sanitarios faltantes.

Dentro del mismo formato WUDFHHOFXDGURGHVLPERORJtD\HOGHWDOOHGHFDMDVDHVFDOD

292


EJERCICIO No. 20

7tWXOR
PlanWDGHLQVWDODFLyQHOpFWULFD ,OXPLQDFLyQ

7pFQLFD
7LQWDVREUHIRUPDWRGHSDSHOPDQWHTXLOODRFDOFRWDPDxR$

Procedimiento
Sobre la copia del plano matriz WUDFH OD LQVWDODFLyQ GH ODV OXPLQDULDV HO HQWXEDGR
alambrado y los diferentes interruptores que PDQLSXODUiQ FDGD XQLGDG 5HDOLFH HO
entubado y alambrado del circuito faltante.

Dentro del mismo formato WUDFHHOFXDGURGHVLPERORJtD

EJERCICIO No. 21

7tWXOR
3ODQWDGHLQVWDODFLyQHOpFWULFD )XHU]D

7pFQLFD
Tinta sobre formato de papel mantequilla o FDOFRWDPDxR$

Procedimiento
Sobre la copia del plano matriz WUDFH OD LQVWDODFLyQ GH ODV WRPDV GH FRUULHQWH HOpFWULFD HO
HQWXEDGR\DODPEUDGRGHFDGDFLUFXLWR5HDOLFHODLQVWDODFLyQGHWRPDVIDOWDQWHV

Dentro del mismo formato trace el cuadro de simbRORJtD

358(%$7(5,&$)$6(

1. &XiOHVVRQORVSODQRVTXHFRPSRQHQODIDVHGHLQVWDODFLRQHVGHXQSUR\HFWR"

2. &XiO HV OD LQIRUPDFLyQ PtQLPD TXH GHEH OOHYDU XQ SODQR GH LQVWDODFLyQ GH DJXD
potable?

3. 4XpVLJQLILFDQODVVLJODV39&\&39&"

4. &XiOHVODIXQFLyQGHXQWDEOHURGHFLUFXLWRVHQXQDYLYLHQGD"

5. &XiO HV OD UD]yQ SRU OD TXH VH XWLOL]D XQ UHOOHQR PD\RU HQ HO iUHD GH VHUYLFLRV
sanitarios del segundo nivel?

299


300


6. &XiOHVODSHQGLHQWHTXHGHEHOOHYDUXQWXERTXHFRQGXFHHODJXDSOXYLDO"

7. 6L OD SHQGLHQWH GH XQ WXER GH DJXDV QHJUDV HV GHO   &XiQWRV FHQWtPHWURV YD
EDMDQGRHOWXERSRUFDGDPHWUROLQHDOGHWXEHUtD"(VFULEDy grafique su respuesta.

8. Explique con sus propiaV SDODEUDV OD UD]yQ SRU OD TXH OD LQVWDODFLyQ GH WXEHUtD GH
GUHQDMHVHQXQVHJXQGR\PiVQLYHOHVHVGLVWLQWDDOSULPHUSLVR

9. Grafique el alambrado de un sistema three way.

FASE 2: PLANOS DE INSTALACIONES

No. CONTENIDO VALOR


01 Plano de agua potable 15
02 ,VRPpWULFRGHLQVWDODFLyQ\GHWDOOHGH 20
cisterna
03 Plano de drenajes de agua negra y pluvial 20
04 Detalle de cajas 15
05 Planta de techos 10
06 3ODQRGHLQVWDODFLyQHOpFWULFDGH 10
LOXPLQDFLyQ
07 3ODQRGHLQVWDODFLyQHOpFWULFDGHIXHU]D 10
13 Total 100 /10%
14 3UXHEDWHyULFD 100 /05%

EJERCICIO No. 22

7tWXOR
3ODQWDGHFLPHQWDFLyQ\FROXPQDV

7pFQLFD
Tinta sobre formato de papeOPDQWHTXLOODRFDOFRWDPDxR$

Procedimiento
Sobre la copia del plano matriz WUDFH OD FLPHQWDFLyQ \ ODV FROXPQDV GHO SUR\HFWR 'LEXMH
WRGD OD LQIRUPDFLyQ UHTXHULGD \ UHDOLFH HO GHWDOOH GH FROXPQDV FLPHQWDFLyQ \ ]DSDWDV
dentro del mismo formato o en otro, a escala 1:10. Resolver la zapata y columnas faltantes.

Dentro del mismo formato WUDFHHOFXDGURGHVLPERORJtD 'HEHUiUHVROYHUFRQDVHVRUtDGHO


SURIHVRUHOUHVWRGHGLVWULEXFLyQGHFROXPQDVFDUHQWHVGHQWURGHOSUR\HFWR

309


310


EJERCICIO No. 23

7tWXOR
Cortes de muro

7pFQLFD
7LQWDVREUHIRUPDWRGHSDSHOPDQWHTXLOODRFDOFRWDPDxR$

Procedimiento
Trazar los cortes de muro que se le presentan, e identificarlos en la planta de cimentaFLyQ
DGHPiVUHDOLFHWUHVVHFFLRQHVPiVHLGHQWLItTXHODVHQODVSODQWas. 7RGRORGHEHUiGLEXMDUD
escala 1:12.5

EJERCICIO No. 24

7tWXOR
Armado de losas

7pFQLFD
7LQWDVREUHIRUPDWRGHSDSHOPDQWHTXLOODRFDOFRWDPDxR$

Procedimiento
Sobre la copia del plano matriz trace el armado de losa tradicional y sobre otro machote,
trace el armado con losa prefabricada. Dentro del mismo formato dibuje detalles y cuadro
GHVLPERORJtD\QRWDV'HEHUiUHDOL]DUHODUPDGRHQORVDVTXHKDFHQIDOWD

EJERCICIO No. 25

7tWXOR
Detalle de vigas

7pFQLFD
Tinta sobre formato de papel manteqXLOODRFDOFRWDPDxR$

Procedimiento
Realice el trazo de los detalles de cada viga indicadas en la planta de losas. Realice el
armado y trazo de la viga V-5. Utilice una escala vertical y una escala horizontal distinta.

319


EJERCICIO No. 26

7tWXOR
Detalle de gradas

7pFQLFD
7LQWDVREUHIRUPDWRGHSDSHOPDQWHTXLOODRFDOFRWDPDxR$

Procedimiento
5HDOLFHHOWUD]RGHOGHWDOOHGHODUPDGRGHJUDGDV5RWXOHWRGDODLQIRUPDFLyQPtQLPDTXH
debe llevar un detalle de gradas.

358(%$7(5,&$)$6(

1. &XiOHV son los planos que componen la fase de estructuras de un proyecto?

2. 4XpLQIRUPDFLyQQRVEULQGDORVSODQRVGHHVWUXFWXUDV"

3. 'HTXp HVWiFRPSXHVWD la mezcla de concreto?

4. &XiOHVODIXQFLyQSULQFLSDOGHODV]DSDWDVHQXQDFRQVWUXFFLyQ"

5. &XiOHVODIXQFLyQSULQFLSDOGHODVVROHUDVHQXQDFRQVWUXFFLyQ"

6. 'LEXMH ODUHSUHVHQWDFLyQGHOGHWDOOHGHXQDFROXPQDGH;0WV \FRQ

7. &XiOHVHOVtPERORTXH VHXWLOL]DSDUDLQGLFDUTXHODVYDULOODVLUiQFRORFDGDVHQ
ambos sentidos?

8. Grafique el levantado de soga de un muro de ladrillo.

9. &XiOHVVRQODVSDUWHVGHXQDHVFDOHUD"

10. &XiOHVODGLIHUHQFLDHQWUHXQDORVDWUDGLFLRQDO\XQDORVDSUHIDEULFDGD"

11. 'HVFULEDHOQ~PHURGHRFWDYRVTXHSRVHHFD

320


&XDGURGHHYDOXDFLyQ

No. CONTENIDO VALOR


06 3ODQRGHFLPHQWDFLyQ\FROXPQDV 20
07 'HWDOOHVGHFLPHQWDFLyQ\FROXPQDV 10
08 Planta de armado de losa tradicional 15
09 Planta de armado de losa prefabricada 15
09 Detalles constructivos 10
10 Detalle de vigas 15
Cortes de muro 10
Detalle de armado de gradas 05
12 Total 100 /20%
13 3UXHEDWHyULFD 100 /10%

(;3/,&$&,1'(/352<(&72),1$/

(OSURIHVRUEULQGDUi al estudiante el plano matriz de una vivienda de un nivel, sobre


ODFXDOHOHVWXGLDQWHGHEHUiUHDOL]DUHOWUD]R\ODLQIRUPDFLyQPtQLPDUHTXHULGDGHORTXH
comprenden los planos de estructuras del proyecto, bajo los mismos conceptos adquiridos
durante el desarrollo del curso.
(OGRFHQWHEULQGDUiDVHVRUtDSHUVRQDOL]DGDDOHVWXGLDQWHGXUDQWHHOGHVDUUROORGHORV
diferentes planos constructivos.

&XDGURGHHYDOXDFLyQ

No. Contenido VALOR


01 3ODQWDGHFLPHQWDFLyQ 25
02 'HWDOOHVGHFLPHQWDFLyQ 10
03 Detalles de columnas 10
04 Planta de armado de losa 25
05 Detalles y vigas 10
06 Detalle de gradas 10
07 3UHVHQWDFLyQ 10

329


330


CONCLUSIONES

El dibujo constructivo es el medio, por el que todo ingeniero y proyectista


FRPXQLFDLGHDVHLQIRUPDFLyQVREUHXQGHWHUPLQDGRSUR\HFWRGHFRQVWUXFFLyQ

(O DSUHQGL]DMH WHyULFR \ SUiFWLFR GHO GLEXMR GD FRPR UHVXOWDGR KDELOLGDGHV \
GHVWUH]DV HQ OD FRPXQLFDFLyQ GH LGHDV SDUD SRVWHULRUPHQWH XELFDUODV HQ HO
tiempo y espacio correctamente.

Todo ingeniero TXHWHQJDXQFRQRFLPLHQWRDPSOLRHQHOiUHDGHOGLEXMRHVWDUi


capacitado para determinar o juzgar, si un plano es o no correcto.

Todos los tipos, dimensiones y dobleces de los formatos establecidos en este


documento son en base a las normas del Instituto Centroamericano de
LQYHVWLJDFLyQ 7HFQROyJLFD ,QGXVWULDO ,&$,7, , lo cual, el conocimiento y la
DSOLFDFLyQGHHVWRVXELFDDOHVWXGLDQWHGHLQJHQLHUtDHQXQPDUFROHJDO

El acotado y rotulado son el alma de cualquier dibujo constructivo, ya que si


pstos se trazan de una forma clara \OHJLEOHGDUiQFRPRUHVXOWDGR una correcta
LQWHUSUHWDFLyQ \ HMHFXFLyQ GH OD REUD \ SRU HQGH XQD EXHQD FRPXQLFDFLyQ
entre el proyectista y el contratista.

Es importante la correFWD HMHFXFLyQ H LQWHUSUHWDFLyQ GHO GLEXMR WUDGLFLRQDl o a


PDQR \D TXH D WUDYpV GH pVWH ORJUDPRV DGTXLULU FRQFHSWRV EiVLFRV H
LPSRUWDQWHV GH OD H[SUHVLyQ JUiILFD DOJR TXH HV GLItFLO REWHQHU VL FRPHQ]DPRV
utilizando el dibujo computarizado como herramienta primaria.

$WUDYpVdel dibujo tradicional o a mano obtenemos FRQFHSWRVGHSUHVHQWDFLyQ


como DOWXUDV FRQVLGHUDEOHV GH URWXODGR XVR FRUUHFWR GH JURVRUHV GH OtQHD
FDOLGDGGHOtQHDUHSUHVHQWDFLyQFRUUHFWDGHODVWUHVGLPHQVLRQHVGHXQREMHWR
etc.

331


RECOMENDACIONES

El estudiante GHEHUiUHDOL]DUYDULRVHMHUFLFLRVTXHD\XGHQDTXHDGTXLHUDKDELOLGDG
\ GHVWUH]D SDUD H[SUHVDU VXV LGHDV D WUDYpV GHO XVR GHO GLEXMR FRPR KHUUDPLHQWD
comunicativa.

7RGR SURIHVLRQDO GH OD FRQVWUXFFLyQ GHEHUi WHQHU conocimiento del dibujo, para
TXHHVWpFDSDFLWDGRDOPRPHQWRGHUHDOL]DUDFWLYLGDGHVGHVXSHUYLVLyQ\HMHFXFLyQ
de obra, y asimismo pueda realizar juicios y valores.

El alumno debe adquirir conocimiento en la forma de presentar un proyecto de


FRQVWUXFFLyQ \ VDber los requerimientos mtQLPRV TXH pste conlleva, con el fin de
UHDOL]DUXQDFRUUHFWDSODQLILFDFLyQGHXQDGHWHUPLQDGDREUD

El educando GHEHUi WHQHU XQD FRQWLQXD SUiFWLFD GHO GLEXMR GXUDQWH HO GHVDUrollo
del curso, con el fin de obtener mejores resultadoVHQVXH[SUHVLyQJUiILFD

6H UHFRPLHQGD TXH HO DOXPQR DGTXLHUD SULPHUDPHQWH XQ DSUHQGL]DMH WHyULFR-
SUiFWLFR D WUDYpV GHO GLEXMR D PDQR FRQ HO ILQ GH REWHQHU FRQFHSWRV EiVLFRV \
posteriormente, adquirir habilidades en el dibujo computarizado.

Se reFRPLHQGD HO FDPELR GH HMHUFLFLRV \ QXHYD IRUPXODFLyQ GH SUHJXQWDV HQ ODV
SUXHEDVWHyULFDVHQFDGDVHPHVWUHFRQHOILQGHHYLWDr que los estudiantes utilicen
HMHUFLFLRV\DUHDOL]DGRVSRURWURV\DTXHHVWRHQWRUSHFHVXGHVDUUROORDFDGpPLFR

332


%,%/,2*5$)$

&DVWDxHGD Soledad Alejandra. 0DQXDO GH DSOLFDFLyQ GHO GLEXMR JHRPpWULFR \


WpFQLFRHQOD$UTXLWHFWXUD
Farusac, 2000.

'LFFLRQDULR(QFLFORSpGLFR/DURXVVH,OXVWUDGR
6HJXQGD(GLFLyQ9ROXPHQ\

(QFLFORSHGLD*HQHUDOGHOD(GXFDFLyn

Epsda. Usac. *XtDWpFQLFDSDUDODLQWHUSUHWDFLyQGHSODQRV\HOHPHQWRVEiVLFRVGH


VXSHUYLVLyQ
Imprenta el Milagro, Zacapa. 1998

*DUFtD, William. 0pWRGR3UiFWLFRGHGLEXMRHLQWHUSUHWDFLyQGHSODQRV


(GLWRULDO([SUHVLyQ*UiILFD
Guatemala, C.A.

. 0pWRGR3UiFWLFRGHGLEXMRHLQWHUSUHWDFLyQGHSODQRV
(GLWRULDO([SUHVLyQ*UiILFD
Guatemala, C.A.

*DUFtD *DWLFD , -XDQ \ &DVWLOOR *DUFtD , Manuel. Documentos de apoyo para la


HODERUDFLyQGHOMXHJRGHSODQRV
Usac. Facultad de $UTXLWHFWXUDFXUVRGHSUiFWLFDLQWHJUDGD

Gillet Scheel , Frederick Lawrence. (OHPHQWRVEiVLFRVSDUDHOGLEXMRHQLQJHQLHUtD


Tesis de grado
8VDF)DFXOWDGGH,QJHQLHUtD

Lemus, Luis Arturo. 3HGDJRJtD7HPDVIXQGDPHQWDOHV


Editorial ServiprenVD&HQWURDPHULFDQDUD(GLFLyQ
Guatemala, C.A. 1996

Lemus, Luis Arturo. 3HGDJRJtD 3, Temas fundamentales.


Editorial Kapeluz
Buenos Aires, Argentina. 1994

Luzadder , Warren J. y Duff , John M. ,QWURGXFFLyQDOGLEXMRGHLQJHQLHUtD


&RPSDxtD(GLWRULDO&RQWLQHQWDO6$GH&93ULPHUD(GLFLyQ
0p[LFR

333


0HOOR&DUYDOKR,UHQH(OSURFHVRGLGiFWLFR
Editorial Kapeluz
Buenos Aires, Argentina. 1974

2UWt](VWXUEiQ-XDQ$OEHUWR7pFQLFD&RPSOHPHQWDULD'LEXMRGH,QJHQLHUtD
(GLWRULDOHVWXGLDQWLO)pQL[
8VDF)DFXOWDGGH,QJHQLHUtD

5REOHGR&pVDU$SXQWHVJHQHUDOHVSDUDHOFXUVRGHWpFQLFDVGHLQYHVWLJDFLyQ
'RFXPHQWDO8VDF)DFXOWDGGH&LHQFLDV(FRQyPLFDV

Spencer , Henry Cecil y Dygdon , John Thomas. 'LEXMR7pFQLFR%iVLFR


&RPSDxtD(GLWRULDO &RQWLQHQWDO6$GH&99LJpVLPRWHUFHUDUHLPSUHVLyQ
0p[LFR

)8(17(6(/(&751,&$6

*yPH] $GULDQD 'HOLD 7HRUtDV GHO $SUHQGL]DMH 7HRUtDV GHO $SUHQGL]DMH (Q
OtQHD http://www.monografias.com/trabajos5/teap/teap.shtml#teoapre. Consultado
el 31/01/09

JuntD GH $QGDOXFtD &RQVHMHUtD GH HGXFDFLyQ \ FLHQFLD &RQRFHU OD (YDOXDFLyQ
,GHDV \ &RQFHSWRV %iVLFRV GH OD (YDOXDFLyQ
www.juntadeandalucia.es/averroes/publicaciones/evaluacion/conocer.pdf.
Consultado el 2/02/09

0LMDQJRV5REOHV$QGUHDGHO&DUPHQ8QLYHUVLGDG)UDQFLVFR0DUURTXtQ0pWRGRVGH
HQVHxDQ]D www.monografias.com/trabajos15/metodos-ensenanza/metodos-
ensenanza.shtml#CLASIF. Consultado el 31/01/09

6iQFKH] Alfonso. R., Ileana. Investigador Agregado, *RQ]iOH] 3pUH], Troadio Lino.
Investigador Titular. Cuba. 7HQGHQFLDV 3HGDJyJLFDV &RQWHPSRUiQHDV Tendencias
SHGDJyJLFDV www.monografias.com/trabajos6/tenpe/tenpe3.shtml#teori.
Consultado el 31/01/09

334


335


336


337


338


339


340


341


342


343


344


345


346


347


348


349


350


351