Documenti di Didattica
Documenti di Professioni
Documenti di Cultura
Issued: 10/1997
Version: D
Auto-Reclosure Function
Data subject to change without notice (AR5Func)
Contents
1. Introduction .............................................................................................. 3
1.1 Features.............................................................................................. 3
1.2 Application........................................................................................... 3
1.3 Input description.................................................................................. 5
1.4 Output description ............................................................................... 6
2. Description of Operation.......................................................................... 7
2.1 Configuration....................................................................................... 7
2.1.1 General ...................................................................................... 7
2.1.2 Relay configuration .................................................................... 7
2.1.3 AR shots and final trip function................................................... 8
2.1.4 Shot selection............................................................................. 9
2.1.5 Initiation of auto-reclosing ........................................................ 10
2.1.6 Auto-reclose operation mode control........................................ 10
2.1.7 Auto-reclose shot initiated by a trip signal ................................ 11
2.1.8 Auto-reclose shot initiated by a start signal .............................. 11
2.1.9 Auto-reclose shot blocked by an initiation signal ...................... 11
2.1.10 Circuit breaker position inputs .................................................. 12
2.1.11 Delaying the CLOSE output signal ........................................... 13
2.1.12 Lock-out resetting..................................................................... 13
2.2 Test mode ......................................................................................... 13
2.3 Resetting........................................................................................... 14
2.4 General ............................................................................................. 15
2.4.1 Discriminating time and reclaim time ........................................ 15
2.4.2 Final trip function (6) ................................................................ 15
2.4.3 Lock-out ................................................................................... 15
2.4.4 Interruption of auto-reclosing.................................................... 16
2.4.5 Secured control of the circuit breaker....................................... 16
2.4.6 Circuit breaker supervision logic............................................... 17
2.4.7 Aids to circuit breaker maintenance ......................................... 18
2.4.8 Frequent-operation counter...................................................... 19
2.4.9 ACTIVE .................................................................................... 19
2.4.10 SHOT_ALARM......................................................................... 20
RE_5_ _ AR5Func ABB Automation
4. Technical Data.........................................................................................35
2
ABB Automation AR5Func RE_5_ _
1. Introduction
1.1 Features
1.2 Application
This document specifies the function of the auto-reclose function block AR5Func
used in products based on the RED 500 Platform.
The majority (about 80...85%) of MV overhead line faults are transient and are
automatically cleared by momentarily de-energizing the line, whereas the rest of the
faults (15...20%) can be cleared by longer interruptions. The de-energization of the
fault place for a desired period of time is implemented by auto-reclose relays or
functions. The auto-reclosers are capable of clearing most of the faults. At a
permanent fault, the auto-reclosing is followed by final tripping. A permanent fault
has to be located and cleared before the fault location can be re-energized.
The auto-reclose function AR5Func can be used for auto-reclosing together with any
circuit breaker that has the characteristics required for auto-reclosing. The function
block provides five programmable auto-reclose shots which can perform one to five
successive auto-reclosures of desired type and duration, such as one high-speed and
one delayed auto-reclosure. When the reclosing is initiated by the start of a protection
function, the auto-reclose function is capable of executing the final trip of the circuit
breaker in a short operate time in case the fault still persists when the last reclosure
selected has been carried out.
A typical auto-reclose situation where one auto-reclose shot has been performed after
the fault was detected is illustrated in Figure 1. In case a), the auto-reclose shot is
initiated by a start signal of the protection function after the start delay time has
elapsed, whereas in case b), the auto-reclose shot is initiated by a trip signal of the
protection function. In both cases, the auto-reclose sequence was successful.
3
RE_5_ _ AR5Func ABB Automation
a) Instant of fault
AR1
(Start signal
from protection)
Start delay time
ACTIVE
OPEN
Dead time
CLOSE
Reclaim time
TRDUE
ACTIVE
Dead time
CLOSE
Reclaim time
TRDUE
)LJXUH 6LJQDOVFKHPHLOOXVWUDWLQJWKHDXWRUHFORVHRSHUDWLRQZKHQLQLWLDWHGE\D
VWDUWVLJQDODRUDWULSVLJQDOERIWKHSURWHFWLRQIXQFWLRQ
4
ABB Automation AR5Func RE_5_ _
)LJXUH )XQFWLRQEORFNV\PERORIWKHDXWRUHFORVXUHIXQFWLRQ$5)XQF
5
RE_5_ _ AR5Func ABB Automation
6
ABB Automation AR5Func RE_5_ _
2.1 Configuration
2.1.1 General
The configuration includes a description of the internal and external operation of the
function block. The internal operation is defined by setting the built-in parameters
according to the needs of the application. The parameters can be set either via the
MIMIC or the serial communication. The external operation, i.e. the logical
connection to process data, can be configured in the Relay Configuration Tool
included in the CAP 505 Tool Box.
Because of the virtually boundless configuration, i.e. the possibilities of the Relay
Configuration Tool, there is no single way of building an auto-reclose system with the
AR5Func. The function block is equipped with all the essential functionality and can
be used as such by simply connecting the AR input(s) to a protection function(s) and
the OPEN and CLOSE outputs to the circuit breaker. The needs vary, however, and to
meet the different requirements, the operation of the AR5Func can be adjusted e.g.
with a few external components as presented in Figure 4 below.
25
&%B75,3
12&/2:
,/ 67$57
25 $5)XQF
,/ 75, 3 $5 23( 1
&%23(1 6+27
&%&/26( $575,3
&,1+ $575,3
1( )/2:
,R 67$57 21 $575,3
%6 75, 3 5(6(7 $575,3
/2&.287B5(6 &%)$,/
6+27B,1& '()75,3 '(),1,7(B75,3
/2&.287
75'8(
$5B,1+,%,7 7''8(
&%B326,7,21 $&7,9( $5B,1B3 52*5(66
6+27B$/$50
)LJXUH ([DPSOHRIDW\SLFDOFRQILJXUDWLRQIRUWKH$5)XQF
The examples presented below illustrate some of the special cases in configuration.
Most of the inputs and outputs in the figures are left floating for clarity reasons, as in
the example above. This does not mean that they should remain like that.
Figure 5, for example, illustrates the configuration of an application where the final
trip is carried out by the start of the protection function (AR2) but not until one auto-
7
RE_5_ _ AR5Func ABB Automation
reclose sequence i.e. one shot is completed by tripping of the protection function
(AR1). The operation of the start signal is blocked by an external AND gate until the
reclaim timer is started (TRDUE) by the first shot.
25
&%B23(1B6,*1$/
12&/2:
,/ 6 7$57
$5)XQF
,/ 75,3 $5 23(1
,/ &%)3 $5 &/26(
$1'
%6 (55 $5 6+27
%6 $5 6+27
75,** $5,1+ 6+27
*5283 $56<1& 6+27
)LJXUH $QH[DPSOHRIWKHXVHRIH[WHUQDOFRPSRQHQWVLQFRQILJXUDWLRQ
The operation of the auto-recloser is illustrated in Figure 6. The shot pointer indicates
the shot to start when the auto-reclose function receives its AR initiation signal
through one of the initiation lines AR1...AR4. The boxes for each of the initiation
lines determine the action to be taken when an auto-reclose initiation signal is
received. Start means that an auto-reclose shot is initiated, while block means that
the auto-reclose shot is prevented when the initiation signal is active. A dash means
that no action will be taken.
Shot Pointer
1 2 3 4 5 6 7
AR2
Start Start Yes
AR3
Shot Pointer = 1
Start Start No
AR4
Start Yes
Dead time Dead time Dead time Dead time Dead time
Circuit
td td td td Final trip breaker
closing
Reclaim time
)LJXUH )XQFWLRQDOGLDJUDPIRUWKHDXWRUHFORVHIXQFWLRQ$5)XQF
The programmable start delay associated with the boxes in the grey area is activated if
the auto-reclose shot is initiated by the start signal of a protection stage (selected with
parameters ,QLWLDWLRQPRGH, ch8x/S1), see Figure 7. After the start delay, the circuit
breaker is opened by the auto-reclose function. When the auto-reclose shot is initiated
8
ABB Automation AR5Func RE_5_ _
by the trip signal of the protection, a protection function trips the circuit breaker and
simultaneously initiates the AR shot.
The AR shots start from the tripping of the circuit breaker and simultaneously, the
dead time of the shot is started. When the dead time has elapsed, the circuit breaker is
closed and the reclaim and discrimination time starts running. A new initiation signal
received during the discrimination time will inhibit further AR shots and the shot
pointer will move to the final trip stage (6). An auto-reclose request received during
the reclaim time will increase the shot pointer and perform the function selected. If no
function is selected, the shot pointer moves right to the lock-out stage (7). At this
point, the AR function is locked-out during the reclaim time, after which the shot
pointer is reset and the function is prepared for a new AR sequence (lock-out reset
mode is automatic). If the lock-out reset is programmed to be manual, the only way to
cancel the lock-out of AR is to reset it locally over the MMI, via a digital input (or
any logic) or via serial communication.
1
0
0
1 t
AR1
1 Shot in
2
1 & S
progress
R
0
Start
OPEN
AR2 1 End
of
1
pulse
AR3 shot
Initiation mode
AR4 (ch81/S1)
)LJXUH 3URJUDPPDEOHSDUDPHWHUVRI6KRW
There are two different methods of selecting the shots to be enabled and ready to react
on the initiation lines. The default method is that the shots with a number equal to or
greater than the current value (i.e. position) of the shot pointer are enabled. Which of
the enabled shots is to start depends only on the setting of the Start/Block/No action
of each shot. A shot with a smaller number takes precedence over shots with greater
numbers as well as over the final trip function. The other method is to enable exactly
one shot at a time, the one indicated by the shot pointer. Figure 8 illustrates the
operation of the shot pointer in shot selection, and the related parameters. No matter
which method is used, the final trip is enabled until the shot pointer reaches the
position 7 (lock-out).
9
RE_5_ _ AR5Func ABB Automation
1
ON 2 1 0
0
input signal AR operation
(ch80/S3)
Shots enable
(ch80/S9)
0 1
Shot Pointer
(ch80/V2)
1 7
)LJXUH 6KRWVHOHFWLRQORJLFUHODWHGSDUDPHWHUVDQGVKRWSRLQWHU
1 An AR shot of a value smaller than that indicated by the shot pointer cannot be
started.
2 An initiation signal (AR1...4) has to be active and the corresponding setting has to
be Start.
3 No initiation signal that inhibits (Block) the shot must be active.
4 Should a start delay have been set for the AR shot (see Auto-reclose shot initiated
by a start signal below), the initiation signal still has to be active when the start
delay elapses, to enable initiation of the AR shot.
Example (see Figure 6):
The initiation signals AR1 and AR2 are assumed to be activated when the position of
the shot pointer is 2 (AR shot 1 has just been made). AR shot 2 would be the next one
to start but it is blocked by AR1. The AR shots 3...5 have not been configured to be
initiated by either signal but the final trip function (6) has, and so the final tripping
operation will take place next.
10
ABB Automation AR5Func RE_5_ _
as soon as the function block is put into use again. The operation mode does not affect
the LOCKOUT output or the locked-out condition.
An AR shot initiated by a trip signal of the protection function will start immediately.
The circuit breaker is then opened by a protection function.
A start delay can be set to delay the start of an AR shot. Separate start delays can be
set for each box in the grey area in Figure 6.
When the AR shot is to be initiated by the start signal of the protection function, the
circuit breaker is opened by the auto-reclose function once the start delay time of the
concerned AR shot has elapsed. The zero value can also be selected for the start
delay.
What is important for the start delay is that the corresponding initiation signal remains
active throughout the time. Should the initiation signal reset, the time delay starts
from zero again. The use of another initiation signal for blocking the start of an AR
shot does not affect the time delay.
In the example in Figure 9, the input AR2 has a starting function and the input AR1 a
blocking function. In case a), a momentary activation of the input AR1 does not affect
the start of the AR shot nor the start delay. The input AR1 used for blocking in case b)
remains active for a longer time than the start delay of AR2. The AR shot is started 50
ms after the blocking is reset via AR1.
AR2
(Start)
Start delay time Start delay time
AR1
(Block)
t t
ACTIVE
)LJXUH ([DPSOHVRI$5LQLWLDWLRQ
11
RE_5_ _ AR5Func ABB Automation
function will wait until the block signal is reset or the protection function performs
definite tripping.
The position inputs CBOPEN and CBCLOSE should be connected to the circuit
breaker status signals. If these are not available, there are two alternatives. If the
inputs are configured as constant FALSE, the function block ignores the circuit
breaker position in all operations and the position is assumed to be correct, e.g.
open after an OPEN pulse of the specified width. The other alternative is to connect
the inputs to the trip signal of the protection function, as shown in Figure 10. The
operation is the same but in this case, the AR5Func can generate the DEFTRIP signal
and update the definite trip counters even if final tripping is not handled by the
function block.
&%B23(1B6,* 1$/
12& /2:
,/ 67$57
$5)XQF
,/ 75,3 $5 2 3( 1
$5 &/2 6(
$5 6+27
$5 6+27
$5,1+ 6+27
$56<1& 6+27
&%23(1 6+27
&%&/26( $575,3
&,1+ $575,3
21 $575,3
5(6(7 $575,3
/2&.2 87B5(6 &%)$,/
6+27B,1& '()75,3
/2&.2 87
75'8(
7''8(
$&7,9(
6+27B$/$50
)LJXUH &RQILJXUDWLRQRIFLUFXLWEUHDNHULQSXWVZKHQWKHFLUFXLWEUHDNHUVWDWXVLV
QRWDYDLODEOHDQGILQDOWULSSLQJLVFDUULHGRXWE\SURWHFWLRQIXQFWLRQV
The internal circuit breaker status (&%SRVLWLRQ, ch80/S3) is changed only when there
is no conflict between the position inputs CBOPEN and CBCLOSE. At power-on
reset, the status is set to undefined and it will remain so until no conflict exist
between the inputs. While the status is undefined, the AR5Func operates normally as
described above, always assuming that the state is correct. Figure 11 shows how the
circuit breaker status is decoded. It should be noted, however, that this is not a real-
life example of how the circuit breaker operates.
power-on
CBOPEN
CBCLOSE
)LJXUH 'HFRGLQJRIWKHLQWHUQDOFLUFXLWEUHDNHUVWDWXV
12
ABB Automation AR5Func RE_5_ _
After the dead time, the CLOSE output is not activated until certain conditions are
fulfilled. The conditions are:
AR1
Start delay time t t =50 ms delay after
initiation signal reset
OPEN
ACTIVE
Dead time 2 s max
CINH
CLOSE
)LJXUH 'HOD\LQJWKH&/26(RXWSXWVLJQDO
The circuit breaker status inputs (CBOPEN and CBCLOSE) can be temporarily
disconnected by using the control setting &%SRVLQSXWV, ch80/V90, which is useful
especially in the regular maintenance of the relay. The control setting forces the
13
RE_5_ _ AR5Func ABB Automation
internal status of circuit breaker (&%SRVLWLRQ, ch80/S3) to the same undefined state
at which it was when the function block was initialized. By disconnecting the OPEN
and CLOSE output signals as well, the auto-reclose sequences can be carried out
while the circuit breaker remains closed all the time.
The normal operation of the circuit breaker status is resumed as soon as a change is
detected in either of the status inputs. Note that the control setting (&%SRVLQSXWV,
ch80/V90) should be used only if the status inputs are connected to reflect the current
status of the circuit breaker.
2.3 Resetting
The operation counters as well as the ARnTRIP (n =1...4) and LOCKOUT output
signals can be reset via the RESET input, or over the serial bus or the local MMI.
The operation indicators, latched output signals and operation counters can be reset as
follows:
14
ABB Automation AR5Func RE_5_ _
2.4 General
When the circuit breaker is closed by the AR shots 1...4, a discriminating time td will
be started. Should one of the initiation signals AR1...AR4 be activated during the
discriminating time, the AR shot pointer moves to the position (6). Then further AR
shots are prevented and definite tripping will follow. This function is generally used
at inverse-time operation in order to limit the number of auto-reclosures when
reclosing further aggravates a fault situation. The discriminating time td can be set out
of use by selecting the value 0.
The reclaim time is always started or restarted at a circuit breaker close operation. A
new initiation signal during the reclaim time will perform the next shot if one has
been selected. When all shots have been executed, the auto-recloser is locked out.
When the reclaim time has elapsed and the automatic lock-out reset mode is selected,
the lock-out situation ends and the shot pointer returns to its nominal position (1).
Definite tripping of the circuit breaker can be carried out by a trip signal of the
protection function or by the final trip function (6) of the auto-reclose function. The
final trip function (6) has to be initiated by the start of the protection function and it
allows final CB tripping to be carried out in a time shorter than the operate time of the
protection function. In this case, the fault is most probably of a permanent nature and
waiting for the protection function to trip might thus further aggravate the damage. In
the final trip function, the desired trip time (6) can be selected separately for each
initiation signal.
2.4.3 Lock-out
When the last shot or the final trip function (6) has been carried out, the shot pointer
indicates the position LOCK-OUT (7), which means that the auto-reclose function
does not respond to any initiation signal during the reclaim time. At this time, the
LOCKOUT output signal is high. In addition, the shot pointer indicates the position
(7) in the following situations:
15
RE_5_ _ AR5Func ABB Automation
When the signal or situation that resulted in lock-out resets, the reclaim time (tr)
starts. When the set reclaim time has elapsed, the shot pointer returns to the
position (1), simultaneously clearing the LOCKOUT output.
Manual Lock-out reset:
The Lock-out is reset either locally via the MMI, a digital input or any logic
connected to the LOCKOUT_RES input, or via the serial communication.
Manually resetting the Lock-out immediately resets the LOCKOUT output. The
shot pointer is reset to 1 by the manual Lock-out reset or at end of the reclaim
time, whichever comes last.
The automatic or manual lock-out reset mode is selected by parameter /RFNRXWPRGH
(ch80/S5).
the opening or closing of the circuit breaker fails (CBxxxx inputs do not change
status)
the CB status data changes from open to closed during the dead time of the
auto-reclosure e.g. due to manual closing of the circuit breaker
the ARINH input is activated
the circuit breaker is opened by local or remote control
the auto-reclose program is set out of use
the AR5Func is re-initialized for some reason, e.g. the auxiliary power supply to
the system is temporarily interrupted.
In all the cases mentioned above, specified information about the cause of interruption
can be obtained over the serial communication system.
In addition to the circuit breaker control during auto-reclose sequences, the AR5Func
can be used to open and close the circuit breaker over the serial bus or the MMI. This
operation has two phases, selection and execution, and thus it is called secured
control. The selection phase is carried out by writing the value one to either the open
or the close operation parameter, both of which are function block specific. The
execution phase can be carried out by writing the value one either to the function
block specific parameter or to the common parameter on channel 900. The latter
16
ABB Automation AR5Func RE_5_ _
ch80/V6 Open operation selection of secured control. Value one (1) will select
open operation and cancel close operation if this was selected before.
The value zero (0) will deselect the open operation if selected.
ch80/V7 Close operation selection of secured control. Value one (1) will select
close operation and cancel open operation if this was selected before.
Value zero (0) will deselect the close operation if selected.
ch80/V11 Execution of secured control. Value one (1) will carry out the
operation selected by ch80/V6 or ch80/V7. Note that either the open or
close operation is assumed to be selected. If not, an event (ch80/E29)
is generated to indicate an error.
ch900/V251 Same as ch80/V11, but no event (as error message) will be generated
when no open or close operation has been selected. The command is
broadcasted to other function blocks as well.
ch80/V10 Deselection of secured control. Value one (1) will cancel the operation
possibly selected by ch80/V6 or ch80/V7. The operation selection
parameter, if one has been set, is reset to zero.
The secured open operation will abort an auto-reclose sequence running at the
moment of the execution phase. The event code ch80/E38 is generated to indicate an
abnormal termination of the sequence. Note that the circuit breaker can already be
open when the auto-reclose sequence is aborded - an active sequence is aborted
unconditionally at secured open - so this function is normally used as a remote reset
of an auto-reclose sequence.
The secured opening and closing are subject to the same rules as the opening and
closing by auto-reclose sequences. For example, a close operation is not carried out if
the circuit breaker is already closed or if the open output signal or an AR initiation
input signal is active at the moment of the execution phase. There are no dedicated
events (as error messages) for a secured control being ignored due to a conflict with
the rules.
When the auto-reclose function operates the circuit breaker, it also checks that the
state of the CB changes properly during the set pulse width. To be able to check the
position data, the auto-reclose function block needs information about the position of
the circuit breaker (CBOPEN, CBCLOSE). When required, however, the auto-reclose
17
RE_5_ _ AR5Func ABB Automation
function is able to operate without this information. In such a case, the control
operations, i.e. whether they are successful or not, are not supervised.
For the operation of the circuit breaker, the width of the open pulse and the close
pulse is adjustable. These times are maximum times. If no CB position information is
available, the control impulses are in accordance with the setting. The open and close
signals cannot be active at the same time. If so, the open signal interrupts the close
signal. When CB position information is available, the impulse is interrupted once the
CB position has changed. Should the circuit breaker position remain unchanged
during the control operation, a circuit-breaker fail alarm will be issued (CBFAIL).
In addition, the following conditions are checked before the circuit breaker is closed:
The purpose of the maintenance monitor (also called stress monitor) is to provide an
alarm signal or, possibly, to prevent the closing of the circuit breaker after a certain
number of CB operations. The operation of the maintenance monitor is based on
counting the number of times the circuit breaker has opened. As soon as the auto-
reclose function block notices a circuit breaker trip, the value of the maintenance
monitor decreases.
Different load on the circuit breaker influences the maintenance monitor in a different
way. For example, the overcurrent may have the weighting factor 20 and the manual
opening the weighting factor 1, which means that respectively, the monitor value is
decreased by 20 or 1. The AR5Func block has five different weighting factors: for
openings initiated by AR1, by AR2, by AR3, by AR4 and by manual control. The
weighting factors can be set in the range 0...50.
When the maintenance monitor reaches the value zero, a permanent CBFAIL alarm
signal is issued. The maintenance monitor can be configured so($WVWUHVVFQW,
ch80/S20) that the value zero prevents CB closing and auto-reclose operations. The
alarm is reset by giving the maintenance monitor a new value.
18
ABB Automation AR5Func RE_5_ _
In addition, a pre-alarm level can be set for the maintenance monitor. When the
monitor reaches this level or falls below it, a pulse-shaped CBFAIL alarm signal is
given when the CB is opened. The pre-alarm function can be set out of use by
choosing the setting value zero (0) for it.
The maintenance monitor can be set out of use by setting all weighting factors to zero.
When monitoring the water level i.e. the current value of the frequent-operation
counter parameter ()UHTXHQWRSFQW, ch80/S17), note that the parameter will be
decremented (by one) at intervals of 30 (minutes) divided by the leakage value ()UHT
RSOHDN, ch80/S19). No decrementing occurs when the zero value is reached. The
frequent-operation counter can be set out of use by setting the leak value at zero.
2.4.9 ACTIVE
This output signal indicates that the AR function is active. The signal goes up when a
shot (1...5) and its dead time is started. The signal is reset when the shot is completed
or aborted, i.e.:
the dead time of a shot has elapsed and the close signal is activated,
the logic is locked out,
a shot has been ready for two seconds without permission to activate the close
signal, or
either secured open or close control is selected (ch80/V6:1 or ch80/V7:1) and
executed (ch80/V11:1).
The ACTIVE output signal is produced by internally OR'ing the five AR shot Q in
progress output signals.
19
RE_5_ _ AR5Func ABB Automation
2.4.10 SHOT_ALARM
The shot alarm output is activated after the selected number of shots has been
performed. The signal is often used for selection of second settings of protection
function(s). If the programmed alarm limit (6KRWDODUPOHYHO, ch80/S6) matches with
the number of shots in sequence, the signal goes up when a shot (1...5) and its dead
time is started. The signal is reset
The CBFAIL alarm is a 0.2 s pulse that is obtained when a CB operation fails or the
maintenance monitor reaches or falls below the set pre-alarm level, or when an auto-
reclose sequence in progress is interrupted by unsuccessful circuit breaker operation.
The CBFAIL alarm is permanently indicating that the value of the maintenance
monitor is zero.
The ARSYNC input is used, for example, to delay or avoid the connection of
transmission lines fed from different directions when the phase angle difference of the
network sections is too large. Should there be no information about synchronism
within 2 seconds after the dead time has elapsed, the auto-reclose sequence will be
locked out and a CBFAIL alarm will be issued. When the ARSYNC input is activated,
the synchronism condition is assumed to be fulfilled and reclosing is allowed.
The setting parameters 6\QFKURFKHFN (e.g. ch81/S11) can be used to specify whether
information about synchronism is required for the individual AR shots. If the dead
time is short, the circuit breaker can be reclosed without synchronism being lost.
Activation of the CINH input prevents CB closing in situations where the CB spring
is not charged or the gas pressure is below the permitted level. When the CINH input
is activated, CB closing is inhibited. If the CINH input is not reset within two seconds
after the dead time has elapsed, the auto-reclose sequence will be locked out and a
CBFAIL alarm will be issued.
20
ABB Automation AR5Func RE_5_ _
When the ARINH input is activated, any auto-reclose operation in progress will be
locked out. When the ARINH signal disappears, the reclaim time tr starts and an auto-
reclose sequence cannot be carried out until this time has elapsed.
The auto-reclose function records all shots made as well as successful auto-reclosures.
Registers containing information about the number of successful auto-reclosures can
be accessed over the serial communication and over the event reporting system. The
auto-reclose function decides whether the auto-reclosure (the last AR shot) was
successful or not after the reclaim time tr has elapsed.
Registers containing information about the number of all shots made can be accessed
via the MMI or over the serial communication.
2.4.16 Resetting
The RESET input of the AR function is to be used for resetting the AR function
registers. The registers can also be reset over the serial bus or MMI.
Sometimes it may be useful to get all the indications on the MMI reset after an auto-
reclosure. This can be done with the INDRESET function block. Figure 13 shows an
example of the configuration for resetting the indications. The close pulse given by
the auto-reclose function will reset all indications on the MMI. The advantage is that
the MMI always shows the latest trip-indication.
)LJXUH 5HVHWWLQJWKHLQGLFDWLRQVDIWHUDFORVHSXOVHLVJLYHQE\WKH$5IXQFWLRQ
21
RE_5_ _ AR5Func ABB Automation
The SHOT_INC input is used to synchronize the shot pointer of the AR5Func with
the shot pointer of the downstream auto-recloser in the same network. An external
TON type timer circuit might be required for each AR input to reject e.g. inrush
currect peaks which do not cause auto-reclosing downstream. The timer circuit is
connected between the start signal of the protection function and the SHOT_INC
input. (Because the AR input can be connected either to the start or the trip signal of
the protection function, the timer circuit is not built-in in the AR5Func.) Figure 14
shows an example of the configuration for sequence control when the shots are
initiated by the tripping of the protection function. The delays must be set to a slightly
shorter operate time than the operate time of the downstream relay.
25
&%B23(1B6,* 1$/
12& /2:
,/ 67$57
$5)XQF
,/ 75,3 $5 2 3( 1
$5 &/2 6(
$5 6+27
$5 6+27
1( )/2:
,R 67$57 $5,1+ 6+27
%6 75,3 $56<1& 6+27
&%23(1 6+27
&%&/26( $575,3
&,1+ $575,3
721
,1 4 21 $575,3
37 (7 5(6(7 $575,3
/2&.2 87B5(6 &%)$,/
25
6+27B,1& '()75,3
721
,1 4 /2&.2 87
37 (7 75'8(
7''8(
$&7,9(
6+27B$/$50
)LJXUH &RQQHFWLQJWKHVHTXHQFHFRQWUROWLPHUVZKHQVKRWVDUHVWDUWHGE\WKH
WULSSLQJRIWKHSURWHFWLRQIXQFWLRQ
When the relay downstream performs a trip, the start signal at the upstream relay
passes through the timer and the shot pointer is incremented at the falling edge if no
auto-reclose shot is started. The shot pointer is always incremented by one. If the
signal ACTIVE is activated, it means that the upstream relay has tripped and its own
auto-reclose shot has been started. Figure 15 is an example of the operation where the
shot pointer is incremented by sequence control twice before the start delay time is
exceeded and a shot is started.
Start of
protection
Start delay time Start delay time Start delay time
SHOT_INC
t t t
TRDUE
t =External TON
delay time
ACTIVE
Shot Pointer 1 2 3
)LJXUH 2SHUDWLRQRIWKHVHTXHQFHFRQWUROLQSXW6+27B,1&
22
ABB Automation AR5Func RE_5_ _
When the number of shots in sequence reach the preset limit (6KRWDODUPOHYHO,
ch80/S6), the SHOT_ALARM output is activated at the beginning of the dead time
along with the ACTIVE output. The SHOT_ALARM output is cleared at the end of
the reclaim time and also when outputs are reset by the RESET input or by one of the
reset parameters.
23
RE_5_ _ AR5Func ABB Automation
3.1 General
Usually each function block has a specific channel number for serial
communication parameters and events. However, the AR5Func function is divided
on channels 80 to 86 as follows:
Channel Parameters and events
80 General parameters and events;
input and output data
81 Shot 1
82 Shot 2
83 Shot 3
84 Shot 4
85 Shot 5
86 Final trip
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
24
ABB Automation AR5Func RE_5_ _
Shots enabled S9 0 or 1 5) - 0 R/W Enable all shots or only the next one
Frequent op. cnt S17 0...100 - 0 R/W Frequent Operation Counter: current
value in shots
Freq. op. limit S18 0...100 6) - 0 R/W Lock-out limit of the Frequent Operation
Counter in shots
Freq. op. leak S19 1...50 - 1 R/W Leakage of the Frequent Operation
Counter in shots per half an hour
AR1 stress S22 0...50 - 0 R/W Stress factor, when CB opened via AR1
AR2 stress S23 0...50 - 0 R/W Stress factor, when CB opened via AR2
AR3 stress S24 0...50 - 0 R/W Stress factor, when CB opened via AR3
AR4 stress S25 0...50 - 0 R/W Stress factor, when CB opened via AR4
25
RE_5_ _ AR5Func ABB Automation
AR1 oper. mode S2 0...2 2) - 0 R/W AR1 operation mode for shot x
2)
AR2 oper. mode S3 0...2 - 0 R/M AR2 operation mode for shot x
AR3 oper. mode S4 0...2 2) - 0 R/W AR3 operation mode for shot x
2)
AR4 oper. mode S5 0...2 - 0 R/W AR4 operation mode for shot x
Dead time S10 0.20...300.00 s 5.00 R/W Dead time for AR shot x
3)
Synchrocheck S11 0 or 1 - 0 R/W Use of synchrocheck for AR shot x
AR2 init mode S3 0 or 1 1) - 0 R/W AR2 initiation mode for final trip
1)
AR3 init mode S4 0 or 1 - 0 R/M AR3 initiation mode for final trip
AR4 init mode S5 0 or 1 1) - 0 R/W AR4 initiation mode for final trip
AR1 trip delay S6 0...5.00 s 0 R/W Final trip delay, when initiated by AR1
AR2 trip delay S7 0...5.00 s 0 R/W Final trip delay, when initiated by AR2
AR3 trip delay S8 0...5.00 s 0 R/W Final trip delay, when initiated by AR3
AR4 trip delay S9 0...5.00 s 0 R/W Final trip delay, when initiated by AR4
1)
AR_ init mode 0 = No operation; 1 = Final Trip initiated
26
ABB Automation AR5Func RE_5_ _
Event mask 1A V101 0...4294967295 - 42317907 R/W Event mask 1 for event
87 transmission (E0 ... E32)
Event mask 1B V102 0... - 127 R/W Event mask 1 for event
transmission (E32 ... E45)
Event mask 2A V103 0...4294967295 - 42317907 R/W Event mask 2 for event
87 transmission (E0 ... E32)
Event mask 2B V104 0... - 127 R/W Event mask 2 for event
transmission (E32 ... E45)
Event mask 3A V105 0...4294967295 - 42317907 R/W Event mask 3 for event
87 transmission (E0 ... E32)
Event mask 3B V106 0... - 127 R/W Event mask 3 for event
transmission (E32 ... E45)
Event mask 4A V107 0...4294967295 - 42317907 R/W Event mask 4 for event
87 transmission (E0 ... E32)
Event mask 4B V108 0... - 127 R/W Event mask 4 for event
transmission (E32 ... E45)
1)
AR in progress 0 = AR not in progress; 1 = AR shot 1 in progress; 2 = AR shot 2 in progress;
3 = AR shot 3 in progress; 4 = AR shot 4 in progress; 5 = AR shot 5 in
progress
2)
CB position 0 = Unknown; 1 = Closed; 2 = Open
27
RE_5_ _ AR5Func ABB Automation
28
ABB Automation AR5Func RE_5_ _
29
RE_5_ _ AR5Func ABB Automation
30
ABB Automation AR5Func RE_5_ _
Num shots 3rd V33 0...11 1) - 0 R/W Shots / third last AR seq.
1)
Num shots 4th V34 0...11 - 0 R/W Shots / fourth last AR seq.
Num shots 5th V35 0...11 1) - 0 R/W Shots / fifth last AR seq.
1)
Num shots 0 = Dummy data; 1...5 = Shot count; 6...11 = Shot count (+6) with Def Trip
31
RE_5_ _ AR5Func ABB Automation
3.3.4 Events
32
ABB Automation AR5Func RE_5_ _
E35 8 1 AR in use -
33
RE_5_ _ AR5Func ABB Automation
E6 64 0 AR shot x successful -
1)
Character x in the event reason refers to the shot number (1,2,3,4 or 5). The above events are
generated separately for each shot.
34
ABB Automation AR5Func RE_5_ _
35
1MRS752297-MUM AR5Func
Issued: 10/1997
Version: E/17.01.2002
Auto-Reclosure Function
Data subject to change without notice
Contents
1. Introduction .............................................................................................. 3
1.1 Features.............................................................................................. 3
1.2 Application........................................................................................... 3
1.3 Input description.................................................................................. 5
1.4 Output description ............................................................................... 6
2. Description of Operation.......................................................................... 7
2.1 Configuration....................................................................................... 7
2.1.1 General ...................................................................................... 7
2.1.2 Relay configuration .................................................................... 7
2.1.3 AR shots and final trip function................................................... 8
2.1.4 Shot selection............................................................................. 9
2.1.5 Initiation of auto-reclosing ........................................................ 10
2.1.6 Auto-reclose operation mode control........................................ 10
2.1.7 Auto-reclose shot initiated by a trip signal ................................ 11
2.1.8 Auto-reclose shot initiated by a start signal .............................. 11
2.1.9 Auto-reclose shot blocked by an initiation signal ...................... 11
2.1.10 Circuit breaker position inputs .................................................. 12
2.1.11 Delaying the CLOSE output signal ........................................... 13
2.1.12 Lock-out resetting..................................................................... 13
2.2 Test mode ......................................................................................... 13
2.3 Resetting........................................................................................... 14
2.4 General ............................................................................................. 15
2.4.1 Discriminating time and reclaim time ........................................ 15
2.4.2 Final trip function (6) ................................................................ 15
2.4.3 Lock-out ................................................................................... 15
2.4.4 Interruption of auto-reclosing.................................................... 16
2.4.5 Secured control of the circuit breaker....................................... 16
2.4.6 Circuit breaker supervision logic............................................... 17
2.4.7 Aids to circuit breaker maintenance ......................................... 18
2.4.8 Frequent-operation counter...................................................... 19
2.4.9 ACTIVE .................................................................................... 19
2.4.10 SHOT_ALARM......................................................................... 20
AR5Func Substation Automation
4. Technical Data.........................................................................................35
2
Substation Automation AR5Func
1. Introduction
1.1 Features
1.2 Application
This document specifies the function of the auto-reclose function block AR5Func
used in products based on the RED 500 Platform.
The majority (about 80...85%) of MV overhead line faults are transient and are
automatically cleared by momentarily de-energizing the line, whereas the rest of the
faults (15...20%) can be cleared by longer interruptions. The de-energization of the
fault place for a desired period of time is implemented by auto-reclose relays or
functions. The auto-reclosers are capable of clearing most of the faults. At a
permanent fault, the auto-reclosing is followed by final tripping. A permanent fault
has to be located and cleared before the fault location can be re-energized.
The auto-reclose function AR5Func can be used for auto-reclosing together with any
circuit breaker that has the characteristics required for auto-reclosing. The function
block provides five programmable auto-reclose shots which can perform one to five
successive auto-reclosures of desired type and duration, such as one high-speed and
one delayed auto-reclosure. When the reclosing is initiated by the start of a protection
function, the auto-reclose function is capable of executing the final trip of the circuit
breaker in a short operate time in case the fault still persists when the last reclosure
selected has been carried out.
A typical auto-reclose situation where one auto-reclose shot has been performed after
the fault was detected is illustrated in Figure 1. In case a), the auto-reclose shot is
initiated by a start signal of the protection function after the start delay time has
elapsed, whereas in case b), the auto-reclose shot is initiated by a trip signal of the
protection function. In both cases, the auto-reclose sequence was successful.
3
AR5Func Substation Automation
a) Instant of fault
AR1
(Start signal
from protection)
Start delay time
ACTIVE
OPEN
Dead time
CLOSE
Reclaim time
TRDUE
ACTIVE
Dead time
CLOSE
Reclaim time
TRDUE
)LJXUH 6LJQDOVFKHPHLOOXVWUDWLQJWKHDXWRUHFORVHRSHUDWLRQZKHQLQLWLDWHGE\D
VWDUWVLJQDODRUDWULSVLJQDOERIWKHSURWHFWLRQIXQFWLRQ
4
Substation Automation AR5Func
)LJXUH )XQFWLRQEORFNV\PERORIWKHDXWRUHFORVXUHIXQFWLRQ$5)XQF
5
AR5Func Substation Automation
6
Substation Automation AR5Func
2.1 Configuration
2.1.1 General
The configuration includes a description of the internal and external operation of the
function block. The internal operation is defined by setting the built-in parameters
according to the needs of the application. The parameters can be set either via the
MIMIC or the serial communication. The external operation, i.e. the logical
connection to process data, can be configured in the Relay Configuration Tool
included in the CAP 505 Tool Box.
Because of the virtually boundless configuration, i.e. the possibilities of the Relay
Configuration Tool, there is no single way of building an auto-reclose system with the
AR5Func. The function block is equipped with all the essential functionality and can
be used as such by simply connecting the AR input(s) to a protection function(s) and
the OPEN and CLOSE outputs to the circuit breaker. The needs vary, however, and to
meet the different requirements, the operation of the AR5Func can be adjusted e.g.
with a few external components as presented in Figure 4 below.
25
&%B75,3
12&/2:
,/ 67$57
25 $5)XQF
,/ 75, 3 $5 23( 1
&%23(1 6+27
&%&/26( $575,3
&,1+ $575,3
1( )/2:
,R 67$57 21 $575,3
%6 75, 3 5(6(7 $575,3
/2&.287B5(6 &%)$,/
6+27B,1& '()75,3 '(),1,7(B75,3
/2&.287
75'8(
$5B,1+,%,7 7''8(
&%B326,7,21 $&7,9( $5B,1B3 52*5(66
6+27B$/$50
)LJXUH ([DPSOHRIDW\SLFDOFRQILJXUDWLRQIRUWKH$5)XQF
The examples presented below illustrate some of the special cases in configuration.
Most of the inputs and outputs in the figures are left floating for clarity reasons, as in
the example above. This does not mean that they should remain like that.
Figure 5, for example, illustrates the configuration of an application where the final
trip is carried out by the start of the protection function (AR2) but not until one auto-
7
AR5Func Substation Automation
reclose sequence i.e. one shot is completed by tripping of the protection function
(AR1). The operation of the start signal is blocked by an external AND gate until the
reclaim timer is started (TRDUE) by the first shot.
25
&%B23(1B6,*1$/
12&/2:
,/ 6 7$57
$5)XQF
,/ 75,3 $5 23(1
,/ &%)3 $5 &/26(
$1'
%6 (55 $5 6+27
%6 $5 6+27
75,** $5,1+ 6+27
*5283 $56<1& 6+27
)LJXUH $QH[DPSOHRIWKHXVHRIH[WHUQDOFRPSRQHQWVLQFRQILJXUDWLRQ
The operation of the auto-recloser is illustrated in Figure 6. The shot pointer indicates
the shot to start when the auto-reclose function receives its AR initiation signal
through one of the initiation lines AR1...AR4. The boxes for each of the initiation
lines determine the action to be taken when an auto-reclose initiation signal is
received. Start means that an auto-reclose shot is initiated, while block means that
the auto-reclose shot is prevented when the initiation signal is active. A dash means
that no action will be taken.
Shot Pointer
1 2 3 4 5 6 7
AR2
Start Start Yes
AR3
Shot Pointer = 1
Start Start No
AR4
Start Yes
Dead time Dead time Dead time Dead time Dead time
Circuit
td td td td Final trip breaker
closing
Reclaim time
)LJXUH )XQFWLRQDOGLDJUDPIRUWKHDXWRUHFORVHIXQFWLRQ$5)XQF
The programmable start delay associated with the boxes in the grey area is activated if
the auto-reclose shot is initiated by the start signal of a protection stage (selected with
parameters ,QLWLDWLRQPRGH, ch8x/S1), see Figure 7. After the start delay, the circuit
breaker is opened by the auto-reclose function. When the auto-reclose shot is initiated
8
Substation Automation AR5Func
by the trip signal of the protection, a protection function trips the circuit breaker and
simultaneously initiates the AR shot.
The AR shots start from the tripping of the circuit breaker and simultaneously, the
dead time of the shot is started. When the dead time has elapsed, the circuit breaker is
closed and the reclaim and discrimination time starts running. A new initiation signal
received during the discrimination time will inhibit further AR shots and the shot
pointer will move to the final trip stage (6). An auto-reclose request received during
the reclaim time will increase the shot pointer and perform the function selected. If no
function is selected, the shot pointer moves right to the lock-out stage (7). At this
point, the AR function is locked-out during the reclaim time, after which the shot
pointer is reset and the function is prepared for a new AR sequence (lock-out reset
mode is automatic). If the lock-out reset is programmed to be manual, the only way to
cancel the lock-out of AR is to reset it locally over the MMI, via a digital input (or
any logic) or via serial communication.
1
0
0
1 t
AR1
1 Shot in
2
1 & S
progress
R
0
Start
OPEN
AR2 1 End
of
1
pulse
AR3 shot
Initiation mode
AR4 (ch81/S1)
)LJXUH 3URJUDPPDEOHSDUDPHWHUVRI6KRW
There are two different methods of selecting the shots to be enabled and ready to react
on the initiation lines. The default method is that the shots with a number equal to or
greater than the current value (i.e. position) of the shot pointer are enabled. Which of
the enabled shots is to start depends only on the setting of the Start/Block/No action
of each shot. A shot with a smaller number takes precedence over shots with greater
numbers as well as over the final trip function. The other method is to enable exactly
one shot at a time, the one indicated by the shot pointer. Figure 8 illustrates the
operation of the shot pointer in shot selection, and the related parameters. No matter
which method is used, the final trip is enabled until the shot pointer reaches the
position 7 (lock-out).
9
AR5Func Substation Automation
1
ON 2 1 0
0
input signal AR operation
(ch80/S3)
Shots enable
(ch80/S9)
0 1
Shot Pointer
(ch80/V2)
1 7
)LJXUH 6KRWVHOHFWLRQORJLFUHODWHGSDUDPHWHUVDQGVKRWSRLQWHU
1 An AR shot of a value smaller than that indicated by the shot pointer cannot be
started.
2 An initiation signal (AR1...4) has to be active and the corresponding setting has to
be Start.
3 No initiation signal that inhibits (Block) the shot must be active.
4 Should a start delay have been set for the AR shot (see Auto-reclose shot initiated
by a start signal below), the initiation signal still has to be active when the start
delay elapses, to enable initiation of the AR shot.
Example (see Figure 6):
The initiation signals AR1 and AR2 are assumed to be activated when the position of
the shot pointer is 2 (AR shot 1 has just been made). AR shot 2 would be the next one
to start but it is blocked by AR1. The AR shots 3...5 have not been configured to be
initiated by either signal but the final trip function (6) has, and so the final tripping
operation will take place next.
10
Substation Automation AR5Func
as soon as the function block is put into use again. The operation mode does not affect
the LOCKOUT output or the locked-out condition.
An AR shot initiated by a trip signal of the protection function will start immediately.
The circuit breaker is then opened by a protection function.
A start delay can be set to delay the start of an AR shot. Separate start delays can be
set for each box in the grey area in Figure 6.
When the AR shot is to be initiated by the start signal of the protection function, the
circuit breaker is opened by the auto-reclose function once the start delay time of the
concerned AR shot has elapsed. The zero value can also be selected for the start
delay.
What is important for the start delay is that the corresponding initiation signal remains
active throughout the time. Should the initiation signal reset, the time delay starts
from zero again. The use of another initiation signal for blocking the start of an AR
shot does not affect the time delay.
In the example in Figure 9, the input AR2 has a starting function and the input AR1 a
blocking function. In case a), a momentary activation of the input AR1 does not affect
the start of the AR shot nor the start delay. The input AR1 used for blocking in case b)
remains active for a longer time than the start delay of AR2. The AR shot is started 50
ms after the blocking is reset via AR1.
AR2
(Start)
Start delay time Start delay time
AR1
(Block)
t t
ACTIVE
)LJXUH ([DPSOHVRI$5LQLWLDWLRQ
11
AR5Func Substation Automation
function will wait until the block signal is reset or the protection function performs
definite tripping.
The position inputs CBOPEN and CBCLOSE should be connected to the circuit
breaker status signals. If these are not available, there are two alternatives. If the
inputs are configured as constant FALSE, the function block ignores the circuit
breaker position in all operations and the position is assumed to be correct, e.g.
open after an OPEN pulse of the specified width. The other alternative is to connect
the inputs to the trip signal of the protection function, as shown in Figure 10. The
operation is the same but in this case, the AR5Func can generate the DEFTRIP signal
and update the definite trip counters even if final tripping is not handled by the
function block.
&%B23(1B6,* 1$/
12& /2:
,/ 67$57
$5)XQF
,/ 75,3 $5 2 3( 1
$5 &/2 6(
$5 6+27
$5 6+27
$5,1+ 6+27
$56<1& 6+27
&%23(1 6+27
&%&/26( $575,3
&,1+ $575,3
21 $575,3
5(6(7 $575,3
/2&.2 87B5(6 &%)$,/
6+27B,1& '()75,3
/2&.2 87
75'8(
7''8(
$&7,9(
6+27B$/$50
)LJXUH &RQILJXUDWLRQRIFLUFXLWEUHDNHULQSXWVZKHQWKHFLUFXLWEUHDNHUVWDWXVLV
QRWDYDLODEOHDQGILQDOWULSSLQJLVFDUULHGRXWE\SURWHFWLRQIXQFWLRQV
The internal circuit breaker status (&%SRVLWLRQ, ch80/S3) is changed only when there
is no conflict between the position inputs CBOPEN and CBCLOSE. At power-on
reset, the status is set to undefined and it will remain so until no conflict exist
between the inputs. While the status is undefined, the AR5Func operates normally as
described above, always assuming that the state is correct. Figure 11 shows how the
circuit breaker status is decoded. It should be noted, however, that this is not a real-
life example of how the circuit breaker operates.
power-on
CBOPEN
CBCLOSE
)LJXUH 'HFRGLQJRIWKHLQWHUQDOFLUFXLWEUHDNHUVWDWXV
12
Substation Automation AR5Func
After the dead time, the CLOSE output is not activated until certain conditions are
fulfilled. The conditions are:
AR1
Start delay time t t =50 ms delay after
initiation signal reset
OPEN
ACTIVE
Dead time 2 s max
CINH
CLOSE
)LJXUH 'HOD\LQJWKH&/26(RXWSXWVLJQDO
The circuit breaker status inputs (CBOPEN and CBCLOSE) can be temporarily
disconnected by using the control setting &%SRVLQSXWV, ch80/V90, which is useful
especially in the regular maintenance of the relay. The control setting forces the
13
AR5Func Substation Automation
internal status of circuit breaker (&%SRVLWLRQ, ch80/S3) to the same undefined state
at which it was when the function block was initialized. By disconnecting the OPEN
and CLOSE output signals as well, the auto-reclose sequences can be carried out
while the circuit breaker remains closed all the time.
The normal operation of the circuit breaker status is resumed as soon as a change is
detected in either of the status inputs. Note that the control setting (&%SRVLQSXWV,
ch80/V90) should be used only if the status inputs are connected to reflect the current
status of the circuit breaker.
2.3 Resetting
The operation counters as well as the ARnTRIP (n =1...4) and LOCKOUT output
signals can be reset via the RESET input, or over the serial bus or the local MMI.
The operation indicators, latched output signals and operation counters can be reset as
follows:
14
Substation Automation AR5Func
2.4 General
When the circuit breaker is closed by the AR shots 1...4, a discriminating time td will
be started. Should one of the initiation signals AR1...AR4 be activated during the
discriminating time, the AR shot pointer moves to the position (6). Then further AR
shots are prevented and definite tripping will follow. This function is generally used
at inverse-time operation in order to limit the number of auto-reclosures when
reclosing further aggravates a fault situation. The discriminating time td can be set out
of use by selecting the value 0.
The reclaim time is always started or restarted at a circuit breaker close operation. A
new initiation signal during the reclaim time will perform the next shot if one has
been selected. When all shots have been executed, the auto-recloser is locked out.
When the reclaim time has elapsed and the automatic lock-out reset mode is selected,
the lock-out situation ends and the shot pointer returns to its nominal position (1).
Definite tripping of the circuit breaker can be carried out by a trip signal of the
protection function or by the final trip function (6) of the auto-reclose function. The
final trip function (6) has to be initiated by the start of the protection function and it
allows final CB tripping to be carried out in a time shorter than the operate time of the
protection function. In this case, the fault is most probably of a permanent nature and
waiting for the protection function to trip might thus further aggravate the damage. In
the final trip function, the desired trip time (6) can be selected separately for each
initiation signal.
2.4.3 Lock-out
When the last shot or the final trip function (6) has been carried out, the shot pointer
indicates the position LOCK-OUT (7), which means that the auto-reclose function
does not respond to any initiation signal during the reclaim time. At this time, the
LOCKOUT output signal is high. In addition, the shot pointer indicates the position
(7) in the following situations:
15
AR5Func Substation Automation
When the signal or situation that resulted in lock-out resets, the reclaim time (tr)
starts. When the set reclaim time has elapsed, the shot pointer returns to the
position (1), simultaneously clearing the LOCKOUT output.
Manual Lock-out reset:
The Lock-out is reset either locally via the MMI, a digital input or any logic
connected to the LOCKOUT_RES input, or via the serial communication.
Manually resetting the Lock-out immediately resets the LOCKOUT output. The
shot pointer is reset to 1 by the manual Lock-out reset or at end of the reclaim
time, whichever comes last.
The automatic or manual lock-out reset mode is selected by parameter /RFNRXWPRGH
(ch80/S5).
the opening or closing of the circuit breaker fails (CBxxxx inputs do not change
status)
the CB status data changes from open to closed during the dead time of the
auto-reclosure e.g. due to manual closing of the circuit breaker
the ARINH input is activated
the circuit breaker is opened by local or remote control
the auto-reclose program is set out of use
the AR5Func is re-initialized for some reason, e.g. the auxiliary power supply to
the system is temporarily interrupted.
In all the cases mentioned above, specified information about the cause of interruption
can be obtained over the serial communication system.
In addition to the circuit breaker control during auto-reclose sequences, the AR5Func
can be used to open and close the circuit breaker over the serial bus or the MMI. This
operation has two phases, selection and execution, and thus it is called secured
control. The selection phase is carried out by writing the value one to either the open
or the close operation parameter, both of which are function block specific. The
execution phase can be carried out by writing the value one either to the function
block specific parameter or to the common parameter on channel 900. The latter
16
Substation Automation AR5Func
ch80/V6 Open operation selection of secured control. Value one (1) will select
open operation and cancel close operation if this was selected before.
The value zero (0) will deselect the open operation if selected.
ch80/V7 Close operation selection of secured control. Value one (1) will select
close operation and cancel open operation if this was selected before.
Value zero (0) will deselect the close operation if selected.
ch80/V11 Execution of secured control. Value one (1) will carry out the
operation selected by ch80/V6 or ch80/V7. Note that either the open or
close operation is assumed to be selected. If not, an event (ch80/E29)
is generated to indicate an error.
ch900/V251 Same as ch80/V11, but no event (as error message) will be generated
when no open or close operation has been selected. The command is
broadcasted to other function blocks as well.
ch80/V10 Deselection of secured control. Value one (1) will cancel the operation
possibly selected by ch80/V6 or ch80/V7. The operation selection
parameter, if one has been set, is reset to zero.
The secured open operation will abort an auto-reclose sequence running at the
moment of the execution phase. The event code ch80/E38 is generated to indicate an
abnormal termination of the sequence. Note that the circuit breaker can already be
open when the auto-reclose sequence is aborded - an active sequence is aborted
unconditionally at secured open - so this function is normally used as a remote reset
of an auto-reclose sequence.
The secured opening and closing are subject to the same rules as the opening and
closing by auto-reclose sequences. For example, a close operation is not carried out if
the circuit breaker is already closed or if the open output signal or an AR initiation
input signal is active at the moment of the execution phase. There are no dedicated
events (as error messages) for a secured control being ignored due to a conflict with
the rules.
When the auto-reclose function operates the circuit breaker, it also checks that the
state of the CB changes properly during the set pulse width. To be able to check the
position data, the auto-reclose function block needs information about the position of
the circuit breaker (CBOPEN, CBCLOSE). When required, however, the auto-reclose
17
AR5Func Substation Automation
function is able to operate without this information. In such a case, the control
operations, i.e. whether they are successful or not, are not supervised.
For the operation of the circuit breaker, the width of the open pulse and the close
pulse is adjustable. These times are maximum times. If no CB position information is
available, the control impulses are in accordance with the setting. The open and close
signals cannot be active at the same time. If so, the open signal interrupts the close
signal. When CB position information is available, the impulse is interrupted once the
CB position has changed. Should the circuit breaker position remain unchanged
during the control operation, a circuit-breaker fail alarm will be issued (CBFAIL).
In addition, the following conditions are checked before the circuit breaker is closed:
The purpose of the maintenance monitor (also called stress monitor) is to provide an
alarm signal or, possibly, to prevent the closing of the circuit breaker after a certain
number of CB operations. The operation of the maintenance monitor is based on
counting the number of times the circuit breaker has opened. As soon as the auto-
reclose function block notices a circuit breaker trip, the value of the maintenance
monitor decreases.
Different load on the circuit breaker influences the maintenance monitor in a different
way. For example, the overcurrent may have the weighting factor 20 and the manual
opening the weighting factor 1, which means that respectively, the monitor value is
decreased by 20 or 1. The AR5Func block has five different weighting factors: for
openings initiated by AR1, by AR2, by AR3, by AR4 and by manual control. The
weighting factors can be set in the range 0...50.
When the maintenance monitor reaches the value zero, a permanent CBFAIL alarm
signal is issued. The maintenance monitor can be configured so($WVWUHVVFQW,
ch80/S20) that the value zero prevents CB closing and auto-reclose operations. The
alarm is reset by giving the maintenance monitor a new value.
18
Substation Automation AR5Func
In addition, a pre-alarm level can be set for the maintenance monitor. When the
monitor reaches this level or falls below it, a pulse-shaped CBFAIL alarm signal is
given when the CB is opened. The pre-alarm function can be set out of use by
choosing the setting value zero (0) for it.
The maintenance monitor can be set out of use by setting all weighting factors to zero.
When monitoring the water level i.e. the current value of the frequent-operation
counter parameter ()UHTXHQWRSFQW, ch80/S17), note that the parameter will be
decremented (by one) at intervals of 30 (minutes) divided by the leakage value ()UHT
RSOHDN, ch80/S19). No decrementing occurs when the zero value is reached. The
frequent-operation counter can be set out of use by setting the )UHTRSOLPLW to zero.
2.4.9 ACTIVE
This output signal indicates that the AR function is active. The signal goes up when a
shot (1...5) and its dead time is started. The signal is reset when the shot is completed
or aborted, i.e.:
the dead time of a shot has elapsed and the close signal is activated,
the logic is locked out,
a shot has been ready for two seconds without permission to activate the close
signal, or
either secured open or close control is selected (ch80/V6:1 or ch80/V7:1) and
executed (ch80/V11:1).
The ACTIVE output signal is produced by internally OR'ing the five AR shot Q in
progress output signals.
19
AR5Func Substation Automation
2.4.10 SHOT_ALARM
The shot alarm output is activated after the selected number of shots has been
performed. The signal is often used for selection of second settings of protection
function(s). If the programmed alarm limit (6KRWDODUPOHYHO, ch80/S6) matches with
the number of shots in sequence, the signal goes up when a shot (1...5) and its dead
time is started. The signal is reset
The CBFAIL alarm is a 0.2 s pulse that is obtained when a CB operation fails or the
maintenance monitor reaches or falls below the set pre-alarm level, or when an auto-
reclose sequence in progress is interrupted by unsuccessful circuit breaker operation.
The CBFAIL alarm is permanently indicating that the value of the maintenance
monitor is zero.
The ARSYNC input is used, for example, to delay or avoid the connection of
transmission lines fed from different directions when the phase angle difference of the
network sections is too large. Should there be no information about synchronism
within 2 seconds after the dead time has elapsed, the auto-reclose sequence will be
locked out and a CBFAIL alarm will be issued. When the ARSYNC input is activated,
the synchronism condition is assumed to be fulfilled and reclosing is allowed.
The setting parameters 6\QFKURFKHFN (e.g. ch81/S11) can be used to specify whether
information about synchronism is required for the individual AR shots. If the dead
time is short, the circuit breaker can be reclosed without synchronism being lost.
Activation of the CINH input prevents CB closing in situations where the CB spring
is not charged or the gas pressure is below the permitted level. When the CINH input
is activated, CB closing is inhibited. If the CINH input is not reset within two seconds
after the dead time has elapsed, the auto-reclose sequence will be locked out and a
CBFAIL alarm will be issued.
20
Substation Automation AR5Func
When the ARINH input is activated, any auto-reclose operation in progress will be
locked out. When the ARINH signal disappears, the reclaim time tr starts and an auto-
reclose sequence cannot be carried out until this time has elapsed.
The auto-reclose function records all shots made as well as successful auto-reclosures.
Registers containing information about the number of successful auto-reclosures can
be accessed over the serial communication and over the event reporting system. The
auto-reclose function decides whether the auto-reclosure (the last AR shot) was
successful or not after the reclaim time tr has elapsed.
Registers containing information about the number of all shots made can be accessed
via the MMI or over the serial communication.
2.4.16 Resetting
The RESET input of the AR function is to be used for resetting the AR function
registers. The registers can also be reset over the serial bus or MMI.
Sometimes it may be useful to get all the indications on the MMI reset after an auto-
reclosure. This can be done with the INDRESET function block. Figure 13 shows an
example of the configuration for resetting the indications. The close pulse given by
the auto-reclose function will reset all indications on the MMI. The advantage is that
the MMI always shows the latest trip-indication.
)LJXUH 5HVHWWLQJWKHLQGLFDWLRQVDIWHUDFORVHSXOVHLVJLYHQE\WKH$5IXQFWLRQ
21
AR5Func Substation Automation
The SHOT_INC input is used to synchronize the shot pointer of the AR5Func with
the shot pointer of the downstream auto-recloser in the same network. An external
TON type timer circuit might be required for each AR input to reject e.g. inrush
currect peaks which do not cause auto-reclosing downstream. The timer circuit is
connected between the start signal of the protection function and the SHOT_INC
input. (Because the AR input can be connected either to the start or the trip signal of
the protection function, the timer circuit is not built-in in the AR5Func.) Figure 14
shows an example of the configuration for sequence control when the shots are
initiated by the tripping of the protection function. The delays must be set to a slightly
shorter operate time than the operate time of the downstream relay.
25
&%B23(1B6,* 1$/
12& /2:
,/ 67$57
$5)XQF
,/ 75,3 $5 2 3( 1
$5 &/2 6(
$5 6+27
$5 6+27
1( )/2:
,R 67$57 $5,1+ 6+27
%6 75,3 $56<1& 6+27
&%23(1 6+27
&%&/26( $575,3
&,1+ $575,3
721
,1 4 21 $575,3
37 (7 5(6(7 $575,3
/2&.2 87B5(6 &%)$,/
25
6+27B,1& '()75,3
721
,1 4 /2&.2 87
37 (7 75'8(
7''8(
$&7,9(
6+27B$/$50
)LJXUH &RQQHFWLQJWKHVHTXHQFHFRQWUROWLPHUVZKHQVKRWVDUHVWDUWHGE\WKH
WULSSLQJRIWKHSURWHFWLRQIXQFWLRQ
When the relay downstream performs a trip, the start signal at the upstream relay
passes through the timer and the shot pointer is incremented at the falling edge if no
auto-reclose shot is started. The shot pointer is always incremented by one. If the
signal ACTIVE is activated, it means that the upstream relay has tripped and its own
auto-reclose shot has been started. Figure 15 is an example of the operation where the
shot pointer is incremented by sequence control twice before the start delay time is
exceeded and a shot is started.
Start of
protection
Start delay time Start delay time Start delay time
SHOT_INC
t t t
TRDUE
t =External TON
delay time
ACTIVE
Shot Pointer 1 2 3
)LJXUH 2SHUDWLRQRIWKHVHTXHQFHFRQWUROLQSXW6+27B,1&
22
Substation Automation AR5Func
When the number of shots in sequence reach the preset limit (6KRWDODUPOHYHO,
ch80/S6), the SHOT_ALARM output is activated at the beginning of the dead time
along with the ACTIVE output. The SHOT_ALARM output is cleared at the end of
the reclaim time and also when outputs are reset by the RESET input or by one of the
reset parameters.
23
AR5Func Substation Automation
3.1 General
Usually each function block has a specific channel number for serial
communication parameters and events. However, the AR5Func function is divided
on channels 80 to 86 as follows:
Channel Parameters and events
80 General parameters and events;
input and output data
81 Shot 1
82 Shot 2
83 Shot 3
84 Shot 4
85 Shot 5
86 Final trip
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
24
Substation Automation AR5Func
Shots enabled S9 0 or 1 5) - 0 R/W Enable all shots or only the next one
Frequent op. cnt S17 0...100 - 0 R/W Frequent Operation Counter: current
value in shots
Freq. op. limit S18 0...100 6) - 0 R/W Lock-out limit of the Frequent Operation
Counter in shots
Freq. op. leak S19 1...50 - 1 R/W Leakage of the Frequent Operation
Counter in shots per half an hour
AR1 stress S22 0...50 - 0 R/W Stress factor, when CB opened via AR1
AR2 stress S23 0...50 - 0 R/W Stress factor, when CB opened via AR2
AR3 stress S24 0...50 - 0 R/W Stress factor, when CB opened via AR3
AR4 stress S25 0...50 - 0 R/W Stress factor, when CB opened via AR4
25
AR5Func Substation Automation
AR1 oper. mode S2 0...2 2) - 0 R/W AR1 operation mode for shot x
2)
AR2 oper. mode S3 0...2 - 0 R/M AR2 operation mode for shot x
AR3 oper. mode S4 0...2 2) - 0 R/W AR3 operation mode for shot x
2)
AR4 oper. mode S5 0...2 - 0 R/W AR4 operation mode for shot x
Dead time S10 0.20...300.00 s 5.00 R/W Dead time for AR shot x
3)
Synchrocheck S11 0 or 1 - 0 R/W Use of synchrocheck for AR shot x
AR2 init mode S3 0 or 1 1) - 0 R/W AR2 initiation mode for final trip
1)
AR3 init mode S4 0 or 1 - 0 R/M AR3 initiation mode for final trip
AR4 init mode S5 0 or 1 1) - 0 R/W AR4 initiation mode for final trip
AR1 trip delay S6 0...5.00 s 0 R/W Final trip delay, when initiated by AR1
AR2 trip delay S7 0...5.00 s 0 R/W Final trip delay, when initiated by AR2
AR3 trip delay S8 0...5.00 s 0 R/W Final trip delay, when initiated by AR3
AR4 trip delay S9 0...5.00 s 0 R/W Final trip delay, when initiated by AR4
1)
AR_ init mode 0 = No operation; 1 = Final Trip initiated
26
Substation Automation AR5Func
Event mask 1A V101 0...4294967295 - 42317907 R/W Event mask 1 for event
87 transmission (E0 ... E32)
Event mask 1B V102 0... - 127 R/W Event mask 1 for event
transmission (E32 ... E45)
Event mask 2A V103 0...4294967295 - 42317907 R/W Event mask 2 for event
87 transmission (E0 ... E32)
Event mask 2B V104 0... - 127 R/W Event mask 2 for event
transmission (E32 ... E45)
Event mask 3A V105 0...4294967295 - 42317907 R/W Event mask 3 for event
87 transmission (E0 ... E32)
Event mask 3B V106 0... - 127 R/W Event mask 3 for event
transmission (E32 ... E45)
Event mask 4A V107 0...4294967295 - 42317907 R/W Event mask 4 for event
87 transmission (E0 ... E32)
Event mask 4B V108 0... - 127 R/W Event mask 4 for event
transmission (E32 ... E45)
1)
AR in progress 0 = AR not in progress; 1 = AR shot 1 in progress; 2 = AR shot 2 in progress;
3 = AR shot 3 in progress; 4 = AR shot 4 in progress; 5 = AR shot 5 in
progress
2)
CB position 0 = Unknown; 1 = Closed; 2 = Open
27
AR5Func Substation Automation
28
Substation Automation AR5Func
29
AR5Func Substation Automation
30
Substation Automation AR5Func
Num shots 3rd V33 0...11 1) - 0 R/W Shots / third last AR seq.
1)
Num shots 4th V34 0...11 - 0 R/W Shots / fourth last AR seq.
Num shots 5th V35 0...11 1) - 0 R/W Shots / fifth last AR seq.
1)
Num shots 0 = Dummy data; 1...5 = Shot count; 6...11 = Shot count (+6) with Def Trip
31
AR5Func Substation Automation
3.3.4 Events
32
Substation Automation AR5Func
E35 8 1 AR in use -
33
AR5Func Substation Automation
E6 64 0 AR shot x successful -
1)
Character x in the event reason refers to the shot number (1,2,3,4 or 5). The above events are
generated separately for each shot.
34
Substation Automation AR5Func
35
1MRS752357-MUM CMBWEAR_
Issued: 10/1997
Version: C/1.2.2002
Circuit-Breaker Electric Wear
Data subject to change without notice
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 3
2. Description of Operation.......................................................................... 4
2.1 Configuration....................................................................................... 4
2.2 Operation criteria................................................................................. 5
2.3 Alarm acknowledgement ..................................................................... 6
2.4 Resetting............................................................................................. 6
1. Introduction
1.1 Features
1.2 Application
This document specifies the functions of the circuit-breaker wear function blocks
CMBWEAR1 and CMBWEAR2 used in products based on the RED 500 Platform.
The function blocks are identical in operation.
Calculating the electrical wear of the circuit breaker is based on the current in each
phase before opening. The breaker wear is calculated for each phase separately and
when the accumulated breaker wear has reached the setting value, the function block
will issue an alarm signal.
The function block uses a 16-point setting table for the current and the corresponding
breaker wear value. The calculation is based on linear interpolation using the table.
Typically, the breaker wear increases in proportion to the square of the current.
However, the interpolation table solution provides a close match and facilitates the
configuration.
)LJXUH )XQFWLRQEORFNV\PEROVRI&0%:($5DQG&0%:($5
2
Substation Automation CMBWEAR_
3
CMBWEAR_ Substation Automation
2.1 Configuration
The breaker wear configuration table can be programmed via the Relay Configuration
Tool dialogue box (settings of the configured resource) presented in Figure 2 below.
)LJXUH %UHDNHUZHDUFRQILJXUDWLRQWDEOHLQWKHGLDORJXHER[RIWKH5HOD\
&RQILJXUDWLRQ7RRO
4
Substation Automation CMBWEAR_
When the circuit breaker is in closed state, the rising edge of the OPEN pulse will
trigger the analyzation stage which again will end when the circuit breaker enters
from the undefined state to the open state (BINOPEN==TRUE &
BINCLOSE==FALSE). If the breaker does not reach open state within a 100 second
timeout period, the analyzation stage will terminate without accumulating the breaker
wear.
The analyzation stage finds the maximum current peak value in each phase and uses
the obtained values as a reference while interpolating the breaker wear for each phase
by means of the 16-point setting table. Note that before the interpolation, the
maximum values are scaled to RMS by the factor 1/ 2 .
The breaker wear values of each phase are added to the accumulated breaker wear
variables, and when the accumulated breaker wear has reached the setting value in
one or several phases, the alarm is given. When the breaker breaks the rated currents,
the electrical counting (breaker wear value) will be approximately the same as the
mechanical counting, i.e. every breaking operation increases the wear value by 1.
Thus, the calculation stage always adds 1 to the actual breaker wear parameter
declared in the table.
5
CMBWEAR_ Substation Automation
The calculation stage uses extrapolation if needed. If the current values in the breaker
wear table do not start from zero, the function block assumes that the breaker wear
parameter of the current 0 kA is zero. If the current value exceeds the maximum
current specified in the table, the function block will extrapolate according to the
largest and second largest current values (the calculation expects the breaker wear
parameter to increase linearly).
Because of the variation of breakers on the market, the breaker wear vs. current values
can be programmed in the Relay Configuration Tool.
If an alarm condition is detected, the function block issues detailed alarm indications
both locally on the MMI and remotely via serial communication.
The alarm signal acknowledgement deactivates the active alarm signal of the function
block. The alarm signal can be acknowledged by the rising edge of the ACK signal, or
with a local menu command or a remote command. Separate events are not generated
by the acknowledgement because it deactivates the ALARM signal and an event is
generated by the deactivation.
If the accumulated breaker wear has exceeded the setting and an alarm has been
generated, there are two ways to proceed. After the alarm acknowledgement, either
the setting limit can be raised to a higher value or the accumulated value can be
decreased to a smaller value or to zero. In any case, if the accumulated value is still
higher than the setting value and the previous alarm has been acknowledged, the next
breaker open command will issue a new alarm.
2.4 Resetting
The operation indications of the function block can be reset via the general parameter
F001V011 or the push-button C on the front panel of the MMI, which both affect all
function blocks.
6
Substation Automation CMBWEAR_
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for CMBWEAR1 is 187 and that for
CMBWEAR2 188.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
7
CMBWEAR_ Substation Automation
Event mask 1 V101 0...3 - 2 R/W Event mask 1 for event transmission
(E0 ... E1)
Event mask 2 V103 0...3 - 2 R/W Event mask 2 for event transmission
(E0 ... E1)
Event mask 3 V105 0...3 - 2 R/W Event mask 3 for event transmission
(E0 ... E1)
Event mask 4 V107 0...3 - 2 R/W Event mask 4 for event transmission
(E0 ... E1)
Current 1/16 V13 0...1000.00 kA 0 R/W Current value in breaker wear table
(1/16)
Wear 1/16 V14 0...10000.00 - 0 R/W Wear value in breaker wear table
(1/16)
Current 2/16 V15 0...1000.00 kA 4 R/W Current value in breaker wear table
(2/16)
8
Substation Automation CMBWEAR_
Current 3/16 V17 0...1000.00 kA 8 R/W Current value in breaker wear table
(3/16)
Wear 3/16 V18 0...10000.00 - 33 R/W Wear value in breaker wear table
(3/16)
Current 4/16 V19 0...1000.00 kA 12 R/W Current value in breaker wear table
(4/16)
Wear 4/16 V20 0...10000.00 - 92 R/W Wear value in breaker wear table
(4/16)
Current 5/16 V21 0...1000.00 kA 16 R/W Current value in breaker wear table
(5/16)
Wear 5/16 V22 0...10000.00 - 164 R/W Wear value in breaker wear table
(5/16)
Current 6/16 V23 0...1000.00 kA 20 R/W Current value in breaker wear table
(6/16)
Wear 6/16 V24 0...10000.00 - 256 R/W Wear value in breaker wear table
(6/16)
Wear 7/16 V26 0...10000.00 - 369 R/W Wear value in breaker wear table
(7/16)
Current 8/16 V27 0...1000.00 kA 28 R/W Current value in breaker wear table
(8/16)
Wear 8/16 V28 0...10000.00 - 502 R/W Wear value in breaker wear table
(8/16)
Current 9/16 V29 0...1000.00 kA 32 R/W Current value in breaker wear table
(9/16)
Wear 9/16 V30 0...10000.00 - 655 R/W Wear value in breaker wear table
(9/16)
Current 10/16 V31 0...1000.00 kA 36 R/W Current value in breaker wear table
(10/16)
Wear 10/16 V32 0...10000.00 - 829 R/W Wear value in breaker wear table
(10/16)
Current 11/16 V33 0...1000.00 kA 40 R/W Current value in breaker wear table
(11/16)
Wear 11/16 V34 0...10000.00 - 1024 R/W Wear value in breaker wear table
(11/16)
Current 12/16 V35 0...1000.00 kA 44 R/W Current value in breaker wear table
(12/16)
Wear 12/16 V36 0...10000.00 1239 R/W Wear value in breaker wear table
(12/16)
9
CMBWEAR_ Substation Automation
Wear 13/16 V38 0...10000.00 1475 R/W Wear value in breaker wear table
(13/16)
Current 14/16 V39 0...1000.00 52 R/W Current value in breaker wear table
(14/16)
Wear 14/16 V40 0...10000.00 1731 R/W Wear value in breaker wear table
(14/16)
Current 15/16 V41 0...1000.00 56 R/W Current value in breaker wear table
(15/16)
Wear 15/16 V42 0...10000.00 2007 R/W Wear value in breaker wear table
(15/16)
Current 16/16 V43 0...1000.00 60 R/W Current value in breaker wear table
(16/16)
Wear 16/16 V44 0...10000.00 2304 R/W Wear value in breaker wear table
(16/16)
3.3.2 Events
10
Substation Automation CMBWEAR_
11
1MRS100181 RE_5_ _
Issued: 10/1997
Version: D
Supervision Function of the
Data subject to change without notice
Energizing Current Input Circuit
(CMCU3)
Contents
1. Introduction .............................................................................................. 2
1.1 Application........................................................................................... 2
1.2 Input description.................................................................................. 2
1.3 Output description ............................................................................... 2
2. Description of Operation.......................................................................... 3
2.1 Configuration....................................................................................... 3
2.2 Measuring mode ................................................................................. 3
2.3 Operation criteria................................................................................. 3
2.4 Test mode ........................................................................................... 4
2.5 Registers............................................................................................. 4
2.6 Resetting............................................................................................. 5
3. Parameters and Events ............................................................................ 6
1. Introduction
1.1 Application
This document specifies the function of the phase current supervision function block
CMCU3 used in products based on the RED 500 Platform.
)LJXUH )XQFWLRQEORFNV\PERORI&0&8
2
ABB Automation CMCU3 RE_5_ _
2.1 Configuration
When the analogue channels have been selected and configured in the dialogue box,
the inputs and outputs of the function block can be configured on a graphical
worksheet of the configuration tool. The phase currents IL1, IL2 and IL3 are connected
to the corresponding IL1, IL2 and IL3 inputs of the function block and, in the same
way, the digital outputs of the function block are connected to the output signals.
The function block supervises the energizing circuits by comparing the measured
phase currents. If one or two phase currents exceed the setting High limit, while the
measured phase current in the remaining one or two phases is below the setting Low
limit, the output ALARM is activated after the settable alarm delay.
The function block is disabled if all input currents are below the setting Low limit.
The ALARM output will reset automatically when the fault disappears.
3
RE_5_ _ CMCU3 ABB Automation
)LJXUH %DVLFEORFNGLDJUDPRIWKH&0&8IXQFWLRQEORFN
The user can activate the ALARM output of the function block with the control
parameter Test ALARM either locally via the MMI or externally via the serial
communication.
2.5 Registers
The function block records the phase current values required for later fault analysis at
the moment of the supervision alarm, i.e. when the set operate time delay (parameter
Alarm delay) has elapsed.
4
ABB Automation CMCU3 RE_5_ _
2.6 Resetting
The user does not need to acknowledge the ALARM output signal but it resets
automatically when the fault disappears.
Operation Recorded
indicators data
1)
Parameter F181V013 X
2)
General parameter F001V011 X
2)
General parameter F001V013 X X
2)
Push-button C X
2)
Push-buttons C + E (5 s) X X
1)
Resets the recorded data of the CMCU3 function block.
2)
Affects all function blocks.
5
RE_5_ _ CMCU3 ABB Automation
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for CMCU3 is 181.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
6
ABB Automation CMCU3 RE_5_ _
High limit V3 10...20 % In 12 R/W High limit for phase current supervision
Low limit V4 2...8 % In 6 R/W Low limit for phase current supervision
Event mask 1 V101 0...3 - 3 R/W Event mask 1 for event transmission
(E0 ... E1)
Event mask 2 V103 0...3 - 3 R/W Event mask 2 for event transmission
(E0 ... E1)
Event mask 3 V105 0...3 - 3 R/W Event mask 3 for event transmission
(E0 ... E1)
Event mask 4 V107 0...3 - 3 R/W Event mask 4 for event transmission
(E0 ... E1)
1)
Operation mode 0 = In use; 1 = Not in use
2)
Current selection 1 = L1 & L2 & L3; 2 = L1 & L2; 3 = L1 & L3; 4 = L2 & L3
3)
Test alarm 0 = Do not activate; 1 = Activate
7
RE_5_ _ CMCU3 ABB Automation
3.3.6 Events
8
ABB Automation CMCU3 RE_5_ _
9
1MRS752358-MUM CMCU3
Issued: 10/1997
Version: E/1.2.2002
Supervision Function of the
Data subject to change without notice
Energizing Current Input Circuit
Contents
1. Introduction .............................................................................................. 2
1.1 Application........................................................................................... 2
1.2 Input description.................................................................................. 2
1.3 Output description ............................................................................... 2
2. Description of Operation.......................................................................... 3
2.1 Configuration....................................................................................... 3
2.2 Measuring mode ................................................................................. 3
2.3 Operation criteria................................................................................. 3
2.4 Test mode ........................................................................................... 4
2.5 Registers............................................................................................. 4
2.6 Resetting............................................................................................. 5
3. Parameters and Events ............................................................................ 6
1. Introduction
1.1 Application
This document specifies the function of the phase current supervision function block
CMCU3 used in products based on the RED 500 Platform.
)LJXUH )XQFWLRQEORFNV\PERORI&0&8
2
Substation Automation CMCU3
2.1 Configuration
When the analogue channels have been selected and configured in the dialogue box,
the inputs and outputs of the function block can be configured on a graphical
worksheet of the configuration tool. The phase currents IL1, IL2 and IL3 are connected
to the corresponding IL1, IL2 and IL3 inputs of the function block and, in the same
way, the digital outputs of the function block are connected to the output signals.
The function block supervises the energizing circuits by comparing the measured
phase currents. If one or two phase currents exceed the setting High limit, while the
measured phase current in the remaining one or two phases is below the setting Low
limit, the output ALARM is activated after the settable alarm delay.
The function block is disabled if all input currents are below the setting Low limit.
The ALARM output will reset automatically when the fault disappears.
3
CMCU3 Substation Automation
)LJXUH %DVLFEORFNGLDJUDPRIWKH&0&8IXQFWLRQEORFN
The user can activate the ALARM output of the function block with the control
parameter Test ALARM either locally via the MMI or externally via the serial
communication.
2.5 Registers
The function block records the phase current values required for later fault analysis at
the moment of the supervision alarm, i.e. when the set operate time delay (parameter
Alarm delay) has elapsed.
4
Substation Automation CMCU3
2.6 Resetting
The user does not need to acknowledge the ALARM output signal but it resets
automatically when the fault disappears.
Operation Recorded
indicators data
1)
Parameter F181V013 X
2)
General parameter F001V011 X
2)
General parameter F001V013 X X
2)
Push-button C X
2)
Push-buttons C + E (5 s) X X
1)
Resets the recorded data of the CMCU3 function block.
2)
Affects all function blocks.
5
CMCU3 Substation Automation
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for CMCU3 is 181.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
6
Substation Automation CMCU3
High limit V3 10...20 % In 12 R/W High limit for phase current supervision
Low limit V4 2...8 % In 6 R/W Low limit for phase current supervision
Event mask 1 V101 0...3 - 3 R/W Event mask 1 for event transmission
(E0 ... E1)
Event mask 2 V103 0...3 - 3 R/W Event mask 2 for event transmission
(E0 ... E1)
Event mask 3 V105 0...3 - 3 R/W Event mask 3 for event transmission
(E0 ... E1)
Event mask 4 V107 0...3 - 3 R/W Event mask 4 for event transmission
(E0 ... E1)
1)
Operation mode 0 = Not in use; 1 = In use
2)
Current selection 1 = L1 & L2 & L3; 2 = L1 & L2; 3 = L1 & L3; 4 = L2 & L3
3)
Test alarm 0 = Do not activate; 1 = Activate
7
CMCU3 Substation Automation
3.3.6 Events
8
Substation Automation CMCU3
9
1MRS752359-MUM CMGAS1
Issued: 10/1997
Version: C/1.2.2002
Gas Pressure Monitoring
Data subject to change without notice
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 2
1.4 Output description ............................................................................... 2
2. Description of Operation.......................................................................... 3
2.1 Operation criteria................................................................................. 3
2.2 Alarm acknowledgement ..................................................................... 3
2.3 Resetting............................................................................................. 3
1. Introduction
1.1 Features
1.2 Application
This document specifies the function of the gas pressure monitoring function block
CMGAS1 used in products based on the RED 500 Platform.
A digital input can be used for monitoring the gas pressure. When the gas pressure
drops below the acceptable limit, the digital signal becomes active (active low) and
triggers the alarm signal. The alarm signal cannot be acknowledged before the breaker
poles have been refilled to the correct pressure.
)LJXUH )XQFWLRQEORFNV\PERORI&0*$6
2
Substation Automation CMGAS1
The GAS signal indicates the gas pressure: an active signal (FALSE) indicates a fault
condition, whereas an inactive signal (TRUE) indicates the correct gas pressure. The
function block will activate the ALARM signal when the specific alarm delay has
elapsed after the falling edge of the GAS signal. In order to activate the ALARM
signal, the gas pressure should remain FALSE throughout the alarm delay.
The alarm cannot be acknowledged if the GAS input is FALSE. The alarm signal
acknowledgement deactivates the active alarm signal of the function block. The alarm
signal can be acknowledged by the rising edge of the ACK signal, or by the local
menu command or the remote command. Separate events are not generated by the
acknowledgement because it deactivates the ALARM signal and an event is generated
by the deactivation.
2.3 Resetting
The operation indications of the function block can be reset via the general parameter
F001V011 or the push-button C on the front panel of the MMI, which both affect all
function blocks.
3
CMGAS1 Substation Automation
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for CMGAS1 is 186.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
4
Substation Automation CMGAS1
5
CMGAS1 Substation Automation
3.3.3 Events
6
Substation Automation CMGAS1
B -
7
1MRS752359-MUM CMGAS1
Issued: 10/1997
Version: D/12.3.2002
Gas Pressure Monitoring
Data subject to change without notice
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 2
1.4 Output description ............................................................................... 2
2. Description of Operation.......................................................................... 3
2.1 Operation criteria................................................................................. 3
2.2 Alarm acknowledgement ..................................................................... 3
2.3 Resetting............................................................................................. 3
1. Introduction
1.1 Features
1.2 Application
This document specifies the function of the gas pressure monitoring function block
CMGAS1 used in products based on the RED 500 Platform.
A digital input can be used for monitoring the gas pressure. When the gas pressure
drops below the acceptable limit, the digital signal becomes active (active low) and
triggers the alarm signal. The alarm signal cannot be acknowledged before the breaker
poles have been refilled to the correct pressure.
)LJXUH )XQFWLRQEORFNV\PERORI&0*$6
2
Substation Automation CMGAS1
The GAS signal indicates the gas pressure: an active signal (FALSE) indicates a fault
condition, whereas an inactive signal (TRUE) indicates the correct gas pressure. The
function block will activate the ALARM signal when the specific alarm delay has
elapsed after the falling edge of the GAS signal. In order to activate the ALARM
signal, the gas pressure should remain FALSE throughout the alarm delay.
The alarm cannot be acknowledged if the GAS input is FALSE. The alarm signal
acknowledgement deactivates the active alarm signal of the function block. The alarm
signal can be acknowledged by the rising edge of the ACK signal, or by the local
menu command or the remote command. Separate events are not generated by the
acknowledgement because it deactivates the ALARM signal and an event is generated
by the deactivation.
2.3 Resetting
The operation indications of the function block can be reset via the general parameter
F001V011 or the push-button C on the front panel of the MMI, which both affect all
function blocks.
3
CMGAS1 Substation Automation
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for CMGAS1 is 186.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
4
Substation Automation CMGAS1
5
CMGAS1 Substation Automation
3.3.3 Events
6
Substation Automation CMGAS1
B -
7
1MRS752360-MUM CMGAS3
Issued: 3/2000
Version: A/1.2.2002
Three-Pole Gas Pressure Monitoring
Data subject to change without notice
Contents
1 Introduction ....................................................................................2
1.1 Features.......................................................................................... 2
1.2 Application ...................................................................................... 2
1.3 Input description.............................................................................. 2
1.4 Output description ........................................................................... 2
2 Description of Operation...............................................................3
4 Technical Data................................................................................7
CMGAS3 Substation Automation
1 Introduction
1.1 Features
Monitors the gas pressure of the three circuit-breaker poles
Issues an alarm signal if the gas pressure is invalid
1.2 Application
This document specifies the function of the three-pole gas pressure monitoring
function block CMGAS3 used in products based on the RED 500 Platform.
Three digital inputs are used for monitoring the SF6 gas pressure. When the gas
pressure drops below the acceptable limit, the falling edge of a digital signal triggers
and activates an alarm signal. The alarm signal cannot be acknowledged before the
breaker poles have been refilled to the correct pressure.
)LJXUH )XQFWLRQEORFNV\PERORI&0*$6
2
Substation Automation CMGAS3
2 Description of Operation
The digital signals GAS_L1, GAS_L2 and GAS_L3 indicate the gas pressure of each
pole: an active signal (FALSE) indicates a fault condition, whereas an inactive signal
(TRUE) indicates the correct gas pressure. The function block will activate the
ALARM signal when the specific alarm delay has elapsed after the falling edge of any
of the GAS_L1..3 signals. In order to activate the ALARM signal, the gas pressure
should remain FALSE throughout the alarm delay.
After an alarm is detected, an indication on the MMI is activated telling which pole of
the circuit breaker is damaged or needs to be refilled with gas, and the corresponding
event is sent.
2.2 Resetting
The operation indications of the function block can be reset via the general parameter
F001V011 or the push-button C on the front panel of the MMI, which both affect all
function blocks.
The alarm cannot be acknowledged if any of the GAS_L1..3 inputs is FALSE. The
alarm signal acknowledgement deactivates the active alarm signal of the function
block. The alarm signal can be acknowledged by the rising edge of the ACK signal, or
by the local menu command or the remote command. Separate events are not
generated by the acknowledgement because it deactivates the ALARM signal and an
event is generated by the deactivation.
3
CMGAS3 Substation Automation
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for CMGAS3 is 194.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
4
Substation Automation CMGAS3
5
CMGAS3 Substation Automation
3.3.3 Events
Code Weighting Default mask Event reason Event state
coefficient
E0 1 0 Low gas pressure alarm Reset
E1 2 1 Low gas pressure alarm Activated
E2 4 0 Low gas pressure warning L1 Inactive
E3 8 1 Low gas pressure warning L1 Active
E4 16 0 Low gas pressure warning L2 Inactive
E5 32 1 Low gas pressure warning L2 Active
E6 64 0 Low gas pressure warning L3 Inactive
E7 128 1 Low gas pressure warning L3 Active
6
Substation Automation CMGAS3
4 Technical Data
Configuration data Task execution interval (Relay Configuration Tool):
100 ms (recommended) at the rated frequency fn = 50 Hz
7
1MRS752360-MUM CMGAS3
Issued: 3/2000
Version: B/12.3.2002
Three-Pole Gas Pressure Monitoring
Data subject to change without notice
Contents
1 Introduction ....................................................................................2
1.1 Features.......................................................................................... 2
1.2 Application ...................................................................................... 2
1.3 Input description.............................................................................. 2
1.4 Output description ........................................................................... 2
2 Description of Operation...............................................................3
4 Technical Data................................................................................7
CMGAS3 Substation Automation
1 Introduction
1.1 Features
Monitors the gas pressure of the three circuit-breaker poles
Issues an alarm signal if the gas pressure is invalid
1.2 Application
This document specifies the function of the three-pole gas pressure monitoring
function block CMGAS3 used in products based on the RED 500 Platform.
Three digital inputs are used for monitoring the SF6 gas pressure. When the gas
pressure drops below the acceptable limit, the falling edge of a digital signal triggers
and activates an alarm signal. The alarm signal cannot be acknowledged before the
breaker poles have been refilled to the correct pressure.
)LJXUH )XQFWLRQEORFNV\PERORI&0*$6
2
Substation Automation CMGAS3
2 Description of Operation
The digital signals GAS_L1, GAS_L2 and GAS_L3 indicate the gas pressure of each
pole: an active signal (FALSE) indicates a fault condition, whereas an inactive signal
(TRUE) indicates the correct gas pressure. The function block will activate the
ALARM signal when the specific alarm delay has elapsed after the falling edge of any
of the GAS_L1..3 signals. In order to activate the ALARM signal, the gas pressure
should remain FALSE throughout the alarm delay.
After an alarm is detected, an indication on the MMI is activated telling which pole of
the circuit breaker is damaged or needs to be refilled with gas, and the corresponding
event is sent.
2.2 Resetting
The operation indications of the function block can be reset via the general parameter
F001V011 or the push-button C on the front panel of the MMI, which both affect all
function blocks.
The alarm cannot be acknowledged if any of the GAS_L1..3 inputs is FALSE. The
alarm signal acknowledgement deactivates the active alarm signal of the function
block. The alarm signal can be acknowledged by the rising edge of the ACK signal, or
by the local menu command or the remote command. Separate events are not
generated by the acknowledgement because it deactivates the ALARM signal and an
event is generated by the deactivation.
3
CMGAS3 Substation Automation
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for CMGAS3 is 194.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
4
Substation Automation CMGAS3
5
CMGAS3 Substation Automation
3.3.3 Events
Code Weighting Default mask Event reason Event state
coefficient
E0 1 0 Low gas pressure alarm Reset
E1 2 1 Low gas pressure alarm Activated
E2 4 0 Low gas pressure warning L1 Inactive
E3 8 1 Low gas pressure warning L1 Active
E4 16 0 Low gas pressure warning L2 Inactive
E5 32 1 Low gas pressure warning L2 Active
E6 64 0 Low gas pressure warning L3 Inactive
E7 128 1 Low gas pressure warning L3 Active
6
Substation Automation CMGAS3
4 Technical Data
Alarm delay accuracy 0.5% of set value or 150 ms
7
1MRS752361-MUM CMSCHED
Issued: 10/1997
Version: C/1.2.2002
Scheduled Maintenance
Data subject to change without notice
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 2
1.4 Output description ............................................................................... 2
2. Description of Operation.......................................................................... 3
2.1 Operation criteria................................................................................. 3
2.2 Registers............................................................................................. 3
2.3 Alarm acknowledgement ..................................................................... 4
2.4 Resetting............................................................................................. 4
1. Introduction
1.1 Features
1.2 Application
This document specifies the function of the scheduled maintenance CMSCHED used
in products based on the RED 500 Platform.
)LJXUH )XQFWLRQEORFNV\PERORI&06&+('
2
Substation Automation CMSCHED
The function block activates the ALARM output whenever the accumulated number
of days is greater than or equal to the setting value of the Alarm interval parameter
and when the time set for the Alarm time parameter is passed. The alarm time
specifies the moment of day when the alarm is generated.
The function block memorizes internally the real time clock (RTC) date at the
moment when the alarm is acknowledged and then compares the memorized value to
the current value of the RTC to calculate the number of days passed. This process is
susceptible to the real time clock synchronization that may be done through external
communication. Due to synchronization, for example while connecting the unit to the
communication network, the RTC may suddenly jump to a new, possibly very
different value and cause false alarms. The initial value of the memorized date will
also be the RTC time during the configuration downloading. Therefore, if the unit is
disconnected from the clock source and reset before the configuration process, the
initial value may be incorrect.
If an alarm condition is detected, the function block issues detailed alarm indications
both locally on the MMI and remotely via serial communication.
2.2 Registers
The Elapsed time parameter indicates the number of days passed since last
acknowledgement. If the alarm is active but it is not acknowledged, the day counter
will continue counting up until acknowledgement, which is when the counter is reset
to zero.
3
CMSCHED Substation Automation
The alarm signal acknowledgement deactivates the active alarm signal of the function
block. The alarm signal can be acknowledged by the rising edge of the ACK signal, or
by the local menu command or the remote command. Separate events are not
generated by the acknowledgement because it deactivates the ALARM signal and an
event is generated by the deactivation.
2.4 Resetting
The operation indications of the function block can be reset via the general parameter
F001V011 or the push-button C on the front panel of the MMI, which both affect all
function blocks.
4
Substation Automation CMSCHED
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for CMSCHED is 189.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
5
CMSCHED Substation Automation
Alarm time S2 00.00...23.59 hh.mm 08.00 R/W Interrupt clock time in format
hh.mm
3.3.2 Events
6
Substation Automation CMSCHED
C -
7
1MRS752362-MUM CMSPRC1
Issued: 10/1997
Version: C/1.2.2002
Spring Charging Control 1
Data subject to change without notice
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 3
2. Description of Operation.......................................................................... 4
2.1 Configuration....................................................................................... 4
2.2 Operation criteria................................................................................. 4
2.3 Alarm acknowledgement ..................................................................... 5
2.4 Resetting............................................................................................. 5
1. Introduction
1.1 Features
1.2 Application
This document specifies the function of the spring charging control CMSPRC1 used
in products based on the RED 500 Platform.
The relay is itself able to control the spring charging. One digital input is needed to
ensure that the spring has been charged.
)LJXUH )XQFWLRQEORFNV\PERORI&0635&
2
Substation Automation CMSPRC1
3
CMSPRC1 Substation Automation
2.1 Configuration
The system provides two modes for spring charging, both of which are triggered by
the START pin. The first mode always causes a fixed pulse width, while the second
mode cuts the pulse when the digital input indicates a charged spring or when the
maximum pulse width has been reached.
The rising edge of the START signal triggers the charging process and activates the
MOTORON output. The charging time can be either fixed or dynamic, depending on
the configuration mode. If the charging time is zero, the START signal is only used as
a reference for charging time measurements and the MOTORON output is not
activated.
The spring charging time is the period from the moment of energizing the motor until
the moment when the proximity switch (BINCHARGE) indicates a charged spring.
The spring charging time measurement will begin only after the START signal. The
time measurement accuracy is based on the cyclic execution interval of the function
block. The function block expects a constant output relay delay and compensates it
from the measured value (compensation parameter 10 ms).
The function block monitors the spring charging time regarding the specified
minimum and maximum alarm limits and gives an alarm if the time is not within the
specified limits. The alarm functions can be disabled by setting the specific alarm
limits to zero. However, the deactivation of alarms does not block the spring charging
measurements.
CMSPRC1 has a 100 second timeout for the charging time measurement. If the
BINCHARGE input does not indicate a charged spring within 100 seconds after the
START command, the measurement is terminated and the last charging time
parameter is set to 100s. In this case, a maximum time alarm is given, provided the
alarm is not disabled.
4
Substation Automation CMSPRC1
The alarm signal acknowledgement deactivates the active alarm signals of the
function block. The alarm signals can be simultaneously acknowledged by the rising
edge of the ACK signal, or by the local menu command or the remote command.
Separate events are not generated by the acknowledgement because it deactivates the
ALARM signal and an event is generated by the deactivation.
2.4 Resetting
The operation indications of the function block can be reset via the general parameter
F001V011 or the push-button C on the front panel of the MMI, which both affect all
function blocks.
5
CMSPRC1 Substation Automation
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for CMSPRC1 is 190.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
6
Substation Automation CMSPRC1
Event mask 1 V101 0...959 - 682 R/W Event mask 1 for event transmission
(E0 ... E9)
Event mask 2 V103 0...959 - 682 R/W Event mask 2 for event transmission
(E0 ... E9)
Event mask 3 V105 0...959 - 682 R/W Event mask 3 for event transmission
(E0 ... E9)
Event mask 4 V107 0...959 - 682 R/W Event mask 4 for event transmission
(E0 ... E9)
7
CMSPRC1 Substation Automation
3.3.3 Events
E6 - - - -
8
Substation Automation CMSPRC1
9
1MRS100191 (CMTCS1) RE_5_ _
1MRS100192 (CMTCS2) Trip Circuit Supervision
Issued: 10/1997
Version: C (CMTCS_)
Data subject to change without notice
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 2
1.4 Output description ............................................................................... 2
2. Description of Operation.......................................................................... 3
2.1 Configuration....................................................................................... 3
2.2 Operation criteria................................................................................. 3
2.3 Alarm acknowledgement ..................................................................... 5
2.4 Resetting............................................................................................. 5
1. Introduction
1.1 Features
The trip coil control and measuring circuits are continuously supervised regarding
interruptions, and an alarm is issued in case of an interruption
In the RED 500 Platform, two trip output relays are provided with trip circuit
supervision
1.2 Application
This document specifies the functions of the trip circuit supervision function blocks
CMTCS1 and CMTCS2 used in products based on the RED 500 Platform. The
function blocks are identical in operation.
The function block does not perform the supervision itself but it is used as an aid for
configuration. The functional part belongs mainly to the self-supervision tasks of the
PS_ card.
)LJXUH )XQFWLRQEORFNV\PEROVRI&07&6DQG&07&6
2
ABB Automation CMTCS1 RE_5_ _
CMTCS2
2.1 Configuration
The trip circuit supervision status signals from the PS1 card (TCS1 and TCS2) can be
connected by means of the Relay Configuration Tool. The blocking signals can also
be configured by the user with the configuration tool.
The trip circuit supervision is based on the constant current injection principle. If the
resistance of the trip circuit exceeds a certain limit, e.g. because of loose contacts or
oxidation, or if the OPEN contact has welded, the voltage over the OPEN contact falls
below 20 V dc and the supervision function of the trip circuit is activated.
The supervision state (TCS1 or TCS2) is logical TRUE when the trip circuit condition
is OK and FALSE when a trip circuit fault has occurred. The TCSSTATE input is
used for monitoring the supervision state. The function block includes a delay
parameter that can be defined by the user. If the fault time exceeds the delay
parameter time, the ALARM output of the function block is activated along with the
respective notification on the MMI.
The input/output circuits are galvanically isolated from each other. The constant-
current generator forces a 1.5 mA measuring current through the circuit-breaker trip
circuit. The constant current generator is connected over the trip contact of the circuit.
The current generator for the TCS1 is connected to the terminals X4.1/12-13 and the
current generator for the TCS2 to the terminals X4.1/17-18 of the RE_ 54_ terminal.
Under no-fault conditions, the voltage over the contact of the constant current
generator must be above 20 V ac/dc.
where
3
RE_5_ _ CMTCS1 ABB Automation
CMTCS2
The resistor Rhext must be so calculated that the trip circuit supervision current
through the resistor is low enough not to influence the trip coil of the circuit breaker.
On the other hand, the voltage drop over the resistor Rhext must be low enough not to
jeopardize the operating condition presented in the formula above.
The following values are recommended for the resistor Rhext in Figure 2 below:
- Uc +
Ic TCS_
20 V CMTCS_
Rh int M
R
A
L
TCSSTATE ALARM
A
1 kW BS
Rh ext
Rs
TCSfunc
The event E3 is not sent if the object is blocked in the initial condition (after reset).
4
ABB Automation CMTCS1 RE_5_ _
CMTCS2
The ALARM output will reset automatically when the fault disappears or when the
BS signal is activated. The user cannot reset the output without disabling the function.
2.4 Resetting
The operation indications of the function block can be reset via the general parameter
F001V011 or the push-button C on the front panel of the MMI, which both affect all
function blocks.
5
RE_5_ _ CMTCS1 ABB Automation
CMTCS2
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for CMTCS1 is 191 and that for CMTCS2
192.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
6
ABB Automation CMTCS1 RE_5_ _
CMTCS2
Event mask 2 V103 0...15 - 10 R/W Event mask 2 for event transmission
(E0 ... E3)
Event mask 3 V105 0...15 - 10 R/W Event mask 3 for event transmission
(E0 ... E3)
Event mask 4 V107 0...15 - 10 R/W Event mask 4 for event transmission
(E0 ... E3)
7
RE_5_ _ CMTCS1 ABB Automation
CMTCS2
3.3.3 Events
8
ABB Automation CMTCS1 RE_5_ _
CMTCS2
B -
9
1MRS752363-MUM CMTCS_
Issued: 10/1997
Version: D/15.3.2002
Trip Circuit Supervision
Data subject to change without notice
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 2
1.4 Output description ............................................................................... 2
2. Description of Operation.......................................................................... 3
2.1 Configuration....................................................................................... 3
2.2 Operation criteria................................................................................. 3
2.3 Alarm acknowledgement ..................................................................... 5
2.4 Resetting............................................................................................. 5
1. Introduction
1.1 Features
The trip coil control and measuring circuits are continuously supervised regarding
interruptions, and an alarm is issued in case of an interruption
In the RED 500 Platform, two trip output relays are provided with trip circuit
supervision
1.2 Application
This document specifies the functions of the trip circuit supervision function blocks
CMTCS1 and CMTCS2 used in products based on the RED 500 Platform. The
function blocks are identical in operation.
The function block does not perform the supervision itself but it is used as an aid for
configuration. The functional part belongs mainly to the self-supervision tasks of the
PS_ card.
)LJXUH )XQFWLRQEORFNV\PEROVRI&07&6DQG&07&6
2
Substation Automation CMTCS_
2.1 Configuration
The trip circuit supervision status signals from the PS1 card (TCS1 and TCS2) can be
connected by means of the Relay Configuration Tool. The blocking signals can also
be configured by the user with the configuration tool.
The trip circuit supervision is based on the constant current injection principle. If the
resistance of the trip circuit exceeds a certain limit, e.g. because of loose contacts or
oxidation, or if the OPEN contact has welded, the voltage over the OPEN contact falls
below 20 V dc and the supervision function of the trip circuit is activated.
The supervision state (TCS1 or TCS2) is logical TRUE when the trip circuit condition
is OK and FALSE when a trip circuit fault has occurred. The TCSSTATE input is
used for monitoring the supervision state. The function block includes a delay
parameter that can be defined by the user. If the fault time exceeds the delay
parameter time, the ALARM output of the function block is activated along with the
respective notification on the MMI.
The input/output circuits are galvanically isolated from each other. The constant-
current generator forces a 1.5 mA measuring current through the circuit-breaker trip
circuit. The constant current generator is connected over the trip contact of the circuit.
The current generator for the TCS1 is connected to the terminals X4.1/12-13 and the
current generator for the TCS2 to the terminals X4.1/17-18 of the RE_ 54_ terminal.
Under no-fault conditions, the voltage over the contact of the constant current
generator must be above 20 V ac/dc.
where
3
CMTCS_ Substation Automation
The resistor Rhext must be so calculated that the trip circuit supervision current
through the resistor is low enough not to influence the trip coil of the circuit breaker.
On the other hand, the voltage drop over the resistor Rhext must be low enough not to
jeopardize the operating condition presented in the formula above.
The following values are recommended for the resistor Rhext in Figure 2 below:
- Uc +
Ic TCS_
20 V CMTCS_
Rh int M
R
A
L
TCSSTATE ALARM
A
1 kW BS
Rh ext
Rs
TCSfunc
The event E3 is not sent if the object is blocked in the initial condition (after reset).
4
Substation Automation CMTCS_
The ALARM output will reset automatically when the fault disappears or when the
BS signal is activated. The user cannot reset the output without disabling the function.
2.4 Resetting
The operation indications of the function block can be reset via the general parameter
F001V011 or the push-button C on the front panel of the MMI, which both affect all
function blocks.
5
CMTCS_ Substation Automation
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for CMTCS1 is 191 and that for CMTCS2
192.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
6
Substation Automation CMTCS_
Event mask 2 V103 0...15 - 10 R/W Event mask 2 for event transmission
(E0 ... E3)
Event mask 3 V105 0...15 - 10 R/W Event mask 3 for event transmission
(E0 ... E3)
Event mask 4 V107 0...15 - 10 R/W Event mask 4 for event transmission
(E0 ... E3)
7
CMTCS_ Substation Automation
3.3.3 Events
8
Substation Automation CMTCS_
B -
9
1MRS752364-MUM CMTIME_
Issued: 10/1997
Version: C/1.2.2002
Operate Time Counter for the Used
Data subject to change without notice
Operate Time (Motors)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 2
1.4 Output description ............................................................................... 2
2. Description of Operation.......................................................................... 3
2.1 Operation criteria................................................................................. 3
2.2 Registers............................................................................................. 3
2.3 Alarm acknowledgement ..................................................................... 3
2.4 Resetting............................................................................................. 3
1. Introduction
1.1 Features
1.2 Application
This document specifies the functions of the operate-time counter function blocks
CMTIME1 and CMTIME2 used in products based on the RED 500 Platform. The
function blocks are identical in operation.
Operate-time counting (in hours) is necessary e.g. for some motors. The cumulative
counting value is registered. The data for the direct digital input used for time
measurement may also be generated from the analogue sensor by discrete compare
operations.
)LJXUH )XQFWLRQEORFNV\PEROVRI&07,0(DQG&07,0(
2
Substation Automation CMTIME_
The function block measures and accumulates the operate time when the BININP
input is active. The alarm signal is activated when the accumulated time value is equal
to or greater than the alarm limit. If the values of the alarm setting parameters are
zero, the function block will only measure the accumulated operate time.
2.2 Registers
The elapsed time indicates the accumulated hours and minutes. The time values can
be set if necessary.
The alarm signal acknowledgement deactivates the active alarm signal of the function
block and resets the accumulated time values. The alarm signal can be acknowledged
by the rising edge of the ACK signal, or by the local menu command or the remote
command. Separate events are not generated by the acknowledgement because it
deactivates the ALARM signal and an event is generated by the deactivation.
The function block will internally keep track of the timing at 100 ms accuracy.
However, only the minute-level time will be available and memorized.
2.4 Resetting
The operation indications of the function block can be reset via the general parameter
F001V011 or the push-button C on the front panel of the MMI, which both affect all
function blocks.
3
CMTIME_ Substation Automation
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for CMTIME1 is 184 and that for CMTIME2
185.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
4
Substation Automation CMTIME_
Max mins S2 0...59 min 0 R/W Maximum accumulated time alarm limit
minutes
5
CMTIME_ Substation Automation
3.3.3 Events
6
Substation Automation CMTIME_
B -
7
1MRS752365-MUM CMTRAV1
Issued: 10/1997
Version: C/1.2.2002
Breaker Travel Time 1
Data subject to change without notice
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 3
2. Description of Operation.......................................................................... 4
2.1 Configuration....................................................................................... 4
2.2 Operation criteria................................................................................. 4
2.3 Register clear ...................................................................................... 5
2.4 Alarm acknowledgement ..................................................................... 5
2.5 Resetting............................................................................................. 5
3. Parameters and Events ............................................................................ 6
1. Introduction
1.1 Features
1.2 Application
This document specifies the function of the circuit-breaker travel time function block
CMTRAV1 used in products based on the RED 500 Platform.
The circuit-breaker travel time is based on measuring the time when the digital
indications of the breaker show an undefined state. The travel time tells the actual
propagation time of the pole / relative speed of the pole (speed = pole travel distance /
time). The actual opening time measurements performed inside the circuit breaker
(measures the opening time consisting of reaction time and travel time) describe both
the electrical and mechanical delays.
A typical opening travel time for a circuit breaker is about 5 ms. The function block
will issue an alarm signal if the travel time exceeds the opening time. Both the
opening and the closing have their own alarm limits.
)LJXUH )XQFWLRQEORFNV\PERORIWKHWUDYHOWLPHPHDVXUHPHQW
2
Substation Automation CMTRAV1
3
CMTRAV1 Substation Automation
2.1 Configuration
The digital inputs BINOPEN and BINCLOSE should be connected to the circuit
breaker state signals. The time inputs TIMOPEN and TIMCLOSE should be
connected to the time stamps of the corresponding digital inputs. If the time stamp
reference is not connected, the time measurement accuracy depends on the execution
interval of the function block.
The BINOPEN and BINCLOSE signals are measured and, once a change occurs, the
opening travel time or closing travel time measurements are performed. If the
measured travel time is greater than or equal to the limit values, the corresponding
alarm is given. The alarm signals remain active until the fault condition is
acknowledged.
O pen command
BI NCLOSE
BINOPEN
TIMCLOSE TIMOPEN
)LJXUH 7UDYHOWLPHPHDVXUHPHQWIRURSHQRSHUDWLRQ
4
Substation Automation CMTRAV1
Close command
BINOPEN
BINCLOSE
TI MOPEN TI MCLO SE
)LJXUH 7UDYHOWLPHPHDVXUHPHQWIRUFORVHRSHUDWLRQ
Both the open and close travel time alarms can be disabled by setting the
corresponding alarm limit values to zero. However, the function block will still
continue measuring the travel time.
The function block has a 100 second timeout in travel time measurement. If the
timeout is exceeded, the registered travel time value is set to 100 s. The corresponding
alarm ia also generated, provided the alarm is not disabled.
The last open and close travel times are registered. The registrations can be cleared
both remotely and locally.
The alarm signal acknowledgement deactivates the active alarm signals of the
function block. The alarm signals can be simultaneously acknowledged by the rising
edge of the ACK signal, or by the local menu command or the remote command.
Separate events are not generated by the acknowledgement because it deactivates the
ALARM signal and an event is generated by the deactivation.
2.5 Resetting
The operation indications of the function block can be reset via the general parameter
F001V011 or the push-button C on the front panel of the MMI, which both affect all
function blocks.
5
CMTRAV1 Substation Automation
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for CMTRAV1 is 193.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
6
Substation Automation CMTRAV1
Close alarm lim. S2 0...100.000 s 0.01 R/W Alarm limit for closing
7
CMTRAV1 Substation Automation
3.3.2 Events
8
Substation Automation CMTRAV1
9
1MRS752366-MUM CMVO3
Issued: 10/1997
Version: D/1.2.2002
Supervision of the Energizing Voltage
Data subject to change without notice Input Circuit
Contents
1. Introduction .............................................................................................. 2
1.1 Application........................................................................................... 2
1.2 Input description.................................................................................. 2
1.3 Output description ............................................................................... 2
2. Description of Operation.......................................................................... 3
2.1 Configuration....................................................................................... 3
2.2 Measuring mode ................................................................................. 3
2.3 Operation criteria................................................................................. 3
2.4 Test mode ........................................................................................... 4
2.5 Registers............................................................................................. 4
2.6 Resetting............................................................................................. 5
3. Parameters and Events ............................................................................ 6
1. Introduction
1.1 Application
This document specifies the function of the phase voltage supervision function block
CMVO3 used in products based on the RED 500 Platform.
)LJXUH )XQFWLRQEORFNV\PERORI&092
2
Substation Automation CMVO3
2.1 Configuration
When the analogue channels have been selected and configured in the dialogue box,
the inputs and outputs of the function block can be configured on a graphical
worksheet of the configuration tool. The phase-to-phase voltages U12, U23 and U31 or
the phase-to-earth voltages UL1, UL2 and UL3 are connected to the corresponding
UL1_U12, UL2_U23 and UL3_U31 inputs of the function block and, in the same
way, the digital outputs of the function block are connected to the output signals.
The function block supervises the energizing circuits by comparing the measured
voltages. If one or two voltages exceed the setting High limit, while the measured
values of the remaining one or two voltages are below the Low limit, the output
ALARM is activated after the set alarm delay.
The function block is disabled if all input voltages are below the setting Low limit.
3
CMVO3 Substation Automation
)LJXUH %DVLFEORFNGLDJUDPRIWKH&092IXQFWLRQEORFN
The user can activate the ALARM output of the function block with the control
parameter Test ALARM either locally via the MMI or externally via the serial
communication.
2.5 Registers
The function block records the voltage values required for later fault analysis at the
moment of the supervision alarm, i.e. when the set operate time delay (parameter
Alarm delay) has elapsed.
4
Substation Automation CMVO3
2.6 Resetting
The user does not need to acknowledge the ALARM output signal but it resets
automatically when the fault disappears.
Operation Recorded
indicators data
1)
Parameter F182V013 X
2)
General parameter F001V011 X
2)
General parameter F001V013 X X
2)
Push-button C X
2)
Push-buttons C + E (5 s) X X
1)
Resets the recorded data of the CMVO3 function block.
2)
Affects all function blocks.
5
CMVO3 Substation Automation
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for CMVO3 is 182.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
6
Substation Automation CMVO3
7
CMVO3 Substation Automation
3.3.6 Events
8
Substation Automation CMVO3
9
1MRS752347-MUM CO3DC _
Issued: 10/1997
Version: C/31.1.2002
Three-State Disconnector
Data subject to change without notice (3 state inputs / 4 control outputs)
Contents
1. Introduction .............................................................................................. 3
1.1 Features.............................................................................................. 3
1.2 Application........................................................................................... 3
1.3 Input description.................................................................................. 4
1.4 Output description ............................................................................... 5
2. Description of Operation.......................................................................... 6
2.1 Configuration....................................................................................... 6
2.1.1 General ...................................................................................... 6
2.1.2 Relay configuration .................................................................... 6
2.2 Operation criteria................................................................................. 7
2.2.1 Object control............................................................................. 7
2.2.2 Interlocking................................................................................. 7
2.2.3 Open operation .......................................................................... 7
2.2.4 Close operation .......................................................................... 8
2.2.5 Earth operation........................................................................... 8
2.2.6 Free operation............................................................................ 9
2.2.7 Logic command priority .............................................................. 9
2.2.8 Object state.............................................................................. 10
2.2.9 Object state validity .................................................................. 11
2.2.10 Opening, closing, earthing and freeing pulse widths................. 11
2.2.11 Opening, closing, earthing and freeing time monitoring............ 12
2.2.12 Cycle count monitoring............................................................. 12
2.2.13 Alarm signal acknowledgement................................................ 13
2.3 Interlocking bypass mode.................................................................. 13
2.4 Recordings clear ............................................................................... 13
2.5 Direct object control for remote operation.......................................... 13
2.6 Intermediate state suppression ......................................................... 14
2.7 Secured object control for remote operation...................................... 14
2.7.1 Secured object control (LON) ................................................... 14
2.7.2 Secured object control (SPA) ................................................... 17
2.8 Event logging on command handling................................................. 18
2.9 Secured object control for local operation ......................................... 18
CO3DC_ Substation Automation
3.1 General..............................................................................................19
3.2 Setting values ....................................................................................20
3.2.1 Actual settings ..........................................................................20
3.2.2 Control settings.........................................................................21
3.3 Measurement values .........................................................................23
3.3.1 Output data...............................................................................23
3.3.2 Events ......................................................................................24
4. Technical Data.........................................................................................26
2
Substation Automation CO3DC_
1. Introduction
1.1 Features
General functions:
Remote control
Secured remote control
Secured local control
Interlocking
MMI indication
Remote indication
Alarm of the maximum opening, closing, earthing and freeing (isolating) time
Special features:
1.2 Application
This document specifies the function of the three-state disconnector function blocks
CO3DC1 and CO3DC2 used in products based on the RED 500 Platform. The
function blocks are identical in operation.
The function block CO3DC_ is designed to be used for the control of a three-state
(i.e. open, close, earth) disconnector. The function block also takes care of user-
defined interlocking logics and has guaranteed opening, closing, freeing and earthing
pulse widths. The open, close, earth and undefined states of an object can be indicated
both remotely and locally by the function block. The three-state disconnector has the
same function as a basic disconnector function block plus additional controls for the
function block state.
3
CO3DC_ Substation Automation
)LJXUH )XQFWLRQEORFNV\PEROVRI&2'&DQG&2'&
4
Substation Automation CO3DC_
5
CO3DC_ Substation Automation
2.1 Configuration
2.1.1 General
The graphical presentation of the component in the MIMIC view is defined in the
Relay Mimic Editor while the logical connection to process data can be configured by
means of the Relay Configuration Tool.
The IV signal should be connected by means of the variable BixIV in the Relay
Configuration Tool. If BI1, BI2 and BI3, for example, are connected to BINOPEN,
BINCLOSE and BINEARTH, the connections shown in Figure 2 below could be used
for IV.
)LJXUH ([DPSOHRIFRQQHFWLRQVIRUWKH,9LQSXW
6
Substation Automation CO3DC_
The three-state object control is achieved by four commands. Each command has its
own interlocking enable signal that permits the operation. The command state
diagram is presented below.
Close state
CLO SE OPEN
Open st ate
FREE EARTH
Earth state
)LJXUH &RQWUROOLQJWKHWKUHHVWDWHGLVFRQQHFWRUE\IRXUFRPPDQGV
2.2.2 Interlocking
The interlocking allows open, close, earth and free operations via the signals
OPENENA, CLOSEENA, EARTHENA and FREEENA. The control operations are
allowed if the interlocking signals for the concerned operations are TRUE. By default,
the corresponding operations are not permitted provided the inputs are unconnected.
An open command can be issued locally, remotely or by the logic OPEN signal and
the corresponding actions must be enabled by the interlocking signal (OPENENA).
The function block can be controlled both via the basic remote communication and
via the local MMI. The open pulse is issued via the OOPEN output and the pulse
width can be defined by adjusting the setting parameter Open pulse.
The open operation is possible provided the object is not blocked by the interlocking
logic and the closing pulse (OCLOSE), freeing pulse (OFREE) or earthing pulse
(OEARTH) is not active. The interlocking enable signal state is checked on the rising
edge of the open signal and thus, if the interlocking signal blocks the open signal after
the rising edge, the blocking will not cancel the open operation. The secured object
control is a special case (see sections Secured object control for remote operation
7
CO3DC_ Substation Automation
and Secured object control for local operation) and does not directly affect the logic
control and the direct control of the object.
The normal open operation is enabled if the OPENENA signal is active, whereas the
logic open control is enabled if the OPENENA signal is active and the OPEN signal
rises or if both the signals are activated at the same time. If the interlocking is not
used, the OPENENA signal should be active.
A close command can be issued locally, remotely or by the logic CLOSE signal and
the corresponding actions must be enabled by the interlocking signal (CLOSEENA).
The function block can be controlled both via the basic remote communication and
via the local MMI. The close pulse is issued via the OCLOSE output and the pulse
width can be defined by adjusting the setting parameter Close pulse.
The close operation is possible provided the object is not blocked by the interlocking
logic and the opening pulse (OOPEN), freeing pulse (OFREE) or earthing pulse
(OEARTH) is not active. The interlocking enable signal state is checked on the rising
edge of the close signal. The secured object control is a special case and does not
directly affect the logic control and direct control of the object.
The normal close operation is enabled if the CLOSEENA signal is active, whereas the
logic close control is enabled if the CLOSEENA signal is active and the CLOSE
signal rises or if both the signals are activated at the same time. If the interlocking is
not used, the CLOSEENA signal should be active.
An earth command can be issued locally, remotely and by the logic (EARTH signal)
and the corresponding actions must be enabled by the interlocking (EARTHENA).
The function block can be controlled both via the basic remote communication and
via the local MMI. The earth pulse is issued via the OEARTH output and the pulse
width can be defined by adjusting the setting parameter Earth pulse.
The earth operation is possible provided the object is not blocked by the interlocking
logic and the closing pulse (OCLOSE), freeing pulse (OFREE) or opening pulse
(OOPEN) is not active. The interlocking enable signal state is checked on a rising
edge of the earth signal. The secured object control is a special case and does not
directly affect the logic control and direct control of the object.
The normal earth operation is enabled if the EARTHENA signal is active, whereas
the logic earth control is enabled if the EARTHENA signal is active and the EARTH
signal rises or if both the signals are activated at the same time. If the interlocking is
not used, the EARTHENA signal should be active.
8
Substation Automation CO3DC_
A free command can be issued locally, remotely or by the logic FREE signal and the
corresponding actions must be enabled by the interlocking signal (FREEENA). The
function block can be controlled both via the basic remote communication and via the
local MMI. The free pulse is issued via the OFREE output and the pulse width can be
defined by adjusting the setting value.
The free operation is possible provided the object is not blocked by the interlocking
logic and the closing pulse (OCLOSE), opening pulse (OOPEN) or earthing pulse
(OEARTH) is not active. The interlocking enable signal state is checked on a rising
edge of the free signal. The secured object control is a special case and does not
directly affect the logic control and direct control of the object.
The normal free operation is enabled if the FREEENA signal is active, whereas the
logic free control is enabled if the FREEENA signal is active and the FREE signal
rises or if both the signals are activated at the same time. If the interlocking is not
used, the FREEENA signal should be active.
Normally, the command priority is not a critical issue provided the interlocking
signals are strictly used. However, the design of internal control signals may cause
unexpected situations and therefore, the function block validates the logic commands
(OPEN, CLOSE, EARTH and FREE) on the rising edge and gives them a certain
priority. If the command is enabled and the output command pulse (OOPEN,
OCLOSE, OEARTH or OFREE) is not active, the command is valid and the
concerned output pulse will be started. Otherwise the command will be ignored as
shown in Figure 4 below.
OPEN
CLOSE
OOPEN
OCLOSE
)LJXUH &ORVHFRPPDQGLVQRWYDOLGDWHGEHFDXVHWKHULVLQJHGJHRFFXUVGXULQJWKH
RSHQFRPPDQGSXOVH
Cyclic state machine follows the command order described in Figure 3. For example, at
close state only the open command pulse causes state transfer. When the current state
is open, both close and earth commands are available, in which case the internal
command priority defines that earth command overruns close command.
However, the forced pulse mode (this mode is explained further on in section
Opening, closing, earthing and freeing pulse widths) means that the current object
state is not checked when the object is controlled. This means that the object can, for
9
CO3DC_ Substation Automation
example, issue an open command pulse even though the earth state is indicated. In this
case, the internal command priority will be as follows in descending order of
importance:
The object state is defined by the three digital inputs BINOPEN, BINCLOSE and
BINEARTH. The debounces and short disturbances on an input are eliminated by
filtering. The digital input filtering time can be adjusted in the relay configuration
separately for each digital input used by the function block. For further information,
refer to Technical Reference Manual, General.
The following table illustrates how the valid object states are defined. Otherwise the
object is in an undefined state.
The 3-bit state is divided into two separate 2-bit parameters OC and FE due to typical
SCADA system requirements. The OC parameter describes how the disconnector
state is related to the close position: If the disconnector is in close position, OC state
is 01. If the diconnector is in any other defined (non-travelling) position, the OC state
is 10. In a similar way, the FE parameter defines the object state in relation to the
earth state. Because of this two-fold structure, the events are also divided into two
separate groups. The following state transition diagram shows how the typical events
are sent. It should be noticed that the event transmissions of the state parameters OC
and FE are separately handled.
O C = 00 ( E3* ) F E= 00 ( E4 1*)
O C = 11 ( E2* ) F E= 11 ( E4 0*)
O C = 10 ( E0* **) O p en ( fre e) sta te F E= 10 (E 38 ***)
O C =0 0 ( E3 *) F E= 00 (E 41 *)
O C =1 1 ( E2 *) F E= 11 (E 40 *)
O C = 10 ( E0* *) Ear th s ta te F E= 01 (E 39 )
* = Event will be sent if not filtered by the setting parameter Event delay
** = Event will be sent if an event was sent about the undefined state
*** = Event will be sent if the two-bit state really changed
10
Substation Automation CO3DC_
The following table illustrates the relation between the digital inputs and the
indication parameters.
The validity of digital inputs that indicate the object state is used as additional
information in indications and event logging. The IV can be combined from the
validity of inputs BINOPEN, BINCLOSE and BINEARTH. The non-active (FALSE)
IV signal shows that the input state is valid, while an active (TRUE) signal indicates
the invalid state. The interlocking should be based on the signals OPENENA,
CLOSEENA, EARTHENA and FREEENA. Thus, if the validity information is
needed for blocking the control operations, additional user defined logic should be
used. Refer to section Opening, closing, earthing and freeing pulse widths to see
how the state affects the control command pulses.
The type of the pulse width can be defined with the setting parameter Fixed pulse.
The function block provides two modes for characterizing the opening, closing,
earthing and freeing pulse widths. The default mode (Variable pulse) causes a
variable pulse width, which means that the output pulse is deactivated when the object
state shows that the disconnector has entered the correct state. This object diagnostics
can also be registered (see next section). The fixed pulse width mode (Fixed pulse)
always uses the maximum pulse width, which is defined by a setting parameter (Open
pulse/Close pulse/Earth pulse/Free pulse) set by the user.
The state checking can be defined with the setting parameter Forced pulse. The
default mode is Forced pulse, which means that the function block will issue
enabled command pulses regardless of the present object state. Note the remark
concerning enabled state transitions in section Logic command priority. On the
other hand, if the single pulse mode is active, the object will check whether the object
state already indicates the correct position and then ignore the command and the
command pulse. If a command is given in the forced mode and the object is already in
the correct position, the maximum pulse width will be used for the operation.
11
CO3DC_ Substation Automation
Note that if the IV input indicates an invalid state of the forced pulse, the function
block will internally use the forced pulse mode regardless of the setting.
The function block measures the opening, closing, earthing and freeing time of the
object. The time measurement starts when the function block activates the specific
output pulse (OOPEN, OCLOSE, OEARTH or OFREE) and ends when the object
state indicates that the object has reached the correct state or when 100 s timeout has
elapsed. Thus, the measured time includes the reaction time plus the travel time. The
recorded time 100 s indicates an unsuccessful operation.
O OPE N
BI NCLOSE
B INOPE N
)LJXUH ([DPSOHRIWLPHPHDVXUHPHQWIRUWKHRSHQFRPPDQG
The alarm signal AOPEN, ACLOSE, AEARTH or AFREE is activated if the opening,
closing, earthing or freeing time monitoring detects a time period greater than or equal
to the alarm limit value. The opening, closing, earthing and freeing time
measurements have their own alarm limits. When an alarm condition is detected, the
function block issues detailed indications of the alarms on the MMI and via the
remote system. However, if the alarm setting limits have been set to zero by the user,
the alarm signals will not be activated. The time measurements are still carried out
even if the alarm option is disabled.
The time measurement accuracy depends on the execution interval of the function
block. The function block compensates the output relay delay and the system delays
internally by deducting them from the measured time.
The latest opening, closing, earthing and freeing times are recorded. Additionally, the
function block records the maximum opening, closing, earthing and freeing times.
These recordings can be cleared all at a time by the command Regist clear.
A three-state object has two cycle counters, for open cycles and for earth cycles
(parameters Open cycles and Earth cycles). The first one indicates the transition
between the open and close states and the latter one between the open and earth states.
Cycle count values will be incremented by one when the digital input state changes
indicate a complete cycle. Generally, one cycle between the open and close states is:
close command -> closed -> open command -> opened. Correspondingly, one cycle
12
Substation Automation CO3DC_
between the earth and open states is: free command -> opened -> earth command ->
earthed.
The active alarm signals of the function block are deactivated by acknowledgement or
by the next successful operation. The alarm signals can be simultaneously
acknowledged by the rising edge of the ACK signal or by a local menu command or a
remote command. If the ACK signal is continuously active, new alarms are still
recognized and the corresponding alarm signals are activated. Acknowledged alarm
signals will be reactivated once the same error condition is encountered again.
The following table describes supported monitoring alarm outputs and how they are
acknowledged:
The measured values recorded can be reset locally and remotely via object-related
clear commands.
Via remote communication, the open, close, earth and free commands can be issued to
the object directly without pre-selection. A direct command is possible if the control
13
CO3DC_ Substation Automation
position and interlocking signals allow the operation. The event E24 or E25 is
generated by the command success.
If the state of an object is changed to undefined state, the state change event (E2 or
E3) can be delayed by a certain time value defined by the parameter Event delay.
The event is appropriate for alarm purposes because it can be sent to inform that the
circuit breaker has not reached the correct state within a reasonable time. If the
correct state is reached within the defined delay, the corresponding state change event
is not sent at all.
Command authority - Ensures that the command source is authorized to operate the
object
Mutual exclusion - Ensures that only one command source at a time can control
the object
Interlocking - Allows only safe commands
Execution - Supervises command execution
The virtual LON input and output connections can be configured in the Relay
Configuration Tool while the actual LON network connections of the corresponding
signals are defined in the LNT tool.
During the selection step, the horizontal interlocking signals (virtual LON inputs) are
refreshed in order to guarantee the signal integrity. The refresh operation is executed
only provided the LON is selected as a communication protocol (parameter V18 at
channel 1) and the command timeout (parameter V19 at channel 1) is 1.5s or more.
The actual time for updating the virtual LON inputs is the command timeout minus
200ms. If the command timeout is less than 1.5s, the secured object control is
accomplished as described in paragraph Secured object control (SPA) below.
14
Substation Automation CO3DC_
1. Select command
The command source is identified from the LON message
3. Wait 200 ms
Activating the BLOCK input can inhibit the operation and cause a response
(stage 6)
5. Calculate interlocking
6. Response
The event ack (acknowledged, E25) or nack (not acknowledged, E24) as a
response to the select command
Message of the ack or nack to the remote system
SYS COM
6 1
2
Feeder Feeder Feeder
terminal terminal terminal
15
CO3DC_ Substation Automation
8. Execute command
The command source identified from the LON message
In case of a wrong command source, the object will respond with nack
9. Calculate interlocking
If the interlocking state inhibits the operation, the execution will branch to stage 11
Activating the BLOCK input can inhibit the operation and cause a response
(stage 11)
11. Response
The event ack (acknowledged, E25) or nack (not acknowledged, E24) as a
response to the execute command
Message of the ack or nack to the remote system
SYS COM
11 8
14
13
Feeder Feeder Feeder
terminal terminal terminal
16
Substation Automation CO3DC_
If the configuration does not support horizontal communication via LON, the
following command handling scheme is applied instead of the one described above:
1. Select command
Message of the ack or nack to the remote system according to the present
interlocking state
2. Command reservation
The object will activate the RESERVE output
The RESERVE output is automatically deactivated when the BLOCK signal is
activated
External RESERVE logic is configuration-dependent
3. Wait 200 ms
Activating the BLOCK input can inhibit the operation and cause a response
(stage 6)
4. Calculate interlocking
5. Response
The event ack (acknowledged, E25) or nack (not acknowledged, E24) as a
response to the select command
7. Execute command
Message of the ack or nack to the remote system according to the present
interlocking state
8. Calculate interlocking
If the interlocking state inhibits the operation, the execution will branch to stage 10
Activating the BLOCK input can forbid the operation and cause an execution
branch to stage10
9. Perform command
Start the output pulse
17
CO3DC_ Substation Automation
10. Response
The event ack (acknowledged, E25) or nack (not acknowledged, E24) as a
response to the execute command
The following facts should be considered regarding the logging of command handling
events. The command nack (E24) or ack (E25) will always follow the given local or
remote command. They should be considered as user interface responses. An
unsuccessful event (E28) is generated as a result of commands issued by digital
inputs i.e. when a conflict occurs due to an interlocking enable signal or when the
forced mode is not selected and a command is given that requires the option.
18
Substation Automation CO3DC_
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for CO3DC1 is 139 and that for CO3DC2 140.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
19
CO3DC_ Substation Automation
Event delay S3 0.000...60.000 s 0.100 R/W Event delay for undefined state
Earth pulse S20 0.04...100.000 s 0.100 R/W Earthing time pulse width
Earth alarm S21 0.00...100.000 s 10.000 R/W Earthing time alarm limit
Free pulse S22 0.04...100.000 s 0.100 R/W Freeing time pulse width
Free alarm S23 0.00...100.000 s 10.000 R/W Freeing time alarm limit
1)
Fixed pulse 0 = Variable pulse; 1 = Fixed pulse
2)
Forced pulse 0 = Single pulse; 1 = Forced pulse
20
Substation Automation CO3DC_
21
CO3DC_ Substation Automation
Event mask 1A V101 0...3742367743 - 2282401535 R/W Event mask 1 for event
transmission (E0 ... E31)
Event mask 1B V102 0...16383 - 16362 R/W Event mask 1 for event
transmission (E32 ... E45)
Event mask 2A V103 0...3742367743 - 2282401535 R/W Event mask 2 for event
transmission (E0 ... E31)
Event mask 2B V104 0...16383 - 16362 R/W Event mask 2 for event
transmission (E32 ... E45)
Event mask 3A V105 0...3742367743 - 2282401535 R/W Event mask 3 for event
transmission (E0 ... E31)
Event mask 3B V106 0...16383 - 16362 R/W Event mask 3 for event
transmission (E32 ... E45)
Event mask 4A V107 0...3742367743 - 2282401535 R/W Event mask 4 for event
transmission (E0 ... E31)
Event mask 4B V108 0...16383 - 16362 R/W Event mask 4 for event
transmission (E32 ... E45)
1)
Open/Close state 0 = Undefined (00); 1 = Close (01); 2 = Open (10); 3 = Undefined (11)
2)
Free/Earth state 0 = Undefined (00); 1 = Earth (01); 2 = Free (10); 3 = Undefined (11)
3)
Interlocking 0 = Enabled; 1 = Interlocked
4)
IV state 0 = Valid; 1 = Invalid
5)
Block state 0 = Inactive; 1 = Active
6)
Summarized stat 10-bit vector consisting of the bit values of
[RESERVE BLOCK FREEENA EARTHENA OPENENA CLOSEENA IV
BINEARTH BINOPEN BINCLOSE]:
RESERVE = 512
BLOCK = 256
FREEENA = 128
EARTHENA = 64
OPENENA = 32
CLOSEENA = 16
IV = 8
BINEARTH = 4
BINOPEN = 2
BINCLOSE = 1
For example, if RESERVE = TRUE, BINOPEN = TRUE and the rest = FALSE,
the 10-bit vector is [1000000010] and the parameter gets the value 514
22
Substation Automation CO3DC_
23
CO3DC_ Substation Automation
3.3.2 Events
Events 0...31
24
Substation Automation CO3DC_
Events 32...45
25
CO3DC_ Substation Automation
26
1MRS100120 (COCB1) RE_5_ _
1MRS100121 (COCB2) Circuit Breaker
Issued: 10/1997
Version: C (2 state inputs/ 2 control inputs)
Data subject to change without notice (COCB1, COCB2)
Contents
1. Introduction .............................................................................................. 3
1.1 Features.............................................................................................. 3
1.2 Application........................................................................................... 3
1.3 Input description.................................................................................. 4
1.4 Output description ............................................................................... 5
2. Description of Operation.......................................................................... 6
2.1 Configuration....................................................................................... 6
2.1.1 General ...................................................................................... 6
2.1.2 Relay configuration .................................................................... 6
2.2 Operation criteria................................................................................. 7
2.2.1 Interlocking................................................................................. 7
2.2.2 Protective open .......................................................................... 7
2.2.3 Open operation .......................................................................... 8
2.2.4 Close operation .......................................................................... 8
2.2.5 Logic command priority .............................................................. 9
2.2.6 Object state................................................................................ 9
2.2.7 Object state validity .................................................................. 10
2.2.8 Opening and closing pulse width.............................................. 10
2.2.9 Opening and closing time monitoring ....................................... 10
2.2.10 Inactive time monitoring ........................................................... 12
2.2.11 Cycle count monitoring............................................................. 12
2.2.12 Alarm signal acknowledgement................................................ 12
2.3 Interlocking bypass mode.................................................................. 13
2.4 Recordings clear ............................................................................... 13
2.5 Direct object control for remote operation.......................................... 13
2.6 Intermediate state suppression ......................................................... 14
2.7 Secured object control for remote operation...................................... 14
2.7.1 Secured object control (LON) ................................................... 14
2.7.2 Secured object control (SPA) ................................................... 17
2.7.3 Event logging on command handling........................................ 18
2.8 Secured object control for local operation ......................................... 18
3. Parameters and Events .......................................................................... 19
RE_5_ _ COCB1 ABB Automation
COCB2
3.1 General..............................................................................................19
3.2 Setting values ....................................................................................20
3.2.1 Actual settings ..........................................................................20
3.2.2 Control settings.........................................................................21
3.3 Measurement values .........................................................................22
3.3.1 Output data...............................................................................22
3.3.2 Events ......................................................................................23
4. Technical Data.........................................................................................24
2
ABB Automation COCB1 RE_5_ _
COCB2
1. Introduction
1.1 Features
General functions:
Remote control
Secured remote control
Secured local control
Interlocking
MMI indication
Remote indication
Alarm of maximum opening and closing time
Alarm of cycle count exceeding and inactive time
Special features:
1.2 Application
This document specifies the function of the two circuit-breaker function blocks
COCB1 and COCB2 used in products based on the RED 500 Platform. The function
blocks are identical in operation.
The function block can be used for controlling the open and close states of a circuit
breaker, disconnector or an earthing switch. The function block also takes care of the
user-defined interlocking logics and has guaranteed opening and closing pulse widths
and forced open control operations for protection purposes. The open, close and
undefined states of an object can be indicated both remotely and locally by the
function block. Since the function block is mainly designed for circuit breakers, it will
issue specific alarm signals based on the condition monitoring features.
3
RE_5_ _ COCB1 ABB Automation
COCB2
)LJXUH )XQFWLRQEORFNV\PEROVRI&2&%DQG&2&%
4
ABB Automation COCB1 RE_5_ _
COCB2
5
RE_5_ _ COCB1 ABB Automation
COCB2
2.1 Configuration
2.1.1 General
The graphical presentation of the component in the MIMIC view is defined in the
Relay Mimic Editor while the logical connection to process data can be configured by
means of the Relay Configuration Tool.
The time stamp values TIMOPEN and TIMCLOSE of the input signals BINOPEN
and BINCLOSE and the IV signal should be connected by means of the variables
BixTime and BixIV in the Relay Configuration Tool. If, for example, BI1 and
BI2 are connected to BINOPEN and BINCLOSE, the connections shown in Figure 2
below could be used for TIMOPEN, TIMCLOSE and IV.
)LJXUH ([DPSOHRIFRQQHFWLRQVIRUWKH,97,023(1DQG7,0&/26(LQSXWV
6
ABB Automation COCB1 RE_5_ _
COCB2
2.2.1 Interlocking
The interlocking allows open and close operations via the OPENENA and
CLOSEENA signals. The control operations are allowed if the interlocking signals for
the concerned operations are TRUE. By default, the corresponding operations are not
permitted provided the inputs are unconnected.
The OPENDIR input (Direct open) can be used for protection purposes. This input
should not be confused with the direct open command (parameter V4 in control
settings) that can be given via serial communication. A rising edge (note that
command signals are edge triggered) on the active OPENDIR input causes an OOPEN
pulse that overrides the OCLOSE control pulse. The OPENENA signal does not
affect the protective open operation.
)LJXUH 'LUHFW3527(&7,9(B23(1RXWSXWUHOD\FRQQHFWLRQ
However, this kind of configuration should be used with caution because the close
signal outputs from COCB are only blocked until the PROTECTIVE_OPEN signal
becomes non-active (for further clarification, see Figure 4). Thus, external logic
7
RE_5_ _ COCB1 ABB Automation
COCB2
cannot prevent the close outputs from being activated. The close pulse activation
during an active PROTECTIVE_OPEN signal can only be eliminated by connecting
PROTECTIVE_OPEN also to the OPENDIR input. For more information, see
sections Opening and closing pulse width and Opening and closing time
monitoring.
PROTECTIVE_OPEN
OUTPUT_RELAY_CLOSE
cocbprot.CNV
OUTPUT_RELAY_CLOSE_ALARM
)LJXUH ([DPSOHVLJQDOVUHODWHGWRWKHFRQILJXUDWLRQFRQQHFWLRQVLQ)LJXUH
An open command can be issued locally, remotely or by the logic OPEN signal and
the corresponding actions must be enabled by the interlocking signal (OPENENA).
The function block can be controlled both via the basic remote communication and
via the local MMI. The open pulse is issued via the OOPEN output and the pulse
width can be defined by adjusting the actual setting parameter Open pulse.
The open operation is possible provided the object is not blocked by the interlocking
logic and the closing pulse OCLOSE is not active. In case that open operation is
attempted while OCLOSE is still active, object selection shows the message Open
enable in the MIMIC view. However, the opening operation causes interlocked state
until OCLOSE is deactivated. The interlocking enable signal state is checked on the
rising edge of the open signal and thus, if the interlocking signal blocks the open
signal after the rising edge, the blocking will not cancel the open operation. The
secured object control is a special case (see sections Secured object control for
remote operation and Secured object control for local operation) and does not
directly affect the logic control and the direct control of the object.
In contrast to protective open, the normal open operation is enabled if the OPENENA
signal is active, whereas the logic open control is enabled if the OPENENA signal is
active and the OPEN signal rises or if both the signals are activated at the same time.
If the interlocking is not used, the OPENENA signal should be active.
A close command can be issued locally, remotely or by the logic CLOSE signal and
the corresponding action must be enabled by the interlocking signal (CLOSEENA).
The function block can be controlled both via the basic remote communication and
via the local MMI. The close pulse is issued via the OCLOSE output and the pulse
width can be defined by adjusting the setting parameter Close pulse.
8
ABB Automation COCB1 RE_5_ _
COCB2
The close operation is possible provided the object is not blocked by the interlocking
logic and the opening pulse OOPEN is not active (see also section Open operation).
The interlocking enable signal state is checked on the rising edge of the close signal.
The secured object control is a special case and does not directly affect the logic
control and direct control of the object.
The normal close operation is enabled if the CLOSEENA signal is active, whereas the
logic close control is enabled if the CLOSEENA signal is active and the CLOSE
signal rises or if both the signals are activated at the same time. If the interlocking is
not used, the CLOSEENA signal should be active.
Normally, the command priority is not a critical issue provided the interlocking
signals are strictly used. However, the design of internal control signals may cause
unexpected situations and therefore, the function block validates the logic commands
(OPEN, CLOSE) on the rising edge and gives them a certain priority. If the command
is enabled and the output pulse (OOPEN, OCLOSE) is not active, the command is
valid and the concerned output pulse will be started. Otherwise the command will be
ignored as shown in Figure 5 below.
OPEN
CLOSE
OOPEN
OCLOSE
)LJXUH &ORVHFRPPDQGLVQRWYDOLGDWHGEHFDXVHWKHULVLQJHGJHRFFXUVGXULQJWKH
RSHQFRPPDQGSXOVH
The internal command priority determines that the open command takes priority over
the close command. However, the OPENDIR signal on rising edge has the highest
priority and the command pulse for opening is always started. (Note that if the forced
pulse mode is not selected (i.e., selection is single pulse mode) and the object is
already in open state, the opening pulse will not be completed).
The object state is defined by the two digital inputs BINOPEN and BINCLOSE. The
debounces and short disturbances on an input are eliminated by filtering. The digital
input filtering time can be adjusted in the relay configuration separately for each
digital input used by the function block. For further information, refer to Technical
Reference Manual, General.
9
RE_5_ _ COCB1 ABB Automation
COCB2
The validity of digital inputs that indicate the object state is used as additional
information in indications and event logging. The IV signal is combined from the
validity of inputs BINOPEN and BINCLOSE. The non-active (FALSE) IV signal
shows that the input state is valid, while an active (TRUE) signal indicates the invalid
state. The interlocking is based on the signals OPENENA and CLOSEENA. Thus, if
the validity information is needed for blocking the control operations, additional user-
defined logic should be used. Refer to section Opening and closing pulse width to
see how the state affects the control command pulses.
The type of the pulse width can be defined with the setting parameter Fixed pulse.
The function block provides two modes for characterizing the opening and closing
pulse widths. The default mode (Variable pulse) causes variable pulse width, which
means that the output pulse is deactivated when the object state shows that the
disconnector or circuit breaker has entered the correct state. This object diagnostics
can also be registered (see next section). The fixed pulse width mode (Fixed pulse)
always uses maximum pulse width, which is defined by a setting parameter (Open
pulse/Close pulse) set by the user.
The state checking can be defined with the setting parameter Forced pulse. The
default mode is Forced pulse, which means that the function block will issue
enabled command pulses regardless of the present object state. However, if the
Single pulse mode is active, the object will check whether the object state already
indicates the correct position so that it can ignore the command and the command
pulse. However, the steady LED indicator for control interlocking is on for 30
seconds unless new select operation is done. If a command is given in the forced
mode and the object is already in the correct position, the maximum pulse width
(setting parameter Open pulse/Close pulse) will be used for the operation.
Note that if the IV input indicates an invalid state of the forced pulse, the function
block will internally use the forced pulse mode regardless of the setting.
The function block measures the opening and closing time of the object. The time
measurement starts when the function block activates the specific output pulse
(OOPEN or OCLOSE) and ends when the object state indicates that the object has
reached the correct state or when 100 s timeout has elapsed. Thus, the measured time
10
ABB Automation COCB1 RE_5_ _
COCB2
includes the reaction time plus the travel time. The recorded time 100 s indicates an
unsuccessful operation. See the description for the function block CMTRAV1 for
further information about the travelling time measurements. Note that the diagnostic
measurements start when the object itself issues the open command. Therefore, the
OPENDIR input is used for activating the time measurement for protective functions,
which is illustrated in Figure 6 below.
)LJXUH ([DPSOHRIFRQQHFWLRQIRUWKH23(1',5LQSXWZKHQWLPHPHDVXUHPHQWLV
XVHGIRUSURWHFWLRQIXQFWLRQV
OOPEN
BINCLOSE
BINOPEN
TIMOPEN
OCLO SE
BINOPEN
BINCLOSE
TI MCLO SE
)LJXUH 7LPHPHDVXUHPHQWIRURSHQDQGFORVHFRPPDQGV
11
RE_5_ _ COCB1 ABB Automation
COCB2
The alarm signal AOPEN or ACLOSE is activated if the opening or closing time
monitoring detects a time period greater than or equal to the alarm limit value. Both
the opening and closing time measurements have their own alarm limits (Open
alarm/Close alarm). When an alarm condition is detected, the function block issues
detailed indications of the alarms on the MMI and via the remote system. However, if
the alarm setting limits have been set to zero by the user, the alarm signals will not be
activated. The time measurements are still carried out even if the alarm option is
disabled.
The inputs TIMOPEN and TIMCLOSE are used for the time measurements of the
function block. The process data tells the exact change times of the rising (and
falling) edge(s) of each input and guarantees thus the time measurement accuracy
regardless of the function block execution interval. However, if the time inputs are not
connected, the time measurement accuracy depends on the execution interval of the
function block. The function block compensates the output relay delay and the system
delays internally by deducting them from the measured time. The parameters Open
compens and Close compens are used for compensating the specific output relay
delays of the opening and closing relays.
The latest opening time and closing time are recorded. Additionally, the function
block records the maximum opening and closing times. The recordings can be cleared
all at a time by the command Regist clear.
The inactive time calculation is performed for the open and close states of the objects.
If the inactive time value (in days) is greater than or equal to the limit value (Inactive
alarm) and the specified alarm moment (Alarm time, exact time value that day) is
at hand, the alarm signal AINACT and the respective notifications (alarm text on
MMI and remote alarm indications) will be activated. However, if the alarm setting
limits have been set to zero by the user, the alarm signals will not be activated.
The cycle count value will be incremented when the digital input state changes
indicate a full cycle. Generally, one cycle is: close command -> closed -> open
command -> opened. If the cycle counter value is greater than or equal to the limit
value (parameter Cycle alarm), an alarm signal (ACYCLES) and the respective
notifications (alarm text on MMI and remote alarm indications) will be activated.
However, if the alarm setting limits have been set to zero by the user, the alarm
signals will not be activated.
The alarm signal acknowledgement deactivates all active alarm signals of the function
block. The alarm signals can be simultaneously acknowledged by the rising edge of
the ACK signal, by a local menu command or by a remote command. If the ACK
12
ABB Automation COCB1 RE_5_ _
COCB2
signal is continuously active, new alarms are recognized and the corresponding alarm
signals are activated. Alarm signals remain active until the user acknowledges them
and resets the corresponding measured value (e.g. cycle count) by entering a new
value or until the next successful operation occurs.
Acknowledged alarm signals will be re-activated when the same error condition is
encountered again. The user should reset the appropriate alarm limit in order to get rid
of the particular alarm. The circuit breaker cycle counter, for example, will issue the
alarm signal continuously whenever a cycle count is increased over the cycle alarm
parameter value until the user resets the process cycle count value.
The following table describes supported monitoring alarm outputs and how they are
acknowledged:
The measured values recorded can be reset locally and remotely via object-related
clear commands.
Via remote communication, open and close commands can be issued to the object
directly without pre-selection. A direct command is possible if the control position
and interlocking signals allow the operation. The event E24 or E25 is generated
depending on the command success.
13
RE_5_ _ COCB1 ABB Automation
COCB2
If the state of an object is changed to undefined state, the state change event (E2 or
E3) can be delayed by a certain time value defined by the parameter Event delay.
The event is appropriate for alarm purposes because it can be sent to inform that the
circuit breaker has not reached the correct state within a reasonable time. If the
correct state is reached within the defined delay, the corresponding state change event
is not sent at all.
Command authority - Ensures that the command source is authorized to operate the
object
Mutual exclusion - Ensures that only one command source at a time can control
the object
Interlocking - Allows only safe commands
Execution - Supervises command execution
The virtual LON input and output connections can be configured in the Relay
Configuration Tool while the actual LON network connections of the corresponding
signals are defined in the LNT tool.
During the selection step, the horizontal interlocking signals (virtual LON inputs) are
refreshed in order to guarantee the signal integrity. The refresh operation is executed
only provided the LON is selected as a communication protocol (parameter V18 at
channel 1) and the command timeout (parameter V19 at channel 1) is 1.5s or more.
The actual time for updating the virtual LON inputs is the command timeout minus
200 ms. If the command timeout is less than 1.5s, the secured object control is
accomplished as described in paragraph Secured object control (SPA) below.
14
ABB Automation COCB1 RE_5_ _
COCB2
1. Select command
The command source is identified from the LON message
3. Wait 200 ms
Activating the BLOCK input can inhibit the operation and cause a response
(stage 6)
5. Calculate interlocking
6. Response
The event ack (acknowledged, E25) or nack (not acknowledged, E24) as a
response to the select command
Message of the ack or nack to the remote system
SYS COM
6 1
2
Feeder Feeder Feeder
terminal terminal terminal
15
RE_5_ _ COCB1 ABB Automation
COCB2
8. Execute command
The command source identified from the LON message
In case of a wrong command source, the object will respond with nack
9. Calculate interlocking
If the interlocking state inhibits the operation, the execution will branch to stage 11
Activating the BLOCK input can inhibit the operation and cause a response
(stage 11)
11. Response
The event ack (acknowledged, E25) or nack (not acknowledged, E24) as a
response to the execute command
Message of the ack or nack to the remote system
SYS COM
11 8
14
13
Feeder Feeder Feeder
terminal terminal terminal
16
ABB Automation COCB1 RE_5_ _
COCB2
If the configuration does not support horizontal communication via LON, the
following command handling scheme is applied instead of the one described above:
1. Select command
Message of the ack or nack to the remote system according to the present
interlocking state
2. Command reservation
The object will activate the RESERVE output
The RESERVE output is automatically deactivated when the BLOCK signal is
activated
External RESERVE logic is configuration-dependent
3. Wait 200 ms
Activating the BLOCK input can inhibit the operation and cause a response
(stage 6)
4. Calculate interlocking
5. Response
The event ack (acknowledged, E25) or nack (not acknowledged, E24) as a
response to the select command
7. Execute command
Message of the ack or nack to the remote system according to the present
interlocking state
8. Calculate interlocking
If the interlocking state inhibits the operation, the execution will branch to stage 10
Activating the BLOCK input can forbid the operation and cause an execution
branch to stage 10
9. Perform command
Start the output pulse
17
RE_5_ _ COCB1 ABB Automation
COCB2
10. Response
The event ack (acknowledged, E25) or nack (not acknowledged, E24) as a
response to the execute command
The following facts should be considered regarding the logging of command handling
events. The command nack (E24) or ack (E25) will always follow the given local or
remote command. They should be considered as user interface responses. An
unsuccessful event (E28) is generated as a result of commands issued by digital
inputs i.e. when a conflict occurs due to an interlocking enable signal or when the
forced mode is not selected and a command is given that requires the option.
18
ABB Automation COCB1 RE_5_ _
COCB2
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for COCB1 is 120 and that for COCB2 121.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
19
RE_5_ _ COCB1 ABB Automation
COCB2
Event delay S3 0.000...60.000 s 0.200 R/W Event delay for undefined state
Inactive alarm S10 0...1825 days 1825 R/W Inactive time alarm limit
Cycle alarm S11 0...10000 - 5000 R/W Cycle count alarm limit
Open compens S12 0.000...0.020 s 0.007 R/W Output relay delay compensation
parameter for opening time
measurements
Close compens S13 0.000...0.020 s 0.007 R/W Output relay delay compensation
parameter for closing time
measurements
1)
Fixed pulse 0 = Variable pulse; 1 = Fixed pulse
2)
Forced pulse 0 = Single pulse; 1 = Forced pulse
20
ABB Automation COCB1 RE_5_ _
COCB2
Alarm time V40 0.00...23.59 - 8.00 R/W Inactive time alarm time
setting
21
RE_5_ _ COCB1 ABB Automation
COCB2
Event mask 2 V103 0...536870911 - 145403647 R/W Event mask 2 for event
transmission (E0 ... E28)
Event mask 3 V105 0...536870911 - 145403647 R/W Event mask 3 for event
transmission (E0 ... E28)
Event mask 4 V107 0...536870911 - 145403647 R/W Event mask 4 for event
transmission (E0 ... E28)
Last change V41 0...2000000000 - 2000000000 R/M Object state change time
(internally used)
1)
Object state 0 = Undefined (00); 1 = Close (01); 2 = Open (10); 3 = Undefined (11)
2)
Interlock close/open 1 = Interlocked; 0 = Enabled
3)
IV state 0 = Valid; 1 = Invalid
4)
Block state 0 = Inactive; 1 = Active
5)
Summarized stat 10-bit vector consisting of the bit values of
[RESERVE BLOCK 0 0 OPENENA CLOSEENA IV 0 BINOPEN BINCLOSE]:
RESERVE = 512
BLOCK = 256
OPENENA = 32
CLOSEENA = 16
IV = 8
BINOPEN = 2
BINCLOSE = 1
For example, if RESERVE = TRUE, BINOPEN = TRUE and the rest = FALSE,
the 10-bit vector is [1000000010] and the parameter gets the value 514
22
ABB Automation COCB1 RE_5_ _
COCB2
3.3.2 Events
23
RE_5_ _ COCB1 ABB Automation
COCB2
24
1MRS752348-MUM COCB_
Issued: 10/1997
Version: D/11.2.2002
Circuit Breaker
Data subject to change without notice (2 state inputs/ 2 control inputs)
Contents
1. Introduction .............................................................................................. 3
1.1 Features.............................................................................................. 3
1.2 Application........................................................................................... 3
1.3 Input description.................................................................................. 4
1.4 Output description ............................................................................... 5
2. Description of Operation.......................................................................... 6
2.1 Configuration....................................................................................... 6
2.1.1 General ...................................................................................... 6
2.1.2 Relay configuration .................................................................... 6
2.2 Operation criteria................................................................................. 7
2.2.1 Interlocking................................................................................. 7
2.2.2 Protective open .......................................................................... 7
2.2.3 Open operation .......................................................................... 8
2.2.4 Close operation .......................................................................... 8
2.2.5 Logic command priority .............................................................. 9
2.2.6 Object state................................................................................ 9
2.2.7 Object state validity .................................................................. 10
2.2.8 Opening and closing pulse width.............................................. 10
2.2.9 Opening and closing time monitoring ....................................... 10
2.2.10 Inactive time monitoring ........................................................... 12
2.2.11 Cycle count monitoring............................................................. 12
2.2.12 Alarm signal acknowledgement................................................ 12
2.3 Interlocking bypass mode.................................................................. 13
2.4 Recordings clear ............................................................................... 13
2.5 Direct object control for remote operation.......................................... 13
2.6 Intermediate state suppression ......................................................... 14
2.7 Secured object control for remote operation...................................... 14
2.7.1 Secured object control (LON) ................................................... 14
2.7.2 Secured object control (SPA) ................................................... 17
2.7.3 Event logging on command handling........................................ 18
2.8 Secured object control for local operation ......................................... 18
3. Parameters and Events .......................................................................... 19
COCB_ Substation Automation
3.1 General..............................................................................................19
3.2 Setting values ....................................................................................20
3.2.1 Actual settings ..........................................................................20
3.2.2 Control settings.........................................................................21
3.3 Measurement values .........................................................................22
3.3.1 Output data...............................................................................22
3.3.2 Events ......................................................................................23
4. Technical Data.........................................................................................24
2
Substation Automation COCB_
1. Introduction
1.1 Features
General functions:
Remote control
Secured remote control
Secured local control
Interlocking
MMI indication
Remote indication
Alarm of maximum opening and closing time
Alarm of cycle count exceeding and inactive time
Special features:
1.2 Application
This document specifies the function of the two circuit-breaker function blocks
COCB1 and COCB2 used in products based on the RED 500 Platform. The function
blocks are identical in operation.
The function block can be used for controlling the open and close states of a circuit
breaker, disconnector or an earthing switch. The function block also takes care of the
user-defined interlocking logics and has guaranteed opening and closing pulse widths
and forced open control operations for protection purposes. The open, close and
undefined states of an object can be indicated both remotely and locally by the
function block. Since the function block is mainly designed for circuit breakers, it will
issue specific alarm signals based on the condition monitoring features.
3
COCB_ Substation Automation
)LJXUH )XQFWLRQEORFNV\PEROVRI&2&%DQG&2&%
4
Substation Automation COCB_
5
COCB_ Substation Automation
2.1 Configuration
2.1.1 General
The graphical presentation of the component in the MIMIC view is defined in the
Relay Mimic Editor while the logical connection to process data can be configured by
means of the Relay Configuration Tool.
The time stamp values TIMOPEN and TIMCLOSE of the input signals BINOPEN
and BINCLOSE and the IV signal should be connected by means of the variables
BixTime and BixIV in the Relay Configuration Tool. If, for example, BI1 and
BI2 are connected to BINOPEN and BINCLOSE, the connections shown in Figure 2
below could be used for TIMOPEN, TIMCLOSE and IV.
)LJXUH ([DPSOHRIFRQQHFWLRQVIRUWKH,97,023(1DQG7,0&/26(LQSXWV
6
Substation Automation COCB_
2.2.1 Interlocking
The interlocking allows open and close operations via the OPENENA and
CLOSEENA signals. The control operations are allowed if the interlocking signals for
the concerned operations are TRUE. By default, the corresponding operations are not
permitted provided the inputs are unconnected.
The OPENDIR input (Direct open) can be used for protection purposes. This input
should not be confused with the direct open command (parameter V4 in control
settings) that can be given via serial communication. A rising edge (note that
command signals are edge triggered) on the active OPENDIR input causes an OOPEN
pulse that overrides the OCLOSE control pulse. The OPENENA signal does not
affect the protective open operation.
)LJXUH 'LUHFW3527(&7,9(B23(1RXWSXWUHOD\FRQQHFWLRQ
However, this kind of configuration should be used with caution because the close
signal outputs from COCB are only blocked until the PROTECTIVE_OPEN signal
becomes non-active (for further clarification, see Figure 4). Thus, external logic
7
COCB_ Substation Automation
cannot prevent the close outputs from being activated. The close pulse activation
during an active PROTECTIVE_OPEN signal can only be eliminated by connecting
PROTECTIVE_OPEN also to the OPENDIR input. For more information, see
sections Opening and closing pulse width and Opening and closing time
monitoring.
PROTECTIVE_OPEN
OUTPUT_RELAY_CLOSE
cocbprot.CNV
OUTPUT_RELAY_CLOSE_ALARM
)LJXUH ([DPSOHVLJQDOVUHODWHGWRWKHFRQILJXUDWLRQFRQQHFWLRQVLQ)LJXUH
An open command can be issued locally, remotely or by the logic OPEN signal and
the corresponding actions must be enabled by the interlocking signal (OPENENA).
The function block can be controlled both via the basic remote communication and
via the local MMI. The open pulse is issued via the OOPEN output and the pulse
width can be defined by adjusting the actual setting parameter Open pulse.
The open operation is possible provided the object is not blocked by the interlocking
logic and the closing pulse OCLOSE is not active. In case that open operation is
attempted while OCLOSE is still active, object selection shows the message Open
enable in the MIMIC view. However, the opening operation causes interlocked state
until OCLOSE is deactivated. The interlocking enable signal state is checked on the
rising edge of the open signal and thus, if the interlocking signal blocks the open
signal after the rising edge, the blocking will not cancel the open operation. The
secured object control is a special case (see sections Secured object control for
remote operation and Secured object control for local operation) and does not
directly affect the logic control and the direct control of the object.
In contrast to protective open, the normal open operation is enabled if the OPENENA
signal is active, whereas the logic open control is enabled if the OPENENA signal is
active and the OPEN signal rises or if both the signals are activated at the same time.
If the interlocking is not used, the OPENENA signal should be active.
A close command can be issued locally, remotely or by the logic CLOSE signal and
the corresponding action must be enabled by the interlocking signal (CLOSEENA).
The function block can be controlled both via the basic remote communication and
via the local MMI. The close pulse is issued via the OCLOSE output and the pulse
width can be defined by adjusting the setting parameter Close pulse.
8
Substation Automation COCB_
The close operation is possible provided the object is not blocked by the interlocking
logic and the opening pulse OOPEN is not active (see also section Open operation).
The interlocking enable signal state is checked on the rising edge of the close signal.
The secured object control is a special case and does not directly affect the logic
control and direct control of the object.
The normal close operation is enabled if the CLOSEENA signal is active, whereas the
logic close control is enabled if the CLOSEENA signal is active and the CLOSE
signal rises or if both the signals are activated at the same time. If the interlocking is
not used, the CLOSEENA signal should be active.
Normally, the command priority is not a critical issue provided the interlocking
signals are strictly used. However, the design of internal control signals may cause
unexpected situations and therefore, the function block validates the logic commands
(OPEN, CLOSE) on the rising edge and gives them a certain priority. If the command
is enabled and the output pulse (OOPEN, OCLOSE) is not active, the command is
valid and the concerned output pulse will be started. Otherwise the command will be
ignored as shown in Figure 5 below.
OPEN
CLOSE
OOPEN
OCLOSE
)LJXUH &ORVHFRPPDQGLVQRWYDOLGDWHGEHFDXVHWKHULVLQJHGJHRFFXUVGXULQJWKH
RSHQFRPPDQGSXOVH
The internal command priority determines that the open command takes priority over
the close command. However, the OPENDIR signal on rising edge has the highest
priority and the command pulse for opening is always started. (Note that if the forced
pulse mode is not selected (i.e., selection is single pulse mode) and the object is
already in open state, the opening pulse will not be completed).
The object state is defined by the two digital inputs BINOPEN and BINCLOSE. The
debounces and short disturbances on an input are eliminated by filtering. The digital
input filtering time can be adjusted in the relay configuration separately for each
digital input used by the function block. For further information, refer to Technical
Reference Manual, General.
9
COCB_ Substation Automation
The validity of digital inputs that indicate the object state is used as additional
information in indications and event logging. The IV signal is combined from the
validity of inputs BINOPEN and BINCLOSE. The non-active (FALSE) IV signal
shows that the input state is valid, while an active (TRUE) signal indicates the invalid
state. The interlocking is based on the signals OPENENA and CLOSEENA. Thus, if
the validity information is needed for blocking the control operations, additional user-
defined logic should be used. Refer to section Opening and closing pulse width to
see how the state affects the control command pulses.
The type of the pulse width can be defined with the setting parameter Fixed pulse.
The function block provides two modes for characterizing the opening and closing
pulse widths. The default mode (Variable pulse) causes variable pulse width, which
means that the output pulse is deactivated when the object state shows that the
disconnector or circuit breaker has entered the correct state. This object diagnostics
can also be registered (see next section). The fixed pulse width mode (Fixed pulse)
always uses maximum pulse width, which is defined by a setting parameter (Open
pulse/Close pulse) set by the user.
The state checking can be defined with the setting parameter Forced pulse. The
default mode is Forced pulse, which means that the function block will issue
enabled command pulses regardless of the present object state. However, if the
Single pulse mode is active, the object will check whether the object state already
indicates the correct position so that it can ignore the command and the command
pulse. However, the steady LED indicator for control interlocking is on for 30
seconds unless new select operation is done. If a command is given in the forced
mode and the object is already in the correct position, the maximum pulse width
(setting parameter Open pulse/Close pulse) will be used for the operation.
Note that if the IV input indicates an invalid state of the forced pulse, the function
block will internally use the forced pulse mode regardless of the setting.
The function block measures the opening and closing time of the object. The time
measurement starts when the function block activates the specific output pulse
(OOPEN or OCLOSE) and ends when the object state indicates that the object has
reached the correct state or when 100 s timeout has elapsed. Thus, the measured time
10
Substation Automation COCB_
includes the reaction time plus the travel time. The recorded time 100 s indicates an
unsuccessful operation. See the description for the function block CMTRAV1 for
further information about the travelling time measurements. Note that the diagnostic
measurements start when the object itself issues the open command. Therefore, the
OPENDIR input is used for activating the time measurement for protective functions,
which is illustrated in Figure 6 below.
)LJXUH ([DPSOHRIFRQQHFWLRQIRUWKH23(1',5LQSXWZKHQWLPHPHDVXUHPHQWLV
XVHGIRUSURWHFWLRQIXQFWLRQV
OOPEN
BINCLOSE
BINOPEN
TIMOPEN
OCLO SE
BINOPEN
BINCLOSE
TI MCLO SE
)LJXUH 7LPHPHDVXUHPHQWIRURSHQDQGFORVHFRPPDQGV
11
COCB_ Substation Automation
The alarm signal AOPEN or ACLOSE is activated if the opening or closing time
monitoring detects a time period greater than or equal to the alarm limit value. Both
the opening and closing time measurements have their own alarm limits (Open
alarm/Close alarm). When an alarm condition is detected, the function block issues
detailed indications of the alarms on the MMI and via the remote system. However, if
the alarm setting limits have been set to zero by the user, the alarm signals will not be
activated. The time measurements are still carried out even if the alarm option is
disabled.
The inputs TIMOPEN and TIMCLOSE are used for the time measurements of the
function block. The process data tells the exact change times of the rising (and
falling) edge(s) of each input and guarantees thus the time measurement accuracy
regardless of the function block execution interval. However, if the time inputs are not
connected, the time measurement accuracy depends on the execution interval of the
function block. The function block compensates the output relay delay and the system
delays internally by deducting them from the measured time. The parameters Open
compens and Close compens are used for compensating the specific output relay
delays of the opening and closing relays.
The latest opening time and closing time are recorded. Additionally, the function
block records the maximum opening and closing times. The recordings can be cleared
all at a time by the command Regist clear.
The inactive time calculation is performed for the open and close states of the objects.
If the inactive time value (in days) is greater than or equal to the limit value (Inactive
alarm) and the specified alarm moment (Alarm time, exact time value that day) is
at hand, the alarm signal AINACT and the respective notifications (alarm text on
MMI and remote alarm indications) will be activated. However, if the alarm setting
limit (Inactive alarm, S10) has been set to zero by the user, the alarm signal will not
be activated.
The cycle count value will be incremented when the digital input state changes
indicate a full cycle. Generally, one cycle is: close command -> closed -> open
command -> opened. If the cycle counter value is greater than or equal to the limit
value (parameter Cycle alarm), an alarm signal (ACYCLES) and the respective
notifications (alarm text on MMI and remote alarm indications) will be activated.
However, if the alarm setting limits have been set to zero by the user, the alarm
signals will not be activated.
The alarm signal acknowledgement deactivates all active alarm signals of the function
block. The alarm signals can be simultaneously acknowledged by the rising edge of
12
Substation Automation COCB_
the ACK signal, by a local menu command or by a remote command. If the ACK
signal is continuously active, new alarms are recognized and the corresponding alarm
signals are activated. Alarm signals remain active until the user acknowledges them
and resets the corresponding measured value (e.g. cycle count) by entering a new
value or until the next successful operation occurs.
Acknowledged alarm signals will be re-activated when the same error condition is
encountered again. The user should reset the appropriate alarm limit in order to get rid
of the particular alarm. The circuit breaker cycle counter, for example, will issue the
alarm signal continuously whenever a cycle count is increased over the cycle alarm
parameter value until the user resets the process cycle count value.
The following table describes supported monitoring alarm outputs and how they are
acknowledged:
The measured values recorded can be reset locally and remotely via object-related
clear commands.
Via remote communication, open and close commands can be issued to the object
directly without pre-selection. A direct command is possible if the control position
and interlocking signals allow the operation. The event E24 or E25 is generated
depending on the command success.
13
COCB_ Substation Automation
If the state of an object is changed to undefined state, the state change event (E2 or
E3) can be delayed by a certain time value defined by the parameter Event delay.
The event is appropriate for alarm purposes because it can be sent to inform that the
circuit breaker has not reached the correct state within a reasonable time. If the
correct state is reached within the defined delay, the corresponding state change event
is not sent at all.
Command authority - Ensures that the command source is authorized to operate the
object
Mutual exclusion - Ensures that only one command source at a time can control
the object
Interlocking - Allows only safe commands
Execution - Supervises command execution
The virtual LON input and output connections can be configured in the Relay
Configuration Tool while the actual LON network connections of the corresponding
signals are defined in the LNT tool.
During the selection step, the horizontal interlocking signals (virtual LON inputs) are
refreshed in order to guarantee the signal integrity. The refresh operation is executed
only provided the LON is selected as a communication protocol (parameter V18 at
channel 1) and the command timeout (parameter V19 at channel 1) is 1.5s or more.
The actual time for updating the virtual LON inputs is the command timeout minus
200 ms. If the command timeout is less than 1.5s, the secured object control is
accomplished as described in paragraph Secured object control (SPA) below.
14
Substation Automation COCB_
1. Select command
The command source is identified from the LON message
3. Wait 200 ms
Activating the BLOCK input can inhibit the operation and cause a response
(stage 6)
5. Calculate interlocking
6. Response
The event ack (acknowledged, E25) or nack (not acknowledged, E24) as a
response to the select command
Message of the ack or nack to the remote system
SYS COM
6 1
2
Feeder Feeder Feeder
terminal terminal terminal
15
COCB_ Substation Automation
8. Execute command
The command source identified from the LON message
In case of a wrong command source, the object will respond with nack
9. Calculate interlocking
If the interlocking state inhibits the operation, the execution will branch to stage 11
Activating the BLOCK input can inhibit the operation and cause a response
(stage 11)
11. Response
The event ack (acknowledged, E25) or nack (not acknowledged, E24) as a
response to the execute command
Message of the ack or nack to the remote system
SYS COM
11 8
14
13
Feeder Feeder Feeder
terminal terminal terminal
16
Substation Automation COCB_
If the configuration does not support horizontal communication via LON, the
following command handling scheme is applied instead of the one described above:
1. Select command
Message of the ack or nack to the remote system according to the present
interlocking state
2. Command reservation
The object will activate the RESERVE output
The RESERVE output is automatically deactivated when the BLOCK signal is
activated
External RESERVE logic is configuration-dependent
3. Wait 200 ms
Activating the BLOCK input can inhibit the operation and cause a response
(stage 6)
4. Calculate interlocking
5. Response
The event ack (acknowledged, E25) or nack (not acknowledged, E24) as a
response to the select command
7. Execute command
Message of the ack or nack to the remote system according to the present
interlocking state
8. Calculate interlocking
If the interlocking state inhibits the operation, the execution will branch to stage 10
Activating the BLOCK input can forbid the operation and cause an execution
branch to stage 10
9. Perform command
Start the output pulse
17
COCB_ Substation Automation
10. Response
The event ack (acknowledged, E25) or nack (not acknowledged, E24) as a
response to the execute command
The following facts should be considered regarding the logging of command handling
events. The command nack (E24) or ack (E25) will always follow the given local or
remote command. They should be considered as user interface responses. An
unsuccessful event (E28) is generated as a result of commands issued by digital
inputs i.e. when a conflict occurs due to an interlocking enable signal or when the
forced mode is not selected and a command is given that requires the option.
18
Substation Automation COCB_
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for COCB1 is 120 and that for COCB2 121.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
19
COCB_ Substation Automation
Event delay S3 0.000...60.000 s 0.200 R/W Event delay for undefined state
Inactive alarm S10 0...1825 days 1825 R/W Inactive time alarm limit
Cycle alarm S11 0...10000 - 5000 R/W Cycle count alarm limit
Open compens S12 0.000...0.020 s 0.007 R/W Output relay delay compensation
parameter for opening time
measurements
Close compens S13 0.000...0.020 s 0.007 R/W Output relay delay compensation
parameter for closing time
measurements
1)
Fixed pulse 0 = Variable pulse; 1 = Fixed pulse
2)
Forced pulse 0 = Single pulse; 1 = Forced pulse
20
Substation Automation COCB_
Alarm time V40 0.00...23.59 - 8.00 R/W Inactive time alarm time
setting
21
COCB_ Substation Automation
Event mask 2 V103 0...536870911 - 145403647 R/W Event mask 2 for event
transmission (E0 ... E28)
Event mask 3 V105 0...536870911 - 145403647 R/W Event mask 3 for event
transmission (E0 ... E28)
Event mask 4 V107 0...536870911 - 145403647 R/W Event mask 4 for event
transmission (E0 ... E28)
Last change V41 0...2000000000 - 2000000000 R/M Object state change time
(internally used)
1)
Object state 0 = Undefined (00); 1 = Close (01); 2 = Open (10); 3 = Undefined (11)
2)
Interlock close/open 1 = Interlocked; 0 = Enabled
3)
IV state 0 = Valid; 1 = Invalid
4)
Block state 0 = Inactive; 1 = Active
5)
Summarized stat 10-bit vector consisting of the bit values of
[RESERVE BLOCK 0 0 OPENENA CLOSEENA IV 0 BINOPEN BINCLOSE]:
RESERVE = 512
BLOCK = 256
OPENENA = 32
CLOSEENA = 16
IV = 8
BINOPEN = 2
BINCLOSE = 1
For example, if RESERVE = TRUE, BINOPEN = TRUE and the rest = FALSE,
the 10-bit vector is [1000000010] and the parameter gets the value 514
22
Substation Automation COCB_
3.3.2 Events
23
COCB_ Substation Automation
24
1MRS752349-MUM COCBDIR
Issued: 10/1997
Version: C/31.1.2002
Direct Open for CBs via MMI
Data subject to change without notice
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Output description ............................................................................... 2
2. Description of Operation.......................................................................... 3
2.1 Configuration....................................................................................... 3
2.2 Operation criteria................................................................................. 3
3. Parameters and Events ............................................................................ 4
1. Introduction
1.1 Features
Provides a user-defined open pulse via the MMI push-button combination up-
arrow and 0
Can also be controlled remotely
1.2 Application
This document specifies the function of the COCBDIR function block used in
products based on the RED 500 Platform. The function block is mainly designed for
the direct open of the circuit breaker.
)LJXUH )XQFWLRQEORFNV\PEROIRUWKHGLUHFWRSHQRIWKHFLUFXLWEUHDNHU
2
Substation Automation COCBDIR
2.1 Configuration
The OPEN signal can be connected directly to the relay output signal or to the
OPENDIR input of the function block COCB1 or COCB2.
Pressing a certain button combination will cause an OPEN pulse, the duration of
which can be defined by the user.
3
COCBDIR Substation Automation
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for COCBDIR is 141.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
4
Substation Automation COCBDIR
Event mask 1 V101 0...3 - 2 R/W Event mask 1 for event transmission
(E0 ... E1)
Event mask 2 V103 0...3 - 2 R/W Event mask 2 for event transmission
(E0 ... E1)
Event mask 3 V105 0...3 - 2 R/W Event mask 3 for event transmission
(E0 ... E1)
Event mask 4 V107 0...3 - 2 R/W Event mask 4 for event transmission
(E0 ... E1)
3.3 Events
5
COCBDIR Substation Automation
B Corrected: MMI indications could not be cleared with the C button in revision A
6
1MRS752350-MUM CODC_
Issued: 10/1997
Version: C/1.2.2002
Disconnector
Data subject to change without notice (2 state inputs/ 2 control inputs)
Contents
1. Introduction .............................................................................................. 3
1.1 Features.............................................................................................. 3
1.2 Application........................................................................................... 3
1.3 Input description.................................................................................. 4
1.4 Output description ............................................................................... 4
2. Description of Operation.......................................................................... 5
2.1 Configuration....................................................................................... 5
2.1.1 General ...................................................................................... 5
2.1.2 Relay configuration .................................................................... 5
2.2 Operation criteria................................................................................. 6
2.2.1 Interlocking................................................................................. 6
2.2.2 Open operation .......................................................................... 6
2.2.3 Close operation .......................................................................... 7
2.2.4 Logic command priority .............................................................. 7
2.2.5 Object state................................................................................ 7
2.2.6 Object state validity .................................................................... 8
2.2.7 Opening and closing pulse width................................................ 8
2.2.8 Opening and closing time monitoring ......................................... 9
2.2.9 Cycle count monitoring............................................................. 10
2.2.10 Alarm signal acknowledgement................................................ 10
2.3 Interlocking bypass mode.................................................................. 10
2.4 Recordings clear ............................................................................... 10
2.5 Direct object control for remote operation.......................................... 10
2.6 Intermediate state suppression ......................................................... 11
2.7 Secured object control for remote operation...................................... 11
2.7.1 Secured object control (LON) ................................................... 11
2.7.2 Secured object control (SPA) ................................................... 14
2.7.3 Event logging on command handling........................................ 15
2.8 Secured object control for local operation ......................................... 15
3. Parameters and Events .......................................................................... 16
4. Technical Data.........................................................................................21
2
Substation Automation CODC_
1. Introduction
1.1 Features
General functions:
Remote control
Secured remote control
Secured local control
Interlocking
MMI indication
Remote indication
Alarm of the maximum opening and closing time
Special features:
1.2 Application
This document specifies the function of the five disconnector function blocks
CODC1...CODC5 used in products based on the RED 500 Platform. The function
blocks are identical in operation.
The function block CODC_ can be used for controlling the open and close states of a
disconnector or an earthing switch. The function block also takes care of the user-
defined interlocking logics and has guaranteed opening and closing pulse widths. The
open, close and undefined states of an object can be indicated both remotely and
locally by the function block.
3
CODC_ Substation Automation
)LJXUH $VDQH[DPSOHWKHIXQFWLRQEORFNV\PERORI&2'&
4
Substation Automation CODC_
2.1 Configuration
2.1.1 General
The graphical presentation of the component in the MIMIC view is defined in the
Relay Mimic Editor while the logical connection to process data can be configured by
means of the Relay Configuration Tool.
The IV signal should be connected by means of the variable BixIV in the Relay
Configuration Tool. If BI1 and BI2, for example, are connected to BINOPEN and
BINCLOSE, the connections shown in Figure 2 below could be used for IV.
)LJXUH ([DPSOHRIFRQQHFWLRQVIRUWKH,9LQSXW
5
CODC_ Substation Automation
2.2.1 Interlocking
The interlocking allows open and close operations via the signals OPENENA and
CLOSEENA. The control operations are allowed if the interlocking signals for the
concerned operations are TRUE. By default, the corresponding actions are not
permitted provided the inputs are unconnected.
An open command can be issued locally, remotely or by the logic OPEN signal, and
the corresponding actions must be enabled by the interlocking signal (OPENENA).
The function block can be controlled both via the basic remote communication and
via the local MMI. The open pulse is issued via the OOPEN output and the pulse
width can be defined by adjusting the setting parameter Open pulse.
The open operation is possible provided the object is not blocked by the interlocking
logic and the closing pulse OCLOSE is not active. In case that open operation is
attempted while OCLOSE is still active, object selection shows message Open
enable in MIMIC view. However, the opening operation causes interlocked state
until OCLOSE is deactivated. The interlocking enable signal state is checked on the
rising edge of the open signal and thus, if the interlocking signal blocks the open
signal after the rising edge, the blocking will not cancel the open operation. The
secured object control is a special case (see sections If the state of an object is
changed to undefined state, the state change event (E2 or E3) can be delayed by a
certain time value defined by the parameter Event delay. The event is appropriate
for alarm purposes because it can be sent to inform that the circuit breaker has not
reached the correct state within a reasonable time. If the correct state is reached
within the defined delay, the corresponding state change event is not sent at all.
Secured object control for remote operation and Secured object control for local
operation) and does not directly affect the logic control and the direct control of the
object.
The normal open operation is enabled if the OPENENA signal is active, whereas the
logic open control is enabled if the OPENENA signal is active and the OPEN signal
rises or if both the signals are activated at the same time. If the interlocking is not
used, the OPENENA signal should be active.
6
Substation Automation CODC_
A close command can be issued locally, remotely or by the logic CLOSE signal and
the corresponding actions must be enabled by the interlocking signal (CLOSEENA).
The function block can be controlled both via the basic remote communication and
via the local MMI. The close pulse is issued via the OCLOSE output and the pulse
width can be defined by adjusting the setting parameter Close pulse.
The close operation is possible provided the object is not blocked by the interlocking
logic and the opening pulse OOPEN is not active (see section Open operation). The
interlocking enable signal state is checked on the rising edge of the close signal. The
secured object control is a special case and does not directly affect the logic control
and direct control of the object.
The normal close operation is enabled if the CLOSEENA signal is active, whereas the
logic close control is enabled if the CLOSEENA signal is active and the CLOSE
signal rises or if both the signals are activated at the same time. If the interlocking is
not used, the CLOSEENA signal should be active.
Normally, the command priority is not a critical issue provided the interlocking
signals are strictly used. However, the design of internal control signals may cause
unexpected situations and therefore, the function block validates the logic commands
(OPEN, CLOSE) on the rising edge and gives them a certain priority. If the command
is enabled and the output pulse (OOPEN, OCLOSE) is not active, the command is
valid and the concerned output pulse will be started. Otherwise the command will be
ignored as shown in Figure 3 below.
OPEN
CLOSE
OOPEN
OCLOSE
)LJXUH &ORVHFRPPDQGLVQRWYDOLGDWHGEHFDXVHWKHULVLQJHGJHRFFXUVGXULQJWKH
RSHQFRPPDQGSXOVH
The internal command priority determines that the open command takes priority over
the close command.
The object state is defined by the two digital inputs BINOPEN and BINCLOSE. The
debounces and short disturbances on an input are eliminated by filtering. The digital
7
CODC_ Substation Automation
input filtering time can be adjusted in the relay configuration separately for each
digital input used by the function block. For further information, refer to Technical
Reference Manual, General.
The validity of digital inputs that indicate the object state is used as additional
information in indications and event logging. The IV signal is combined from the
validity of inputs BINOPEN and BINCLOSE. The non-active (FALSE) IV signal
shows that the input state is valid, while an active (TRUE) signal indicates the invalid
state. The interlocking is based on the signals OPENENA and CLOSEENA. Thus, if
the validity information is needed for blocking the control operations, additional user-
defined logic should be used. Refer to section Opening and closing pulse width to
see how the state affects the control command pulses.
The type of the pulse width can be defined with the setting parameter Fixed pulse.
The function block provides two modes for characterizing the opening and closing
pulse widths. The default mode (Variable pulse) causes variable pulse width, which
means that the output pulse is deactivated when the object state shows that the
disconnector or circuit breaker has entered the correct state. This object diagnostics
can also be registered (see next section). The fixed pulse width mode (Fixed pulse)
always uses maximum pulse width, which is defined by a setting parameter (Open
pulse/Close pulse) set by the user.
The state checking can be defined with the setting parameter Forced pulse. The
default mode is Forced pulse, which means that the function block will issue
enabled command pulses regardless of the present object state. However, if the
Single pulse mode is active, the object will check whether the object state already
indicates the correct position so that it can ignore the command and the command
pulse. However, the steady LED indicator for control interlocking is on for 30
seconds unless new select operation is done. If a command is given in the forced
mode and the object is already in the correct position, the maximum pulse width
(setting parameter Open pulse/Close pulse) will be used for the operation.
Note that if the IV input indicates an invalid state of the forced pulse, the function
block will internally use the forced pulse mode regardless of the setting.
8
Substation Automation CODC_
The function block measures the opening and closing time of the object. The time
measurement starts when the function block activates the specific output pulse
(OOPEN or OCLOSE) and ends when the object state indicates that the object has
reached the correct state or when 100 s timeout has elapsed. Thus, the measured time
includes the reaction time plus the travel time. The recorded time 100 s indicates an
unsuccessful operation.
O OPEN
BI NCLOSE
BINOPEN
OCLO SE
BINOPEN
BINCLOSE
)LJXUH 7LPHPHDVXUHPHQWIRURSHQDQGFORVHFRPPDQGV
The alarm signal AOPEN or ACLOSE is activated if the opening or closing time
monitoring detects a time period greater than or equal to the alarm limit value. Both
the opening and closing time measurements have their own alarm limits (Open
alarm/Close alarm). When an alarm condition is detected, the function block issues
detailed indications of the alarms on the MMI and via the remote system. However, if
the alarm setting limits have been set to zero by the user, the alarm signals will not be
activated. The time measurements are still carried out even if the alarm option is
disabled.
The time measurement accuracy depends on the execution interval of the function
block. The function block compensates the output relay delay and the system delays
internally by deducting them from the measured time.
The latest opening time and closing time are recorded (Last open/Last close).
Additionally, the function block records the maximum opening and closing times
(Max open/Max close). The recordings can be cleared all at a time by the command
Regist clear.
9
CODC_ Substation Automation
The cycle count value will be incremented when the digital input state changes
indicate a full cycle. Generally, one cycle is: close command -> closed -> open
command -> opened.
The active alarm signals of the function block are deactivated by acknowledgement or
by the next successful operation. The alarm signals can be simultaneously
acknowledged by the rising edge of the ACK signal or by a local menu command or a
remote command. If the ACK signal is continuously active, new alarms are still
recognized and the corresponding alarm signals are activated. Acknowledged alarm
signals will be reactivated once the same error condition is encountered again.
The following table describes supported monitoring alarm outputs and how they are
acknowledged:
The measured values recorded can be reset locally and remotely via object-related
clear commands.
Via remote communication, open and close commands can be issued to the object
directly without pre-selection. A direct command is possible if the control position
10
Substation Automation CODC_
and interlocking signals allow the operation. The event E24 or E25 is generated by the
command success.
If the state of an object is changed to undefined state, the state change event (E2 or
E3) can be delayed by a certain time value defined by the parameter Event delay.
The event is appropriate for alarm purposes because it can be sent to inform that the
circuit breaker has not reached the correct state within a reasonable time. If the
correct state is reached within the defined delay, the corresponding state change event
is not sent at all.
Command authority - Ensures that the command source is authorized to operate the
object
Mutual exclusion - Ensures that only one command source at a time can control
the object
Interlocking - Allows only safe commands
Execution - Supervises command execution
The virtual LON input and output connections can be configured in the Relay
Configuration Tool while the actual LON network connections of the corresponding
signals are defined in the LNT tool.
During the selection step, the horizontal interlocking signals (virtual LON inputs) are
refreshed in order to guarantee the signal integrity. The refresh operation is executed
only provided the LON is selected as a communication protocol (parameter V18 at
channel 1) and the command timeout (parameter V19 at channel 1) is 1.5s or more.
The actual time for updating the virtual LON inputs is the command timeout minus
200ms. If the command timeout is less than 1.5s, the secured object control is
accomplished as described in paragraph Secured object control (SPA) below.
11
CODC_ Substation Automation
1. Select command
The command source is identified from the LON message
3. Wait 200 ms
Activating the BLOCK input can inhibit the operation and cause a response
(stage 6)
5. Calculate interlocking
6. Response
The event ack (acknowledged, E25) or nack (not acknowledged, E24) as a
response to the select command
Message of the ack or nack to the remote system
SYS COM
6 1
2
Feeder Feeder Feeder
terminal terminal terminal
12
Substation Automation CODC_
8. Execute command
The command source identified from the LON message
In case of a wrong command source, the object will respond with nack
9. Calculate interlocking
If the interlocking state inhibits the operation, the execution will branch to stage 11
Activating the BLOCK input can inhibit the operation and cause a response
(stage 11)
11. Response
The event ack (acknowledged, E25) or nack (not acknowledged, E24) as a
response to the execute command
Message of the ack or nack to the remote system
SYS COM
11 8
14
13
Feeder Feeder Feeder
terminal terminal terminal
13
CODC_ Substation Automation
If the configuration does not support horizontal communication via LON, the
following command handling scheme is applied instead of the one described above:
1. Select command
Message of the ack or nack to the remote system according to the present
interlocking state
2. Command reservation
The object will activate the RESERVE output
The RESERVE output is automatically deactivated when the BLOCK signal is
activated
External RESERVE logic is configuration-dependent
3. Wait 200 ms
Activating the BLOCK input can inhibit the operation and cause a response
(stage 6)
4. Calculate interlocking
5. Response
The event ack (acknowledged, E25) or nack (not acknowledged, E24) as a
response to the select command
7. Execute command
Message of the ack or nack to the remote system according to the present
interlocking state
8. Calculate interlocking
If the interlocking state inhibits the operation, the execution will branch to stage 10
Activating the BLOCK input can forbid the operation and cause an execution
branch to stage 10
9. Perform command
Start the output pulse
14
Substation Automation CODC_
10. Response
The event ack (acknowledged, E25) or nack (not acknowledged, E24) as a
response to the execute command
The following facts should be considered regarding the logging of command handling
events. The command nack (E24) or ack (E25) will always follow the given local or
remote command. They should be considered as user interface responses. An
unsuccessful event (E28) is generated as a result of commands issued by digital
inputs i.e. when a conflict occurs due to an interlocking enable signal or when the
forced mode is not selected and a command is given that requires the option.
15
CODC_ Substation Automation
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channels for CODC_ are the following:
Function block Channel
CODC1 122
CODC2 123
CODC3 124
CODC4 125
CODC5 126
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
16
Substation Automation CODC_
Event delay S3 0.000...60.000 S 0.100 R/W Event delay for undefined state
17
CODC_ Substation Automation
18
Substation Automation CODC_
Event mask 2 V103 0...521142271 - 134917887 R/W Event mask 2 for event
transmission (E0 ... E28)
Event mask 3 V105 0...521142271 - 134917887 R/W Event mask 3 for event
transmission (E0 ... E28)
Event mask 4 V107 0...521142271 134917887 R/W Event mask 4 for event
transmission (E0 ... E28)
1)
Object state 0 = Undefined (00); 1 = Close (01); 2 = Open (10); 3 = Undefined (11)
2)
Interlocking type 1 = Interlocked; 0 = Enabled
3)
IV state 0 = Valid; 1 = Invalid
4)
Block state 0 = Inactive; 1 = Active
5)
Summarized stat 10-bit vector consisting of the bit values of
[RESERVE BLOCK 0 0 OPENENA CLOSEENA IV 0 BINOPEN BINCLOSE]:
RESERVE = 512
BLOCK = 256
OPENENA = 32
CLOSEENA = 16
IV = 8
BINOPEN = 2
BINCLOSE = 1
For example, if RESERVE = TRUE, BINOPEN = TRUE and the rest = FALSE,
the 10-bit vector is [1000000010] and the parameter gets the value 514
19
CODC_ Substation Automation
3.3.2 Events
20
Substation Automation CODC_
21
1MRS752351-MUM COIND_
Issued: 10/1997
Version: C/1.2.2002
Object Indication
Data subject to change without notice (2 state inputs)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 2
2. Description of Operation.......................................................................... 3
2.1 General ............................................................................................... 3
2.2 Configuration....................................................................................... 3
2.3 Object state......................................................................................... 4
2.4 Object state validity ............................................................................. 4
2.5 Cycle count measuring........................................................................ 4
2.6 Intermediate state suppression ........................................................... 4
3. Parameters and Events ............................................................................ 5
1. Introduction
1.1 Features
General functions:
- MMI indication
- Remote indication
1.2 Application
This document specifies the functions of the eight object indication function blocks
COIND1...COIND8 used in products based on the RED 500 Platform. The function
blocks are identical in operation.
The function block COIND_ indicates remotely and locally the open, close and
undefined states of a disconnector or an earthing switch.
)LJXUH $VDQH[DPSOHIXQFWLRQEORFNV\PERORI&2,1'
BINOPEN Digital signal (BOOL, active high) Open status of the object
BINCLOSE Digital signal (BOOL, active high) Close status of the object
IV Digital signal (BOOL, active high) Validity of object state
2
Substation Automation COIND_
2.1 General
The graphical presentation of the component in the MIMIC view is defined in the
Relay Mimic Editor while the logical connection to process data can be configured by
means of the Relay Configuration Tool.
2.2 Configuration
The IV signal should be connected by means of the variable BixIV in the Relay
Configuration Tool. If, for example, BI1 and BI2 are connected to BINOPEN and
BINCLOSE, the connections shown in figure 2 below could be used for IV.
)LJXUH ([DPSOHRIFRQQHFWLRQVIRUWKH,9LQSXW
3
COIND_ Substation Automation
The object state is defined by the two digital inputs BINOPEN and BINCLOSE. The
digital input filtering time can be adjusted in the relay configuration separately for
each digital input used by the function block.
The validity of digital inputs that indicate the object state is used as additional
information in indications and event logging. The IV can be combined from the
validity of inputs BINOPEN and BINCLOSE. A non-active signal (FALSE) shows
that the input state is valid, while an active signal indicates the invalid state.
The cycle count value is incremented by one when the digital input state changes
indicate a full cycle. Generally, one cycle is: close command closed open
command opened.
If the state of an object is changed to undefined state, the state change event (E2 or
E3) can be delayed by a certain time value defined by the parameter Event delay.
The event is appropriate for alarm purposes because it can be sent to inform that the
circuit breaker has not reached the correct state within a reasonable time. If the
correct state is reached within the defined delay, the corresponding state change event
is not sent at all.
4
Substation Automation COIND_
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channels for the object indication function blocks are
the following:
Function block Channel
COIND1 127
COIND2 128
COIND3 129
COIND4 130
COIND5 131
COIND6 132
COIND7 133
COIND8 134
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
5
COIND_ Substation Automation
Event mask 1 V101 0...783 - 527 R/W Event mask 1 for event
transmission (E0 ... E9)
Event mask 2 V103 0...783 - 527 R/W Event mask 2 for event
transmission (E0 ... E9)
Event mask 3 V105 0...783 - 527 R/W Event mask 3 for event
transmission (E0 ... E9)
Event mask 4 V107 0...783 - 527 R/W Event mask 4 for event
transmission (E0 ... E9)
1)
Object state 0 = Undefined (00); 1 = Close (01) ; 2 = Open (10) ; 3 = Undefined (11)
2)
IV state 0 = Valid; 1 = Invalid
3)
Summarized stat 4-bit vector consisting of the bit values of [IV 0 BINOPEN BINCLOSE ]:
IV = 8, BINOPEN = 2, BINCLOSE = 1
0 = [0000], 1 = [0001], 2 = [0010], 3 = [0011], 8 = [1000], 9 = [1001],
10 = [1010], 11 = [1011]
6
Substation Automation COIND_
3.3 Events
7
COIND_ Substation Automation
8
1MRS752352-MUM COLOCAT
Issued: 10/1997
Version: C/1.2.2002
Logic Control Position Selector
Data subject to change without notice
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 3
2. Description of Operation.......................................................................... 4
2.1 General ............................................................................................... 4
2.2 Configuration....................................................................................... 4
2.3 Operation criteria................................................................................. 4
1. Introduction
1.1 Features
Facilitates flexible selection of the control position, offering four different control
position settings: remote, local, disabled and logic
The control position can be changed via the MMI panel with the R/L key and the
logic signals, provided the logic control position setting has been activated via the
MMI
The control position status information and interlocking bypass status for other
application programs
Password-protected control position setting
1.2 Application
This document specifies the function of the logic control position selector COLOCAT
used in products based on the RED 500 Platform.
Normally, the device control position setting can be changed via the MMI by
choosing the remote, local or disabled position. The COLOCAT function block
enables the logic control position as an additional feature. The control position setting
can only be changed via the MMI and it allows the control of all objects.
In remote position, the control objects can only be controlled via remote
communication and, accordingly, the local position only enables local operation via
the MMI. The disabled position inhibits the control of objects. The control position
setting is password-protected.
The logic position setting allows the logic control position via the inputs BINLOCAL
and BINREMOTE, which facilitates the flexible selection of control position. The
status outputs can be used for an application-specific logic.
Note:
The control position setting, which can be selected when the function block
COLOCAT is used, refers to selecting the disabled, local, remote or logic state
The logic setting facilitates the digital control position
The control position refers to the selected position, i.e. disabled, local or remote
2
Substation Automation COLOCAT
)LJXUH )XQFWLRQEORFNV\PERORI&2/2&$7
3
COLOCAT Substation Automation
2.1 General
The control position state can be accessed via the parameter F002V005.
2.2 Configuration
As a default, the control position setting is in disabled state and can be changed via
the MMI. If the device does not include an MMI, the position is automatically remote,
provided the function block COLOCAT has not been instanced. In case the function
block has been instanced in the Relay Configuration Tool, the control position setting
is logic and can be changed by means of the digital inputs. In such a configuration, the
BINLOCAL input should be FALSE.
If the control position setting is logic, the digital inputs have the following effect:
Input Output
BINLOCAL BINREMOTE LOCAL REMOTE
ON OFF ON OFF
OFF ON OFF ON
ON ON OFF OFF
OFF OFF OFF OFF
The output signal BYPASS reflects the present status of the control bypass mode. The
status of the global bypass mode can be activated via the parameter F002V004 for all
control objects. The LOGIC output reflects the activation of the logic position via the
parameter F002V007. The figure below describes the basic internal structure of the
function block.
4
Substation Automation COLOCAT
instance
COLOCAT
BINLOCAL LOCAL
BINREMOTE REMOTE
BYPASS
LOGIC
)LJXUH ,QWHUQDOVWUXFWXUHRIWKH&2/2&$7IXQFWLRQEORFN
5
COLOCAT Substation Automation
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for COLOCAT is 142.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
6
Substation Automation COLOCAT
Event mask 1 V101 0...3 - 2 R/W Event mask 1 for event transmission
(E0 ... E1)
Event mask 2 V103 0...3 - 2 R/W Event mask 2 for event transmission
(E0 ... E1)
Event mask 3 V105 0...3 - 2 R/W Event mask 3 for event transmission
(E0 ... E1)
Event mask 4 V107 0...3 - 2 R/W Event mask 4 for event transmission
(E0 ... E1)
1)
Logic setting 0 = Inactive; 1 = Active
2)
Binary position 0 = Disable state; 1 = Local state (BINLOCAL active); 2 = Remote state
(BINREMOTE active)
3.3 Events
7
COLOCAT Substation Automation
8
1MRS100143 RE_5_ _
Issued: 3/2000
Version: A
Power factor controller
Data subject to change without notice (COPFC)
Contents
1. Introduction.............................................................................................. 2
1.1 Features .............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description .................................................................................. 3
1.4 Output description ............................................................................... 4
2. Description of Operation......................................................................... 5
2.1 Configuration ....................................................................................... 5
2.2 Operating principle of the power factor controller ................................ 5
2.2.1 Operating principle when the limit values are exceeded ............. 7
2.2.2 Control parameters of calculation ............................................... 8
2.2.3 Overvoltage inhibit...................................................................... 9
2.2.4 Undercurrent and overvoltage protection.................................... 9
2.3 Switching sequences........................................................................... 9
2.3.1 Linear mode ............................................................................. 10
2.3.2 Circular mode ........................................................................... 11
2.4 Control functions ............................................................................... 12
2.5 Alarms ............................................................................................... 13
2.6 Manual mode..................................................................................... 13
2.7 Day / night target cos switching ....................................................... 14
2.8 Testing mode..................................................................................... 14
2.8.1 General .................................................................................... 14
2.8.2 Test results............................................................................... 15
2.9 Resetting ........................................................................................... 16
3. Parameters and Events ......................................................................... 17
3.1 General ............................................................................................. 17
3.2 Setting values.................................................................................... 18
3.2.1 Setting group 1 ......................................................................... 18
3.2.2 Control settings ........................................................................ 19
3.2.3 Manual command..................................................................... 20
3.3 Measurement values ......................................................................... 20
3.3.1 Input data ................................................................................. 20
3.3.2 Output data .............................................................................. 21
3.3.3 Recorded data.......................................................................... 21
3.3.4 Events ...................................................................................... 22
4. Technical Data ....................................................................................... 23
RE_5_ _ COPFC ABB Automation
1. Introduction
1.1 Features
Load power control based on the target cos (target Power Factor)
Adjustable sensitivity of the operation
Settable limit values for determining a safe operating area
Eight possible switching sequences for selecting the capacitor combination
Detection and alarm of three possible fault conditions
Manual and automatic operation modes
Testing mode for facilitating the commissioning and for fine adjusting the settings
1.2 Application
This document specifies the function of the power factor controller function block
COPFC used in products based on the RED 500 Platform.
The function block is designed to be used as an intelligent control unit for controlling
the switching of capacitor banks based on the reactive power requirements of the
load.
)LJXUH )XQFWLRQEORFNV\PERORIWKHSRZHUIDFWRUFRQWUROOHU&23)&
2
ABB Automation COPFC RE_5_ _
DN_COSPHI Digital signal (BOOL, Control input for switching between the
active high) "Target day cos PF" and the "Target
night PF"
DISCONNECT Digital signal (BOOL, Control input for immediately
active high) disconnecting all capacitor banks
simultaneously
RESET Reset signal (BOOL, Signal for resetting the alarm signals and
pos.edge recorded data of COPFC
3
RE_5_ _ COPFC ABB Automation
REQ_DOWN Digital signal (BOOL, active Duration demand time the timer
high) was started to remove step(s)
CONT_FAIL Digital signal (BOOL, active A control operation failed or an
high) undefined state of a circuit
breaker was detected
ALAR_Q Digital signal (BOOL, active Overcompensation or
high) undercompensation alarm
4
ABB Automation COPFC RE_5_ _
2.1 Configuration
The following analogue channel combinations are available in the dialogue box of the
configuration tool. When all the phase currents and phase voltages are known, P and
Q are calculated from positive-sequence components. The correct channel
combination is selected via the configuration tool.
-----------------------------------------------------------------------------------------------------------
Note that when the COPFC function block is used, the power and energy
measurement must be selected for one of the above channel combinations via the
resource settings dialogue Measurements of the Relay Configuration Tool.
The capacitor banks are switched in or out to adjust the load power as close as
possible to the targeted power factor value. One to four capacitor banks can be
controlled by the COPFC function block.
5
RE_5_ _ COPFC ABB Automation
In short, the operating principle of COPFC is the following: The function block
measures the active power P, and the allowed reactive power Q can be calculated
using the set target cos . If the measured reactive power differs enough from the
allowed reactive power, the function block switches a capacitor on or off. The basic
variables used by the COPFC function block are described in Figure 2 below.
measured cos
measured Q
measured P P
Q measured Q
inductive
=positive
allowed Q
)LJXUH 2SHUDWLQJSULQFLSOHRI&23)&EDVHGRQWKHWDUJHWFRVFDOFXODWLRQ
If the measured reactive power is greater than the allowed reactive power, the
differential power Q is positive, which means that the network is too inductive. On
the other hand, if the measured reactive power is smaller than the allowed reactive
power, the differential power Q is negative and the network is too capacitive. The
switching operations of a capacitor compared with the Q value are presented in
Figure 3 below.
Capacitor added
100 %
+Q 70 %
= "Sensitivity Ind"
Q=0
t
Q 60 %
= "Sensitivity Cap"
100 %
Capacitor removed
)LJXUH 3ULQFLSOHRIVZLWFKLQJRSHUDWLRQV
6
ABB Automation COPFC RE_5_ _
The sensitivity for switching operations can be adjusted by changing the sensitivity
percentages with the parameters Sensitivity Ind and Sensitivity Cap. In Figure 3,
the operation is illustrated with the default values of these parameters. If the
sensitivity is set to be 100 %, a capacitor will be added or removed when the
calculated differential power Q is equal to the step size of the capacitor to be
switched. The operation is more sensitive if a value below 100 % is set and vice
versa.
In addition to the target cos , the COPFC function block has the two limiting
parameters Maximum Q limit and Minimum Q limit for determining the proper
operation. These parameters are used to keep the reactive power within safe limits.
Figure 4 presents a situation where the load takes a lot of power but the power factor
cos of the network is equal to the target cos . In this case the basic target cos -
calculation presented in Figure 2 and Figure 3 does not cause any action because the
differential power Q is zero and, consequently, no switchings will take place.
Accordingly, additional limits have to be set to prevent the load from exceeding the
permissible absolute value limits for the reactive power.
Q
Calculated target replaced
by "Maximum Q limit"
"Maximum
Q limit"
calculated
target
target cos
"Minimum P
Q limit"
)LJXUH ([DPSOHZKHQWKHFDOFXODWHGWDUJHWIRUUHDFWLYHSRZHULVUHSODFHGE\
WKHOLPLWYDOXH
If COPFC has switched on all the capacitor banks but the measured reactive power
still exceeds the Maximum Q limit, the function block will give the alarm Q limit
exceeded. The same alarm is given if all the capacitor banks have been disconnected
but the measured reactive power still remains below the Minimum Q limit.
7
RE_5_ _ COPFC ABB Automation
The parameter Calc. method can have two values: 1) Normal or 2) Integral. As
a default, the calculation is performed in the normal mode but when the integral
mode is used, the measured reactive power will be more strongly filtered. The
integral mode is useful for situations where the load is varying and the demand is
thus continuously cancelled before the end of the Duration demand delay.
The parameter Cont. principle defines whether the target is reached
progressively or directly. As a default, the control principle is set to be
progressive, which means that capacitors are switched in or out step by step to
reach the cos target. The other possibility, direct switching, means that
intermediary steps between two non-contiguous switching levels are cancelled.
The parameter Duration demand is a delay for which the need for switching
should be valid before switching in or out is done. If, for example, the calculated
need is to add or remove one capacitor step and the setting parameter Duration
demand is set to be 30 s, the need (+1 or -1) should be valid for 30 s before
COPFC sends the control signal (open or close).
If the need falls to zero for less than 1 second, the time counter is not started from
the beginning, whereas if the need remains zero for more than 1 second, the time
counter is set to zero. When the calculated need is greater than +1 or -1, the time
counter will get a value that is half of the duration demand, i.e.15 s in this
example.
The operation of the parameter Duration demand and the outputs REQ_UP and
REQ_DOWN is illustrated in Figure 5 below.
Capacitor added
Q = +1
Q = 0
t
"Duration demand"
Q = -1
Q = -2
Capacitor(s) removed
REQ_UP
REQ_DOWN
DuratDem
)LJXUH 2SHUDWLRQRIWKHSDUDPHWHU'XUDWLRQGHPDQGDQGWKHFRUUHVSRQGLQJ
RXWSXWV
8
ABB Automation COPFC RE_5_ _
The overvoltage inhibit level can be set with the parameter Overvolt. limit. When
COPFC measures a voltage greater than this setting, it will not switch in additional
capacitor steps, because adding the steps in this situation could increase the voltage to
a harmful level.
The parameter Overvolt. limit can be given the same value regardless of whether
phase-to-phase or phase-to-earth voltages are measured. In other words, the setting
1.0 x Un always refers to a full phase-to-phase or phase-to-earth voltage.
The function block OL3Cap is specially designed for protection against overload
produced by harmonic currents and overvoltage. Accordingly, OL3Cap should be
used as the main overload protection. Moreover, the overvoltage protection function
block OV3Low can be used for back-up protection, when required. When the
measured voltage exceeds the setting limit of OV3Low, the trip output is activated
and an open signal is sent to the capacitor banks to switch them off.
Note! OV3Low should only be used as back-up protection because the actual
overload protection function OL3Cap provides more accurate calculation of the actual
voltage stress over the capacitor when e.g. the influence of the harmonics is taken into
account.
1:1:1:1......1 linear
1:1:1:1......1 circular
1:1:2:2......1,2 circular
1:2:2:2......2 linear
1:2:2:2......2 circular
1:2:4:4......4 linear
1:2:4:4......4 circular
1:2:4:8
In above switching sequence alternatives, the ratio indicates the relative sizes of the
second, third and fourth capacitor banks in relation to the first bank. For example,
9
RE_5_ _ COPFC ABB Automation
1:2:4:4 means that the capacitance of the second bank is twice that of the first bank,
whereas both the third and the fourth banks are four times the size of the first
capacitor bank.
A control sequence with the linear mode is especially useful for controlling harmonic
filters. Figure 6 and Figure 7 present the operating principle of the linear mode.
Capacitor steps
Request 1 2 3 4
+ X
+ X X
+ X X X
X X
X
+ X X
+ X X X
+ X X X X
X X X
X X
X
)LJXUH ([DPSOHIRUDFRQWUROOLQJVHTXHQFHZKHQ7\SHRIVHTLVOLQHDU
Capacitor steps
Request 1 2 3 4 Target steps
+ X 1
+ X 2
+ X X 3
+ X X 4
X X 3
X 2
X 1
+ X 2
+ X X 3
+ X X 4
+ X X X 5
)LJXUH ([DPSOHIRUDFRQWUROOLQJVHTXHQFHZKHQ7\SHRIVHTLVOLQHDU
10
ABB Automation COPFC RE_5_ _
The objective of the circular mode is to switch the capacitors equally on and off, so
that in the long run, the capacitors are evenly worn out because the operation number
for each bank is approximately the same. The controlling sequence with the circular
mode is most suitable for capacitor banks that have equal step sizes. Some example
sequences for the circular mode are presented in Figure 8 and Figure 9.
Capacitor steps
Request 1 2 3 4
+ X
+ X X
+ X X X
X X
X
+ X X
+ X X X
+ X X X X
X X X
X X
X
)LJXUH ([DPSOHIRUDFRQWUROOLQJVHTXHQFHZKHQ7\SHRIVHTLV
FLUFXODU
Capacitor steps
Request Target steps
1 2 3 4
+ X 1
+ X 2
+ X X 3
+ X X 4
X X 3
+ X X 4
X X 3
+ X X 4
X X 3
X 2
X 1
)LJXUH ([DPSOHIRUDFRQWUROOLQJVHTXHQFHZKHQ7\SHRIVHTLV
FLUFXODU
11
RE_5_ _ COPFC ABB Automation
The function block COPFC sends a request signal of control commands, via LON
network or using the digital outputs, to a capacitor bank that is desired to be opened or
closed. If the control requests and/or state information from the circuit breakers are
transmitted via LON network, the network connection between COPFC and the
capacitor banks should be configured with the Lon Network Tool.
When COPFC detects that the desired state has been reached after the request signal,
it deactivates the particular output.
Each relay that protects a certain capacitor bank must have a control function block
COCB_ for a circuit breaker. The actual control pulses for the circuit breaker are
formed by this function block. COCB_ includes several useful functions that can be
set by the user, e.g.:
COPFC
REF 545
Loads
Protection
- unbalance
- overload
- undercurrent
Control
- COCB
)LJXUH 6WDWLRQOHYHOOD\RXWIRUGLIIHUHQWIXQFWLRQV7KHFRQQHFWLRQVPDUNHGZLWK
GDVKHGOLQHLQDERYHILJXUHFDQEHLPSOHPHQWHGHLWKHUZLWKVHSDUDWHZLUHV
IRUHDFKRSHQDQGFORVHUHTXHVWRUZLWK/21FRPPXQLFDWLRQE\
FRQILJXULQJWKHFRPPXQLFDWLRQEHWZHHQIHHGHUWHUPLQDOVZLWKWKH/21
1HWZRUN7RRO
12
ABB Automation COPFC RE_5_ _
2.5 Alarms
The COPFC function block detects and gives alarms for the following fault
conditions:
An alarm signal is deactivated when the reason for the alarm vanishes or when the
user resets the alarm(s).
Note! When COPFC detects a pumping situation, the operation mode is changed from
Automatic mode to Manual mode and the automatic operation of the function
block is frozen, which means that the function block will not switch capacitors
automatically on or off. When the operation mode is changed from Manual mode
back to Automatic mode by setting, the automatic control of the reactive power is
continued and the pumping alarm is reset. If another pumping situation is then
detected, the COPFC will be frozen again.
The COPFC function block includes four possible operation modes: 1) Not in use
2) Automatic mode 3) Manual mode and 4) Testing mode. If the Manual mode is
selected, the automatic operation of COPFC is blocked and the user is able to add and
remove capacitor steps as desired via the MMI of the relay or via remote commands.
13
RE_5_ _ COPFC ABB Automation
The actual manual command is given with the control parameter Manual command.
The parameter can have the following values: 1) Not activated 2) Remove one step 3)
Add one step 4) Disconnect all. The COPFC function block will obey the set control
sequence also in the manual mode (see section Switching sequences), which means
that the relay decides internally which bank should be added or removed when the
manual command is given by the user.
Note! The delays (e.g. Discharge time) are also taken into account in the manual
mode. Accordingly, if the manual command is given but the discharge time has not
yet elapsed, the manual command is ignored, the indication COPFC: Reconn.
inhibited is presented on the MMI of the relay and the corresponding event is sent.
The setting parameters S44 to S47 (Target day PF, Day unit, Target night PF
and Night unit) can be used to separately define the daytime and night-time cos
values to which COPFC aims to adjust the reactive power. The target factor is defined
with the parameters S44 and S46, whereas the parameters S45 and S47 determine
whether the target is on the inductive or capacitive side.
Switching between the day and night cos target can be done in three different ways.
The parameter Day&night switch defines which method is used. The possibilities
are:
By digital input: When the digital input DN_COSPHI (Figure 4) is active, the set
night value is used as a target value for cos . On the other hand, if the digital
input is unconnected or the connected input is not active, the COPFC function
block uses the set day value as a target value for cos .
By internal clock: Switching between the day and night targets is done
continuously according to the clock of the relay. The night target is valid when
the clock shows the time between the parameters Night starts and Night ends,
otherwise the day target is used.
By setting: When this switching method is used, the value of the parameter D&n
command defines which target is valid.
The default value of the control parameter Day&night switch for the cos
switching is Not in use, i.e. the set day target is used as a target value and the set
night value is ignored.
2.8.1 General
In the testing mode the COPFC function block will switch the first capacitor bank on
and off four times sequentially. The Ready LED on the front panel of the MMI of
14
ABB Automation COPFC RE_5_ _
the relay will blink until the test is over. The testing will last three to four times the
Reconn. inhibit setting delay.
Note! The following items should be noticed before starting the testing:
The Reconn. inhibit delay (=Discharge time of the capacitor bank) should be
properly set
The Size of 1.step parameter should have approximately the right value
The Operation mode parameter should be set to Testing mode
The event Testing: OK will be sent and can be read in the EVENTS view of the
relay
The indication text TESTING OK will appear on the MMI of the relay
If the testing was completed successfully, the COPFC function block will
automatically replace the value set as the capacitor step size (parameter Size of
1.step) with the value measured during the testing. This corrected value is the
measured mean value of the reactive power changes during the period when the first
bank is switched on and off four times sequentially.
On the other hand, an unsuccessful testing will be indicated in the following ways:
The event Testing: Failed will be sent and can also be read in the EVENTS
view of the relay
The indication text TESTING: Failed will appear on the MMI of the relay
Possible reasons for a failed testing are the following:
If also the digital output CONT_FAIL is activated during the testing phase, the
reasons for the failed testing may be the following:
1. The control command pulses are not passed properly to a circuit breaker
2. The state information from a circuit breaker is not properly passed to COPFC
COPFC has measured a capacitor step size over 25 % greater or smaller than
originally set by the user. In this case:
1. Check the setting of the capacitor step size
15
RE_5_ _ COPFC ABB Automation
If all the items above are in order, the reason for the unsuccessful testing is that there
is over 25 % differential in the capacitor step size measurements between the
switchings. Try running the test once more.
If the test was completed successfully, the Operation mode may be changed from
the testing mode to the automatic mode to start the load power control.
2.9 Resetting
The alarm signals and recorded data can be reset either via the RESET input, or over
the serial bus or the local MMI.
The operation indicators, alarm signals and recorded data can be reset as follows:
16
ABB Automation COPFC RE_5_ _
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for COPFC is 143.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen seen on the MMI of
the relay terminal, the event mask value 56 (8 + 16 + 32) is written to the
Event mask 1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
17
RE_5_ _ COPFC ABB Automation
Type of seq S42 0...7 1) - 0 R/W The relational step sizes and
the type of the switching
sequence
Size of 1.step S43 10.0...50000.0 kvar 100.0 R/W Size of the first capacitor bank
(should be the smallest)
Target day PF S44 0.701.00 - 0.95 R/W Target value for daytime cos
2)
Day unit S45 0...1 - 0 R/W Unit that indicates whether the
daytime target is in the
capacitive or inductive side
Target night PF S46 0.701.00 - 0.95 R/W Target value for night-time
cos
Night unit S47 0...1 2) - 0 R/W Unit that indicates whether the
night-time target is in the
capacitive or inductive side
Maximum Q limit S51 0.1...100.0 Mvar 100.0 R/W Alarm limit for the maximum
reactive power
Minimum Q limit S52 -100.0...0.0 Mvar -100.0 R/W Alarm limit for the minimum
reactive power
Overvolt. limit S53 0.80...1.60 x Un 1.05 R/W Overvoltage limit when the
switching in is inhibited
1)
Type of seq 0=1:1:1:1 linear; 1=1:1:1:1 circul.; 2=1:1:2:2 circul.; 3=1:2:2:2 linear;
4=1:2:2:2 circul.; 5=1:2:4:4 linear; 6=1:2:4:4 circul.; 7=1:2:4:8
2)
Day unit / night unit 0 = Inductive; 1 = Capacitive
18
ABB Automation COPFC RE_5_ _
Duration demand V5 0.5...6000.0 s 30.0 R/W Time for which the demand
should be valid before switching
in or out is done
19
RE_5_ _ COPFC ABB Automation
Connected banks I4 0... 65535 - 0 R/M Banks that are on, e.g. 14
means that the 1. and 4.
banks are connected
20
ABB Automation COPFC RE_5_ _
The parameters Switches / day and Switches / week show how many switching
operations have been carried out for the capacitor banks.
Both the opening and closing operations for each bank increment the counter. For
example, disconnecting all four banks and then switching the first bank on makes a
total of five operations.
The recorded data parameters can be reset with the parameter Reset registers or via
the RESET input. A new counting period is started at the moment of resetting and the
values are updated at the end of the period.
21
RE_5_ _ COPFC ABB Automation
3.3.4 Events
22
ABB Automation COPFC RE_5_ _
23
1MRS752353-MUM COPFC
Issued: 3/2000
Version: B/1.2.2002
Power factor controller
Data subject to change without notice
Contents
1. Introduction ............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 4
2. Description of Operation......................................................................... 5
2.1 Configuration....................................................................................... 5
2.2 Operating principle of the power factor controller ................................ 5
2.2.1 Operating principle when the limit values are exceeded............. 7
2.2.2 Control parameters of calculation............................................... 8
2.2.3 Overvoltage inhibit ..................................................................... 9
2.2.4 Undercurrent and overvoltage protection ................................... 9
2.3 Switching sequences........................................................................... 9
2.3.1 Linear mode ............................................................................. 10
2.3.2 Circular mode........................................................................... 11
2.4 Control functions ............................................................................... 12
2.5 Alarms............................................................................................... 13
2.6 Manual mode .................................................................................... 13
2.7 Day / night target cos switching....................................................... 14
2.8 Testing mode .................................................................................... 14
2.8.1 General .................................................................................... 14
2.8.2 Test results .............................................................................. 15
2.9 Resetting........................................................................................... 16
3. Parameters and Events ......................................................................... 17
3.1 General ............................................................................................. 17
3.2 Setting values.................................................................................... 18
3.2.1 Setting group 1......................................................................... 18
3.2.2 Control settings ........................................................................ 19
3.2.3 Manual command..................................................................... 20
3.3 Measurement values ......................................................................... 20
3.3.1 Input data ................................................................................. 20
3.3.2 Output data .............................................................................. 21
3.3.3 Recorded data.......................................................................... 21
3.3.4 Events ...................................................................................... 22
4. Technical Data ....................................................................................... 23
COPFC Substation Automation
1. Introduction
1.1 Features
Load power control based on the target cos (target Power Factor)
Adjustable sensitivity of the operation
Settable limit values for determining a safe operating area
Eight possible switching sequences for selecting the capacitor combination
Detection and alarm of three possible fault conditions
Manual and automatic operation modes
Testing mode for facilitating the commissioning and for fine adjusting the settings
1.2 Application
This document specifies the function of the power factor controller function block
COPFC used in products based on the RED 500 Platform.
The function block is designed to be used as an intelligent control unit for controlling
the switching of capacitor banks based on the reactive power requirements of the
load.
)LJXUH )XQFWLRQEORFNV\PERORIWKHSRZHUIDFWRUFRQWUROOHU&23)&
2
Substation Automation COPFC
DN_COSPHI Digital signal (BOOL, Control input for switching between the
active high) "Target day cos PF" and the "Target
night PF"
DISCONNECT Digital signal (BOOL, Control input for immediately
active high) disconnecting all capacitor banks
simultaneously
RESET Reset signal (BOOL, Signal for resetting the alarm signals and
pos.edge recorded data of COPFC
3
COPFC Substation Automation
REQ_DOWN Digital signal (BOOL, active Duration demand time the timer
high) was started to remove step(s)
CONT_FAIL Digital signal (BOOL, active A control operation failed or an
high) undefined state of a circuit
breaker was detected
ALAR_Q Digital signal (BOOL, active Overcompensation or
high) undercompensation alarm
4
Substation Automation COPFC
2.1 Configuration
The following analogue channel combinations are available in the dialogue box of the
configuration tool. When all the phase currents and phase voltages are known, P and
Q are calculated from positive-sequence components. The correct channel
combination is selected via the configuration tool.
-----------------------------------------------------------------------------------------------------------
Note that when the COPFC function block is used, the power and energy
measurement must be selected for one of the above channel combinations via the
resource settings dialogue Measurements of the Relay Configuration Tool.
The capacitor banks are switched in or out to adjust the load power as close as
possible to the targeted power factor value. One to four capacitor banks can be
controlled by the COPFC function block.
5
COPFC Substation Automation
In short, the operating principle of COPFC is the following: The function block
measures the active power P, and the allowed reactive power Q can be calculated
using the set target cos . If the measured reactive power differs enough from the
allowed reactive power, the function block switches a capacitor on or off. The basic
variables used by the COPFC function block are described in Figure 2 below.
measured cos
measured Q
measured P P
Q measured Q
inductive
=positive
allowed Q
)LJXUH 2SHUDWLQJSULQFLSOHRI&23)&EDVHGRQWKHWDUJHWFRVFDOFXODWLRQ
If the measured reactive power is greater than the allowed reactive power, the
differential power Q is positive, which means that the network is too inductive. On
the other hand, if the measured reactive power is smaller than the allowed reactive
power, the differential power Q is negative and the network is too capacitive. The
switching operations of a capacitor compared with the Q value are presented in
Figure 3 below.
Capacitor added
100 %
+Q 70 %
= "Sensitivity Ind"
Q=0
t
Q 60 %
= "Sensitivity Cap"
100 %
Capacitor removed
)LJXUH 3ULQFLSOHRIVZLWFKLQJRSHUDWLRQV
6
Substation Automation COPFC
The sensitivity for switching operations can be adjusted by changing the sensitivity
percentages with the parameters Sensitivity Ind and Sensitivity Cap. In Figure 3,
the operation is illustrated with the default values of these parameters. If the
sensitivity is set to be 100 %, a capacitor will be added or removed when the
calculated differential power Q is equal to the step size of the capacitor to be
switched. The operation is more sensitive if a value below 100 % is set and vice
versa.
In addition to the target cos , the COPFC function block has the two limiting
parameters Maximum Q limit and Minimum Q limit for determining the proper
operation. These parameters are used to keep the reactive power within safe limits.
Figure 4 presents a situation where the load takes a lot of power but the power factor
cos of the network is equal to the target cos . In this case the basic target cos -
calculation presented in Figure 2 and Figure 3 does not cause any action because the
differential power Q is zero and, consequently, no switchings will take place.
Accordingly, additional limits have to be set to prevent the load from exceeding the
permissible absolute value limits for the reactive power.
Q
Calculated target replaced
by "Maximum Q limit"
"Maximum
Q limit"
calculated
target
target cos
"Minimum P
Q limit"
)LJXUH ([DPSOHZKHQWKHFDOFXODWHGWDUJHWIRUUHDFWLYHSRZHULVUHSODFHGE\
WKHOLPLWYDOXH
If COPFC has switched on all the capacitor banks but the measured reactive power
still exceeds the Maximum Q limit, the function block will give the alarm Q limit
exceeded. The same alarm is given if all the capacitor banks have been disconnected
but the measured reactive power still remains below the Minimum Q limit.
7
COPFC Substation Automation
The parameter Calc. method can have two values: 1) Normal or 2) Integral. As
a default, the calculation is performed in the normal mode but when the integral
mode is used, the measured reactive power will be more strongly filtered. The
integral mode is useful for situations where the load is varying and the demand is
thus continuously cancelled before the end of the Duration demand delay.
The parameter Cont. principle defines whether the target is reached
progressively or directly. As a default, the control principle is set to be
progressive, which means that capacitors are switched in or out step by step to
reach the cos target. The other possibility, direct switching, means that
intermediary steps between two non-contiguous switching levels are cancelled.
The parameter Duration demand is a delay for which the need for switching
should be valid before switching in or out is done. If, for example, the calculated
need is to add or remove one capacitor step and the setting parameter Duration
demand is set to be 30 s, the need (+1 or -1) should be valid for 30 s before
COPFC sends the control signal (open or close).
If the need falls to zero for less than 1 second, the time counter is not started from
the beginning, whereas if the need remains zero for more than 1 second, the time
counter is set to zero. When the calculated need is greater than +1 or -1, the time
counter will get a value that is half of the duration demand, i.e.15 s in this
example.
The operation of the parameter Duration demand and the outputs REQ_UP and
REQ_DOWN is illustrated in Figure 5 below.
Capacitor added
Q = +1
Q = 0
t
"Duration demand"
Q = -1
Q = -2
Capacitor(s) removed
REQ_UP
REQ_DOWN
DuratDem
)LJXUH 2SHUDWLRQRIWKHSDUDPHWHU'XUDWLRQGHPDQGDQGWKHFRUUHVSRQGLQJ
RXWSXWV
8
Substation Automation COPFC
The overvoltage inhibit level can be set with the parameter Overvolt. limit. When
COPFC measures a voltage greater than this setting, it will not switch in additional
capacitor steps, because adding the steps in this situation could increase the voltage to
a harmful level.
The parameter Overvolt. limit can be given the same value regardless of whether
phase-to-phase or phase-to-earth voltages are measured. In other words, the setting
1.0 x Un always refers to a full phase-to-phase or phase-to-earth voltage.
The function block OL3Cap is specially designed for protection against overload
produced by harmonic currents and overvoltage. Accordingly, OL3Cap should be
used as the main overload protection. Moreover, the overvoltage protection function
block OV3Low can be used for back-up protection, when required. When the
measured voltage exceeds the setting limit of OV3Low, the trip output is activated
and an open signal is sent to the capacitor banks to switch them off.
Note! OV3Low should only be used as back-up protection because the actual
overload protection function OL3Cap provides more accurate calculation of the actual
voltage stress over the capacitor when e.g. the influence of the harmonics is taken into
account.
1:1:1:1......1 linear
1:1:1:1......1 circular
1:1:2:2......1,2 circular
1:2:2:2......2 linear
1:2:2:2......2 circular
1:2:4:4......4 linear
1:2:4:4......4 circular
1:2:4:8
In above switching sequence alternatives, the ratio indicates the relative sizes of the
second, third and fourth capacitor banks in relation to the first bank. For example,
9
COPFC Substation Automation
1:2:4:4 means that the capacitance of the second bank is twice that of the first bank,
whereas both the third and the fourth banks are four times the size of the first
capacitor bank.
A control sequence with the linear mode is especially useful for controlling harmonic
filters. Figure 6 and Figure 7 present the operating principle of the linear mode.
Capacitor steps
Request 1 2 3 4
+ X
+ X X
+ X X X
X X
X
+ X X
+ X X X
+ X X X X
X X X
X X
X
)LJXUH ([DPSOHIRUDFRQWUROOLQJVHTXHQFHZKHQ7\SHRIVHTLVOLQHDU
Capacitor steps
Request 1 2 3 4 Target steps
+ X 1
+ X 2
+ X X 3
+ X X 4
X X 3
X 2
X 1
+ X 2
+ X X 3
+ X X 4
+ X X X 5
)LJXUH ([DPSOHIRUDFRQWUROOLQJVHTXHQFHZKHQ7\SHRIVHTLVOLQHDU
10
Substation Automation COPFC
The objective of the circular mode is to switch the capacitors equally on and off, so
that in the long run, the capacitors are evenly worn out because the operation number
for each bank is approximately the same. The controlling sequence with the circular
mode is most suitable for capacitor banks that have equal step sizes. Some example
sequences for the circular mode are presented in Figure 8 and Figure 9.
Capacitor steps
Request 1 2 3 4
+ X
+ X X
+ X X X
X X
X
+ X X
+ X X X
+ X X X X
X X X
X X
X
)LJXUH ([DPSOHIRUDFRQWUROOLQJVHTXHQFHZKHQ7\SHRIVHTLV
FLUFXODU
Capacitor steps
Request Target steps
1 2 3 4
+ X 1
+ X 2
+ X X 3
+ X X 4
X X 3
+ X X 4
X X 3
+ X X 4
X X 3
X 2
X 1
)LJXUH ([DPSOHIRUDFRQWUROOLQJVHTXHQFHZKHQ7\SHRIVHTLV
FLUFXODU
11
COPFC Substation Automation
The function block COPFC sends a request signal of control commands, via LON
network or using the digital outputs, to a capacitor bank that is desired to be opened or
closed. If the control requests and/or state information from the circuit breakers are
transmitted via LON network, the network connection between COPFC and the
capacitor banks should be configured with the Lon Network Tool.
When COPFC detects that the desired state has been reached after the request signal,
it deactivates the particular output.
Each relay that protects a certain capacitor bank must have a control function block
COCB_ for a circuit breaker. The actual control pulses for the circuit breaker are
formed by this function block. COCB_ includes several useful functions that can be
set by the user, e.g.:
COPFC
REF 545
Loads
Protection
- unbalance
- overload
- undercurrent
Control
- COCB
)LJXUH 6WDWLRQOHYHOOD\RXWIRUGLIIHUHQWIXQFWLRQV7KHFRQQHFWLRQVPDUNHGZLWK
GDVKHGOLQHLQDERYHILJXUHFDQEHLPSOHPHQWHGHLWKHUZLWKVHSDUDWHZLUHV
IRUHDFKRSHQDQGFORVHUHTXHVWRUZLWK/21FRPPXQLFDWLRQE\
FRQILJXULQJWKHFRPPXQLFDWLRQEHWZHHQIHHGHUWHUPLQDOVZLWKWKH/21
1HWZRUN7RRO
12
Substation Automation COPFC
2.5 Alarms
The COPFC function block detects and gives alarms for the following fault
conditions:
An alarm signal is deactivated when the reason for the alarm vanishes or when the
user resets the alarm(s).
Note! When COPFC detects a pumping situation, the operation mode is changed from
Automatic mode to Manual mode and the automatic operation of the function
block is frozen, which means that the function block will not switch capacitors
automatically on or off. When the operation mode is changed from Manual mode
back to Automatic mode by setting, the automatic control of the reactive power is
continued and the pumping alarm is reset. If another pumping situation is then
detected, the COPFC will be frozen again.
The COPFC function block includes four possible operation modes: 1) Not in use
2) Automatic mode 3) Manual mode and 4) Testing mode. If the Manual mode is
selected, the automatic operation of COPFC is blocked and the user is able to add and
remove capacitor steps as desired via the MMI of the relay or via remote commands.
13
COPFC Substation Automation
The actual manual command is given with the control parameter Manual command.
The parameter can have the following values: 1) Not activated 2) Remove one step 3)
Add one step 4) Disconnect all. The COPFC function block will obey the set control
sequence also in the manual mode (see section Switching sequences), which means
that the relay decides internally which bank should be added or removed when the
manual command is given by the user.
Note! The delays (e.g. Discharge time) are also taken into account in the manual
mode. Accordingly, if the manual command is given but the discharge time has not
yet elapsed, the manual command is ignored, the indication COPFC: Reconn.
inhibited is presented on the MMI of the relay and the corresponding event is sent.
The setting parameters S44 to S47 (Target day PF, Day unit, Target night PF
and Night unit) can be used to separately define the daytime and night-time cos
values to which COPFC aims to adjust the reactive power. The target factor is defined
with the parameters S44 and S46, whereas the parameters S45 and S47 determine
whether the target is on the inductive or capacitive side.
Switching between the day and night cos target can be done in three different ways.
The parameter Day&night switch defines which method is used. The possibilities
are:
By digital input: When the digital input DN_COSPHI (Figure 4) is active, the set
night value is used as a target value for cos . On the other hand, if the digital
input is unconnected or the connected input is not active, the COPFC function
block uses the set day value as a target value for cos .
By internal clock: Switching between the day and night targets is done
continuously according to the clock of the relay. The night target is valid when
the clock shows the time between the parameters Night starts and Night ends,
otherwise the day target is used.
By setting: When this switching method is used, the value of the parameter D&n
command defines which target is valid.
The default value of the control parameter Day&night switch for the cos
switching is Not in use, i.e. the set day target is used as a target value and the set
night value is ignored.
2.8.1 General
In the testing mode the COPFC function block will switch the first capacitor bank on
and off four times sequentially. The Ready LED on the front panel of the MMI of
14
Substation Automation COPFC
the relay will blink until the test is over. The testing will last three to four times the
Reconn. inhibit setting delay.
Note! The following items should be noticed before starting the testing:
The Reconn. inhibit delay (=Discharge time of the capacitor bank) should be
properly set
The Size of 1.step parameter should have approximately the right value
The Operation mode parameter should be set to Testing mode
The event Testing: OK will be sent and can be read in the EVENTS view of the
relay
The indication text TESTING OK will appear on the MMI of the relay
If the testing was completed successfully, the COPFC function block will
automatically replace the value set as the capacitor step size (parameter Size of
1.step) with the value measured during the testing. This corrected value is the
measured mean value of the reactive power changes during the period when the first
bank is switched on and off four times sequentially.
On the other hand, an unsuccessful testing will be indicated in the following ways:
The event Testing: Failed will be sent and can also be read in the EVENTS
view of the relay
The indication text TESTING: Failed will appear on the MMI of the relay
Possible reasons for a failed testing are the following:
If also the digital output CONT_FAIL is activated during the testing phase, the
reasons for the failed testing may be the following:
1. The control command pulses are not passed properly to a circuit breaker
2. The state information from a circuit breaker is not properly passed to COPFC
COPFC has measured a capacitor step size over 25 % greater or smaller than
originally set by the user. In this case:
1. Check the setting of the capacitor step size
15
COPFC Substation Automation
If all the items above are in order, the reason for the unsuccessful testing is that there
is over 25 % differential in the capacitor step size measurements between the
switchings. Try running the test once more.
If the test was completed successfully, the Operation mode may be changed from
the testing mode to the automatic mode to start the load power control.
2.9 Resetting
The alarm signals and recorded data can be reset either via the RESET input, or over
the serial bus or the local MMI.
The operation indicators, alarm signals and recorded data can be reset as follows:
16
Substation Automation COPFC
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for COPFC is 143.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen seen on the MMI of
the relay terminal, the event mask value 56 (8 + 16 + 32) is written to the
Event mask 1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
17
COPFC Substation Automation
Type of seq S42 0...7 1) - 0 R/W The relational step sizes and
the type of the switching
sequence
Size of 1.step S43 10.0...50000.0 kvar 100.0 R/W Size of the first capacitor bank
(should be the smallest)
Target day PF S44 0.701.00 - 0.95 R/W Target value for daytime cos
2)
Day unit S45 0...1 - 0 R/W Unit that indicates whether the
daytime target is in the
capacitive or inductive side
Target night PF S46 0.701.00 - 0.95 R/W Target value for night-time
cos
Night unit S47 0...1 2) - 0 R/W Unit that indicates whether the
night-time target is in the
capacitive or inductive side
Maximum Q limit S51 0.1...100.0 Mvar 100.0 R/W Alarm limit for the maximum
reactive power
Minimum Q limit S52 -100.0...0.0 Mvar -100.0 R/W Alarm limit for the minimum
reactive power
Overvolt. limit S53 0.80...1.60 x Un 1.05 R/W Overvoltage limit when the
switching in is inhibited
1)
Type of seq 0=1:1:1:1 linear; 1=1:1:1:1 circul.; 2=1:1:2:2 circul.; 3=1:2:2:2 linear;
4=1:2:2:2 circul.; 5=1:2:4:4 linear; 6=1:2:4:4 circul.; 7=1:2:4:8
2)
Day unit / night unit 0 = Inductive; 1 = Capacitive
18
Substation Automation COPFC
Duration demand V5 0.5...6000.0 s 30.0 R/W Time for which the demand
should be valid before switching
in or out is done
19
COPFC Substation Automation
Connected banks I4 0... 65535 - 0 R/M Banks that are on, e.g. 14
means that the 1. and 4.
banks are connected
20
Substation Automation COPFC
The parameters Switches / day and Switches / week show how many switching
operations have been carried out for the capacitor banks.
Both the opening and closing operations for each bank increment the counter. For
example, disconnecting all four banks and then switching the first bank on makes a
total of five operations.
The recorded data parameters can be reset with the parameter Reset registers or via
the RESET input. A new counting period is started at the moment of resetting and the
values are updated at the end of the period.
21
COPFC Substation Automation
3.3.4 Events
22
Substation Automation COPFC
23
1MRS752354-MUM COSW_
Issued: 10/1997
Version: C/1.2.2002
On/Off Switch
Data subject to change without notice (1 output)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Output description ............................................................................... 2
2. Description of Operation.......................................................................... 3
2.1 General ............................................................................................... 3
2.2 Configuration....................................................................................... 3
2.3 Operation criteria................................................................................. 3
1. Introduction
1.1 Features
General functions:
Remote control
Local control
Optional non-volatile parameter or setting value with a default value
(zero after cold boot)
1.2 Application
This document specifies the function of the four on/off switches COSW1...COSW4
used in products based on the RED 500 Platform. The switches are identical in
operation.
The on/off switch is a MIMIC object that represents a boolean setting parameter that
can be controlled like any controllable object.
)LJXUH )XQFWLRQEORFNV\PEROVRI&26:&26:&26:DQG&26:
2
Substation Automation COSW_
2.1 General
As a default, the output value is stored in a non-volatile memory. However, the user
can configure the object so that the value is volatile, in which case the device booting
or configuration change resets the output value to FALSE.
2.2 Configuration
The graphical presentation of the component in the MIMIC view is defined in the
Relay Mimic Editor, while the logical connection to process data can be configured
by means of the Relay Configuration Tool.
The ON signal reflects the latest locally or remotely adjusted boolean value.
3
COSW_ Substation Automation
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channels for the on/off switches are the following:
Function block Channel
COSW1 135
COSW2 136
COSW3 137
COSW4 138
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
4
Substation Automation COSW_
Event mask 1 V101 0...3 - 3 R/W Event mask 1 for event transmission
(E0 ... E1)
Event mask 2 V103 0...3 - 3 R/W Event mask 2 for event transmission
(E0 ... E1)
Event mask 3 V105 0...3 - 3 R/W Event mask 3 for event transmission
(E0 ... E1)
Event mask 4 V107 0...3 - 3 R/W Event mask 4 for event transmission
(E0 ... E1)
1)
Object output state 0 = Inactive; 1 = Active
3.3 Events
5
COSW_ Substation Automation
B To change the value of the control parameter ON state (V1), opening the SPA
password is no longer required
6
1MRS752299-MUM CUB1Cap
Issued: 3/2000
Version: A/17.1.2002
Current Unbalance Protection
Data subject to change without notice for Shunt Capacitor Banks
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 4
1.4 Output description ............................................................................... 4
2. Description of Operation.......................................................................... 5
2.1 Configuration....................................................................................... 5
2.2 Setting the rated values of the protected unit ...................................... 6
2.3 Measuring mode ................................................................................. 6
2.4 Operation criteria................................................................................. 6
2.5 IDMT type operation of CUB1Cap ....................................................... 9
2.6 Standard curve groups ...................................................................... 10
2.6.1 RI curve groups........................................................................ 11
2.6.2 RD curve groups ...................................................................... 11
2.7 Compensation for natural unbalance................................................. 12
2.7.1 Step-by-step instructions for compensation.............................. 12
2.8 Setting groups ................................................................................... 13
2.9 Test mode ......................................................................................... 13
2.10 START, ALARM, TRIP and CBFP outputs ........................................ 13
2.11 Resetting........................................................................................... 14
3. Parameters and Events .......................................................................... 15
3.1 General ............................................................................................. 15
3.2 Setting values.................................................................................... 16
3.2.1 Actual settings.......................................................................... 16
3.2.2 Setting group 1......................................................................... 16
3.2.3 Setting group 2......................................................................... 17
3.2.4 Control settings ........................................................................ 18
3.3 Measurement values ......................................................................... 19
3.3.1 Input data ................................................................................. 19
3.3.2 Output data .............................................................................. 19
3.3.3 Recorded data.......................................................................... 20
3.3.4 Faulty elements counter ........................................................... 23
3.3.5 Events ...................................................................................... 23
4. Technical Data ........................................................................................ 24
CUB1Cap Substation Automation
1. Introduction
1.1 Features
1.2 Application
This document specifies the functions of the unbalance protection function block
CUB1Cap used in products based on the RED 500 Platform.
The function block is designed for the protection of power capacitor banks intended
for reactive power compensation and filtering of the harmonics. The function block is
specially designed for the protection of internal faults in double < connected banks.
Thus, none of the remaining elements is exposed to more than 10% overvoltage.
Normally, CUB1Cap is used with the OL3Cap function block to increase the
sensitivity of protection for capacitor banks.
Due to the two-stage unbalance protection and the compensation facility for natural
unbalance, the protection of capacitor elements with internal fuses can be
implemented with a very high degree of sensitivity. The natural unbalance is primarily
due to the capacitor manufacturing tolerance. Furthermore, CUB1Cap provides a
sophisticated method of detecting the amount of faulty elements in each phase by
calculating the differential unbalance current.
2
Substation Automation CUB1Cap
3I>
3I< OL3Cap
CBFP
Cap
3I>>
NOC3High
CBFP
Io>
CBFP
DEF2Low
I>
CBFP
Cap CUB1Cap
application.CNV
)LJXUH $SSOLFDWLRQH[DPSOHRIFDSDFLWRUEDQNSURWHFWLRQ
)LJXUH )XQFWLRQEORFNV\PERORIWKHFXUUHQWXQEDODQFHSURWHFWLRQIXQFWLRQEORFN
&8%&DS
3
CUB1Cap Substation Automation
4
Substation Automation CUB1Cap
2.1 Configuration
The phase current IL1 and the unbalance current I can be measured via conventional
current transformers or Rogowski coils. The direction of the phase current is
determined to be from the busbar to the bank and that of the unbalance current from
the starpoint 1(branch 1) to the starpoint 2(branch 2). The measuring devices and
signal types for analogue channels are selected and configured in a special dialogue
box of the Relay Configuration Tool. Digital inputs are configured in the same
programming environment (the number of selectable analogue inputs, digital inputs
and digital outputs depends on the hardware used).
)LJXUH %DQNXQLWDQGHOHPHQW
Starpoint 1 Branch.fh8
Starpoint 2
)LJXUH %UDQFKHVDQG
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The phase current IL1 is connected to the
corresponding IL1 input of the function block. The input is used for synchronising
purposes only. The measured unbalance current I is connected to the dI input of the
function block. The possible signal types for the dI input are Io and Iob. Any other
signal type will generate a configuration error. Digital inputs are connected to the
Boolean inputs of the function block and, in the same way, the outputs of the function
5
CUB1Cap Substation Automation
block are connected to the output signals. Please note that both analogue inputs have
to be connected and the signal types have to be correct. If a configuration is not
correct, the output ERR is activated. The output should be connected to an indication,
i.e. an MMIALARM_ function block. A configuration error will force the function
block to the Not in use mode.
A separate scaling factor can be set for each analogue channel. The factors enable
differences between the ratings of the protected unit and those of the measuring
device (CTs, VTs, etc.). A setting of 1.00 means that the rated value of the protected
unit is exactly the same as that of the measuring device. For more information refer to
Technical Reference Manual for REF54_.
The operation of both stages, I1 and I2, is based on the numerically calculated
fundamental frequency component of the unbalance current. The operation is
insensitive to the DC component and the operation accuracy is defined in the
frequency range f/fn=0.95...1.05. In fundamental frequency measurement the
harmonics suppression is at least -50 dB at f = k x fn, where k = 2, 3, 4, 5,...
The unbalance protection is provided with two stages. The tripping stage I1 is based
on an inverse-time characteristic. If the unbalance current exceeds the setting value of
the tripping stage, the stage starts and an IDMT timer is started. The operate time
depends on three factors: the degree of unbalance, the inverse-time multiplier k and
the selected inverse-time characteristic. If the unbalance situation lasts long enough to
exceed the operate time, the stage trips. Furthermore, the stage I1 can also be
configured to operate based on a definite-time characteristic.
Normal mode
If the unbalance current exceeds the setting value of the alarm stage, the stage starts
and a DT timer is started. If the unbalance period exceeds the set operate time, the
stage provides an alarm signal.
Element counter
This mode enables the detection of blown fuses and faulty elements of a capacitor
bank based on the change of the unbalance current. The method has two significant
advantages. Firstly, unbalance protection is capable of detecting symmetrically
6
Substation Automation CUB1Cap
faulted elements in different phases. Secondly, the faulty elements counter indicates
the phase and the branch of a faulty element.
The phase angle of the changed unbalance current is also known and based on the
angle, the phase and the branch of the faulty element can be known. However, the
change of the branch impedance depends on whether internal or external fuses are
used. Therefore, a parameter Fuse location is set to specify the location of the fuses.
There are six individual faulty element counters that can specify the location of a
faulty element in a double-star connected bank. For instance, if the external fuses are
used and the phase angle of the changed unbalance current is -60, the location of the
faulty element is in phase IL3, branch 2. Therefore, the faulty elements counter for the
phase IL3, branch 2 is increased. The phase and the branch of a faulty element can be
determined according to the following table if external fuses are used. The direction
of phase currents is from the busbar to the bank and the direction of the unbalance
current from the starpoint 1 to the starpoint 2.
Please note that if the capacitor bank application is fuseless, the parameter Fuse
location should be set to external. In this case, the following table also applies to
fuseless applications.
7
CUB1Cap Substation Automation
Phase angle of the The phase and the branch of The incrementation
differential unbalance the faulty element(s) of the counter(s)
current related to the
phase current IL1
-15+15 L1, branch 1 1
-15-45 L1, branch 1 & L3, branch 2 1+1
-45-75 L3, branch 2 1
-75-105 L2, branch 1 & L3, branch 2 1+1
-105-135 L2, branch 1 1
-135-165 L2, branch 1 & L1, branch 2 1+1
-165-180, L1, branch 2 1
+165+180
+135+165 L3, branch 1 & L1, branch 2 1+1
+105+135 L3, branch 1 1
+75+105 L3, branch 1 & L2, branch 2 1+1
+45+75 L2, branch 2 1
+15+45 L1, branch 1 & L2, branch 2 1+1
If internal fuses are used, the following table is applied. Furthermore, if the change of
the unbalance current is greater than 3 times the setting value of dI2, the situation is
determined to be a blown external fuse, in which case the following table is applied as
well.
Phase angle of the The phase and the branch of The incrementation
differential unbalance the faulty element(s) of the counter(s)
current related to the
phase current IL1
-15+15 L1, branch 2 1
-15-45 L1, branch 2 & L3, branch 1 1+1
-45-75 L3, branch 1 1
-75-105 L2, branch 2 & L3, branch 1 1+1
-105-135 L2, branch 2 1
-135-165 L2, branch 2 & L1, branch 1 1+1
-165-180, L1, branch 1 1
+165+180
+135+165 L3, branch 2 & L1, branch 1 1+1
+105+135 L3, branch 2 1
+75+105 L3, branch 2 & L2, branch 1 1+1
+45+75 L2, branch 1 1
+15+45 L1, branch 2 & L2, branch 1 1+1
Please note that if two simultaneous faults occur in the same phase but in different
branches, there is no change in the unbalance current and therefore the function block
will QRW detect the faults. Furthermore, there are some rare situations where two
simultaneous faults occur in the same branch but in different phases. In these cases
8
Substation Automation CUB1Cap
the faults will cause a phase angle equal to a situation where there is only one fault in
the other branch. Therefore, the counters will show only one fault.
The setting parameter Operation mode is used to select the operation mode of the
function as follows:
Operation mode
If the operation mode is Not in use, the CUB1Cap is switched off. In any other
mode, the alarm stage I2 functions based on a definite-time characteristic. The
characteristic used by the tripping stage I1 is determined by the operation mode.
Operate time
When the tripping (I1) or the alarm (I2) stage starts, the corresponding start signal is
set to TRUE. Should the situation exceed the set inverse (tripping stage) or definite
(tripping and alarm stages) operate time, the corresponding stage operates. However,
if the alarm stage is configured to function as a faulty elements counter, the operate
time dI2 specifies when the counter is increased. Furthermore, the alarm stage
provides an alarm signal only if the faulty element counter exceeds the set amount of
faulty elements. The alarm signal is indicated by a blinking start LED (yellow).
The delay of the heavy-duty output relay is included in the total operate time. When
the stage operates, the corresponding trip or alarm signal is set to TRUE.
The DT or IDMT timer is allowed to run only if the BS1 signal is inactive, i.e. its
value is FALSE. When the blocking signal BS1 becomes active, i.e. its value turns
TRUE, the timer will be stopped (frozen). When the blocking signal BS2 is active, no
trip signal can be activated. The trip signals can be blocked by activating the signal
BS2 until the time operate time total retardation time has elapsed. The total
retardation time includes a short internal retardation time (SW delay, less than 1 ms)
plus the delay of a heavy-duty output relay.
In the inverse-time mode of CUB1Cap, the operate time is a function of the current:
the higher the current, the shorter is the operate time. Six time/current curve groups
are available. Four of the groups comply with the BS 142 and IEC 60255 standards,
whereas the two curve groups RI and RD (RXIDG) are special type of curve groups
corresponding to the ABB praxis. The setting Operation mode is used for selecting
the desired operate-time characteristic. (For a graphical presentation of the curves,
refer to the manual Technical Descriptions of Functions, Introduction.)
9
CUB1Cap Substation Automation
kx
t[s] =
I
( ) 1
I>
where
Inverse-time
characteristic
Normal inverse 0.02 0.14
Very inverse 1.0 13.5
Extremely inverse 2.0 80.0
Long-time inverse 1.0 120
According to the standard BS 142: 1966, the effective current range is defined as
2...20 times the set start current. If the time/current characteristic is normal inverse,
very inverse or extremely inverse, the function has to start at the latest when the
current exceeds the set start current by 1.3 times. For the long-time inverse
characteristic, the effective current range is specified to be 2...7 times the set start
current and the relay is to start at the latest when the current exceeds the setting value
by 1.1 times. The current unbalance tripping stage will start and the IDMT integration
will begin once the current exceeds the set start value.
The operate time tolerances specified by the standard BS 142 : 1966 are the following
(E denotes the accuracy in per cent):
10
Substation Automation CUB1Cap
The tolerance factors have to be smaller than those defined by the standard BS 142:
1966 for currents 2 and 5 times the setting. The function block CUB1Cap complies
with the tolerances of class 5 (E = 5.0%) for all inverse-time curves.
For example:
k
t s =
I>
0. 339 0. 236 x
I
I
t[s] = 5. 8 -1. 35 x ln
k x I>
The accuracy of the RI- and RD-type characteristics is 5%. Also with the RI- and RD-
type characteristics, the stage will start and the IDMT integration will begin once the
current exceeds the set start current.
11
CUB1Cap Substation Automation
a) b)
IL1 IL1
dI dI
natural natural
dIcompensated
dImeasured
1. Set the parameters. The start currents dI1 and dI2 may have to be set higher to
enable the uncompensated current flow.
3. Set the control parameter Comp natural dI to zero. View the input data: the
current dI is now the uncompensated unbalance current.
4. Record the phasors of the unbalance current I and phase current IL1 by setting the
control parameter Rec natural dI from Do not activate to Activate. Note that the
parameter returns automatically to the Do not activate mode. Furthermore, it should
be noted that the recording should be made only during the steady state condition and
when all the capacitor bank elements are assumed to be in service.
12
Substation Automation CUB1Cap
5. Set the control parameter Comp natural dI according to the per cent value seen in
the input data view. However, you may use a smaller value if only some of the natural
unbalance current needs to be compensated. Check also the control parameter Fuse
location.
6. If you set the compensation level according to the previous input data, the current
dI should be zero.
7. Set the start currents dI1 and dI2 according to the calculations.
Two different groups of setting values, group 1 and group 2, are available for
CUB1Cap. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The start output signals START and ST_ALARM are always pulse-shaped. The
minimum pulse width of the corresponding output signal is set via a separate
parameter on the MMI or the serial communication. If the start situation is longer than
the set pulse width, the specific start signal remains active until the start situation is
over. The output signals TRIP and ALARM may have a non-latching or latching
feature. When the latching mode has been selected, the specific trip or alarm signal
remains active until the output is reset even if the operation criterion has reset.
13
CUB1Cap Substation Automation
The tripping stage provides a delayed trip signal CBFP after the TRIP signal unless
the unbalance condition has disappeared during the set CBFP time delay. In circuit-
breaker failure protection, the CBFP output can be used to operate a circuit breaker in
front of the circuit breaker of the capacitor bank. The control parameter Trip pulse
also sets the width of the CBFP output signal.
2.11 Resetting
The TRIP and ALARM output signals and the registers can be reset either via the
RESET input, or over the serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
14
Substation Automation CUB1Cap
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for CUB1Cap is 117.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
15
CUB1Cap Substation Automation
Start dI1 S43 1.0100.0 %dIn 10.0 R/W Start current of the tripping
stage
Operate time dI1 S44 1.0300 s 5 R/W Operate time of the tripping
stage in DT mode
Time multiplier S45 0.052.0 - 1.00 R/W Time multiplier k for the
tripping stage in IDMT mode
Start dI2 S46 1.0100.0 %dIn 5.0 R/W Start current of the alarm
stage
Operate time dI2 S47 1.0...300 s 300 R/W Operate time of the alarm
stage
16
Substation Automation CUB1Cap
Start dI1 S73 1.0100.0 %dIn 10.0 R/w Start current of the tripping
stage
Operate time dI1 S74 1.0300 s 5 R/w Operate time of the tripping
stage in DT mode
Time multiplier S75 0.052.0 - 1.00 R/w Time multiplier k for the
tripping stage in IDMT mode
Start dI2 S76 1.0100.0 %dIn 5.0 R/w Start current of the alarm
stage
Operate time dI2 S77 1.0...300 s 300 R/w Operate time of the alarm
stage
17
CUB1Cap Substation Automation
Event mask 1 V101 0... 65536 - 831 R/W Event mask 1 for event
transmission (E0 ... E15)
Event mask 2 V103 0... 65536 - 831 R/W Event mask 2 for event
transmission (E0 ... E15)
Event mask 3 V105 0... 65536 - 831 R/W Event mask 3 for event
transmission (E0 ... E15)
Event mask 4 V107 0...65536 - 831 R/W Event mask 4 for event
transmission (E0 ... E15)
1)
Group selection 0 = Group 1; 1 = Group 2; 2 = GROUP input
2)
Active group 0 = Group 1; 1 = Group 2
3)
Trip/alarm signal 0 = Non-latching; 1 = Latching
4)
Rec natural dl 0 = Do not activate; 1 = Activate
5)
Fuse location 0 = External; 1 = Internal
6)
Test 0 = Do not activate; 1 = Activate
18
Substation Automation CUB1Cap
19
CUB1Cap Substation Automation
3.3.3.1 General
The information required for later fault analysis is recorded when the stage starts,
alarms or trips, or when the recording function is triggered via an external triggering
input.
The data of the last three operations (operation 1...3) are recorded and the values of
the most recent operation always replace the data of the oldest operation. The
registers are updated in the following order: Operation 1, Operation 2, Operation 3,
Operation 1, Operation 2,...
The time stamp indicates the rising edge of the START, ST_ALARM or TRIGG
signal. If the ALARM or TRIP signal follows the specific START signal, the time
stamp will be updated.
3.3.3.3 Duration
3.3.3.4 Currents
If the function block alarms or trips, the current values are updated at the moment of
alarming or tripping, i.e. on the rising edge of the ALARM or TRIP signal. For
external triggering, the current values are updated at the moment of triggering, i.e. on
the rising edge of the input signal TRIGG. If the function block starts but does not
alarm or trip, the current values captured one fundamental cycle (20 ms at rated
frequency 50 Hz) after the beginning of the start situation are recorded. So the values
of the phase current IL1 and the unbalance current I always originate from the same
moment and IL1 is recorded as a multiple of the rated current In, whereas I is
recorded as a percentage of the rated unbalance current In. Furthermore, the phase
angle of the unbalance current is recorded.
Note! If the alarm stage I2 alarms and the tripping stage I1 starts but does not trip,
the current values are captured at the moment of starting of the stage I1.
20
Substation Automation CUB1Cap
The status data of the inputs BS1 and BS2 and the parameter Active group are
recorded at the moment of triggering. The parameter Active group indicates the
setting group valid for the recorded data.
3.3.3.6 Priority
1 Tripping of I1
2 Starting of I1
3 Alarming of I2
4 Starting of I2
5 External triggering,
which means that if the function block has started, an external triggering request will
be neglected.
21
CUB1Cap Substation Automation
22
Substation Automation CUB1Cap
3.3.5 Events
23
CUB1Cap Substation Automation
Reset time 40...1000 ms (depends on the minimum pulse width set for the
TRIP output)
24
1MRS100051 RE_5_ _
Phase Discontinuity
Issued: 10/1997
Version: E Protection Function DI>
Data subject to change without notice (CUB3Low)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 3
2. Description of Operation.......................................................................... 4
2.1 Configuration....................................................................................... 4
2.2 Measuring mode ................................................................................. 4
2.3 Operation criteria................................................................................. 4
2.4 Setting groups ..................................................................................... 5
2.5 Test mode ........................................................................................... 5
2.6 START, TRIP and CBFP outputs ........................................................ 5
2.7 Resetting............................................................................................. 6
1. Introduction
1.1 Features
1.2 Application
This document specifies the functions of the phase discontinuity protection function
block CUB3Low used in products based on the RED 500 Platform.
3I>
CBFP
)LJXUH 3URWHFWLRQGLDJUDPV\PERO)RU,(&V\PEROVXVHGLQVLQJOHOLQH
GLDJUDPVUHIHUWRWKHPDQXDO7HFKQLFDO'HVFULSWLRQVRI)XQFWLRQV
,QWURGXFWLRQ056080
2
ABB Automation CUB3Low RE_5_ _
)LJXUH )XQFWLRQEORFNV\PERORI&8%/RZ
3
RE_5_ _ CUB3Low ABB Automation
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The phase currents IL1, IL2 and IL3 are
connected to the corresponding IL1, IL2 and IL3 inputs of the function block. Digital
inputs are connected to the boolean inputs of the function block and in the same way,
the outputs of the function block are connected to the output signals.
The unbalance of the network is detected by monitoring the highest (ILmax) and the
lowest (ILmin) phase currents. The unbalance is thus calculated according to the
formula
At full unbalance, i.e. when a phase conductor is broken before the first load on that
phase, the display of the relay or the feeder terminal will show an unbalance of 100%.
If the current unbalance I exceeds the set start unbalance value during three
successive executions, the function block starts, i.e. the signal START is set to TRUE,
and the DT timer begins counting.
Should the duration of the unbalance situation exceed the set definite operate time,
the function block operates. The delay of the heavy-duty output relay is included in
4
ABB Automation CUB3Low RE_5_ _
the total operate time. When the function block operates, the TRIP signal is set to
TRUE.
The DT timer is allowed to run only if the blocking signal BS1 is not active, i.e. its
value is FALSE. When the signal BS1 is active, i.e. its value is TRUE, the timer will
be stopped (frozen).
When the blocking signal BS2 is active, the TRIP signal cannot be activated. The
TRIP signal can be blocked by activating the signal BS2 until the function block
drops off.
The phase discontinuity protection is not in use when all the measured currents fall
below 10% of the rated current In. The execution task cycle of the function block is
one fundamental cycle (20 ms at 50 Hz).
Two different groups of setting values, group 1 and group 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
The the control parameter Active groupindicates the setting group valid at a given
time.
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The output signal START is always pulse-shaped. The minimum pulse width of the
corresponding output signal is set via a separate parameter on MMI or serial
communication. If the start situation is longer than the set pulse width, the START
signal remains active until the start situation is over. The output signal TRIP may
5
RE_5_ _ CUB3Low ABB Automation
have a non-latching or latching feature. When the latching mode has been selected,
the TRIP signal remains active until the output is reset even if the operation criteria
have reset (the unbalance has disappeared).
The function block provides a delayed trip signal CBFP after the trip signal TRIP
unless the fault has disappeared during the adjustable CBFP time delay. The CBFP
output can be used in circuit breaker failure protection to operate a circuit breaker in
front of the circuit breaker of the feeder. The control parameter Trip pulse also sets
the width of the CBFP output signal.
2.7 Resetting
The TRIP output signal and the registers can be reset either with the RESET input, or
over the serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
6
ABB Automation CUB3Low RE_5_ _
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for CUB3Low is 51.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
7
RE_5_ _ CUB3Low ABB Automation
8
ABB Automation CUB3Low RE_5_ _
Event mask 1 V101 0...4095 - 63 R/W Event mask 1 for event transmission
(E0 ... E11)
Event mask 2 V103 0...4095 - 63 R/W Event mask 2 for event transmission
(E0 ... E11)
Event mask 3 V105 0...4095 - 63 R/W Event mask 3 for event transmission
(E0 ... E11)
Event mask 4 V107 0...4095 - 63 R/W Event mask 4 for event transmission
(E0 ... E11)
1)
Group selection 0 = Group 1; 1 = Group 2; 2 = GROUP input
2)
Active group 0 = Group 1; 1 = Group 2
3)
Trip signal 0 = Non-latching; 1 = Latching
4)
Test 0 = Do not activate; 1 = Activate
9
RE_5_ _ CUB3Low ABB Automation
The information required for later fault analysis is recorded when the function block
starts or trips, or when the recording function is triggered via the external TRIGG
input. The recording function cannot be blocked or prevented.
The data of three last operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
10
ABB Automation CUB3Low RE_5_ _
The time stamp indicates the rising edge of the START, TRIP or TRIGG signal.
3.3.3.2 Duration
The duration of the start situation is recorded as a percentage of the set definite
operate time.
If the function block trips, the current unbalance and amplitudes will be updated at the
moment of tripping i.e. on the rising edge of the TRIP signal. At external triggering,
the values are updated at the moment of triggering i.e. on the rising edge of the input
signal TRIGG. If the function block starts but does not trip, the values captured one
fundamental cycle (20 ms at rated frequency 50 Hz) after the beginning of the start
situation will be recorded. So, the current unbalance and amplitudes always originate
from the same moment.
The status data of the input signals BS1 and BS2 (Active or Not active) and the
Active group parameter are recorded at the moment of triggering. The Active
group parameter indicates the setting group valid for the recorded data.
3.3.3.5 Priorities
1 Tripping
2 Starting
3 External triggering,
which means that if the function has started, an external triggering request will be
neglected.
11
RE_5_ _ CUB3Low ABB Automation
12
ABB Automation CUB3Low RE_5_ _
3.3.4 Events
13
RE_5_ _ CUB3Low ABB Automation
Reset time 40...1000 ms (depends on the minimum pulse width set for the
TRIP output)
14
1MRS752298-MUM CUB3Low
Issued: 10/1997
Version: F/17.01.2002
Phase Discontinuity
Data subject to change without notice Protection Function DI>
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 3
2. Description of Operation.......................................................................... 4
2.1 Configuration....................................................................................... 4
2.2 Measuring mode ................................................................................. 4
2.3 Operation criteria................................................................................. 4
2.4 Setting groups ..................................................................................... 5
2.5 Test mode ........................................................................................... 5
2.6 START, TRIP and CBFP outputs ........................................................ 5
2.7 Resetting............................................................................................. 6
1. Introduction
1.1 Features
1.2 Application
This document specifies the functions of the phase discontinuity protection function
block CUB3Low used in products based on the RED 500 Platform.
2
Substation Automation CUB3Low
)LJXUH )XQFWLRQEORFNV\PERORI&8%/RZ
3
CUB3Low Substation Automation
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The phase currents IL1, IL2 and IL3 are
connected to the corresponding IL1, IL2 and IL3 inputs of the function block. Digital
inputs are connected to the boolean inputs of the function block and in the same way,
the outputs of the function block are connected to the output signals.
The unbalance of the network is detected by monitoring the highest (ILmax) and the
lowest (ILmin) phase currents. The unbalance is thus calculated according to the
formula
At full unbalance, i.e. when a phase conductor is broken before the first load on that
phase, the display of the relay or the feeder terminal will show an unbalance of 100%.
If the current unbalance I exceeds the set start unbalance value during three
successive executions, the function block starts, i.e. the signal START is set to TRUE,
and the DT timer begins counting.
Should the duration of the unbalance situation exceed the set definite operate time,
the function block operates. The delay of the heavy-duty output relay is included in
4
Substation Automation CUB3Low
the total operate time. When the function block operates, the TRIP signal is set to
TRUE.
The DT timer is allowed to run only if the blocking signal BS1 is not active, i.e. its
value is FALSE. When the signal BS1 is active, i.e. its value is TRUE, the timer will
be stopped (frozen).
When the blocking signal BS2 is active, the TRIP signal cannot be activated. The
TRIP signal can be blocked by activating the signal BS2 until the function block
drops off.
The phase discontinuity protection is not in use when all the measured currents fall
below 10% of the rated current In. The execution task cycle of the function block is
one fundamental cycle (20 ms at 50 Hz).
Two different groups of setting values, group 1 and group 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
The the control parameter Active groupindicates the setting group valid at a given
time.
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The output signal START is always pulse-shaped. The minimum pulse width of the
corresponding output signal is set via a separate parameter on MMI or serial
communication. If the start situation is longer than the set pulse width, the START
signal remains active until the start situation is over. The output signal TRIP may
5
CUB3Low Substation Automation
have a non-latching or latching feature. When the latching mode has been selected,
the TRIP signal remains active until the output is reset even if the operation criteria
have reset (the unbalance has disappeared).
The function block provides a delayed trip signal CBFP after the trip signal TRIP
unless the fault has disappeared during the adjustable CBFP time delay. The CBFP
output can be used in circuit breaker failure protection to operate a circuit breaker in
front of the circuit breaker of the feeder. The control parameter Trip pulse also sets
the width of the CBFP output signal.
2.7 Resetting
The TRIP output signal and the registers can be reset either with the RESET input, or
over the serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
6
Substation Automation CUB3Low
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for CUB3Low is 51.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
7
CUB3Low Substation Automation
8
Substation Automation CUB3Low
Event mask 1 V101 0...4095 - 63 R/W Event mask 1 for event transmission
(E0 ... E11)
Event mask 2 V103 0...4095 - 63 R/W Event mask 2 for event transmission
(E0 ... E11)
Event mask 3 V105 0...4095 - 63 R/W Event mask 3 for event transmission
(E0 ... E11)
Event mask 4 V107 0...4095 - 63 R/W Event mask 4 for event transmission
(E0 ... E11)
1)
Group selection 0 = Group 1; 1 = Group 2; 2 = GROUP input
2)
Active group 0 = Group 1; 1 = Group 2
3)
Trip signal 0 = Non-latching; 1 = Latching
4)
Test 0 = Do not activate; 1 = Activate
9
CUB3Low Substation Automation
The information required for later fault analysis is recorded when the function block
starts or trips, or when the recording function is triggered via the external TRIGG
input. The recording function cannot be blocked or prevented.
The data of three last operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
10
Substation Automation CUB3Low
The time stamp indicates the rising edge of the START, TRIP or TRIGG signal.
3.3.3.2 Duration
The duration of the start situation is recorded as a percentage of the set definite
operate time.
If the function block trips, the current unbalance and amplitudes will be updated at the
moment of tripping i.e. on the rising edge of the TRIP signal. At external triggering,
the values are updated at the moment of triggering i.e. on the rising edge of the input
signal TRIGG. If the function block starts but does not trip, the values captured one
fundamental cycle (20 ms at rated frequency 50 Hz) after the beginning of the start
situation will be recorded. So, the current unbalance and amplitudes always originate
from the same moment.
The status data of the input signals BS1 and BS2 (Active or Not active) and the
Active group parameter are recorded at the moment of triggering. The Active
group parameter indicates the setting group valid for the recorded data.
3.3.3.5 Priorities
1 Tripping
2 Starting
3 External triggering,
which means that if the function has started, an external triggering request will be
neglected.
11
CUB3Low Substation Automation
12
Substation Automation CUB3Low
3.3.4 Events
13
CUB3Low Substation Automation
Reset time 40...1000 ms (depends on the minimum pulse width set for the
TRIP output)
14
1MRS752300-MUM DEF2_
Issued: 10/1997
Version: F/22.04.2002
Directional Earth-Fault Protection
Low-Set Stage (DEF2Low)
High-Set Stage (DEF2High)
Data subject to change without notice Instantaneous Stage (DEF2Inst)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 4
1.4 Output description ............................................................................... 4
2. Description of operation .......................................................................... 5
2.1 Configuration....................................................................................... 5
2.2 Measuring mode ................................................................................. 5
2.3 Operation criteria................................................................................. 6
2.3.1 Basic angle criterion ................................................................... 8
2.3.2 I0cos() and I0sin() characteristics ........................................ 11
2.3.3 Intermittent operation using EFSIGN........................................ 13
2.4 Delayed reset facility and drop-off time in DT mode .......................... 14
2.5 IDMT type operation of DEF2Low ..................................................... 15
2.6 Setting groups ................................................................................... 17
2.7 Test mode ......................................................................................... 17
2.8 START, TRIP and CBFP outputs ...................................................... 17
2.9 Resetting........................................................................................... 17
3. Parameters and events .......................................................................... 19
3.1 General ............................................................................................. 19
3.2 Setting values.................................................................................... 20
3.2.1 Actual settings.......................................................................... 20
3.2.2 Setting group 1......................................................................... 22
3.2.3 Setting group 2......................................................................... 23
3.2.4 Control settings ........................................................................ 24
3.3 Measurement values ......................................................................... 26
3.3.1 Input data ................................................................................. 26
3.3.2 Output data .............................................................................. 27
3.3.3 Recorded data.......................................................................... 27
3.3.4 Events ...................................................................................... 31
4. Technical data ........................................................................................ 32
DEF2_ Substation Automation
1. Introduction
1.1 Features
Directional earth-fault protection based on the neutral current Io and the residual
voltage Uo
Four selectable criteria for directional operation
Non-directional earth-fault protection based on the criterion for neutral current or
residual voltage
Definite-time (DT) operation
DEF2Low: four internationally standardized inverse-time (IDMT) characteristics
Neutral current measurement with a core-balance current transformer, residual
connection or by digital addition of phase current signals
Residual voltage measurement with open-delta connected voltage transformers or
by digital addition of phase voltage signals
Two alternative measuring principles: the average value of consecutive
instantaneous peak-to-peak values or the numerically calculated fundamental
frequency component of the earth-fault current and the residual voltage
Delayed trip output for the circuit-breaker failure protection (CBFP) function
1.2 Application
The directional earth-fault protection function blocks are designed to be used for
directional or non-directional earth-fault protection whenever the DT characteristic or,
as concerns DEF2Low, the IDMT (Inverse Definite Minimum Time) characteristic is
appropriate. Suppression of harmonics is possible.
)LJXUH 3URWHFWLRQGLDJUDPV\PEROVRI'()/RZ'()+LJKDQG'(),QVW
)RU,(&V\PEROVXVHGLQVLQJOHOLQHGLDJUDPVUHIHUWRWKHPDQXDO
7HFKQLFDO'HVFULSWLRQVRI)XQFWLRQV,QWURGXFWLRQ056080
2
Substation Automation DEF2_
)LJXUH )XQFWLRQEORFNV\PEROVRI'()/RZ'()+LJKDQG'(),QVW
3
DEF2_ Substation Automation
4
Substation Automation DEF2_
2.1 Configuration
Neutral current Io can be measured with a core balance current transformer, residual
connection or by digital addition of phase current signals. If the neutral of the network
is either isolated or earthed by a high impedance, a core balance current transformer is
recommended to be used in earth fault protection. To ensure sufficient accuracy of
zero sequence current measurements and consequently the selectivity of the scheme,
core balance current transformers should have a transformation ratio of at least 70:1.
Lower transformation ratios like 50:1 or 50:5 are not recommended.
The measuring devices and signal types for analogue channels are specified and
configured in a special dialogue box of the Relay Configuration Tool included in the
CAP 505 Tool Box. Digital inputs are configured in the same programming
environment (the number of selectable analogue inputs, digital inputs and digital
outputs depends on the type of the hardware used).
Note! When the function block DEF2_ is used, the intermittent earth-fault protection
must be selected for the channel connected to the Io input of the function block from
the special measurements dialogue box of the configuration tool, regardless of
whether the intermittent operation itself is used or not. For more information about
the intermittent earth-fault protection, refer to section Intermittent operation using
EFSIGN.
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The neutral current Io is connected to the
Io input of the function block and in the same way, the residual voltage Uo is
connected to the Uo input. Furthermore, the digital inputs are connected to the
Boolean inputs of the function block and the outputs of the function block are
connected to the output signals.
The function block operates on two alternative measuring principles: the average
value of consecutive instantaneous peak-to-peak values or the numerically calculated
fundamental frequency component of the earth-fault current and the residual voltage.
The measuring mode is selected by means of an HMI parameter or a serial
communication parameter.
With both the measuring principles, the operation is insensitive to the DC component
and the operation accuracy is defined in the frequency range f/fn=0.95...1.05. In peak-
to-peak measurement, the harmonics of the neutral current and the residual voltage are
not suppressed, whereas in fundamental frequency measurement the harmonics
suppression is at least -50 dB at f = n x fn, where n = 2, 3, 4, 5,...
5
DEF2_ Substation Automation
When the function block starts, the START signal is set to TRUE. Should the
duration of the earth-fault exceed the set definite operate time or, at the inverse-time
operation, the time determined by the level of the measured neutral current, the
function block operates. The delay of the heavy-duty output relay is included in the
total operate time. When the function block operates, the TRIP signal is set to TRUE.
The DT or IDMT timer is allowed to run only if the blocking signal BS1 is inactive,
i.e. its value is FALSE. When the signal becomes active, i.e. its value turns to TRUE,
the timer will be stopped (frozen).
When the blocking signal BS2 is active, the TRIP signal cannot be activated. The
TRIP signal can be blocked by activating the signal BS2 until the function block
drops off. Whenever the TRIP signal has been activated, the minimum pulse width is
defined via the paramerer Trip pulse.
BasicAng (1) x x x x
BasicAng (2) x x x
BasicAng (3) x x x
IoCos (1) x x x x
IoCos (2) x x
IoCos (3) x x
IoSin (1) x x
IoSin (2) x x
Non-dir. Io (1) x x
Non-dir. Io (2) x x
Non-dir. Uo x x
6
Substation Automation DEF2_
The following table presents the functions available in DEF2High and DEF2Inst:
BasicAng (1) x x x x
BasicAng (2) x x x
IoSin & Uo x x x
IoCos (1) x x x x
IoCos (2) x x
IoSin x x
Non-dir. Io x x
Non-dir. Uo x x
At the directional operation the calculation of the angle , i.e. the phase angle
between residual voltage and neutral current, will start when the neutral current
exceeds the value 0.5% In and the residual voltage the value 0.5% Un.
7
DEF2_ Substation Automation
The basic angle of the directional operation depends on the earthing principle of the
network so that in an isolated network b = -90 and in a compensated network b =
0. The basic angle b can be set to be -90, -60, -30 or 0.
In addition, the basic angle can be changed via the control signal BACTRL, in which
case the alternatives are -90 and 0. The operation of BACTRL depends on the
parameter Basic angle as shown in the following table:
BACTRL = 0 means that the input BACTRL is inactive (FALSE) and BACTRL = 1
means that the input BACTRL is active (TRUE).
8
Substation Automation DEF2_
The operating direction Forward or Reverse can be selected via the parameter
Oper. direction. The default configuration direction is forward, i.e. the power
flow direction is away from the busbar, when the voltage and current transformer
connections are as drawn in the figure below. The function block will operate on fault
currents flowing in the set direction only.
9
DEF2_ Substation Automation
L1 L3
Q1 A
Q0 N
n
Q9 a
da dn
X1.1
27 100V Ch 10, VT4
25
L1 L3 24
P1 S1 100V Ch 9, VT3
22
21
100V Ch 8, VT2
S2 19
P2 18
100V Ch 7, VT1
16
S1 15 0,2A
14 1A Ch 6, CT5
13
12 1A
S2 11 5A Ch 5, CT4
*) 10
9 1A
8 5A Ch 4, CT3
7
6 1A
5 5A Ch 3, CT2
4
3 1A
2 5A Ch 2, CT1
1
X2.2 Ch 9, sensor
DIFF
X2.3 Ch 8, sensor
*) Power flow direction: forward DIFF
X2.4 Ch 7, sensor
DIFF
X2.5 Ch 4, sensor
DIFF
X2.6 Ch 3, sensor
DIFF
X2.7 Ch 2, sensor
DIFF
X2.8 Ch 1, sensor
DIFF
currdir
REF 541
(1MRS 090115-AAB/CAB)
)LJXUH9ROWDJHDQGWUDQVIRUPHUFRQQHFWLRQVRI5()
When the reverse direction has been selected, the basic angle b = Basic angle + 180
(calculated internally) and the operating characteristics are the same as those
illustrated in Figures 2.3.1.-1 and 2.3.1.-2 but rotated by 180. The operation
equations for DSP processing are exactly the same as above.
U0
b= -90
= 70
= 80
10
Substation Automation DEF2_
b = 0 U0
I0
= 80
= 70 Operation area
3% 1% Non-operation area
I 0 / % x In
= 88 120
= 80 110
100
88, 100%
90
80
70
Operation area 60
50 85, 20%
40
-80, 3%
30 73, 1%
20
-70, 3%
10 Start current
-70, 1%
)LJXUH2SHUDWLQJFKDUDFWHULVWLFLOOXVWUDWHGLQDQ,GLDJUDPZKHQWKH
EDVLFDQJOHE DQGVWDUWFXUUHQW [,Q
In addition, the operating characteristic can be changed via the control signal
BACTRL. The operation of BACTRL depends on the parameter Oper. charact. as
follows:
11
DEF2_ Substation Automation
The setting range of the correction factor AngleCorr is 0...5 (see Figures 2.3.2.-1
and 2.3.2.-2). The operating direction Forward or Reverse can be selected via the
parameter Oper. direction. When the reverse direction has been selected, the
operating characteristics are the same as those illustrated in Figures 2.3.2.-1 and
2.3.2.-2 but rotated by 180.
U0
I0
I0 sin( )
StartCurr
AngleCorr
)LJXUH2SHUDWLQJFKDUDFWHULVWLF,VLQ
U0
I0 cos( ) I0
StartCurr Non-operation
area
)LJXUH2SHUDWLQJFKDUDFWHULVWLF,FRV
12
Substation Automation DEF2_
Momentary peak
value of neutral
current Io (k)
Momentary value
of neutral voltage
Uo (k)
3 x fundamental
amplitude of Io Fundamental
amplitude of Io
)LJXUH,QWHUPLWWHQWHDUWKIDXOWLQWKHSURWHFWHGDUHD
The operating direction Forward or Reverse can be selected via the parameter
Oper. direction. When the reverse direction has been selected, the EFSIGN value is
changed accordingly.
When the feeder terminal is used in intermittent earth-fault protection applications the
following should be considered:
degree of compensation
neutral point resistor
accuracy class and saturation point of window-type I0 current transformers
possible parallel feeder applications
rated value of the matching transformer input for I0 channel
U0 relay operate time in relation to feeder protection operate time
network earth capacitance
13
DEF2_ Substation Automation
When balance has been established between the application and the settings, relevant
intermittent earth-fault protection is obtained. In most cases the feeder or machine
terminal detects intermittent earth-faults. Because of the complexity of the
phenomenon, situations may however occur, where the operation of the protection
function might be affected. This may cause non-selective tripping.
The purpose of the delayed reset function is to enable fast clearance of intermittent
faults, e.g. self-sealing insulation faults, and severe faults which may produce high
asymmetrical fault currents that partially saturate the current transformers. It is typical
for an intermittent fault that the fault current contains so- called drop-off periods
during which the fault current is below the set start current. Without the delayed reset
function the DT timer would reset once the current drops off. In the same way, an
apparent drop-off period of the secondary current of the saturated current transformer
might reset the DT timer. The adjustable delayed reset function also enables closer
co-ordination with electromechanical induction disc relays.
When the DT timer has started, it goes on running as normally even if the current
drops off, provided the drop-off period is shorter than the set drop-off time. If the
drop-off period is longer than the set drop-off time, the DT timer will reset when the
drop-off time elapses (Figure 2.4.-1). In Figures 2.4.-1 and 2.4.-2 the input signal IN
of the DT timer is TRUE when the neutral current is above the set start value and the
directional criterion is fulfilled when in use. The input signal is FALSE when the
current is below the set start value or the directional criterion is not fulfilled.
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff1.fh7
Operate time
Operate
timer
)LJXUH7KHGURSRIISHULRGLVORQJHUWKDQWKHVHWGURSRIIWLPH
If the drop-off period is shorter than the set drop-off time and the DT timer time has
elapsed during the drop-off period, the function block will trip once the current
exceeds the set start current again (Figure 2.4.-2).
14
Substation Automation DEF2_
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff2.fh7
Operate time
Operate
timer
)LJXUH7KHGURSRIISHULRGLVVKRUWHUWKDQWKHVHWGURSRIIWLPH
At the inverse-time mode of DEF2Low the operate time is a function of the current;
the higher the current, the shorter is the operate time. Four time/current curve groups
are available. The curves comply with the BS 142 and IEC 60255 standards. The
desired operate time characteristic is selected with the parameter Operation mode.
(For a graphical presentation of the curves, refer to the manual Technical Descriptions
of Functions, Introduction.)
The relationship between time and current is in accordance with the standard IEC
60255-4 and can be expressed as follows
kx
t s =
I
( ) 1
I>
where
15
DEF2_ Substation Automation
Inverse-time
characteristic
Normal inverse 0.02 0.14
Very inverse 1.0 13.5
Extremely inverse 2.0 80.0
Long-time inverse 1.0 120
According to the standard BS 142: 1966 the effective current range is defined to be
2...20 times the set start current. If the time/current characteristic is normal inverse,
very inverse or extremely inverse, the function has to start at the latest when the
current exceeds the set start current by 1.3 times. For the long-time inverse
characteristic the effective current range is specified to be 2...7 times the set start
current and the relay is to start at the latest when the current exceeds the setting value
by 1.1 times. The function block DEF2Low will start and the IDMT integration will
begin once the current exceeds the set start current.
The operate time tolerances specified by the standard BS 142 : 1966 are the following
(E denotes the accuracy in percent):
The tolerance factors have to be smaller than those defined by the standard BS 142:
1966 for currents 2 and 5 times the setting. The DEF2Low complies with the
tolerances of class 5 (E = 5.0%) for all inverse-time curves.
For example:
16
Substation Automation DEF2_
Two different groups of setting values, group 1 and group 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the HMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated. The protection functions operate normally while the
outputs are tested.
The output signal START is always pulse-shaped. The minimum pulse width of the
corresponding output signal is set via a separate parameter on the HMI or on serial
communication. If the start situation is longer than the set pulse width, the START
signal remains active until the start situation is over. The output signal TRIP may be
non-latching or latching. When the latching mode has been selected, the TRIP signal
remains active until the output is reset even if the operation criteria have reset.
The function block provides a delayed trip signal CBFP after the TRIP signal unless
the fault has disappeared during the set CBFP time delay. The CBFP output can be
used in circuit-breaker failure protection to operate a circuit breaker in front of the
circuit breaker of the feeder. The control parameter Trip pulsealso sets the pulse
width of the CBFP output signal.
2.9 Resetting
The TRIP output signal and the registers can be reset either via the RESET input, or
over the serial bus or the local HMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
17
DEF2_ Substation Automation
18
Substation Automation DEF2_
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for DEF2Low is 40, that for DEF2High 41 and
that for DEF2Inst 42.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the HMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / HMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the HMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
19
DEF2_ Substation Automation
DEF2Low
20
Substation Automation DEF2_
21
DEF2_ Substation Automation
DEF2Low
Time multiplier S49 0.05...1.00 - 0.05 R/W Time multiplier at IDMT mode
22
Substation Automation DEF2_
DEF2Low
Time multiplier S79 0.05...1.00 - 0.05 R/W Time multiplier at IDMT mode
23
DEF2_ Substation Automation
DEF2Low
CBFP time V9 100...1000 ms 100 R/W Operate time of the delayed trip
CBFP
Angle correction V10 0.0...5.0 2.0 R/W Angle correction factor for
Iosin() / Iocos()
24
Substation Automation DEF2_
CBFP time V8 100...1000 ms 100 R/W Operate time of the delayed trip
CBFP
25
DEF2_ Substation Automation
DEF2Low
26
Substation Automation DEF2_
3.3.3.1 General
The information required for later fault analysis is recorded when the function block
starts or trips, or when the recording function is triggered via an external triggering
input.
The data of three last operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
27
DEF2_ Substation Automation
The recording function can be blocked by means of the BSREG input. For example, if
an auto-reclose sequence is initiated by the trip signal of the function block, the values
recorded just before Shot 1 are most reliable for later fault analysis. When the auto-
reclose sequence has started, no recordings are needed at the moment of tripping. The
output signal ACTIVE in AR5Func indicating AR in progress is connected to the
BSREG input to prevent useless recording.
The time stamp indicates the rising edge of the START, TRIP or TRIGG signal.
3.3.3.3 Duration
If the function block trips, the current and voltage values are updated at the moment
of tripping i.e. on the rising edge of the TRIP signal. For external triggering, the
current and voltage values are updated at the moment of triggering i.e. on the rising
edge of the input signal TRIGG. If the function block starts but does not trip, the
neutral current and residual voltage values captured one fundamental cycle (20 ms at
rated frequency 50 Hz) after the beginning of the start situation are recorded. The
values of the neutral current Io and residual voltage Uo are recorded as multiples of
the rated value.
The values of Angle(), Angle(b- ) and Intermittent E/F are recorded at the
moment of triggering.
The status data of the input signals BS1, BS2 and BACTRL as well as the Active
group parameter are recorded at the moment of triggering. The Active
groupparameter indicates the setting group valid for the recorded data.
28
Substation Automation DEF2_
3.3.3.7 Priority
1 Tripping
2 Starting
3 External triggering,
which means that if the function block has started, it will neglect an external
triggering request.
29
DEF2_ Substation Automation
30
Substation Automation DEF2_
3.3.4 Events
31
DEF2_ Substation Automation
phase angle 2
Start time Injected neutral current > 2.0 x start current and residual voltage >
2.0 x start voltage:
Reset time 40...1000 ms (depends on the minimum output pulse width set for
the TRIP output)
Operate time accuracy Depends on the frequency of the current and voltage measured:
at definite-time mode
f/fn = 0.95...1.05: 2% of set value or 20 ms2)
Accuracy class index E Depends on the frequency of the current and voltage measured:
at inverse-time mode
(DEF2Low) f/fn = 0.95...1.05: Class index E = 5.0 or 20 ms2)
32
1MRS100100 RE_5_ _
Issued: 3/2000
Version: A
High-Impedance or Flux-Balance
Data subject to change without notice
Based Differential Protection for
Generators and Motors
(Diff3)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 3
2. Description of Operation.......................................................................... 4
2.1 Configuration....................................................................................... 4
2.2 The measuring configuration based on high-impedance principle ....... 4
2.3 The measuring configuration based on flux-balancing principle........... 5
2.4 Operation criteria................................................................................. 6
2.5 Recommendations for current transformers ........................................ 7
2.5.1 High-impedance principle ........................................................... 7
2.5.2 Flux-balancing principle............................................................ 10
2.6 Setting groups ................................................................................... 11
2.7 Test mode ......................................................................................... 11
2.8 TRIP and CBFP outputs.................................................................... 11
2.9 Resetting........................................................................................... 12
3. Parameters and Events .......................................................................... 13
1. Introduction
1.1 Features
1.2 Application
This document specifies the function of Diff3, the three-phase differential protection
for generators and motors based on high-impedance or flux-balancing principle. The
function block is used in products based on the RED 500 Platform.
3I>
)LJXUH 3URWHFWLRQGLDJUDPV\PERORI'LII)RU,(&V\PEROVXVHGLQVLQJOHOLQH
GLDJUDPVUHIHUWRWKHPDQXDO7HFKQLFDO'HVFULSWLRQVRI)XQFWLRQV
,QWURGXFWLRQ056080
)LJXUH )XQFWLRQEORFNV\PERORI'LII
2
ABB Automation Diff3 RE_5_ _
3
RE_5_ _ Diff3 ABB Automation
2.1 Configuration
If the relay is not yet configured, the measuring devices and signal types for the
analogue channels are selected and configured in a special dialogue box of the Relay
Configuration Tool included in the CAP 505 Tool Box. Digital inputs are configured
in the same programming environment (the number of the selectable analogue inputs,
digital inputs and digital outputs depends on the hardware used).
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the Relay Configuration Tool. The differential phase currents
(e.g. IL1, IL2 and IL3 or IL1b, IL2b and IL3b) are connected to the corresponding Id1, Id2
and Id3 inputs of the function block. Digital inputs are connected to the boolean
inputs of the function block and in the same way, the outputs of the function block are
connected to the output signals.
If the relay is already configured, the phase differential currents can be measured via
the measuring configuration presented in Figure 3 below and connected to the chosen
analogue inputs of the relay.
P1 P2 P2 P1
IL1
S1 S2 S2 S1
IL2
IL3
Variable resistor
Stabilizing
resistor
87 87 87
Id1 Id2 Id3
Zdifconn
)LJXUH 7KUHHSKDVHGLIIHUHQWLDOSURWHFWLRQIRUJHQHUDWRUVDQGPRWRUVEDVHGRQ
KLJKLPSHGDQFHSULQFLSOH
4
ABB Automation Diff3 RE_5_ _
Us
Rs =
Ir
(1)
where
I kmax
Us = ( R in + R m )
n (2)
where
Additionally it is required that the knee-point voltages (Uk) of the current transformers
are at least twice the value of the stabilizing voltage (U s).
1RWH The current transformers should be of the same type and the burdens of the
current transformers in every phase should be the same. This makes it possible to use
the same value for the stabilizing resistor and the same value for the Basic setting
parameter in every phase.
For more information about calculating the value of the stabilizing resistor and
choosing the current transformers refer to section Recommendations for current
transformers.
5
RE_5_ _ Diff3 ABB Automation
line end and the other at the neutral end, are both measured by the same core-balance
transformer.
In this scheme, the currents flowing through one core-balance transformer cancel each
other out when there is no fault within the protected area. When a fault occurs within
the protected zone, the currents flowing through the core-balance transformer amplify
each other and the differential protection operates.
Rogowski coils can also be used to measure the currents when using this scheme.
IL1
IL2
IL3
87
Koyhadif
)LJXUH )OX[EDODQFLQJGLIIHUHQWLDOSURWHFWLRQIRUJHQHUDWRUVDQGPRWRUV
1RWH If six current transformers are to be used, it is strongly recommended that the
high-impedance principle described in the previous section or the Stabilized Three-
Phase Differential Protection for Generators (Diff6G) is utilized instead of a summing
configuration where two current transformers are connected in series to constitute a
differential current.
In the high-impedance configuration, the value of the stabilizing resistor, which has to
be calculated before installation and commissioning, mainly determines the stability
6
ABB Automation Diff3 RE_5_ _
of the relay. The Basic setting allows for fine tuning the sensitivity of the
protection.
To make the operation of the relay fast and reliable for in-zone faults, the knee-point
voltage has to be twice the stabilizing voltage. The stabilizing voltage Us of the
function block is given by equation (2) in section The measuring configuration based
on high-impedance principle. The required knee-point voltage Uk of the current
transformer is calculated as follows:
Uk = 2 x Us (3)
The factor 2 is used when no operate delay is permitted for the protection.
The sensitivity requirements for the protection are jeopardized if the magnetizing
current of the current transformers at the knee-point voltage is too high. The Iprim value
of the primary current at which the function block operates at certain settings can be
calculated as follows:
where
The value I0 given in many catalogues is the excitation current at knee-point voltage.
Writing Ie = 0.5 x I0 gives a realistic value for Iprim in equation (4).
1. The nominal current In of the protected winding has to be known, since it also
affects how high Ikmax is. Normally, the Ikmax value for small transformers is
Ikmax 16 x In.
7
RE_5_ _ Diff3 ABB Automation
2. The nominal primary current I1n of the CT (current transformer) must be higher
than the nominal current of the protected winding. The choice of the CT also
specifies Rin.
3. The required Uk is calculated using the formula (3). If the Uk of the CT is not high
enough, another CT has to be chosen. The value of Uk is given by the manufacturer
or in some cases it can be estimated (see equation (5) below).
4. The sensitivity Iprim is calculated with the formula (4). If the achieved sensitivity is
sufficient, the present CT is chosen. If better sensitivity is needed, a CT with a
bigger core is chosen.
If other than class X current transformers are used, an estimate for Uk can be
calculated as follows:
where
If the rated accuracy limit factor Fn is used in equation (5) instead of Fa, also Rm has to
be replaced with the rated burden of the current transformer.
Example of the required knee-point voltage and achieved sensitivity is given below
where the value 6 x In is used as Ikmax. When calculating Iprim, the value Ir = m x Ie has
been given for the setting of the relay and the value Iu = 0 A for the current of the
varistor. Ir depends on the application. However, it is recommended that Ir m x Ie.
The number of CTs connected in parallel is here m = 2.
1RWH: The formulas are based on worst-case analysis, i.e. choosing the CTs
according to the criteria above (equation 3) results in an absolutely stable scheme. In
some cases it is possible to achieve stability by knee-point voltages lower than stated
by the formulae. The conditions of the network, however, have to be known well
enough to ensure the stability. The following rule could be used.
1RWH: The stability analysis is based on the assumption that the ampere turns are the
same for individual CTs. If that is not the case, the selectivity may be endangered. It is
thus recommended that all the CTs used in the scheme are of the same type and
preferably from the same batch. It is also required that the CTs in each phase are of
the same type and the burdens of the CTs are also the same for each phase because the
parameter Basic setting is the same for all the phases.
8
ABB Automation Diff3 RE_5_ _
IL1
IL2
IL3
Sn = 8 MVA
Un = 6 kV
Rm
Ru
I d1
Rs
3Id>
Example
Dif3esim
)LJXUH 'LIIHUHQWLDOSURWHFWLRQRIWKHJHQHUDWRURQO\RQHSKDVHLVSUHVHQWHGLQ
GHWDLO
The protected generator has the following values:
Sn = 8 MVA
Un = 6 kV
In = 770 A
Ikmax = 6 x In = 6 x 770 A = 4620 A
Let us choose the current transformer type KOFD 12 A 21 with the following values
given by the manufacturer:
I1n = 1000 A
I2n = 1 A
Uk = 323 V
Rin = 15.3
I0 = 0.012 A
If the length of the secondary circuit is 100 m (the whole loop being thus 200 m) and
the area of the cross-section is 2.5 mm2, then
The required knee-point voltage can be calculated using the formula (3):
9
RE_5_ _ Diff3 ABB Automation
The required value 155 V is lower than the value 323 V, which means that Uk of this
current transformer is high enough.
As mentioned earlier, writing Ie = 0.5 x I0 gives a realistic value for Iprim in equation
(4). By writing Iu = 0 and Ir = m x 0.5 x I0, the following value for the sensitivity can
be calculated:
Because the parameter Basic setting is set in per cent of the generator nominal
current, the value for Basic setting will then be set to:
Rs = Us / Ir = 78 V / I0 = 78 V / 0.012 A = 6500
Rs = Us / Ir = 78 V / 24 mA = 3250
When the function block is used with the flux-balancing principle, there are no extra
requirements for the measuring devices but the core-balance transformers and
Rogowski coils used in an ordinary overcurrent protection are adequate here as well.
10
ABB Automation Diff3 RE_5_ _
Two different groups of setting values, group 1 and group 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
The TRIP and CBFP digital outputs of the function block can be activated with
separate control parameters for each output either locally via the MMI or externally
via the serial communication. When an output is activated with the test parameter, an
event indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The output signal TRIP may have a non-latching or latching feature. When the
latching mode has been selected, the TRIP signal remains active until the output is
reset even if the operation criteria have reset. When the non-latching mode has been
selected, the TRIP signal remains active until the operation criteria have reset and the
time determined by the control parameter Trip pulse has elapsed.
The function block provides a delayed trip signal CBFP after the TRIP signal unless
the fault has disappeared during the set CBFP time delay. In circuit-breaker failure
protection the CBFP output can be used to operate a circuit breaker in front of the
circuit breaker of the machine. The control parameter Trip pulse also sets the width
of the CBFP output signal. The CBFP signal is always non-latching.
11
RE_5_ _ Diff3 ABB Automation
2.9 Resetting
The TRIP output signal and the registers can be reset via the RESET input, or over the
serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
12
ABB Automation Diff3 RE_5_ _
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for Diff3 is 100.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
13
RE_5_ _ Diff3 ABB Automation
14
ABB Automation Diff3 RE_5_ _
CBFP time V6 1001000 ms 100 R/W Operate time of the delayed trip
CBFP
15
RE_5_ _ Diff3 ABB Automation
3.3.3.1 General
The data of three last operations (operation 1...3) are recorded, and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
The time stamp indicates the moment of the highest fault current during 50 ms after
the tripping.
16
ABB Automation Diff3 RE_5_ _
3.3.3.3 Currents
If the function block trips, all the recorded phase differential current values will
originate from the same moment determined by the highest differential current. The
values of the differential phase currents Id1, Id2 and Id3 are recorded as multiples of the
rated current In.
The status of the Active group parameter, which indicates the setting group valid
for the recorded data, is recorded at the moment of tripping.
17
RE_5_ _ Diff3 ABB Automation
3.3.4 Events
18
ABB Automation Diff3 RE_5_ _
Reset time 60...1020 ms (depends on the minimum pulse width set for the
TRIP output)
Retardation time This function block cannot retard but trips once the current
exceeds the operate value.
19
1MRS752301-MUM Diff3
Issued: 3/2000
Version: B/25.04.2002
High-Impedance or Flux-Balance
Based Differential Protection for
Data subject to change without notice Generators and Motors
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 3
1. Introduction
1.1 Features
1.2 Application
This document specifies the function of Diff3, the three-phase differential protection
for generators and motors based on high-impedance or flux-balancing principle. The
function block is used in products based on the RED 500 Platform.
3I>
)LJXUH3URWHFWLRQGLDJUDPV\PERORI'LII)RU,(&V\PEROVXVHGLQVLQJOH
OLQHGLDJUDPVUHIHUWRWKHPDQXDO7HFKQLFDO'HVFULSWLRQVRI)XQFWLRQV
,QWURGXFWLRQ056080
)LJXUH )XQFWLRQEORFNV\PERORI'LII
2
Substation Automation Diff3
3
Diff3 Substation Automation
2.1 Configuration
If the relay is not yet configured, the measuring devices and signal types for the
analogue channels are selected and configured in a special dialogue box of the Relay
Configuration Tool included in the CAP 505 Tool Box. Digital inputs are configured
in the same programming environment (the number of the selectable analogue inputs,
digital inputs and digital outputs depends on the hardware used).
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the Relay Configuration Tool. The differential phase currents
(e.g. IL1, IL2 and IL3 or IL1b, IL2b and IL3b) are connected to the corresponding Id1, Id2
and Id3 inputs of the function block. Digital inputs are connected to the boolean
inputs of the function block and in the same way, the outputs of the function block are
connected to the output signals.
The phase differential currents can be measured via the measuring configuration
presented in Figure 2.2.-1 below and connected to the chosen analogue inputs of the
relay.
P1 P2 P2 P1
IL1
S1 S2 S2 S1
IL2
IL3
Variable resistor
Stabilizing
resistor
87 87 87
Id1 Id2 Id3
Zdifconn
)LJXUH 7KUHHSKDVHGLIIHUHQWLDOSURWHFWLRQIRUJHQHUDWRUVDQGPRWRUVEDVHG
RQKLJKLPSHGDQFHSULQFLSOH
4
Substation Automation Diff3
Us
Rs =
Ir
(1)
where
I kmax
Us = ( R in + R m )
n (2)
where
Additionally it is required that the knee-point voltages (Uk) of the current transformers
are at least twice the value of the stabilizing voltage (U s).
1RWH The current transformers should be of the same type and the burdens of the
current transformers in every phase should be the same. This makes it possible to use
the same value for the stabilizing resistor and the same value for the Basic setting
parameter in every phase.
For more information about calculating the value of the stabilizing resistor and
choosing the current transformers refer to section Recommendations for current
transformers.
5
Diff3 Substation Automation
line end and the other at the neutral end, are both measured by the same core-balance
transformer.
In this scheme, the currents flowing through one core-balance transformer cancel each
other out when there is no fault within the protected area. When a fault occurs within
the protected zone, the currents flowing through the core-balance transformer amplify
each other and the differential protection operates.
Rogowski coils can also be used to measure the currents when using this scheme.
IL1
IL2
IL3
87
Koyhadif
)LJXUH )OX[EDODQFLQJGLIIHUHQWLDOSURWHFWLRQIRUJHQHUDWRUVDQGPRWRUV
1RWH If six current transformers are to be used, it is strongly recommended that the
high-impedance principle described in the previous section or the Stabilized Three-
Phase Differential Protection for Generators (Diff6G) is utilized instead of a summing
configuration where two current transformers are connected in series to constitute a
differential current.
In the high-impedance configuration, the value of the stabilizing resistor, which has to
be calculated before installation and commissioning, mainly determines the stability
6
Substation Automation Diff3
of the relay. The Basic setting allows for fine tuning the sensitivity of the
protection.
To make the operation of the relay fast and reliable for in-zone faults, the knee-point
voltage has to be twice the stabilizing voltage. The stabilizing voltage Us of the
function block is given by equation (2) in section The measuring configuration based
on high-impedance principle. The required knee-point voltage Uk of the current
transformer is calculated as follows:
Uk = 2 x Us (3)
The factor 2 is used when no operate delay is permitted for the protection.
The sensitivity requirements for the protection are jeopardized if the magnetizing
current of the current transformers at the knee-point voltage is too high. The Iprim value
of the primary current at which the function block operates at certain settings can be
calculated as follows:
where
The value I0 given in many catalogues is the excitation current at knee-point voltage.
Writing Ie = 0.5 x I0 gives a realistic value for Iprim in equation (4).
1. The nominal current In of the protected winding has to be known, since it also
affects how high Ikmax is. Normally, the Ikmax value for generators is
Ikmax 6 x In.
7
Diff3 Substation Automation
2. The nominal primary current I1n of the CT (current transformer) must be higher
than the nominal current of the protected winding. The choice of the CT also
specifies Rin.
3. The required Uk is calculated using the formula (3). If the Uk of the CT is not high
enough, another CT has to be chosen. The value of Uk is given by the manufacturer
or in some cases it can be estimated (see equation (5) below).
4. The sensitivity Iprim is calculated with the formula (4). If the achieved sensitivity is
sufficient, the present CT is chosen. If better sensitivity is needed, a CT with a
bigger core is chosen.
If other than class X current transformers are used, an estimate for Uk can be
calculated as follows:
where
If the rated accuracy limit factor Fn is used in equation (5) instead of Fa, also Rm has to
be replaced with the rated burden of the current transformer.
Example of the required knee-point voltage and achieved sensitivity is given below
where the value 6 x In is used as Ikmax. When calculating Iprim, the value Ir = m x Ie has
been given for the setting of the relay and the value Iu = 0 A for the current of the
varistor. Ir depends on the application. However, it is recommended that Ir m x Ie.
The number of CTs connected in parallel is here m = 2.
1RWH: The formulas are based on worst-case analysis, i.e. choosing the CTs
according to the criteria above (equation 3) results in an absolutely stable scheme. In
some cases it is possible to achieve stability by knee-point voltages lower than stated
by the formulae. The conditions of the network, however, have to be known well
enough to ensure the stability. The following rule could be used.
1RWH: The stability analysis is based on the assumption that the ampere turns are the
same for individual CTs. If that is not the case, the selectivity may be endangered. It is
thus recommended that all the CTs used in the scheme are of the same type and
preferably from the same batch. It is also required that the CTs in each phase are of
the same type and the burdens of the CTs are also the same for each phase because the
parameter Basic setting is the same for all the phases.
8
Substation Automation Diff3
IL1
IL2
IL3
Sn = 8 MVA
Un = 6 kV
Rm
Ru
I d1
Rs
3Id>
Example
Dif3esim
)LJXUH'LIIHUHQWLDOSURWHFWLRQRIWKHJHQHUDWRURQO\RQHSKDVHLVSUHVHQWHG
LQGHWDLO
The protected generator has the following values:
Sn = 8 MVA
Un = 6 kV
In = 770 A
Ikmax = 6 x In = 6 x 770 A = 4620 A
Let us choose the current transformer type KOFD 12 A 21 with the following values
given by the manufacturer:
I1n = 1000 A
I2n = 1 A
Uk = 323 V
Rin = 15.3
I0 = 0.012 A
If the length of the secondary circuit is 100 m (the whole loop being thus 200 m) and
the area of the cross-section is 2.5 mm2, then
The required knee-point voltage can be calculated using the formula (3):
9
Diff3 Substation Automation
The required value 155 V is lower than the value 323 V, which means that Uk of this
current transformer is high enough.
As mentioned earlier, writing Ie = 0.5 x I0 gives a realistic value for Iprim in equation
(4). By writing Iu = 0 and Ir = m x 0.5 x I0, the following value for the sensitivity can
be calculated:
Because the parameter Basic setting is set in percent of the generator nominal
current, the value for Basic setting will then be set to:
Rs = Us / Ir = 78 V / I0 = 78 V / 0.012 A = 6500
Rs = Us / Ir = 78 V / 24 mA = 3250
When the function block is used with the flux-balancing principle, there are no extra
requirements for the measuring devices but the core-balance transformers and
Rogowski coils used in an ordinary overcurrent protection are adequate here as well.
10
Substation Automation Diff3
Two different groups of setting values, group 1 and group 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
The selected setting group is valid immediately after switching. The control parameter
"Active group" indicates the setting group which is valid at a given time.
The START, TRIP and CBFP digital outputs of the function block can be activated
with separate control parameters for each output either locally via the HMI or
externally via the serial communication. When an output is activated with the test
parameter, an event indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The output signal START is always pulse-shaped. The minimum pulse width of the
START and TRIP output signals is set via a separate parameter in the HMI or in serial
communication. If the start situation is longer than the set pulse width, the START
signal remains active until the start situation is over. The output signal TRIP may
have a non-latching or a latching feature. When the latching mode has been selected,
the TRIP signal remains active until the output is reset even if the operation criteria
have been reset.
The function block provides a delayed trip signal CBFP after the TRIP signal unless
the fault has disappeared during the set CBFP time delay. In circuit-breaker failure
protection the CBFP output can be used to operate a circuit breaker in front of the
circuit breaker of the machine. The control parameter Trip pulse also sets the width
of the CBFP output signal. The CBFP signal is always non-latching.
11
Diff3 Substation Automation
2.9 Resetting
The TRIP output signal and the registers can be reset via the RESET input, or over the
serial bus or the local HMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
12
Substation Automation Diff3
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for Diff3 is 100.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the HMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / HMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the HMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
13
Diff3 Substation Automation
14
Substation Automation Diff3
CBFP time V6 1001000 ms 100 R/W Operate time of the delayed trip
CBFP
Event mask 1 V101 0...1023 - 783 R/W Event mask 1 for event
transmission (E0 ... E9)
Event mask 2 V103 0...1023 - 783 R/W Event mask 2 for event
transmission (E0 ... E9)
Event mask 3 V105 0...1023 - 783 R/W Event mask 3 for event
transmission (E0 ... E9)
Event mask 4 V107 0...1023 - 783 R/W Event mask 4 for event
transmission (E0 ... E9)
1)
Operation mode 0 = Not in use; 1 = Definite time; 2 = Instantaneous
2)
Group selection 0 = Group 1; 1 = Group 2; 2 = GROUP input
3)
Active group 0 = Group 1; 1 = Group 2
4)
Trip signal 0 = Non-latching; 1 = Latching
5)
Test 0 = Do not activate; 1 = Activate
15
Diff3 Substation Automation
3.3.3.1 General
The data of three last operations (operation 1...3) are recorded, and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
16
Substation Automation Diff3
DT mode
The time stamp indicates the moment of the highest fault current during a period
between the start situation and 50 ms after the tripping.
Instantaneous mode
The time stamp indicates the moment of the highest fault current during 50 ms after
the tripping.
3.3.3.3 Currents
If the function block trips, all the recorded phase differential current values will
originate from the same moment determined by the highest differential current. The
values of the differential phase currents Id1, Id2 and Id3 are recorded as multiples of the
rated current In.
If the function block starts but does not trip, the highest fault current during start
situation is recorded.
The status of the Active group parameter, which indicates the setting group valid
for the recorded data, is recorded at the moment of tripping.
3.3.3.5 Duration
17
Diff3 Substation Automation
18
Substation Automation Diff3
3.3.4 Events
19
Diff3 Substation Automation
Trip time in instantaneous mode Injected currents > 2.0 x operating current:
Start time in definite-time mode Injected currents > 2.0 x operating current:
Reset time 60...1020 ms (depends on the minimum pulse width set for the
TRIP output)
Retardation time in instantaneous This function block cannot retard but trips once the current
mode exceeds the operate value.
Retardation time in definite-time Total retardation time when the current drops
mode
below the start value 2) < 40 ms
20
1MRS752302-MUM Diff6G
Issued: 10/1998
Version: C/18.1.2002
Stabilized Three-Phase
Differential Protection
Data subject to change without notice for Generators
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 4
1.4 Output description ............................................................................... 4
2. Description of Operation.......................................................................... 5
2.1 Configuring the inputs and the outputs ................................................ 5
2.2 Configuration error checking ............................................................... 5
2.3 Setting the rated values of the protected unit ...................................... 6
2.4 Operation criteria................................................................................. 6
2.4.1 Stabilized stage 3I>.................................................................. 6
2.4.2 Saturation detection ................................................................... 8
2.4.3 Instantaneous stage 3I>>......................................................... 8
2.5 Recommendations for current transformers ........................................ 8
2.6 Connection of current transformers ................................................... 10
2.7 Setting groups ................................................................................... 12
2.8 Test mode ......................................................................................... 12
2.9 TRIP and CBFP outputs.................................................................... 12
2.10 Resetting........................................................................................... 13
3. Parameters and Events .......................................................................... 14
3.1 General ............................................................................................. 14
3.2 Setting values.................................................................................... 15
3.2.1 Actual settings.......................................................................... 15
3.2.2 Setting group 1......................................................................... 16
3.2.3 Setting group 2......................................................................... 16
3.2.4 Control settings ........................................................................ 17
3.3 Measurement values ......................................................................... 18
3.3.1 Input data ................................................................................. 18
3.3.2 Output data .............................................................................. 19
3.3.3 Recorded data.......................................................................... 19
3.3.4 Events ...................................................................................... 24
4. Technical Data ........................................................................................ 25
Diff6G Substation Automation
1. Introduction
1.1 Features
1.2 Application
3I>
3I>>
)LJXUH 3URWHFWLRQGLDJUDPV\PERORI'LII*)RU,(&V\PEROVXVHGLQVLQJOHOLQH
GLDJUDPVUHIHUWRWKHPDQXDO7HFKQLFDO'HVFULSWLRQVRI)XQFWLRQV
,QWURGXFWLRQ056080
2
Substation Automation Diff6G
)LJXUH )XQFWLRQEORFNV\PERORI'LII*
3
Diff6G Substation Automation
4
Substation Automation Diff6G
Phase currents can be measured either via conventional current transformers or via
Rogowski coils but no combination of these two is possible.The measuring devices
and signal types for analogue channels are selected and configured in a special
dialogue box of the Relay Configuration Tool included in the CAP 505 Tool Box.
Digital inputs are configured in the same programming environment (the number of
selectable analogue inputs, digital inputs and digital outputs depends on the hardware
used).
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The phase currents IL1, IL2, IL3, IL1b, IL2b
and IL3b are connected to the corresponding IL1, IL2, IL3, IL1b, IL2b and IL3b inputs
of the function block. The currents IL1-IL3 are assumed to be measured at the neutral
end and the currents IL1b-IL3b at the line end of the generator (see Figure 3 below).
Digital inputs are connected to the boolean inputs of the function block and in the
same way, the outputs of the function block are connected to the output signals.
IL1 IL1b
IL2 IL2b
IL3 IL3b
)LJXUH &XUUHQWVDWWKHQHXWUDOHQGDQGDWWKHOLQHHQGRIWKHJHQHUDWRU
When the relay is started, the function block checks the signal types and the
measuring device types of the connected analogue inputs. If the signal types are not
phase currents (IL1, IL2 IL3, IL1b, IL2b or IL3b) or if all the measuring device types are not
current transformers or Rogowski coils, the ERR output is activated. Also an event
E13 is sent.
The program that the function block is instantiated within should be associated with a
task the interval of which is not greater than one fourth of the fundamental cycle. The
ERR output of the function block will be activated if an association with a slower task
is made. Also an event E13 is sent.
5
Diff6G Substation Automation
A separate scaling factor can be set for each analogue channel. The factors enable
differences between the ratings of the protected unit and those of the measuring
device (CTs, VTs, etc.). A setting of 1.00 means that the rated value of the protected
unit is exactly the same as that of the measuring device. For more information refer to
Technical Reference Manual for REM 54_.
The differential protection function block includes two stages for generator
differential protection.
, G = ,1 , 2 (1)
In a normal situation there is no fault in the area protected by the function block. Then
the currents , 1 and , 2 are equal and the differential current ,G = 0. In practise,
however, the differential current sligthly deviates from zero in normal situations. In
generator protection the deviation is caused by CT inaccuracies.
In a stabilized differential relay the differential current required for tripping is the
higher the higher the load current is. The stabilizing current ,E of the relay is obtained
as follows:
,1 + , 2
,E =
2 (2)
6
Substation Automation Diff6G
Id
In Default settings
Maximum settings
3
I b3
2 I b2 OPERATION I d3
Minimum settings
1 I d1
NO OPERATION
In Turn-point 1 Turn-point 2
I d2 Ib
In
1 2 3 4 5
)LJXUH 2SHUDWLQJFKDUDFWHULVWLFIRUWKHVWDELOL]HGVWDJHRIWKHJHQHUDWRU
GLIIHUHQWLDOSURWHFWLRQIXQFWLRQEORFN'LII*
The basic setting for the stabilized stage of the function block is determined according
to Figure 4:
The slope of the operating characteristic for the function block varies in different
parts of the range. In part 1 (0.0 < Ib/I n < Turn-point 1), the differential current
required for tripping is constant. The value of the differential current is the same as
the basic setting selected for the function block. The basic setting basicly allows for
small inaccuracies of current transformers but it can also be used to influence the
overall level of the operating characteristic.
The part 2, i.e. when Turn-point 1 < I b /I n < Turn-point 2, is called the influence area
of the settingStarting ratio. In this part, variations in the starting ratio affect the
slope of the characteristic i.e. how big the change in the differential current required
for tripping is in comparison with the change in the load current. The starting ratio
allows for CT errors.
At high stabilizing currents, i.e. when I b /I n > Turn-point 2, the slope of the
characteristic is constant (part 3). The slope is 100%, which means that the increase in
the differential current is equal to the corresponding increase in the stabilizing
current.
7
Diff6G Substation Automation
The required differential current for tripping at a sertain stabilizing current level can
be calculated using the following formulas:
If the stabilizing current is greater than Turn-point 1 but lower than Turn-point 2,
The stabilized stage is provided with a current transformer saturation detection based
on the waveforms of the currents. The saturation detection blocks Diff6G internally in
case of current transformer saturation during an external fault.
The more important the object to be protected, the more attention should be paid to
the current transformers. Normally, it is not possible to dimension the current
transformers so that they repeat currents with high DC components without saturating
when the residual flux of the current transformer is high. The differential protection
function block Diff6G operates reliably even though the current transformers are
partially saturated. The purpose of the following current transformer
recommendations is to secure the stability of the relay at high through currents and
the quick and sensitive operation of the relay at faults occurring in the protected area,
where the fault currents may be high.
8
Substation Automation Diff6G
The accuracy class recommended for current transformers to be used with the
differential function block Diff6G is 5P, in which the limit of the current error at the
rated primary current is 1% and the limit of the phase displacement is 60 minutes. The
limit of the composite error at the rated accuracy limit primary current is 5%.
The approximate value of the accuracy limit factor Fa corresponding to the actual CT
burden can be calculated on the basis of the rated accuracy limit factor Fn (ALF) at
the rated burden, the rated burden Sn, the internal burden Sin and the actual burden Sa
of the current transformer as follows:
S in + S n
Fa = Fn (3)
S in + S a
EXAMPLE 1
In the example the rated burden Sn of the line end CTs 5P20 is 10 VA, the
secondary rated current 5A, the internal resistance Rin = 0.07 and the accuracy
limit factor Fn (ALF) corresponding to the rated burden is 20 (5P20). Thus the
internal burden of the current transformer is Sin = (5A)2 0.07 = 1.75 VA. The
input impedance of the relay at a rated current of 5A is < 20 m. If the
measurement conductors have a resistance of 0.113 , the actual burden of the
current transformer is Sa =(5A)2 (0.113 + 0.020) = 3.33 VA. Thus the
accuracy limit factor Fa corresponding to the actual burden will be about 46.
The CT burden may grow considerably at the rated current of 5A. At the rated current
of 1A the actual burden of the current transformer decreases, while the repeatability
simultaneously improves.
At faults occurring in the protected area, the fault currents from the line end may be
very high compared to the rated currents of the current transformers. Thanks to the
instantaneous stage of the differential function block, it is enough that the current
transformers are capable of repeating, during the first cycle, the current required for
instantaneous tripping.
Thus the current transformers should be able to reproduce the asymmetric fault
current without saturating within the next 10 ms after the occurrence of the fault, to
secure that the operate times of the relay comply with the times stated in section
Technical Data.
The accuracy limit factors corresponding to the actual burden of the phase current
transformer to be used in differential protection shall fulfill the following
requirement:
9
Diff6G Substation Automation
The parameter r gives the maximum remanence flux density in the CT core. The value
of the parameter r depends on the magnetic material used and on the construction of
the CT. For example the value r = 0.4 means that the remanence flux density may be
40 % of the saturation flux density. The manufacturer of the CT should be contacted
when an accurate value of the parameter r is needed. The value r = 0.4 is
recommended to be used in practice. The requirement can then be rewritten as
follows:
1 A current transformer with a higher rated burden Sn can be chosen (which also
means a higher rated accuracy limit Fn) or
2 a current transformer with a higher nominal primary current I1n (but the same rated
burden) can be chosen
The alternative 2. is more cost effective and therefore often better although the
sensitivity of the scheme is slightly reduced.
EXAMPLE 2
If we assume the maximum through-going fault current Ikmax to be 6000 A and the
nominal primary current of the CT is 1500 A, we get for Fa:
Fa = ( 6000 / 1500 ) 5 = 20
In generator protection it is important that the accuracy limit factors (Fa ) of the phase
current transformers at the neutral end and at the line end of the generator correspond
to each other, i.e. the burdens of the current transformers on both sides are as equal as
possible. Should high inrush or start currents with high DC components pass through
the protected generator when it is connected to the network, special attention should
be paid to the performance and the burdens of the current transformers and to the
settings of the function block.
The connections of the main current transformers are designated as Type I and Type
II. In case the earthings of the current transformers are either inside or outside the area
to be protected, the setting parameterCT connection is of Type I (Figure 5). In case
the earthings of the current transformers are both inside and outside the area to be
protected, the setting parameter CT connection is of Type II (Figure 6). The default
setting is Type I.
10
Substation Automation Diff6G
P2 P1 P1 P2
IL1 IL1b
IL2 IL2b
IL3 IL3b
S2 S1 S1 S2
P1 P2 P2 P1
IL1 IL1b
IL2 IL2b
IL3 IL3b
S1 S2 S2 S1
)LJXUH &RQQHFWLRQRIFXUUHQWWUDQVIRUPHUVRI7\SH,
P1 P2 P1 P2
IL1 IL1b
IL2 IL2b
IL3 IL3b
S1 S2 S1 S2
P2 P1 P2 P1
IL1 IL1b
IL2 IL2b
IL3 IL3b
S2 S1 S2 S1
)LJXUH &RQQHFWLRQRIFXUUHQWWUDQVIRUPHUVRI7\SH,,
11
Diff6G Substation Automation
Two different groups of setting values, group 1 and group 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
The TRIP and CBFP digital outputs of the function block can be activated with
separate control parameters for each output either locally via the MMI or externally
via the serial communication. When an output is activated with the test parameter, an
event indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The output signal TRIP may have a non-latching or latching feature. When the
latching mode has been selected, the TRIP signal remains active until the output is
reset even if the operation criteria have reset. When the non-latching mode has been
selected, the TRIP signal remains active until the operation criteria have reset and the
time determined by the the control parameter Trip pulse has elapsed.
The function block provides a delayed trip signal CBFP after the TRIP signal unless
the fault has disappeared during the set CBFP time delay. In circuit-breaker failure
protection the CBFP output can be used to operate a circuit breaker in front of the
circuit breaker of the machine. The control parameter Trip pulse also sets the width
of the CBFP output signal.
12
Substation Automation Diff6G
2.10 Resetting
The TRIP output signal and the registers can be reset via the RESET input, or over the
serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
13
Diff6G Substation Automation
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for Diff6G is 99.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
14
Substation Automation Diff6G
15
Diff6G Substation Automation
Starting ratio S42 10...50 % 10 R/W Slope of the second line of the operating
characteristics
Turn-point 1 S43 0.0...1.0 x In 0.5 R/W Turn-point between the first and the
second line of the operating
characteristics
Turn-point 2 S44 1.0...3.0 x In 1.5 R/W Turn-point between the second and the
third line of the operating characteristics
Inst. setting S45 5...30 x In 5 R/W Tripping value of the instantaneous stage
Starting ratio S72 10...50 % 10 R/W Slope of the second line of the operating
characteristics
Turn-point 1 S73 0.0...1.0 x In 0.5 R/W Turn-point between the first and the
second line of the operating
characteristics
Turn-point 2 S74 1.0...3.0 x In 1.5 R/W Turn-point between the second and the
third line of the operating characteristics
Inst. setting S75 5...30 x In 5 R/W Tripping value of the instantaneous stage
16
Substation Automation Diff6G
CBFP time V6 100...1000 ms 100 R/W Operate time of the delayed trip CBFP
5)
CT connection V7 0 or 1 - 0 R/W Determined by the directions of the
connected currents transformers
Event mask 1 V101 0...16383 - 8255 R/W Event mask 1 for event transmission
(E0 ... E13)
Event mask 2 V103 0...16383 - 8255 R/W Event mask 2 for event transmission
(E0 ... E13)
Event mask 3 V105 0...16383 - 8255 R/W Event mask 3 for event transmission
(E0 ... E13)
Event mask 4 V107 0...16383 - 8255 R/W Event mask 4 for event transmission
(E0 ... E13)
1)
Status 0 = Not in use; 1 = In use
2)
Group selection 0 = Group 1; 1 = Group 2; 2 = GROUP input
3)
Active group 0 = Group 1; 1 = Group 2
4)
Trip signal 0 = Non-latching; 1 = Latching
5)
CT connection 0 = Type I; 1 = Type II
6)
Test 0 = Do not activate; 1 = Activate
17
Diff6G Substation Automation
Angle IL2-IL3 I14 -180...180 0 R/M Phase diff. of the currents L2 & L3
Angle IL3-IL1 I15 -180...180 0 R/M Phase diff. of the currents L3 & L1
Angle IL1b-IL2b I16 -180...180 0 R/M Phase diff. of the currents L1b & L2b
Angle IL2b-IL3b I17 -180...180 0 R/M Phase diff. of the currents L2b & L3b
Angle IL3b-IL1b I18 -180...180 0 R/M Phase diff. of the currents L3b & L1b
Angle IL1-IL1b I19 -180...180 0 R/M Phase diff. of the currents L1 & L1b
Angle IL2-IL2b I20 -180...180 0 R/M Phase diff. of the currents L2 & L2b
Angle IL3-IL3b I21 -180...180 0 R/M Phase diff. of the currents L3 & L3b
18
Substation Automation Diff6G
3.3.3.1 General
The information required for later fault analysis is recorded when the function block
trips or when the recording function is triggered via an external triggering input.
The data of three last operations (operation 1...3) are recorded, and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
The time stamp indicates the rising edge of the TRIGG signal or the moment of the
highest fault current during the period of 50 ms after the rising edge of the TRIP
signal.
If the function block trips, all the recorded current and phase difference values will
originate from the same moment determined by the highest differential current. For
external triggering, the current values are recorded at the moment of triggering i.e. on
the rising edge of the input signal TRIGG. Consequently, the values of the phase
currents I L1, I L2, I L3, I L1b, I L2b, I L3b, the values of the differential currents I d1, I d2 ,I d3,
the values of the stabilizing currents Ib1, Ib2, Ib3 and the phase difference values always
originate from the same moment. The current values are recorded as multiples of the
rated current In and the phase difference values are recorded in degrees.
19
Diff6G Substation Automation
The status data of the input signals BS1 and BS2 (Active or Not active) as well as the
parameters Active group and Reg. reason are recorded at the moment of tripping
and triggering. The Active group parameter indicates the setting group valid for the
recorded data and the Reg. Reason parameter the reason for the particular
registration (i.e. trip of the stabilized stage, trip of the instantaneous stage or
activation of the TRIGG input).
20
Substation Automation Diff6G
21
Diff6G Substation Automation
22
Substation Automation Diff6G
23
Diff6G Substation Automation
3.3.4 Events
E12 0 0 - -
24
Substation Automation Diff6G
4% of set value or 2% x In
4% of set value or 2% x In
25
1MRS100035 (Low) RE_5_ _
1MRS100036 (High) Three-Phase Directional
1MRS100037 (Inst)
Issued: 10/1998 Overcurrent Protection
Version: C
Low-Set Stage (DOC6Low)
Data subject to change without notice
High-Set Stage (DOC6High)
Instantaneous Stage (DOC6Inst)
Contents
1. Introduction .............................................................................................. 3
1.1 Features.............................................................................................. 3
1.2 Application........................................................................................... 3
1.3 Input description.................................................................................. 5
1.4 Output description ............................................................................... 6
2. Description of Operation.......................................................................... 7
2.1 Configuration....................................................................................... 7
2.2 Measuring mode ................................................................................. 7
2.3 Operation criteria................................................................................. 8
2.3.1 Current direction......................................................................... 8
2.3.2 Memory function....................................................................... 12
2.3.3 Non-directional operation of DOC6High and DOC6Inst............ 12
2.3.4 DIRECTION output .................................................................. 13
2.4 Delayed reset facility and drop-off time in DT mode .......................... 13
2.5 IDMT type operation of DOC6Low .................................................... 14
2.5.1 Standard curve groups ............................................................. 14
2.5.2 RI curve groups........................................................................ 16
2.5.3 RD curve groups ...................................................................... 16
2.6 Setting groups ................................................................................... 17
2.7 Test mode ......................................................................................... 17
2.8 START, TRIP and CBFP outputs ...................................................... 17
2.9 Resetting........................................................................................... 18
3. Parameters and Events .......................................................................... 19
4. Technical Data.........................................................................................34
2
ABB Automation DOC6Low, DOC6High, DOC6Inst RE_5_ _
1. Introduction
1.1 Features
1.2 Application
This document specifies the functions of the directional overcurrent function blocks
DOC6Low, DOC6High and DOC6Inst used in products based on the RED 500
Platform. The operation of the low-set stage differs from that of the high-set and
instantaneous stages regarding the following two features:
3
RE_5_ _ DOC6Low, DOC6High, DOC6Inst ABB Automation
)LJXUH )XQFWLRQEORFNV\PEROVRI'2&/RZ'2&+LJKDQG'2&,QVW
4
ABB Automation DOC6Low, DOC6High, DOC6Inst RE_5_ _
5
RE_5_ _ DOC6Low, DOC6High, DOC6Inst ABB Automation
DOC6Low
6
ABB Automation DOC6Low, DOC6High, DOC6Inst RE_5_ _
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The phase currents IL1, IL2 and IL3 are
connected to the IL1, IL2 and IL3 inputs and the phase-to-phase voltages U12, U23 and
U31 correspondingly to the U12, U23 and U31 inputs of the function block. If phase-
to-earth voltages are used, they are connected to the inputs as follows: U1 to input
U12, U2 to input U23 and U3 to input U31. Furthermore, digital inputs are connected
to the boolean inputs of the function block, and in the same way, the outputs of the
function block are connected to the output signals.
The function block operates on two alternative measuring principles: the average
value of consecutive instantaneous peak-to-peak values or the numerically calculated
fundamental frequency component of the short-circuit current. The measuring mode is
selected via either an MMI parameter or a serial communication parameter as follows:
With both the measuring principles, the operation is insensitive to the DC component
and the operation accuracy is defined in the frequency range f/fn=0.95...1.05. In peak-
to-peak measurement, the harmonics of the phase currents are not suppressed,
whereas in fundamental frequency measurement the harmonics suppression is about
-50 dB at f = n x fn, where n = 2, 3, 4, 5,...
7
RE_5_ _ DOC6Low, DOC6High, DOC6Inst ABB Automation
The function block starts if the current flows in the set operating direction and
exceeds the set start current in two or more phases or, if earth-fault protection is
enabled, in one or more phases. The set start current is automatically doubled when
the signal connected to the DOUBLE input becomes active. The automatic doubling
function can be used e.g. during a magnetizing inrush or at start-up.
)LJXUH )XQFWLRQRIWKH'28%/(LQSXW
When the function block starts, the START signal is set to TRUE. Should the
directional overcurrent situation exceed the set definite operate time or, at the inverse-
time operation, the time determined by the level of the measured current, the function
block operates. The delay of the heavy-duty output relay is included in the total
operate time. When the function block operates, the TRIP signal is set to TRUE.
The DT or IDMT timer is allowed to run only if the blocking signal BS1 is not active,
i.e. its value is FALSE. When the signal becomes active, i.e. its value turns to TRUE,
the timer will be stopped (frozen).
When the blocking signal BS2 is active, the TRIP signal cannot be activated. The
TRIP signal can be blocked by activating the signal BS2 until the function block
drops off.
The operating direction can be set to either forward or reverse via the setting
parameter Oper. Direction. The default configuration direction is forward, i.e. the
power flow direction is away from the busbar, when the voltage and current
transformer connections are as drawn in the figure below. The function block will
operate on fault currents flowing in the set direction only.
8
ABB Automation DOC6Low, DOC6High, DOC6Inst RE_5_ _
L1 L3
Q1 A
Q0 N
n
Q9 a
da dn
X1.1
27 100V Ch 10, VT4
25
L1 L3 24
P1 S1 100V Ch 9, VT3
22
21
100V Ch 8, VT2
S2 19
P2 18
100V Ch 7, VT1
16
S1 15 0,2A
14 1A Ch 6, CT5
13
12 1A
S2 11 5A Ch 5, CT4
*) 10
9 1A
8 5A Ch 4, CT3
7
6 1A
5 5A Ch 3, CT2
4
3 1A
2 5A Ch 2, CT1
1
X2.2 Ch 9, sensor
DIFF
X2.3 Ch 8, sensor
*) Power flow direction: forward DIFF
X2.4 Ch 7, sensor
DIFF
X2.5 Ch 4, sensor
DIFF
X2.6 Ch 3, sensor
DIFF
X2.7 Ch 2, sensor
DIFF
X2.8 Ch 1, sensor
DIFF
currdir
REF 541
(1MRS 090115-AAB/CAB)
)LJXUH 9ROWDJHDQGWUDQVIRUPHUFRQQHFWLRQVRI5()
In case of a two-phase short circuit, the direction of the current is determined using
the phase-to-phase voltage and the phase-to-phase current of the two faulty phases.
Phase-to-phase currents are numerically derived from the measured phase currents. If
phase-to-earth voltages are connected, phase-to-phase voltages are numerically
derived from the measured phase-to-earth voltages. Which currents and voltages are
used depends on between which phases the short circuit is, as shown below:
Current is flowing in the set operating direction when the phase difference is within
the defined operating sector. The phase difference is the difference between the
phase-to-phase current and the set basic angle b which is given in relation to the
phase-to-phase voltage and set via the parameter Basic angle b. How the phase
difference is calculated depends on between which phases the short circuit is, as
shown below:
9
RE_5_ _ DOC6Low, DOC6High, DOC6Inst ABB Automation
In case of a three-phase short circuit i.e. when an overcurrent is detected in all three
phases, the function block will operate if at least one of the phase differences 12, 23
and 31 is within the operating sector.
The operating sector for forward operation is within +/ -80 from the basic angle b
and the one for reverse operation correspondingly the sector outside +/ -100 from b,
as shown in Figure 5. The operating sector includes a hysteresis of 10, which means
that when the operating direction is set to forward and the phase difference is within
the operating sector of +/-80, the sector will be enlarged to +/-90. When is outside
the operating sector, the size of the sector will remain as +/-80. Correspondingly, the
operating sector for reverse operation is enlarged to the sector outside +/-90 when
the phase difference is within the operating sector.
)LJXUH 'HWHUPLQDWLRQRIFXUUHQWGLUHFWLRQLQDWZRSKDVHVKRUWFLUFXLWVLWXDWLRQ
Figure 5 shows an example of a short circuit between the phases L1 and L2. Here the
fault current is flowing in forward direction since the phase difference 12 is +30,
which is within the forward direction operating sector.
The use of earth-fault protection is optional, which means that when the setting
parameter Earth fault pr. is given the value Disabled, the function block operates
on short circuits only, and when the parameter is set to Enabled, the function block
operates on both short circuits and earth faults.
10
ABB Automation DOC6Low, DOC6High, DOC6Inst RE_5_ _
The principle for determining the current direction in case of an earth fault depends
on whether phase-to-phase voltages or phase-to-earth voltages are connected to the
function block. When phase-to-earth voltages are connected, the direction of the
current is determined using the phase-to-earth voltage and the phase current of the
faulty phase. Which phase difference is used depends on in which phase the earth
fault is, as shown below:
The operating sector is defined in relation to the basic angle b, which is given in
relation to the phase-to-earth voltage. As for the short circuit case the operating sector
for forward operation is within +/-80 from the basic angle b and the one for reverse
operation the sector outside +/-100 from b, both with the hysteresis of 10.
)LJXUH 'HWHUPLQDWLRQRIFXUUHQWGLUHFWLRQLQFDVHRIDQHDUWKIDXOWZKHQSKDVH
WRHDUWKYROWDJHVDUHPHDVXUHG
Figure 6 shows an example of an earth fault in phase L1. Here the phase difference 1
is +30, which means that the current is flowing in forward direction.
When phase-to-phase voltages are connected to the function block, the current
direction in an earth-fault situation is determined using the same phase differences as
in a short circuit situation. Which phase difference is used depends on in which phase
the earth fault is, as shown below:
11
RE_5_ _ DOC6Low, DOC6High, DOC6Inst ABB Automation
The operation sectors in this case are the same as in the short circuit case.
The function block is provided with a memory function to secure a reliable and
correct directional relay operation in case of a close short circuit or an earth fault
characterized by an extremely low voltage. At sudden loss of voltage, the phase angle
of the voltage is calculated on the basis of a fictive voltage. The fictive voltage is
calculated using the voltage measured before the fault occured, assuming that the
voltage is not affected by the fault. The memory function enables the function block
to operate up to 2 seconds after a total loss of voltage.
When the voltage falls below 0.07 x Un at a close fault, the fictive voltage will be
used to determine the phase angle. The measured voltage is applied again as soon as
the voltage rises above 0.08 x Un. The fictive voltage is also discarded if the measured
voltage stays below 0.08 x Un for more than 2 seconds or if the fault current
disappears while the fictive voltage is in use.
When the voltage is below 0.08 x Un and the fictive voltage either cannot be used
because the phase angle could not be reliably measured before the fault situation or
has already been used for 2 seconds, the current direction cannot be determined and
the function block will not operate.
The function block will always operate non-directionally in an inrush situation where
a circuit breaker is closed against a close fault and the current direction cannot be
reliably measured, i.e. voltage does not rise above 0.08 x Un. The state of the setting
parameter Nondir. operat. does not affect this feature.
12
ABB Automation DOC6Low, DOC6High, DOC6Inst RE_5_ _
The DIRECTION output is set to TRUE when any current is flowing in the set
operating direction, which means that any of the used phase differences is inside the
operating sector. In all other situations the output is set to FALSE.
The purpose of the delayed reset function is to enable fast clearance of intermittent
faults, e.g. self-sealing insulation faults, and severe faults that may produce high
asymmetrical fault currents that partially saturate the current transformers. It is typical
for an intermittent fault that the fault current contains so-called drop-off periods
during which the fault current is below the set start current. Without the delayed reset
function the DT timer would reset once the current drops off. In the same way, an
apparent drop-off period of the secondary current of the saturated current transformer
might cause the DT timer to reset. The adjustable delayed reset function also enables
closer co-ordination with electromechanical induction disc relays.
When the DT timer has started, it goes on running normally even if the current drops
off, provided the drop-off period is shorter than the set drop-off time. If the drop-off
period is longer than the set drop-off time, the DT timer will reset when the drop-off
time elapses (Figure 7).
In Figures 7 and 8 the input signal IN of the DT timer is TRUE when the current is
above the set start value and FALSE when the current is below the set start value.
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff1.fh7
Operate time
Operate
timer
)LJXUH 7KHGURSRIISHULRGLVORQJHUWKDQWKHVHWGURSRIIWLPH
13
RE_5_ _ DOC6Low, DOC6High, DOC6Inst ABB Automation
If the drop-off period is shorter than the set drop-off time and the DT timer time has
elapsed during the drop-off period, the function block will trip once the current
exceeds the set start value again (Figure 8).
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff2.fh7
Operate time
Operate
timer
)LJXUH 7KHGURSRIISHULRGLVVKRUWHUWKDQWKHVHWGURSRIIWLPH
At the inverse-time mode of the low-set stage the operate time of the function block is
a function of the current; the higher the current, the shorter is the operate time. Six
time/current curve groups are available. Four of the groups comply with the BS 142
and IEC 60255 standards, whereas the two curve groups RI and RD (RXIDG) are
special type of curve groups corresponding to the ABB praxis. The desired operate
time characteristic is selected via the parameter Operation mode.
14
ABB Automation DOC6Low, DOC6High, DOC6Inst RE_5_ _
The relationship between time and current is in accordance with the standard IEC
60255 and can be expressed as follows
kx
t[s] =
I
( ) 1
I>
where
Inverse-time
characteristic
Normal inverse 0.02 0.14
Very inverse 1.0 13.5
Extremely inverse 2.0 80.0
Long-time inverse 1.0 120
According to the standard BS 142: 1966 the effective current range is defined as
2...20 times the set start current. If the time/current characteristic is normal inverse,
very inverse, or extremely inverse, the function has to start at the latest when the
current exceeds the set start current 1.3 times. For the long-time inverse characteristic
the effective current range is specified to be 2...7 times the set start current and the
relay is to start at the latest when the current exceeds the setting value 1.1 times. The
three-phase directional overcurrent function block DOC6Low will start and the IDMT
integration will begin once the current exceeds the set start value and the phase angle
criteria is fulfilled.
The operate time tolerances specified by the standard BS 142 : 1966 are the following
(E denotes the accuracy in per cent):
15
RE_5_ _ DOC6Low, DOC6High, DOC6Inst ABB Automation
The tolerance factors have to be smaller than those defined by the standard BS 142:
1966 for currents of 2 and 5 times the setting. The function block DOC6Low
complies with the tolerances of class 5 (E = 5.0%) for all inverse-time curves.
For example:
k
t s =
I>
0. 339 0. 236 x
I
I
t[s] = 5. 8 -1. 35 x ln
k x I>
The accuracy of the RI- and RD-type characteristics is 5%. Also with the RI- and RD-
type characteristics, the function block will start and the IDMT integration will begin
once the current exceeds the set start current.
16
ABB Automation DOC6Low, DOC6High, DOC6Inst RE_5_ _
Two different groups of setting values, group 1 and group 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The output signal START is always pulse-shaped. The minimum pulse width of the
corresponding output signal is set via a separate parameter on the MMI or via serial
communication. If the start situation is longer than the set pulse width, the START
signal remains active until the start situation is over. The output signal TRIP may
have a non-latching or latching feature. When the latching mode has been selected,
the TRIP signal remains active until the output is reset even if the operation criteria
have reset.
The function block provides a delayed trip signal CBFP after the TRIP signal unless
the fault has disappeared during the set CBFP time delay. In circuit-breaker failure
protection, the CBFP output can be used to operate a circuit breaker in front of the
circuit breaker of the feeder. The control parameter Trip pulse also sets the width of
the CBFP output signal.
17
RE_5_ _ DOC6Low, DOC6High, DOC6Inst ABB Automation
2.9 Resetting
The TRIP output signal and the registers can be reset either via the RESET input, or
over the serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
18
ABB Automation DOC6Low, DOC6High, DOC6Inst RE_5_ _
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for DOC6Low is 35, that for DOC6High 36
and that for DOC6Inst 37.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
19
RE_5_ _ DOC6Low, DOC6High, DOC6Inst ABB Automation
DOC6Low
20
ABB Automation DOC6Low, DOC6High, DOC6Inst RE_5_ _
DOC6Low
21
RE_5_ _ DOC6Low, DOC6High, DOC6Inst ABB Automation
DOC6Low
Time multiplier S74 0.05...1.00 - 0.05 R/W Time multiplier at IDMT mode
22
ABB Automation DOC6Low, DOC6High, DOC6Inst RE_5_ _
DOC6Low
CBFP time V9 100...1000 ms 100 R/W Operate time of the delayed trip
CBFP
23
RE_5_ _ DOC6Low, DOC6High, DOC6Inst ABB Automation
CBFP time V8 100...1000 ms 100 R/W Operate time of the delayed trip
CBFP
24
ABB Automation DOC6Low, DOC6High, DOC6Inst RE_5_ _
Input DOUBLE I20 0 or 1 1) - 0 R/M Signal for doubling the set start
current
25
RE_5_ _ DOC6Low, DOC6High, DOC6Inst ABB Automation
DOC6Low
3.3.3.1 General
The information required for later fault analysis is recorded when the function block
starts or trips, or when the recording function is triggered via an external triggering
input.
The data of three last operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
The recording function can be blocked via the BSREG input. For example, if an auto-
reclose sequence is initiated by the trip signal of the function block, the values most
reliable for later fault analysis are those recorded just before Shot 1. When the auto-
reclose sequence has started, no recordings are needed at the moment of tripping. The
output signal ACTIVE in AR5Func indicating AR in progress is connected to the
BSREG input to prevent useless recording.
26
ABB Automation DOC6Low, DOC6High, DOC6Inst RE_5_ _
The time stamp indicates the rising edge of the START, TRIP or TRIGG signal.
3.3.3.3 Duration
If the function block trips, the measured current, voltage and phase difference values
are updated at the moment of tripping i.e. on the rising edge of the TRIP signal. For
external triggering, the measured values are updated at the moment of triggering i.e.
on the rising edge of the input signal TRIGG. If the function block starts but does not
trip, the values captured one fundamental cycle (20 ms at rated frequency 50 Hz) after
the beginning of the start situation are recorded. Thus the values of the currents,
voltages and phase differences always originate from the same moment.
The currents are recorded as multiples of the rated current In and the voltages as
multiples of the rated voltage Un. The phase differences are recorded in degrees.
The state of the DIRECTION signal of DOC6Low is recorded at the same moment as
currents and voltages are recorded.
The status data of the input signals BS1, BS2 and DOUBLE (Active or Not active) as
well as the Active group parameter are recorded at the moment of triggering.
27
RE_5_ _ DOC6Low, DOC6High, DOC6Inst ABB Automation
3.3.3.8 Priority
1 Tripping
2 Starting
3 External triggering,
which means that if the function block has started, it will neglect an external
triggering request.
28
ABB Automation DOC6Low, DOC6High, DOC6Inst RE_5_ _
29
RE_5_ _ DOC6Low, DOC6High, DOC6Inst ABB Automation
30
ABB Automation DOC6Low, DOC6High, DOC6Inst RE_5_ _
31
RE_5_ _ DOC6Low, DOC6High, DOC6Inst ABB Automation
3.3.4 Events
DOC6Low
32
ABB Automation DOC6Low, DOC6High, DOC6Inst RE_5_ _
33
RE_5_ _ DOC6Low, DOC6High, DOC6Inst ABB Automation
Current measurement:
Voltage measurement:
Reset time 40...1000 ms (depends on the minimum pulse width set for the
TRIP output)
34
1MRS752303-MUM DOC6_
Issued: 10/1998
Version: D/02.05.2002 Three-Phase Directional
Overcurrent Protection
Low-Set Stage (DOC6Low)
High-Set Stage (DOC6High)
Data subject to change without notice
Instantaneous Stage (DOC6Inst)
Contents
1. Introduction .............................................................................................. 3
1.1 Features.............................................................................................. 3
1.2 Application........................................................................................... 3
1.3 Input description.................................................................................. 5
1.4 Output description ............................................................................... 6
2
Substation Automation DOC6_
1. Introduction
1.1 Features
1.2 Application
This document specifies the functions of the directional overcurrent function blocks
DOC6Low, DOC6High and DOC6Inst used in products based on the RED 500
Platform. The operation of the low-set stage differs from that of the high-set and
instantaneous stages regarding the following two features:
3
DOC6_ Substation Automation
)LJXUH)XQFWLRQEORFNV\PEROVRI'2&/RZ'2&+LJKDQG'2&,QVW
4
Substation Automation DOC6_
5
DOC6_ Substation Automation
DOC6Low
6
Substation Automation DOC6_
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The phase currents IL1, IL2 and IL3 are
connected to the IL1, IL2 and IL3 inputs and the phase-to-phase voltages U12, U23 and
U31 correspondingly to the U12, U23 and U31 inputs of the function block. If phase-
to-earth voltages are used, they are connected to the inputs as follows: U1 to input
U12, U2 to input U23 and U3 to input U31. In both cases, all six analog inputs have to
be connected. Otherwise the configuration error output will be activated and the
protection function will be blocked. Furthermore, digital inputs are connected to the
Boolean inputs of the function block, and in the same way, the outputs of the function
block are connected to the output signals.
The function block operates on two alternative measuring principles: the average
value of consecutive instantaneous peak-to-peak values or the numerically calculated
fundamental frequency component of the short-circuit current. The measuring mode is
selected via either an HMI parameter or a serial communication parameter as follows:
With both the measuring principles, the operation is insensitive to the DC component
and the operation accuracy is defined in the frequency range f/fn=0.95...1.05. In peak-
to-peak measurement, the harmonics of the phase currents are not suppressed,
7
DOC6_ Substation Automation
The function block starts if the current flows in the set operating direction and
exceeds the set start current in two or more phases or, if earth-fault protection is
enabled, in one or more phases. The set start current is automatically doubled when
the signal connected to the DOUBLE input becomes active. The automatic doubling
function can be used e.g. during a magnetizing inrush or at start-up.
)LJXUH)XQFWLRQRIWKH'28%/(LQSXW
When the function block starts, the START signal is set to TRUE. Should the
directional overcurrent situation exceed the set definite operate time or, at the inverse-
time operation, the time determined by the level of the measured current, the function
block operates. The internal delay of the heavy-duty output relay is included in the
total operate time. When the function block operates, the TRIP signal is set to TRUE.
The DT or IDMT timer is allowed to run only if the blocking signal BS1 is not active,
i.e. its value is FALSE. When the signal becomes active, i.e. its value turns to TRUE,
the timer will be stopped (frozen).
When the blocking signal BS2 is active, the TRIP signal cannot be activated. The
TRIP signal can be blocked by activating the signal BS2 until the function block
drops off.
8
Substation Automation DOC6_
The operating direction can be set to either forward or reverse via the setting
parameter Oper. Direction. The default configuration direction is forward, i.e. the
power flow direction is away from the busbar, when the voltage and current
transformer connections are as drawn in the figure below. The function block will
operate on fault currents flowing in the set direction only.
L1 L3
Q1 A
Q0 N
n
Q9 a
da dn
X1.1
27 100V Ch 10, VT4
25
L1 L3 24
P1 S1 100V Ch 9, VT3
22
21
100V Ch 8, VT2
S2 19
P2 18
100V Ch 7, VT1
16
S1 15 0,2A
14 1A Ch 6, CT5
13
12 1A
S2 11 5A Ch 5, CT4
*) 10
9 1A
8 5A Ch 4, CT3
7
6 1A
5 5A Ch 3, CT2
4
3 1A
2 5A Ch 2, CT1
1
X2.2 Ch 9, sensor
DIFF
X2.3 Ch 8, sensor
*) Power flow direction: forward DIFF
X2.4 Ch 7, sensor
DIFF
X2.5 Ch 5, sensor
DIFF
X2.6 Ch 4, sensor
DIFF
X2.7 Ch 3, sensor
DIFF
X2.8 Ch 2, sensor
DIFF
X2.9 Ch 1, sensor
DIFF
currdir
REF 541
(1MRS 090115-AAB/CAB)
)LJXUH9ROWDJHDQGFXUUHQWWUDQVIRUPHUFRQQHFWLRQVRI5()
In case of a two-phase short circuit, the direction of the current is determined using
the phase-to-phase voltage and the phase-to-phase current phasors of the two faulty
phases. Phase-to-phase currents are numerically derived from the measured phase
currents. If phase-to-earth voltages are connected, phase-to-phase voltages are
numerically derived from the measured phase-to-earth voltages. Which currents and
voltages are used depends on between which phases the short circuit is, as shown
below:
9
DOC6_ Substation Automation
Current is flowing in the set operating direction when the phase difference is within
the defined operating sector. The phase difference is the difference between the
phase-to-phase current and the set basic angle b which is given in relation to the
phase-to-phase voltage and set via the parameter Basic angle b. How the phase
difference is calculated depends on between which phases the short circuit is, as
shown below:
In case of a three-phase short circuit i.e. when an overcurrent is detected in all three
phases, the function block will operate if at least one of the phase differences 12, 23
and 31 is within the operating sector.
The operating sector for forward operation is within 80 from the basic angle b and
the one for reverse operation correspondingly the sector outside 100 from b, as
shown in Figure 2.3.1-2. The operating sector includes a hysteresis of 10, which
means that when the operating direction is set to forward and the phase difference is
within the operating sector of 80, the sector will be enlarged to 90. When is
outside the operating sector, the size of the sector will remain as 80.
Correspondingly, the operating sector for reverse operation is enlarged to the sector
outside 90 when the phase difference is within the operating sector.
10
Substation Automation DOC6_
)LJXUH'HWHUPLQDWLRQRIFXUUHQWGLUHFWLRQLQDWZRSKDVHVKRUWFLUFXLW
VLWXDWLRQ
Figure 2.3.1-2 shows an example of a short circuit between the phases L1 and L2. Here
the fault current is flowing in forward direction since the phase difference 12 is +30,
which is within the forward direction operating sector.
The use of earth-fault protection is optional, which means that when the setting
parameter Earth fault pr. is given the value Disabled, the function block operates
on short circuits only, and when the parameter is set to Enabled, the function block
operates on both short circuits and earth faults.
The principle for determining the current direction in case of an earth fault depends
on whether phase-to-phase voltages or phase-to-earth voltages are connected to the
function block. When phase-to-earth voltages are connected, the direction of the
current is determined using the phase-to-earth voltage and the phase current of the
faulty phase. Which phase difference is used depends on in which phase the earth
fault is, as shown below:
The operating sector is defined in relation to the basic angle b, which is given in
relation to the phase-to-earth voltage. As for the short circuit case the operating sector
for forward operation is within 80 from the basic angle b and the one for reverse
operation the sector outside 100 from b, both with the hysteresis of 10.
11
DOC6_ Substation Automation
)LJXUH'HWHUPLQDWLRQRIFXUUHQWGLUHFWLRQLQFDVHRIDQHDUWKIDXOWZKHQ
SKDVHWRHDUWKYROWDJHVDUHPHDVXUHG
Figure 2.3.1-3 shows an example of an earth fault in phase L1. Here the phase
difference 1 is +30, which means that the current is flowing in forward direction.
When phase-to-phase voltages are connected to the function block, the current
direction in an earth-fault situation is determined using the same phase differences as
in a short circuit situation. Which phase difference is used depends on in which phase
the earth fault is, as shown below:
The operation sectors in this case are the same as in the short circuit case.
The function block is provided with a memory function to secure a reliable and
correct directional relay operation in case of a close short circuit or an earth fault
characterized by an extremely low voltage. At sudden loss of voltage, the phase angle
of the voltage is calculated on the basis of a fictive voltage. The fictive voltage is
calculated using the voltage measured before the fault occurred, assuming that the
voltage is not affected by the fault. The memory function enables the function block
to operate up to 2 seconds after a total loss of voltage.
12
Substation Automation DOC6_
When the voltage falls below 0.07 x Un at a close fault, the fictive voltage will be
used to determine the phase angle. The measured voltage is applied again as soon as
the voltage rises above 0.08 x Un. The fictive voltage is also discarded if the measured
voltage stays below 0.08 x Un for more than 2 seconds or if the fault current
disappears while the fictive voltage is in use.
When the voltage is below 0.08 x Un and the fictive voltage is unusable, the fault
direction cannot be determined. In this case the low-set stage will not operate at all.
The high-set or instantaneous stage will not operate directionally but they can operate
non-directionally as described in the next paragraph. Fictive voltage can be unusable
for two reasons:
the phase angle could not be reliably measured before the fault situation
The DIRECTION output is set to TRUE when any current is flowing in the set
operating direction, which means that any of the used phase differences is inside the
operating sector. In all other situations the output is set to FALSE.
2.4 Delayed reset facility and drop-off time in DT and IDMT modes
The purpose of the delayed reset function is to enable fast clearance of intermittent
faults, e.g. self-sealing insulation faults, and severe faults that may produce high
asymmetrical fault currents that partially saturate the current transformers. It is typical
for an intermittent fault that the fault current contains so-called drop-off periods
during which the fault current is below the set start current. Without the delayed reset
function the DT or the IDMT timer would reset once the current drops off. In the
same way, an apparent drop-off period of the secondary current of the saturated
13
DOC6_ Substation Automation
current transformer might cause the DT or the IDMT timer to reset. The adjustable
delayed reset function also enables closer co-ordination with electromechanical
induction disc relays.
When the DT timer has started, it goes on running normally even if the current drops
off, provided the drop-off period is shorter than the set drop-off time. In the same
situation the IDMT timer is frozen. If the drop-off period is longer than the set drop-
off time, the DT or the IDMT timer will reset when the drop-off time elapses. The
situation in the case of the DT timer is described in Figure 2.4.-1.
In Figures 2.4.-1 and 2.4.-2 the input signal IN of the DT timer is TRUE when the
current is above the set start value and FALSE when the current is below the set start
value.
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff1.fh7
Operate time
Operate
timer
)LJXUH7KHGURSRIISHULRGLVORQJHUWKDQWKHVHWGURSRIIWLPH
14
Substation Automation DOC6_
If the drop-off period is shorter than the set drop-off time and the DT timer time has
elapsed during the drop-off period, the function block will trip once the current
exceeds the set value again (Figure 2.4.-2).
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff2.fh7
Operate time
Operate
timer
)LJXUH7KHGURSRIISHULRGLVVKRUWHUWKDQWKHVHWGURSRIIWLPH
In the inverse-time mode of the low-set stage the operate time of the function block is
a function of the current; the higher the current, the shorter is the operate time. Six
time/current curve groups are available. Four of the groups comply with the BS 142
and IEC 60255 standards, whereas the two curve groups RI and RD (RXIDG) are
special type of curve groups corresponding to the ABB praxis. The desired operate
time characteristic is selected via the parameter Operation mode.
For a graphical presentation of the IDMT curves, refer to the manual Technical
Descriptions of Functions, Introduction.
15
DOC6_ Substation Automation
kx
t[s] =
I
( ) 1
I>
where
I phase current
Inverse-time
characteristic
Normal inverse 0.02 0.14
Very inverse 1.0 13.5
Extremely inverse 2.0 80.0
Long-time inverse 1.0 120
According to the standard BS 142: 1966 the effective current range is defined as
2...20 times the set start current. If the time/current characteristic is normal inverse,
very inverse, or extremely inverse, the function has to start at the latest when the
current exceeds the set start current 1.3 times. For the long-time inverse characteristic
the effective current range is specified to be 2...7 times the set start current and the
relay is to start at the latest when the current exceeds the setting value 1.1 times. The
three-phase directional overcurrent function block DOC6Low will start and the IDMT
integration will begin once the current exceeds the set start value and the phase angle
criteria is fulfilled.
The operate time tolerances specified by the standard BS 142 : 1966 are the following
(E denotes the accuracy in percent):
16
Substation Automation DOC6_
The tolerance factors are in accordance to those defined by the standard BS 142: 1966
for currents of 2 and 5 times the setting. The function block DOC6Low complies with
the tolerances of class 5 (E = 5.0%) for all inverse-time curves.
For example:
k
t s =
I>
0. 339 0. 236 x
I
I
t[s] = 5. 8 -1. 35 x ln
k x I>
The accuracy of the RI- and RD-type characteristics is 5%. Also with the RI- and RD-
type characteristics, the function block will start and the IDMT integration will begin
once the current exceeds the set start current.
17
DOC6_ Substation Automation
Two different groups of setting values, group 1 and group 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
The group settings come into effect immediately after selection. The control
parameter "Active group" indicates that the setting group is valid at a given time.
The digital outputs of the function block can be activated with separate control
settings for each output either locally via the HMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The output signal START is always pulse-shaped. The minimum pulse width of the
corresponding output signal is set via a separate parameter on the HMI or via serial
communication. If the start situation is longer than the set pulse width, the START
signal remains active until the start situation is over. The output signal TRIP may
have a non-latching or latching feature. When the latching mode has been selected,
the TRIP signal remains active until the output is reset even if the operation criteria
have reset.
The function block provides a delayed trip signal CBFP after the TRIP signal unless
the fault has disappeared during the set CBFP time delay. In circuit-breaker failure
protection, the CBFP output can be used to operate a circuit breaker in front of the
circuit breaker of the feeder. The control parameter Trip pulse also sets the width of
the CBFP output signal.
18
Substation Automation DOC6_
2.9 Resetting
The TRIP output signal and the registers can be reset either via the RESET input, or
over the serial bus or the local HMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
19
DOC6_ Substation Automation
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for DOC6Low is 35, that for DOC6High 36
and that for DOC6Inst 37.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the HMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / HMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the HMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
20
Substation Automation DOC6_
DOC6Low
21
DOC6_ Substation Automation
DOC6Low
22
Substation Automation DOC6_
DOC6Low
23
DOC6_ Substation Automation
DOC6Low
CBFP time V9 100...1000 ms 100 R/W Operate time of the delayed trip
CBFP
24
Substation Automation DOC6_
CBFP time V8 100...1000 ms 100 R/W Operate time of the delayed trip
CBFP
25
DOC6_ Substation Automation
Input DOUBLE I20 0 or 1 1) - 0 R/M Signal for doubling the set start
current
26
Substation Automation DOC6_
DOC6Low
3.3.3.1 General
The information required for later fault analysis is recorded when the function block
starts or trips, or when the recording function is triggered via an external triggering
input.
The data of three last operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
The recording function can be blocked via the BSREG input. For example, if an auto-
reclose sequence is initiated by the trip signal of the function block, the values most
reliable for later fault analysis are those recorded just before Shot 1. When the auto-
reclose sequence has started, no recordings are needed at the moment of tripping. The
output signal ACTIVE in AR5Func indicating AR in progress is connected to the
BSREG input to prevent useless recording.
27
DOC6_ Substation Automation
The time stamp indicates the rising edge of the START, TRIP or TRIGG signal.
3.3.3.3 Duration
If the function block trips, the measured current, voltage and phase difference values
are updated at the moment of tripping i.e. on the rising edge of the TRIP signal. For
external triggering, the measured values are updated at the moment of triggering i.e.
on the rising edge of the input signal TRIGG. If the function block starts but does not
trip, the values captured one fundamental cycle (20 ms at rated frequency 50 Hz) after
the beginning of the start situation are recorded. Thus the values of the currents,
voltages and phase differences always originate from the same moment.
The currents are recorded as multiples of the rated current In and the voltages as
multiples of the rated voltage Un. The phase differences are recorded in degrees.
The state of the DIRECTION signal of DOC6Low is recorded at the same moment as
currents and voltages are recorded.
The status data of the input signals BS1, BS2 and DOUBLE (Active or Not active) as
well as the Active group parameter are recorded at the moment of triggering.
28
Substation Automation DOC6_
3.3.3.8 Priority
1 Tripping
2 Starting
3 External triggering,
which means that if the function block has started, it will neglect an external
triggering request.
29
DOC6_ Substation Automation
30
Substation Automation DOC6_
31
DOC6_ Substation Automation
32
Substation Automation DOC6_
3.3.4 Events
DOC6Low
33
DOC6_ Substation Automation
34
Substation Automation DOC6_
Current measurement:
Voltage measurement:
Reset time 40...1000 ms (depends on the minimum pulse width set for the
TRIP output)
0 or 2 No suppression
E -
35
1MRS752370-MUM EVENT230
Issued: 10/1997
Version: D/7.2.2002
Customer-Defined Event
Data subject to change without notice
Contents
1. Description................................................................................................ 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 2
2. Description of Operation.......................................................................... 3
2.1 General ............................................................................................... 3
2.2 How to use .......................................................................................... 3
3. Setting Values........................................................................................... 5
1. Description
1.1 Features
1.2 Application
)LJXUH )XQFWLRQEORFNV\PERORI(9(17
2
Substation Automation EVENT230
2.1 General
The FALSE -> TRUE input (IN) signal transition signifies an activating event
occurrence (odd event codes), whereas the TRUE -> FALSE input (IN) signal
transition signifies a deactivating event occurrence (even event codes).
Each edge occurrence causes an event generation with an event code and a time
stamp. The event code is internally selected based on the IEC_ADDR input. For
selecting the IEC address, see the events table below. Optionally, one data value may
be passed with the event.
Events to be generated with these functions are found in the local MMI event list.
Note that if the event is masked, it will not be shown in the MMI event list.
This function can be instantiated 32 times per single relay configuration at the
maximum. Each instance should have a unique IEC address. The software does not
check the amount of instances or uniqueness of the IEC addresses.
Assign the desired IEC address as a constant (integer in range 031) into the input
IEC_ADDR. If this input is left unconnected, no events are sent. Do not add any
selection logic to change the value of this input during run-time operation.
This function can be freely assigned to any task cycle desired. Still, be careful not to
generate excessive amounts of events since this may cause event buffer overflow
situations. If the event buffer overflows, no events will be sent until the overflow
situation repeals. Note that EVENT230 will not try to re-send any events it failed to
send due to buffer overflow.
If the input IN is active during the relay start-up (or restart due to configuration
download), EVENT230 will not send the activating event. It will only memorize the
initial state of IN. Only real signal edges generate events.
For example, the following function block diagram can be used to send status of one
relay binary input to the IEC address 12:
3
EVENT230 Substation Automation
)LJXUH ([DPSOHRIXVLQJWKH(9(17IXQFWLRQEORFN
Timers TON, TOF and RS-latch are used here to limit the amount of generated
events. Digital input must be high or low at least 100 milliseconds before its new
status is reported as an event. Thus 100 milliseconds after the rising edge of the
digital input, an activating event with the event code E25 will be sent. After this, the
digital input must stay low 100 milliseconds before the deactivating event E24 will be
sent. Note that the time stamps of the events will indicate the moment of event
sending, not the rising or falling edge of the digital input signal.
One floating point data may be sent to SCADA with the EVENT230. This is useful
for example in reporting the power factor calculated by the MEPE7 function block. In
the example below, standard timers TON and TP are used to trigger the EVENT230
every 10 seconds. The local feedback variable should have an initial value FALSE.
)LJXUH ([DPSOHRIXVLQJWKH(9(17IXQFWLRQEORFN
4
Substation Automation EVENT230
5
EVENT230 Substation Automation
4.1 Events
Note that in the tables below, the data in columns Default and Event reason is the
same for all events.
Events 0...31:
6
Substation Automation EVENT230
Events 3263:
7
EVENT230 Substation Automation
8
1MRS750528-MUM Technical Descriptions of Functions,
Issued: 10/97
Version: H/16.05.2002
Introduction
Data subject to change without notice
Introduction Substation Automation
Contents
1. Introduction ...............................................................................................3
2. Functions...................................................................................................6
2.1 Protection functions .............................................................................6
2.2 Measurement functions......................................................................11
2.3 Power quality functions ......................................................................11
2.4 Control functions................................................................................12
2.5 Condition monitoring functions...........................................................14
2.6 Communication functions...................................................................14
2.7 General functions...............................................................................15
2.8 Standard functions.............................................................................15
2.8.1 Arithmetic..................................................................................15
2.8.2 Bistable.....................................................................................15
2.8.3 Bit-shift .....................................................................................16
2.8.4 Bitwise operation ......................................................................16
2.8.5 Comparison ..............................................................................16
2.8.6 Counter.....................................................................................16
2.8.7 Edge detection..........................................................................17
2.8.8 Numeric ....................................................................................17
2.8.9 Selection...................................................................................17
2.8.10 Timer ........................................................................................17
2.8.11 Type conversion .......................................................................18
2.8.12 Truncation toward zero .............................................................19
3. Inverse-time characteristics...................................................................20
2
Substation Automation Introduction
1. Introduction
This document is a guide to the actual technical descriptions of functions that can be
found as separate documents divided into the following categories:
protection
measurement
power quality
control
condition monitoring
communication
general
standard
In this document, the functions available are listed both divided under the above
mentioned categories in chapters 2.1 to 2.8 and in alphabetical order in the end of the
document. Some information on the function blocks belonging to each category is
given in this document, whereas the detailed descriptions of functions can be found as
separate documents.
Each description of a function, i.e. a function block manual, covers either one specific
function block or several function blocks representing the stages of a protection,
measurement or other function. For example, the non-directional overcurrent function
blocks NOC3Low, NOC3High and NOC3Inst are described in one manual (NOC3_).
The manuals provide information on the operation and features of function blocks as
well as on their inputs and outputs, a list of HMI parameters (if existing) and technical
data.
The version letter, e.g. A, on the cover of a function block manual indicates the
document version, i.e. corrections to language, layout etc., whereas the technical
revision of the function block in question is given in section Technical Data in the
end of each manual.
3
Introduction Substation Automation
The functionality of RED 500 based products is tied to the hardware configuration
and also depends on the selected functionality level (refer to the technical reference
manual of the product). The desired functions can be activated from a wide range of
protection, measurement, power quality, control, condition monitoring, general and
communication functions within the scope of the I/O connections and analogue
channels available and considering the total CPU load.
The function blocks and elements are seen as graphical symbols on the worksheets of
the Relay Configuration Tool. The name of the element is written under the upper
edge of the block, see Figure 1.3.-1 below. The name of the instance is written above
the upper edge. The direction of processing through the block is from left to right,
input parameters are on the left and output parameters on the right.
)LJXUH *UDSKLFDOV\PEROIRUWKHQRQGLUHFWLRQDORYHUFXUUHQWSURWHFWLRQVWDJH
,!12&/RZ
4
Substation Automation Introduction
Typically, a function block or an element contains inputs and outputs that can be
interconnected with other elements or signals, see Figure 1.3.-2 below. Only the
inputs, outputs and signals with the same data type can be interconnected. For
example, if an output with the data type Boolean (BOOL) is to be connected to an
input of the type Real (REAL), the data type conversion element has to be used.
)LJXUH ([DPSOHRIWKH%RROHDQORJLF
5
Introduction Substation Automation
2. Functions
All the function blocks supported in the RED 500 series are divided into groups
according to the application area and listed in the following tables. Each product of
the RED 500 series supports a subset of the complete function block list. Product-
specific function block lists can be found in the technical reference manual of the
product in question.
Each function block is given a processing load (in percent) from the processing
capacity reserved for the function blocks. The processing loads are directive and they
can vary from product to product. The relay calculates and checks the actual
processing load in connection to the downloading of the configuration. For more
details, please refer to Configuration Guideline (1MRS750745-MUM) chapter 3.4.
Also, information about the task intervals of the function blocks is given in the tables
below. This information can contain a minimum, a maximum and a recommended
task interval of a function block. Some function blocks allow only one option to a task
interval. Because a task interval is always a multiple of a one-fourth of the network
frequency period, it depends on the network frequency. In the lists, task intervals are
given in milliseconds when the frequency of the network is 50 Hz. Intervals are
transformed for the 60 Hz network by multiplying them by 50/60,
e.g. (50/60) * 10 ms = 8.33 ms.
Descriptions of the protection function blocks listed below can be found as separate
documents, except for protection functions consisting of two or three stages. For
example, the descriptions of the function blocks NOC3Low, NOC3High and
NOC3Inst have been compiled into one document.
6
Substation Automation Introduction
7
Introduction Substation Automation
Earth faults
8
Substation Automation Introduction
Overfrequency/ underfrequency
Underexcitation/ overexcitation
9
Introduction Substation Automation
Motor protection
Additional functions
10
Substation Automation Introduction
Descriptions of the power quality function blocks listed below can be found as
separate documents.
11
Introduction Substation Automation
Descriptions of the control function blocks listed below can be found as separate
documents.
12
Substation Automation Introduction
13
Introduction Substation Automation
Descriptions of the condition monitoring function blocks listed below can be found as
separate documents.
Operate time counter 1 for used operate time (motors) 20...100 1 CMTIME1 100184
Operate time counter 2 for used operate time (motors) 20...100 1 CMTIME2 100185
14
Substation Automation Introduction
Descriptions of the function blocks listed below can be found as separate documents
except for the 20 switchgroups, SWGRP1 to SWGRP 20, that have been compiled
into one document.
Descriptions of the standard function blocks below can be found compiled into one
document with the name Generic.
The symbol X in the Extensible inputs column means that the function supports
adding the number of inputs. For example, in figure 1.3.-2 an AND port is used with
both two and three inputs.
2.8.1 Arithmetic
DIV Divider -
EXPT Exponentiation -
MOD Modulo -
MUL Multiplier X
SUB Subtractor -
2.8.2 Bistable
Function Description
RS Reset dominant bistable function block
15
Introduction Substation Automation
2.8.3 Bit-shift
Function Description
ROL Rotate to left
2.8.5 Comparison
EQ Equal X
GT Greater than X
LT Less than X
NE Not equal -
2.8.6 Counter
Function Description
CTD Down-counter
CTU Up-counter
16
Substation Automation Introduction
Function Description
F_TRIG Falling edge detector
2.8.8 Numeric
Function Description
ABS Absolute value
LN Natural logarithm
2.8.9 Selection
MAX Maximum X
MIN Minimum X
MUX Multiplexer X
2.8.10 Timer
Function Description
TOF Time delay OFF
TP Pulse
17
Introduction Substation Automation
Function Description
BOOL2INT BOOL inputs to INT output
18
Substation Automation Introduction
Function Description
TIME_TO_REAL Type conversion TIME to REAL
Function Description
TRUNC_REAL_TO_DINT Truncation toward zero
19
Introduction Substation Automation
t/s
t/s
70
70
60
60
50
50
40
40
30
30
20
20
10
9 10
9
8
8
7
7
6
6
5
5
4
4
3 k 3
1.0
2 0.9
2
0.8
0.7
0.6
0.5
1 1
0.9 0.4
0.9
0.8 0.8 k
0.7 0.3 0.7 1.0
0.6 0.9
0.6
0.8
0.5 0.5 0.7
0.2
0.4 0.6
0.4
0.5
0.3 0.3 0.4
0.1
0.3
0.2 0.2
0.2
0.05
0.1 0.1
0.09 0.09 0.1
0.08 0.08
0.07 0.07
0.06 0.06
0.05
0.05 0.05
0.04 0.04
0.03 0.03
NORMINV
VERYINV
0.02 0.02
1 2 3 4 5 6 7 8 9 10 20 I/I> . 1 2 3 4 5 6 7 8 9 10 20 I/I>
20
Substation Automation Introduction
t/s t/s
70 700
60 600
50 500
40 400
30 300
20 200
10 100
9 90
8 80
7 70
6 60
5 50
4 40
3 30
2 20
1 10
0.9 9
0.8 8
k
0.7 7
1.0
0.6 6 0.9
0.5 5 0.8
0.7
0.4 4
0.6
0.5
0.3 3
k 0.4
0.2 1.0 2
0.3
0.8
0.6 0.2
0.1 0.4 1
0.09 0.9
0.08 0.3 0.8
0.07 0.7
0.2 0.1
0.06 0.6
0.05 0.5
0.1
0.04 0.4
0.05 0.05
0.03 0.3
0.2
LTIMEINV
0.02
EXTRINV
1 2 3 I/I>
4 5 6 7 8 9 10 20 I/I> 1 2 3 4 5 6 7 8 9 10 20
21
Introduction Substation Automation
t/s t/s
70
60 70
60
50
50
40
40
30
30
20
20
10
9 10
8 9
7 8
6 7
5 6
5
4 k
4
3 1.0
0.9
3
0.8
2 0.7
0.6 2
0.5
0.4
1 k
0.9 0.3 1
0.8 0.9
0.7 0.8 1.0
0.6 0.2 0.7
0.9
0.6
0.5
0.5 0.8
0.4
0.4
0.3 0.1 0.7
0.3
0.2
0.05 0.2
0.6
0.1
0.09 0.1
0.08 0.09
0.07 0.08
0.06 0.07
0.05 0.06
0.05
0.04
0.04
0.03 0.05 0.1 0.2 0.3 0.4 0.5
0.03
RI_INV
0.02
1 2 3 4 5 6 7 8 9 10 20 I/I> 0.02
RD_INV
1 2 3 4 5 6 7 8 9 10 20 30 40 I/I>
22
Substation Automation Introduction
100 200
90
80
70
60
50 100
90
40 80
70
30 60
50
20
40
30
10
9 20
8
7
6
5
10
4 9
8
3 7
6
2 5
4
t/s t/s
n=15.0 3
1 n=13.0
0.9 n=11.0
0.8 2
0.7 n=9.0
0.6
n=7.0
0.5
0.4 n=5.0 1
0.9
0.3 0.8
0.7
n=3.0 0.6 n=15.0
0.2 0.5 n=13.0
n=2.0 n=11.0
0.4
n=9.0
0.3
0.1 n=7.0
0.09
0.08 n=1.0
0.07 0.2 n=5.0
0.06
0.05
n=3.0
0.04 n=0.5
0.1
0.09
0.03 0.08 n=2.0
0.07
0.02 0.06
n=0.5 n=1.0
1 2 3 4 5 6 7 8 9 10 20 0.05
1 2 3 4 5 6 7 8 9 10 20
I/I>
I/I>
23
Introduction Substation Automation
40 40
30 30
20 20
10 10
9 9
8 8
7 7
6 6
5 5
4 4
3 3
n=15.0
2 n=13.02
n=11.0
t/s t/s
n=9.0
n=7.0
1 1
0.9 0.9
0.8 n=5.00.8
0.7 0.7
0.6 0.6
0.5 n=3.00.5 n=15.0
0.4 0.4 n=13.0
n=11.0
n=2.0
0.3 0.3
n=9.0
n=7.0
0.2 0.2
n=1.0 n=5.0
0.1 0.1
n=3.0
0.09 0.09
0.08 n=0.5
0.08
0.07 0.07
0.06 0.06 n=2.0
n=0.5 n=1.0
0.05 0.05
1 2 3 4 5 6 7 8 9 10 20 1 2 3 4 5 6 7 8 9 10 20
I/I> I/I>
24
Substation Automation Introduction
40 2000
30
1000
900
800
20 700
600
500
400
300
10
9
200
8
7
6
100
5 90
80
4 70
60
50
3
40
30
2
20
t/s t/s
10
1 9
8
0.9 7
0.8 6 n=15.0
0.7 5 n=13.0
n=11.0
0.6 4
n=9.0
0.5 3 n=7.0
0.4
2 n=5.0
0.3
n=3.0
1
0.9
0.2 0.8 n=2.0
0.7
0.6
0.5
n=15.0 0.4 n=1.0
n=13.0 0.3
0.1
0.09 n=11.0
0.08 0.2 n=0.5
0.07 n=9.0
0.06
n=0.5 n=1.0 n=2.0n=3.0 n=5.0 n=7.0
0.05 0.1
1 2 3 4 5 6 7 8 9 10 20 1 2 3 4 5 6 7 8 9 10 20
I/I> I/I>
)LJXUH,(((LQYHUVHWLPHFKDUDFWHULVWLFFXUYHVHWV6KRUW7LPH([WUHPHO\
,QYHUVHOHIWDQG/RQJ7LPH([WUHPHO\,QYHUVHULJKWIRUFXUUHQW
SURWHFWLRQ
25
Introduction Substation Automation
2000 600
500
400
1000
900 300
800
700
600 200
500
400
300
100
90
200 80
70
60
50
100
90 40
80
70 30
60
50 n=15.0
40 20 n=13.0
n=11.0
30 n=9.0
n=7.0
20 10
9
t/s t/s 8 n=5.0
n=15.0 7
10 n=13.0 6
9 n=11.0 5
8 n=3.0
7 n=9.0 4
6 n=7.0
5 3 n=2.0
4 n=5.0
3 2
n=3.0 n=1.0
2
n=2.0
1
0.9
0.8 n=0.5
1 0.7
0.9
0.8 n=1.0 0.6
0.7
0.6 0.5
0.5 0.4
0.4 n=0.5
0.3
0.3
0.2
0.2
0.1 0.1
1 2 3 4 5 6 7 8 9 10 20 1 2 3 4 5 6 7 8 9 10 20
I/I> I/I>
)LJXUH,(((LQYHUVHWLPHFKDUDFWHULVWLFFXUYHVHWV/RQJ7LPH9HU\,QYHUVH
OHIWDQG/RQJ7LPH,QYHUVHULJKWIRUFXUUHQWSURWHFWLRQ
26
Substation Automation Introduction
t/s
1000
100
10
k>
1,0
0,7
1
0,4
0,2
0,05
0,1
0,01
1,0 1,1 1,2 1,3 1,4 ovolt_A 1,5 U/U>
)LJXUH,QYHUVHWLPHFKDUDFWHULVWLFFXUYHVHW$IRURYHUYROWDJHSURWHFWLRQ
t/s
1000
100
10
k>
1,0
0,7
0,1
0,4
0,2
0,05
0,01
1,0 1,1 1,2 1,3 1,4 ovolt_B 1,5 U/U>
)LJXUH ,QYHUVHWLPHFKDUDFWHULVWLFFXUYHVHW%IRURYHUYROWDJHSURWHFWLRQ
27
Introduction Substation Automation
1000
100
10
k<
1,0
0,7
1
0,4
0,2
0,1
0,1
0,01
U/U< 0,5 0,6 0,7 0,8 0,9 uvolt_C 1,0
)LJXUH ,QYHUVHWLPHFKDUDFWHULVWLFFXUYHVHW&IRUXQGHUYROWDJHSURWHFWLRQ
28
Substation Automation Introduction
AR5Func Protection
CO3DC1 Control
CO3DC2 Control
29
Introduction Substation Automation
COCB1 Control
COCB2 Control
COCBDIR Control
CODC1 Control
CODC2 Control
CODC3 Control
CODC4 Control
CODC5 Control
COIND1 Control
COIND2 Control
COIND3 Control
COIND4 Control
COIND5 Control
COIND6 Control
COIND7 Control
COIND8 Control
COLOCAT Control
COPFC Control
COSW1 Control
COSW2 Control
COSW3 Control
COSW4 Control
CUB1Cap Protection
CUB3Low Protection
DEF2High Protection
DEF2Inst Protection
DEF2Low Protection
Diff3 Protection
Diff6G Protection
30
Substation Automation Introduction
DOC6High Protection
DOC6Inst Protection
DOC6Low Protection
EQ Standard; comparison
Freq1St_ Protection
FuseFail Protection
GE Standard; comparison
GT Standard; comparison
INDRESET General
Inrush3 Protection
LE Standard; comparison
LT Standard; comparison
MEAI18 Measurement
MEAO14 Measurement
MECU1A Measurement
MECU1B Measurement
MECU3A Measurement
MECU3B Measurement
MEDREC16 Measurement
MEFR1 Measurement
MEPE7 Measurement
MEVO1A Measurement
MEVO1B Measurement
MEVO3A Measurement
MEVO3B Measurement
MMIALAR1 Control
MMIALAR2 Control
MMIALAR3 Control
MMIALAR4 Control
31
Introduction Substation Automation
MMIALAR5 Control
MMIALAR6 Control
MMIALAR7 Control
MMIALAR8 Control
MMIDATA1 Control
MMIDATA2 Control
MMIDATA3 Control
MMIDATA4 Control
MMIDATA5 Control
MMIWAKE General
MotStart Protection
NE Standard; comparison
NEF1High Protection
NEF1Inst Protection
NEF1Low Protection
NOC3High Protection
NOC3Inst Protection
NOC3Low Protection
NPS3High Protection
NPS3Low Protection
NUC3St1 Protection
NUC3St2 Protection
OE1Low Protection
OE1High Protection
OL3Cap Protection
OPOW6St1 Protection
OPOW6St2 Protection
OPOW6St3 Protection
OV3High Protection
OV3Low Protection
PREV3 Protection
32
Substation Automation Introduction
PSV3St1 Protection
PSV3St2 Protection
REF1A Protection
ROV1High Protection
ROV1Inst Protection
ROV1Low Protection
RS Standard; bistable
SCVCSt1 Protection
SCVCSt2 Protection
SR Standard; bistable
SWGRP120 General
TOL3Cab Protection
TOL3Dev Protection
TP Standard; timer
33
Introduction Substation Automation
UE6High Protection
UE6Low Protection
UI6Low Protection
UI6High Protection
UPOW6St1 Protection
UPOW6St2 Protection
UPOW6St3 Protection
UV3High Protection
UV3Low Protection
VOC6High Protection
VOC6Low Protection
34
1MRS100072 RE_5_ _
1MRS100076 Underfrequency or Overfrequency
Issued: 10/1998
Version: C Protection
Data subject to change without notice Stages 1, 2, 3, 4 and 5
(Freq1St_)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 3
2. Description of Operation.......................................................................... 4
2.1 Configuration....................................................................................... 4
2.2 Measuring mode ................................................................................. 5
2.3 Operation criteria................................................................................. 5
2.4 Setting groups ..................................................................................... 7
2.5 Test mode ........................................................................................... 7
2.6 START and TRIP outputs.................................................................... 8
2.7 Resetting............................................................................................. 8
1. Introduction
1.1 Features
1.2 Application
The frequency function blocks are specially designed for applications such as
generator protection, load shedding, load restoration and disconnection for island
operation.
f<
f>
df/dt<
df/dt>
)LJXUH )XQFWLRQEORFNV\PERORI)UHT6WBVWDJHDVDQH[DPSOH
2
ABB Automation Freq1St1Freq1St5 RE_5_ _
3
RE_5_ _ Freq1St1Freq1St5 ABB Automation
2.1 Configuration
The input and output signals of the frequency protection function block Freq1St_ is
configured with the Relay Configuration Tool included in the CAP 505 Tool Box.
Frequency protection must be selected for the voltage input via the special
measurements dialogue box in the configuration tool. If the frequency protection is
not selected, the ERR output is activated.
Note! The undervoltage limit value always refers to the pu value of the analogue
channel in use. Therefore, if a single phase-to-earth voltage is used, the limit has to be
scaled unless a voltage divider is used.
For example, when the blocking level is 9 kV (0,8 UN; UN = 11,547 kV), and a
single phase voltage is used as an input:
0,8
SDUDPHWHU = 8 1 0,5 8 1 (8 1 = 20N9 )
3
The output signals TRIP1 and TRIP2 of the function block can be used for frequency-
based load shedding in an underfrequency situation. Some portions of the load can be
reduced by disconnecting the corresponding outgoing lines from the busbar. When the
remaining load is in balance with the power generation available, the power system
frequency will return to its normal value.
The outputs can also be used in frequency-based load restoration. The Relay
Configuration Tool is used for configuring the logic needed for load restoration after
load shedding.
Please note that the task execution interval of the funtion block must be configured to
the fastest task, i.e. 5ms (fn = 50 Hz). A slower task execution interval will cause a
configuration error which will force the function block to the Not in use mode.
4
ABB Automation Freq1St1Freq1St5 RE_5_ _
The actual power system frequency is measured via a sophisticated numerical method.
The operation is insensitive to harmonics and the DC component.
The function block Freq1St_ can be used for underfrequency (f<) or overfrequency
(f>) protection. The function block operates as either underfrequency or
overfrequency relays depending on whether the set operate value is above or below
the rated frequency of the relay or feeder terminal.
The function block also includes a starting element that measures the rate of change
of the power system frequency, so that the need for protection can be anticipated even
before a major frequency change occurs. The parameter Operation Mode is used for
setting the operation direction of the df/dt function. When the set value is indicated as
df/dt<, the negative rate of change of frequency is measured (the function block
operates as a negative derivative function), and when the set value is indicated as
df/dt>, the positive rate of change of frequency is measured (the function block
operates as a positive derivative function). The frequency rate of change function can
also be set out of use.
The output START1 is activated when the f</f> function starts. Correspondingly,
START2 is activated when the f</f> or df/dt function starts, depending on the
operation mode used. The trip signals of both the f</f> function and the df/dt function
(TRIP1 and TRIP2) can be used for load shedding. The operate time of the f</f>
function can be set via the parameter Operate time 1 and the operate time of both
the f</f> function and the df/dt function via the parameter Operate time 2. Active
START1 and START2 signals are both indicated by steady start LEDs (yellow) and
active TRIP1 and TRIP2 signals by steady trip LEDs (red) on the MMI.
The setting parameter Operation mode is used to select the operation mode of the
function as follows:
5
RE_5_ _ Freq1St1Freq1St5 ABB Automation
The calculation window for frequency measurement always has a length of two
fundamental cycles, i.e. 40 ms at the rated system frequency 50 Hz and 33.3 ms at the
rated system frequency 60 Hz. The total operate time is the sum of the start time, the
additional operate delay and the operate delay of the heavy-duty output relay. The
timers are cleared when the abnormal frequency situation has disappeared.
The blocking signal BS1 can be used for blocking the operation of the underfrequency
and overfrequency function f</f>. When the blocking signal BS1 is active, the DT
timer 1 is frozen. In the same way, the blocking signal BS2 can be used for blocking
the operation of the df/dt or f</f> function, depending on the operation mode used.
When the blocking signal BS2 is active, the DT timer 2 is frozen. Active BS1 and
BS2 signals are indicated by blinking start LEDs (yellow) on the MMI.
6
ABB Automation Freq1St1Freq1St5 RE_5_ _
)LJXUH 6LPSOLILHGIXQFWLRQDOEORFNGLDJUDPRIDQXQGHUIUHTXHQF\DQG
RYHUIUHTXHQF\SURWHFWLRQIXQFWLRQEORFN
Note!The operate times and start times are specified for the set rated frequencies 50
Hz and 60 Hz.
Two different groups of setting values, group 1 and group 2, are available for the
function block Freq1St_. Switching between the two groups can be done in the
following three ways:
The control parameter Active group indicates the setting group valid at a given
time.
The digital outputs of the function block Freq1St_ can be activated with separate
control parameters for each output either locally via the MMI or externally via the
serial communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
7
RE_5_ _ Freq1St1Freq1St5 ABB Automation
The output signals START1 and START2 are always pulse-shaped. The minimum
pulse width of the corresponding output signal is set via a separate parameter on the
MMI or on serial communication. If the start situation is longer than the set pulse
width, the START1 and START2 signals remain active until the start situation is
over. The output signals TRIP1 and TRIP2 may be non-latching or latching. When the
latching mode has been selected, the TRIP1 and TRIP2 signals remain active until the
output is reset even if the operation criteria have reset.
Active START1 and START2 signals are indicated by steady start LEDs (yellow) and
active TRIP1 and TRIP2 signals by steady trip LEDs (red) on the MMI.
2.7 Resetting
The TRIP output signals and the registers can be reset either via the RESET input or
over the serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
8
ABB Automation Freq1St1Freq1St5 RE_5_ _
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channels for the frequency function blocks are the
following:
Function block Channel
Freq1St1 72
Freq1St2 73
Freq1St3 74
Freq1St4 75
Freq1St5 76
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
9
RE_5_ _ Freq1St1Freq1St5 ABB Automation
Start df/dt S5 0.2...10.0 Hz/s 10.0 R Start value for frequency rate
of change prot.
Voltage limit S42 0.30...0.90 x Un 0.30 R/W Undervoltage limit for blocking
Start frequency S43 25.00...75.00 Hz 48.70 R/W Start value for U/O frequency
protection
Operate time 1 S44 0.10...120.00 s 20.00 R/W Operate time for U/O frequency
protection
Start df/dt S45 0.2...10.0 Hz/s 10.0 R/W Start value for frequency rate of
change prot.
Operate time 2 S46 0.12...120.00 s 20.00 R/W Timer for df/dt prot. or U/O
frequency prot.
1)
Operation mode 0 = Not in use
1 = f</f> 1 timer
2 = f</f> 2 timers
3 = f</f> OR df/dt>
4 = f</f> AND df/dt>
5 = f</f> OR df/dt<
6 = f</f> AND df/dt<
10
ABB Automation Freq1St1Freq1St5 RE_5_ _
Voltage limit S72 0.30...0.90 x Un 0.30 R/W Undervoltage limit for blocking
Start frequency S73 25.00...75.00 Hz 48.70 R/W Start value for U/O frequency
protection
Operate time 1 S74 0.10...120.00 s 20.00 R/W Operate time for U/O frequency
protection
Start df/dt S75 0.2...10.0 Hz/s 10.0 R/W Start value for frequency rate of
change prot.
Operate time 2 S76 0.12...120.00 s 20.00 R/W Timer for df/dt prot. or U/O
frequency prot.
1)
Operation mode 0 = Not in use
1 = f</f> 1 timer
2 = f</f> 2 timers
3 = f</f> OR df/dt>
4 = f</f> AND df/dt>
5 = f</f> OR df/dt<
6 = f</f> AND df/dt<
11
RE_5_ _ Freq1St1Freq1St5 ABB Automation
Event mask 1 V101 0...16383 - 255 R/W Event mask 1 for event transmission
(E0 ... E13)
Event mask 2 V103 0...16383 - 255 R/W Event mask 2 for event transmission
(E0 ... E13)
Event mask 3 V105 0...16383 - 255 R/W Event mask 3 for event transmission
(E0 ... E13)
Event mask 4 V107 0...16383 - 255 R/W Event mask 4 for event transmission
(E0 ... E13)
1)
Group selection 0 = Group 1; 1 = Group 2; 2 = GROUP input
2)
Active group 0 = Group 1; 1 = Group 2
3)
Trip signal 0 = Non-latching; 1 = Latching
4)
Test 0 = Do not activate; 1 = Activate
12
ABB Automation Freq1St1Freq1St5 RE_5_ _
3.3.3.1 General
The information required for later fault analysis is recorded when the function block
starts or trips, or when the recording function is triggered via the external TRIGG
input.
The data of three last operations (operation 1...3) are recorded, and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
13
RE_5_ _ Freq1St1Freq1St5 ABB Automation
Registers containing information about the voltage, frequency, etc. can be accessed
over the serial communication or the local MMI of the RED 500 unit.
The time stamp indicates the rising edge of the START1, TRIP1, START2, TRIP2 or
TRIGG signals.
3.3.3.3 Duration
The duration of the start situation is recorded as a percentage of the set operate time.
If the function block trips, the frequency and voltage values are updated at the
moment of tripping i.e. on the rising edge of the TRIP signal. At external triggering,
the frequency and voltage values are updated at the moment of triggering i.e. on the
rising edge of the input signal TRIGG. If the function block starts but does not trip,
the values captured one fundamental cycle (20 ms at rated frequency 50 Hz) after the
beginning of the start situation are recorded.
The status data of the input signals BS1, BS2 and TRIGG and the output signals
START1, START2, TRIP1 and TRIP2 as well as the parameter Active group are
recorded at the moment of tripping and triggering. The Active group parameter
indicates the setting group valid for the recorded data.
3.3.3.6 Priority
1 Tripping
2 Starting
3 External triggering,
which means that if the function has started, it will neglect an external triggering
request.
14
ABB Automation Freq1St1Freq1St5 RE_5_ _
Rate of change V210 -15.0...+15.0 Hz/s 0.0 R/M Freq. rate of change
15
RE_5_ _ Freq1St1Freq1St5 ABB Automation
Rate of change V310 -15.0...+15.0 Hz/s 0.0 R/M Freq. rate of change
16
ABB Automation Freq1St1Freq1St5 RE_5_ _
Rate of change V410 -15.0...+15.0 Hz/s 0.0 R/M Freq. rate of change
3.3.4 Events
17
RE_5_ _ Freq1St1Freq1St5 ABB Automation
Note! The operate times and start times are specified for the set
rated frequencies 50 Hz and 60 Hz.
Reset time 140...1000 ms (depends on the minimum pulse width set for the
TRIP output
Frequency dependence of the Accuracy for the f</f> function is defined in the setting range
settings and operate times 25...75 Hz.
18
1MRS752304-MUM Freq1St_
Issued: 10/1998
Version: D/18.1.2002
Underfrequency or Overfrequency
Protection
Data subject to change without notice Stages 1, 2, 3, 4 and 5
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 3
2. Description of Operation.......................................................................... 4
2.1 Configuration....................................................................................... 4
2.2 Measuring mode ................................................................................. 5
2.3 Operation criteria................................................................................. 5
2.4 Setting groups ..................................................................................... 7
2.5 Test mode ........................................................................................... 7
2.6 START and TRIP outputs.................................................................... 8
2.7 Resetting............................................................................................. 8
1. Introduction
1.1 Features
1.2 Application
The frequency function blocks are specially designed for applications such as
generator protection, load shedding, load restoration and disconnection for island
operation.
f<
f>
df/dt<
df/dt>
)LJXUH )XQFWLRQEORFNV\PERORI)UHT6WBVWDJHDVDQH[DPSOH
2
Substation Automation Freq1St_
3
Freq1St_ Substation Automation
2.1 Configuration
The input and output signals of the frequency protection function block Freq1St_ is
configured with the Relay Configuration Tool included in the CAP 505 Tool Box.
Frequency protection must be selected for the voltage input via the special
measurements dialogue box in the configuration tool. If the frequency protection is
not selected, the ERR output is activated.
Note! The undervoltage limit value always refers to the pu value of the analogue
channel in use. Therefore, if a single phase-to-earth voltage is used, the limit has to be
scaled unless a voltage divider is used.
For example, when the blocking level is 9 kV (0,8 UN; UN = 11,547 kV), and a
single phase voltage is used as an input:
0,8
SDUDPHWHU = 8 1 0,5 8 1 (8 1 = 20N9 )
3
The output signals TRIP1 and TRIP2 of the function block can be used for frequency-
based load shedding in an underfrequency situation. Some portions of the load can be
reduced by disconnecting the corresponding outgoing lines from the busbar. When the
remaining load is in balance with the power generation available, the power system
frequency will return to its normal value.
The outputs can also be used in frequency-based load restoration. The Relay
Configuration Tool is used for configuring the logic needed for load restoration after
load shedding.
Please note that the task execution interval of the funtion block must be configured to
the fastest task, i.e. 5ms (fn = 50 Hz). A slower task execution interval will cause a
configuration error which will force the function block to the Not in use mode.
4
Substation Automation Freq1St_
The actual power system frequency is measured via a sophisticated numerical method.
The operation is insensitive to harmonics and the DC component.
The function block Freq1St_ can be used for underfrequency (f<) or overfrequency
(f>) protection. The function block operates as either underfrequency or
overfrequency relays depending on whether the set operate value is above or below
the rated frequency of the relay or feeder terminal.
The function block also includes a starting element that measures the rate of change
of the power system frequency, so that the need for protection can be anticipated even
before a major frequency change occurs. The parameter Operation Mode is used for
setting the operation direction of the df/dt function. When the set value is indicated as
df/dt<, the negative rate of change of frequency is measured (the function block
operates as a negative derivative function), and when the set value is indicated as
df/dt>, the positive rate of change of frequency is measured (the function block
operates as a positive derivative function). The frequency rate of change function can
also be set out of use.
The output START1 is activated when the f</f> function starts. Correspondingly,
START2 is activated when the f</f> or df/dt function starts, depending on the
operation mode used. The trip signals of both the f</f> function and the df/dt function
(TRIP1 and TRIP2) can be used for load shedding. The operate time of the f</f>
function can be set via the parameter Operate time 1 and the operate time of both
the f</f> function and the df/dt function via the parameter Operate time 2. Active
START1 and START2 signals are both indicated by steady start LEDs (yellow) and
active TRIP1 and TRIP2 signals by steady trip LEDs (red) on the MMI.
The setting parameter Operation mode is used to select the operation mode of the
function as follows:
5
Freq1St_ Substation Automation
The calculation window for frequency measurement always has a length of two
fundamental cycles, i.e. 40 ms at the rated system frequency 50 Hz and 33.3 ms at the
rated system frequency 60 Hz. The total operate time is the sum of the start time, the
additional operate delay and the operate delay of the heavy-duty output relay. The
timers are cleared when the abnormal frequency situation has disappeared.
The blocking signal BS1 can be used for blocking the operation of the underfrequency
and overfrequency function f</f>. When the blocking signal BS1 is active, the DT
timer 1 is frozen. In the same way, the blocking signal BS2 can be used for blocking
the operation of the df/dt or f</f> function, depending on the operation mode used.
When the blocking signal BS2 is active, the DT timer 2 is frozen. Active BS1 and
BS2 signals are indicated by blinking start LEDs (yellow) on the MMI.
6
Substation Automation Freq1St_
)LJXUH 6LPSOLILHGIXQFWLRQDOEORFNGLDJUDPRIDQXQGHUIUHTXHQF\DQG
RYHUIUHTXHQF\SURWHFWLRQIXQFWLRQEORFN
Note!The operate times and start times are specified for the set rated frequencies 50
Hz and 60 Hz.
Two different groups of setting values, group 1 and group 2, are available for the
function block Freq1St_. Switching between the two groups can be done in the
following three ways:
The control parameter Active group indicates the setting group valid at a given
time.
The digital outputs of the function block Freq1St_ can be activated with separate
control parameters for each output either locally via the MMI or externally via the
serial communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
7
Freq1St_ Substation Automation
The output signals START1 and START2 are always pulse-shaped. The minimum
pulse width of the corresponding output signal is set via a separate parameter on the
MMI or on serial communication. If the start situation is longer than the set pulse
width, the START1 and START2 signals remain active until the start situation is
over. The output signals TRIP1 and TRIP2 may be non-latching or latching. When the
latching mode has been selected, the TRIP1 and TRIP2 signals remain active until the
output is reset even if the operation criteria have reset.
Active START1 and START2 signals are indicated by steady start LEDs (yellow) and
active TRIP1 and TRIP2 signals by steady trip LEDs (red) on the MMI.
2.7 Resetting
The TRIP output signals and the registers can be reset either via the RESET input or
over the serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
8
Substation Automation Freq1St_
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channels for the frequency function blocks are the
following:
Function block Channel
Freq1St1 72
Freq1St2 73
Freq1St3 74
Freq1St4 75
Freq1St5 76
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
9
Freq1St_ Substation Automation
Start df/dt S5 0.2...10.0 Hz/s 10.0 R Start value for frequency rate
of change prot.
Voltage limit S42 0.30...0.90 x Un 0.30 R/W Undervoltage limit for blocking
Start frequency S43 25.00...75.00 Hz 48.70 R/W Start value for U/O frequency
protection
Operate time 1 S44 0.10...120.00 s 20.00 R/W Operate time for U/O frequency
protection
Start df/dt S45 0.2...10.0 Hz/s 10.0 R/W Start value for frequency rate of
change prot.
Operate time 2 S46 0.12...120.00 s 20.00 R/W Timer for df/dt prot. or U/O
frequency prot.
1)
Operation mode 0 = Not in use
1 = f</f> 1 timer
2 = f</f> 2 timers
3 = f</f> OR df/dt>
4 = f</f> AND df/dt>
5 = f</f> OR df/dt<
6 = f</f> AND df/dt<
10
Substation Automation Freq1St_
Voltage limit S72 0.30...0.90 x Un 0.30 R/W Undervoltage limit for blocking
Start frequency S73 25.00...75.00 Hz 48.70 R/W Start value for U/O frequency
protection
Operate time 1 S74 0.10...120.00 s 20.00 R/W Operate time for U/O frequency
protection
Start df/dt S75 0.2...10.0 Hz/s 10.0 R/W Start value for frequency rate of
change prot.
Operate time 2 S76 0.12...120.00 s 20.00 R/W Timer for df/dt prot. or U/O
frequency prot.
1)
Operation mode 0 = Not in use
1 = f</f> 1 timer
2 = f</f> 2 timers
3 = f</f> OR df/dt>
4 = f</f> AND df/dt>
5 = f</f> OR df/dt<
6 = f</f> AND df/dt<
11
Freq1St_ Substation Automation
Event mask 1 V101 0...16383 - 255 R/W Event mask 1 for event transmission
(E0 ... E13)
Event mask 2 V103 0...16383 - 255 R/W Event mask 2 for event transmission
(E0 ... E13)
Event mask 3 V105 0...16383 - 255 R/W Event mask 3 for event transmission
(E0 ... E13)
Event mask 4 V107 0...16383 - 255 R/W Event mask 4 for event transmission
(E0 ... E13)
1)
Group selection 0 = Group 1; 1 = Group 2; 2 = GROUP input
2)
Active group 0 = Group 1; 1 = Group 2
3)
Trip signal 0 = Non-latching; 1 = Latching
4)
Test 0 = Do not activate; 1 = Activate
12
Substation Automation Freq1St_
3.3.3.1 General
The information required for later fault analysis is recorded when the function block
starts or trips, or when the recording function is triggered via the external TRIGG
input.
The data of three last operations (operation 1...3) are recorded, and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
13
Freq1St_ Substation Automation
Registers containing information about the voltage, frequency, etc. can be accessed
over the serial communication or the local MMI of the RED 500 unit.
The time stamp indicates the rising edge of the START1, TRIP1, START2, TRIP2 or
TRIGG signals.
3.3.3.3 Duration
The duration of the start situation is recorded as a percentage of the set operate time.
If the function block trips, the frequency and voltage values are updated at the
moment of tripping i.e. on the rising edge of the TRIP signal. At external triggering,
the frequency and voltage values are updated at the moment of triggering i.e. on the
rising edge of the input signal TRIGG. If the function block starts but does not trip,
the values captured one fundamental cycle (20 ms at rated frequency 50 Hz) after the
beginning of the start situation are recorded.
The status data of the input signals BS1, BS2 and TRIGG and the output signals
START1, START2, TRIP1 and TRIP2 as well as the parameter Active group are
recorded at the moment of tripping and triggering. The Active group parameter
indicates the setting group valid for the recorded data.
3.3.3.6 Priority
1 Tripping
2 Starting
3 External triggering,
which means that if the function has started, it will neglect an external triggering
request.
14
Substation Automation Freq1St_
Rate of change V210 -15.0...+15.0 Hz/s 0.0 R/M Freq. rate of change
15
Freq1St_ Substation Automation
Rate of change V310 -15.0...+15.0 Hz/s 0.0 R/M Freq. rate of change
16
Substation Automation Freq1St_
Rate of change V410 -15.0...+15.0 Hz/s 0.0 R/M Freq. rate of change
3.3.4 Events
17
Freq1St_ Substation Automation
Note! The operate times and start times are specified for the set
rated frequencies 50 Hz and 60 Hz.
Reset time 140...1000 ms (depends on the minimum pulse width set for the
TRIP output
Frequency dependence of the Accuracy for the f</f> function is defined in the setting range
settings and operate times 25...75 Hz.
F -
18
1MRS752305-MUM FuseFail
Issued: 3/2000
Version: A/18.1.2002
Fuse Failure Supervision
Data subject to change without notice
Contents
1 Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 3
2 Description of Operation.......................................................................... 4
2.1 Configuration....................................................................................... 4
2.2 Configuration error checking ............................................................... 6
2.3 Setting the rated values of the protected unit ...................................... 6
2.4 Measuring mode ................................................................................. 7
2.5 Operation criteria................................................................................. 7
2.5.1 Measuring mode 1 ..................................................................... 7
2.5.2 Measuring mode 2 ..................................................................... 7
2.5.3 Additional criteria to the measuring modes................................. 7
2.5.4 Input MCB .................................................................................. 8
2.6 Test mode ........................................................................................... 8
1 Introduction
1.1 Features
Detection of failures in a voltage measurement circuitry
A failure is detected in a voltage measurement circuitry when the negative-
sequence voltage rises to a significant level while the negative-sequence current
does not rise correspondingly
If only one phase-to-phase voltage is measured, detection is based on the
amplitude of the measured voltage and the absence of high negative-sequence
current
If all the measured voltages are lost while the currents remain at a normal level, a
failure is recognised in the voltage measurement circuit
The output BSOUT indicating a failure in the voltage measurement circuitry is
disabled if a high current value is detected in any phase (=> fault current). This is
particularly important in the case of three-phase short-circuit close to the
measuring point.
The output BSOUT indicating a failure in the voltage measurement circuitry is
disabled also if the current ceases to zero
The function block includes an input for position information of a miniature circuit
breaker (MCB). The opening of the MCB generates an event even if the function
block is in the Not in use mode.
1.2 Application
This document specifies the functions of the fuse failure supervision function block
FuseFail used in products based on the RED 500 Platform.
Such protection functions, e.g. UI6Low, are therefore blocked by FuseFail to avoid a
wrong operation of the protection during the absence of the correct voltage
measurement.
2
Substation Automation FuseFail
)LJXUH )XQFWLRQEORFNV\PERORI)XVH)DLO
3
FuseFail Substation Automation
2 Description of Operation
2.1 Configuration
If the relay is not yet configured, the measuring devices and signal types for the
analogue channels are selected and configured in a special dialogue box of the Relay
Configuration Tool included in the CAP 505 Tool Box. Digital inputs are configured
in the same programming environment (the number of the selectable analogue inputs,
digital inputs and digital outputs depends on the hardware used).
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the Relay Configuration Tool. The phase-to-earth voltages or
phase-to-phase voltages (e.g. UL1, UL2 and UL3 or U12, U23 and U31) are connected to
the corresponding inputs, ULx_Uxy, ULy_Uyz and ULz_Uzx, of the function block.
The phase currents (e.g. IL1, IL2 and IL3 or IL1b, IL2b and IL3b) are connected to the
corresponding inputs ILx, ILy and ILz of the function block. Note that all the currents
and voltages need not be available when using the function block.
The function block will automatically adapt itself to the connected analogue inputs.
Note that if only two voltages are to be connected to the function block, they are
connected to the first and second voltage inputs (ULx_Uxy and ULy_Uyz) of the
function block. If only one (phase-to-phase) voltage is to be connected, it is connected
to the first voltage input. Similarly, if only two currents are to be connected they are
connected to the first and second current inputs of the function block. It is important
that the phase order is always 1-2-3, 2-3-1 or 3-1-2 (refer to section 2.2
Configuration error checking), regardless of the number of the connected voltages
or currents. Refer to examples 1, 2 and 3 below.
([DPSOH&RQQHFWLRQVRIWKHFXUUHQWV
In this example, all phase-to-earth voltages are to be connected but only two phase
currents are available. The possible connections for analogue inputs in this case are
presented in Figure 2. Note that the connected voltages could also be as in example 2
or as in example 3. They are not dependent on the connected currents.
4
Substation Automation FuseFail
([DPSOH&RQQHFWLRQVRIWKHYROWDJHV
In this example, two or three phase-to-phase voltages are measured. The possible
connections for analogue inputs in this case are presented in Figure 3. Note that the
connected currents could also be as in example 1. They are not dependent on the
connected voltages.
)LJXUH $QDORJXHLQSXWFRQQHFWLRQVZKHQSKDVHWRSKDVHYROWDJHVDUHXVHG
([DPSOH&RQQHFWLRQVRIWKHYROWDJHV
In this example, only one phase-to-phase voltage is to be connected to the function
block. The possible connections for analogue inputs in this case are presented in
Figure 4. Note that the connected currents could also be as in example 1. They are not
dependent on the connected voltages.
)LJXUH $QDORJXHLQSXWFRQQHFWLRQVZKHQRQO\RQHSKDVHWRSKDVHYROWDJHLVXVHG
Digital inputs are connected to the boolean inputs of the function block and the ERR
output of the function block is connected to the output signal. The BSOUT output
should be connected to the BLOCK input of the function block (or blocks) which is to
be blocked in the case of a failure in the voltage measurement circuitry. If a digital
signal indicating the state of the miniature circuit breaker (MCB) is available, it
should be connected to the MCB input of the function block. Deactivation of the
MCB input will activate BSOUT output and generate an event indicating an opened
miniature circuit breaker.
5
FuseFail Substation Automation
If a digital signal indicating the state of the circuit breaker is available, it should be
connected to a logical OR together with the BSOUT output of FuseFail and the output
of the logical OR should then be connected to the BLOCK input of the function block
to be blocked.
The function block should be instantiated within the same program as the fastest
function block to be blocked with it. Thus, if there are for example three function
blocks to be blocked, one is executed at 5-millisecond intervals, the other at 10-
millisecond intervals and the third at 20-millisecond intervals, then the FuseFail
function block has to be executed at 5-millisecond intervals. A global variable has to
be used to transfer the status of the BSOUT output to the programs in other tasks. The
fundamental frequency of 50 Hz is assumed in the previous example.
However, the execution interval of the FuseFail function block should not be greater
than 20 milliseconds to ensure the right operation during three-phase short circuits in
networks with a weak infeed.
When BSOUT output is used for blocking function blocks that are executed in a
slower task interval than FuseFail, an additional delay has to be included in the block
activation time and in the reset time. The delay is as long as the interval of the slower
task. The following examples clarify the BSOUT activation time and the reset time. In
these examples, a global variable v_BSOUT is used to deliver the BSOUT signal to
other tasks.
([DPSOH
FuseFail task interval 10 ms BSOUT activation time <35 ms
Function block to task interval 20 ms activation time of the BLOCK input (via global
be blocked variable v_BSOUT) < (35 ms + 20 ms) = 55
ms
([DPSOH
FuseFail task interval 10 ms BSOUT reset time 20 ms
Function block to task interval 20 ms reset time of the BLOCK input (via global
be blocked variable v_BSOUT) 20 ms + 20 ms = 40 ms
If the connected analogue inputs are not sufficient or not in the right order, the ERR
output is activated and an event is generated. Activation of the ERR output also
automatically sets the function block to the Not in use mode, which means that it
cannot operate.
A separate scaling factor can be set for each analogue channel. The factors enable
differences between the ratings of the protected unit and those of the measuring
device (CTs, VTs, etc.). A setting of 1.00 means that the rated value of the protected
unit is exactly the same as that of the measuring device. For more information, refer
to Technical Reference Manual for REM 54_.
6
Substation Automation FuseFail
1. If at least two voltages are connected, the operation is based on positive- and
negative-sequence components of voltage and current.
2. In the case of only one connected phase-to-phase voltage the operation is based on
the amplitude of the measured voltage and on positive- and negative-sequence
currents.
The function block automatically selects the right measuring mode depending on the
connected analogue signals.
1RWH
The operation criteria depend to some extent on the measuring mode. Operation on
both measuring modes is described below.
1. The activation of the BSOUT output is inhibited or BSOUT is reset (if already
active) if the amplitude of any of the measured currents even temporarily exceeds
1.5 x In. The nominal current (In) is determined by the nominal current of the
measuring device and the scaling factor of the analogue channel (see Setting the
7
FuseFail Substation Automation
rated values of the protected unit). This criterion affects also blocking based on
the input MCB.
The inhibition described above is latched to ensure that the decrease of the fault
current does not change the conditions so that the blocking signals would be
activated falsely.
The inhibition is unlatched
when the positive-sequence current has decreased to zero, that is, when the
fault is cleared by opening the circuit breaker
OR
one second after its activation if the activation criteria for BSOUT are not met
anymore
2. The activation of the BSOUT output is inhibited or BSOUT is reset (if already
active) also during an undercurrent situation (positive-sequence current is very
low).
The deactivation of the MCB input (position information of the miniature circuit
breaker, closed when active) will activate the BSOUT output. It will also generate an
additional event indicating the position of the miniature circuit breaker. The event is
generated even if the function block is set to Not in use (control parameter
FuseFail) and BSOUT output will not be activated.
If the first criterion described in the section Additional criteria to the measuring
modes is fulfilled, the BSOUT output will not be activated when the input MCB is
deactivated. The second criterion in that section does not affect blocking based on the
input MCB.
1RWH
The activation of the BSOUT output can take place only if the function block is set to
In use (control parameter FuseFail) and is not blocked by an external blocking
signal connected to the BLOCK input. The default setting for the parameter
FuseFail is Not in use.
The BSOUT output of the function block can be activated with a separate control
parameter either locally via the MMI or externally via the serial communication.
When an output is activated with the test parameter, an event indicating the test is
generated.
The supervising functions operate normally while the BSOUT output is tested.
8
Substation Automation FuseFail
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for FuseFail is 118.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the relay
terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask 1
parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
9
FuseFail Substation Automation
3.2.1 Settings
Parameter Code Values Unit Default Data Explanation
direction
Ratio U2/U1> S41 10...50 % 25 R/W Minimum ratio of negative-sequence
voltage to positive-sequence voltage
to allow blocking
Ratio I2/I1< S42 10...50 % 20 R/W Maximum ratio of negative-
sequence current to positive-
sequence current to allow blocking
10
Substation Automation FuseFail
3.3.3 Events
Code Weighting Default Event reason Event state
coefficient mask
E0 1 1 Fuse failure Reset
E1 2 1 Fuse failure Activated
E2 4 1 MCB position Open
E3 8 1 MCB position Closed
E4 16 0 FuseFail blocked Reset
E5 32 0 FuseFail blocked Activated
E6 64 0 Test mode of FuseFail Off
E7 128 0 Test mode of FuseFail On
E8 0 0 - -
E9 512 1 Configuration error Activated
11
FuseFail Substation Automation
4 Technical Data
Operation accuracies Depends on the frequency of the current and voltage measured:
f/fn=0.98...1.02: 2.0 percentage units (of settings Ratio U2/U1>
and Ratio I2/I1<)
f/fn=0.95...1.05: 4.0 percentage units (of settings Ratio U2/U1>
and Ratio I2/I1<)
BSOUT activation time (when Injected negative-sequence voltage = 2.00 x Ratio U2/U1>:
the task interval is 10 ms) 1) f/fn=0.98...1.02 < 35 ms (within the same task)
Reset time (when the task 20 ms (within the same task)
interval is 10 ms) 2)
Reset ratio 0.8...0.96 (for Ratio U2/U1>)
1.04...1.2 (for Ratio I2/I1<)
Configuration data Task execution interval (Relay Configuration Tool):
5...20 ms, at the rated frequency fn = 50 Hz
1)
When BSOUT output is used for blocking function blocks that are executed in a
slower task interval than FuseFail, an additional delay has to be included in the block
activation time (refer to section 2.1 Configuration).
2)
When BSOUT output is used for blocking function blocks that are executed in a
slower task interval than FuseFail, an additional delay has to be included in the reset
time (refer to section 2.1 Configuration).
12
1MRS752371-MUM Generic Base Elements
Issued: 11/1997
Version: D/12.2.2002
Data subject to change without notice
Contents
1. Arithmetic.................................................................................................. 4
2. Bistable ................................................................................................... 11
2.1 Reset dominant bistable function block (RS) ..................................... 11
2.2 Reset dominant bistable function block (RS_D) with data input......... 12
2.3 Set dominant bistable function block (SR) ......................................... 13
3. Bit-Shift ................................................................................................... 14
3.1 Rotate to left (ROL) ........................................................................... 14
3.2 Rotate to right (ROR) ........................................................................ 15
3.3 Bit-shift to left (SHL) .......................................................................... 16
3.4 Bit-shift to right (SHR) ....................................................................... 17
4. Bitwise Operation ................................................................................... 18
5. Comparison ............................................................................................ 25
6. Counter ....................................................................................................32
6.1 Down-counter (CTD)..........................................................................32
6.2 Up-down counter (CTUD) ..................................................................34
6.3 Up-counter (CTU) ..............................................................................37
7. Edge Detection........................................................................................39
8. Numeric ...................................................................................................41
8.1 Absolute value (ABS).........................................................................41
8.2 Principal arc cosine (ACOS) ..............................................................42
8.3 Principal arc sine (ASIN)....................................................................43
8.4 Principal arc tangent (ATAN) .............................................................44
8.5 Cosine in radians (COS) ....................................................................45
8.6 Natural exponential (EXP) .................................................................46
8.7 Natural logarithm (LN)........................................................................47
8.8 Logarithm base 10 (LOG) ..................................................................48
8.9 Sine in radians (SIN)..........................................................................49
8.10 Square root (SQRT)...........................................................................50
8.11 Tangent in radians (TAN)...................................................................51
9. Selection..................................................................................................52
9.1 Limiter (LIMIT) ...................................................................................52
9.2 Extensible maximum (MAX)...............................................................53
9.3 Extensible minimum (MIN).................................................................54
9.4 Multiplexer (MUX) ..............................................................................55
9.5 Binary selection (SEL) .......................................................................56
2
Substation Automation Generic Base Elements
12.1 TRUNC_REAL_TO_**....................................................................... 80
3
Generic Base Elements Substation Automation
1. Arithmetic
)LJXUH )XQFWLRQEORFNV\PERO
For example:
ADD(2,3) = 5
ADD(2,-3) = -1
4
Substation Automation Generic Base Elements
)LJXUH )XQFWLRQEORFNV\PERO
For example:
DIV(7,3) = 2
5
Generic Base Elements Substation Automation
)LJXUH )XQFWLRQEORFNV\PERO
OUT := IN1IN2
For example:
EXPT(2, 3) = 8
6
Substation Automation Generic Base Elements
)LJXUH )XQFWLRQEORFNV\PERO
Example:
MOD(7,3) = 1
7
Generic Base Elements Substation Automation
)LJXUH )XQFWLRQEORFNV\PERO
OUT := IN
8
Substation Automation Generic Base Elements
)LJXUH )XQFWLRQEORFNV\PERO
For example:
MUL(2,3) = 6
9
Generic Base Elements Substation Automation
)LJXUH )XQFWLRQEORFNV\PERO
For example:
SUB(3,2) = 1
10
Substation Automation Generic Base Elements
2. Bistable
)LJXUH )XQFWLRQEORFNV\PERO
The output Q1 is reset if the RESET1 input is set, regardless of the state of the SET
input. If the SET input is set and RESET1 is low, the output pin Q1 is set. If both the
inputs are FALSE, the output Q1 will preserve its previous value.
11
Generic Base Elements Substation Automation
2.2 Reset dominant bistable function block (RS_D) with data input
)LJXUH )XQFWLRQEORFNV\PERO
If only SET and RESET are used, RS_D operates as an ordinary RS element. When
the RESET input is reset and LOAD goes to 1, the value at D is stored at the output
Q. When the RESET input is set, the output Q is unconditionally reset, i.e. the RESET
input overrides the other inputs.
12
Substation Automation Generic Base Elements
)LJXUH )XQFWLRQEORFNV\PERO
The output Q1 is set if the SET1 input is set, regardless of the state of the RESET
input. If the RESET input is set and SET1 is low, the output pin Q1 is cleared. If both
the inputs are FALSE, the output will preserve its previous value.
13
Generic Base Elements Substation Automation
3. Bit-Shift
)LJXUH )XQFWLRQEORFNV\PERO
14
Substation Automation Generic Base Elements
)LJXUH )XQFWLRQEORFNV\PERO
15
Generic Base Elements Substation Automation
)LJXUH )XQFWLRQEORFNV\PERO
16
Substation Automation Generic Base Elements
)LJXUH )XQFWLRQEORFNV\PERO
17
Generic Base Elements Substation Automation
)LJXUH )XQFWLRQEORFNV\PERO
For example:
AND(TRUE,FALSE) = FALSE
AND(0x0F,0x08) = 0x08
18
Substation Automation Generic Base Elements
4.2.1 Application
BITGET is used to read a selected bit of an integer value and is thus useful in reading
the status information of a relay.
)LJXUH )XQFWLRQEORFNV\PERO
If the BITNR is not within the range from 0 to 15, the output Q is FALSE. Otherwise
the bit value of IN, specified by BITNR, is loaded to the output Q.
19
Generic Base Elements Substation Automation
4.3.1 Application
BITSET is used to set a selected bit of an integer value and is thus useful in writing
the status information of a relay.
)LJXUH )XQFWLRQEORFNV\PERO
When the input EN is FALSEthe data input IN is loaded unchanged to the output Q.
When the input EN is TRUE, the value of the bit number BITNR of the input data IN
is replaced by the value of the input BIT and the result is loaded to the output Q. If the
BITNR input is not within the range from 0 to 15, the output Q remains unchanged.
20
Substation Automation Generic Base Elements
For example:
21
Generic Base Elements Substation Automation
)LJXUH )XQFWLRQEORFNV\PERO
OUT := NOT IN
For example:
NOT(TRUE) = FALSE
NOT(FALSE) = TRUE
NOT(0x80) = 0x7F
22
Substation Automation Generic Base Elements
)LJXUH )XQFWLRQEORFNV\PERO
For example:
23
Generic Base Elements Substation Automation
)LJXUH )XQFWLRQEORFNV\PERO
For example:
XOR(FALSE,FALSE) = FALSE
XOR(TRUE,TRUE) = FALSE
XOR(FALSE,TRUE) = TRUE
XOR(TRUE, FALSE) = TRUE
XOR(0x08, 0x0F) = 0x07
24
Substation Automation Generic Base Elements
5. Comparison
5.1.1 Application
)LJXUH )XQFWLRQEORFNV\PERO
25
Generic Base Elements Substation Automation
)LJXUH )XQFWLRQEORFNV\PERO
OUT := (IN1 = IN2) & (IN2 = IN3) & ... & (INn-1 = INn)
For example:
EQ(1,0) = FALSE
26
Substation Automation Generic Base Elements
)LJXUH )XQFWLRQEORFNV\PERO
OUT := (IN1 IN2) & (IN2 IN3) & ... & (INn-1 INn)
For example:
GE(10,9) = TRUE
GE(10,10) = TRUE
GE(9, 10) = FALSE
27
Generic Base Elements Substation Automation
)LJXUH )XQFWLRQEORFNV\PERO
OUT := (IN1 > IN2) & (IN2 > IN3) & ... & (INn-1 > INn)
For example:
GT(10,9) = TRUE
GT(10,10) = FALSE
GT(9, 10) = FALSE
28
Substation Automation Generic Base Elements
)LJXUH )XQFWLRQEORFNV\PERO
OUT := (IN1 IN2) & ( IN2 IN3) & ... & (INn-1 INn)
For example:
LE(10,9) = FALSE
LE(10,10) = TRUE
LE(9, 10) = TRUE
29
Generic Base Elements Substation Automation
)LJXUH )XQFWLRQEORFNV\PERO
OUT := (IN1 < IN2) & (IN2 < IN3) & ... & (INn-1 < INn)
For example:
LT(10,9) = FALSE
LT(10,10) = FALSE
LT(9, 10) = TRUE
30
Substation Automation Generic Base Elements
)LJXUH )XQFWLRQEORFNV\PERO
For example:
NE(10,9) = TRUE
NE(10,10) = FALSE
NE(9, 10) = TRUE
31
Generic Base Elements Substation Automation
6. Counter
)LJXUH )XQFWLRQEORFNV\PERO
6.1.3.1 Counting
When the LOAD input is FALSE, each rising edge at the CD input decrements the
counter value CV by one.
6.1.3.2 Presetting
The LOAD input is used to load the new preset value of the counter from PV. The
counter is held as long as the LOAD input is TRUE.
32
Substation Automation Generic Base Elements
6.1.3.3 Supervision
The status output Q specifies the relation of the counter value to zero.Q is set when
CV 0.
6.1.3.4 Limits
When the counter reaches its lowest or highest value for the data type INT, all
counting ceases.
33
Generic Base Elements Substation Automation
)LJXUH )XQFWLRQEORFNV\PERO
Note! The CTUD function complies with the corrected version of the IEC 61131-3
standard (see the correction below).
34
Substation Automation Generic Base Elements
6.2.3.1 Up-count
Each rising edge at the CU input increments the counter value by one. If there is a
rising edge at both CU and CD, nothing is done.
6.2.3.2 Down-count
Each rising edge at the CD input decrements the counter value by one. If there is a
rising edge at both CU and CD, nothing is done.
6.2.3.3 Clearing
The RESET input clears the counter and prevents all further counting or loading.
When set, RESET overrides the other inputs of the counter and prevents them from
affecting the state of the counter.
6.2.3.4 Supervision
The status outputs specify the relation of the counter value to zero and to a loaded
preset value. QD is set when CV 0 and QU is set when CV PV.
35
Generic Base Elements Substation Automation
6.2.3.5 Limits
When the counter reaches its lowest or highest value for the data type INT, all
counting ceases.
36
Substation Automation Generic Base Elements
)LJXUH )XQFWLRQEORFNV\PERO
6.3.3.1 Counting
When the RESET input is FALSE, each rising edge at the CU input increments the
counter value CV by one.
6.3.3.2 Clearing
The input RESET clears the counter (CV := 0) and prevents all further counting.
37
Generic Base Elements Substation Automation
6.3.3.3 Supervision
The status output Q specifies the relation of the counter value to a supervision high
limit value. The Q is set, when CV PV.
6.3.3.4 Limits
When the counter reaches its lowest or highest value for the data type INT, all
counting ceases.
38
Substation Automation Generic Base Elements
)LJXUH )XQFWLRQEORFNV\PERO
The Q output of the F_TRIG element stands at the TRUE value from one execution of
the element to the next, following the TRUE to FALSE transition of the CLK input,
and returns to FALSE at the next execution.
39
Generic Base Elements Substation Automation
)LJXUH )XQFWLRQEORFNV\PERO
The Q output of the R_TRIG element stands at the TRUE value from one execution of
the element to the next, following the FALSE to TRUE transition of the CLK input,
and returns to FALSE at the next execution.
40
Substation Automation Generic Base Elements
8. Numeric
)LJXUH )XQFWLRQEORFNV\PERO
For example:
ABS(10) = 10
ABS(-10) = 10
ABS(-10.11) =10.11
41
Generic Base Elements Substation Automation
)LJXUH )XQFWLRQEORFNV\PERO
The ACOS function returns the arc cosine of a floating-point argument IN. IN must be
in the range [-1, 1]. The return value is an angle in the range [0, ] radians.
42
Substation Automation Generic Base Elements
)LJXUH )XQFWLRQEORFNV\PERO
The ASIN function returns the arc sine of a floating-point argument IN. IN must be in
the range [-1, 1]. The return value is an angle in the range
[ , ]
2 2 radians.
43
Generic Base Elements Substation Automation
)LJXUH )XQFWLRQEORFNV\PERO
The ATAN function returns the arc tangent of a floating-point argument IN. The
return value is an angle in the range
[ , ]
2 2 radians.
44
Substation Automation Generic Base Elements
)LJXUH )XQFWLRQEORFNV\PERO
The COS function returns the cosine of a floating-point number IN. IN is an angle
expressed in radians. An argument with large magnitude may produce a result with
little or no significance.
45
Generic Base Elements Substation Automation
)LJXUH )XQFWLRQEORFNV\PERO
OUT := eIN
46
Substation Automation Generic Base Elements
)LJXUH )XQFWLRQEORFNV\PERO
OUT := ln IN
47
Generic Base Elements Substation Automation
)LJXUH )XQFWLRQEORFNV\PERO
OUT := log IN
48
Substation Automation Generic Base Elements
)LJXUH )XQFWLRQEORFNV\PERO
The SIN function returns the sine of a floating-point number IN. IN is an angle
expressed in radians. An argument with large magnitude may produce a result with
little or no significance.
49
Generic Base Elements Substation Automation
)LJXUH )XQFWLRQEORFNV\PERO
287:= ,1
An argument with large magnitude may produce a result with little or no significance.
Negative input values yield to a zero result.
50
Substation Automation Generic Base Elements
)LJXUH )XQFWLRQEORFNV\PERO
The TAN function returns the tangent of a floating-point number IN. IN is an angle
expressed in radians. An argument with large magnitude may produce a result with
little or no significance.
51
Generic Base Elements Substation Automation
9. Selection
)LJXUH )XQFWLRQEORFNV\PERO
OUT := MIN(MAX(IN,MN),MX)
52
Substation Automation Generic Base Elements
)LJXUH )XQFWLRQEORFNV\PERO
53
Generic Base Elements Substation Automation
)LJXUH )XQFWLRQEORFNV\PERO
Returns the minimun of input values, OUT := MIN(IN1, IN2, ..., INn)
54
Substation Automation Generic Base Elements
)LJXUH )XQFWLRQEORFNV\PERO
Select one of the N inputs depending on the input K. Note that index zero selects
the first input IN1. If index K is greater than N-1, funtion returns zero.
For example:
55
Generic Base Elements Substation Automation
)LJXUH )XQFWLRQEORFNV\PERO
56
Substation Automation Generic Base Elements
10. Timer
)LJXUH )XQFWLRQEORFNV\PERO
IN
t0 t1 t2 t3 t4 t5
Q
t0 t1+PT t2 t5+PT
(PT)
ET
t1 t3 t5 0
)LJXUH 2IIGHOD\WLPLQJ
57
Generic Base Elements Substation Automation
)LJXUH )XQFWLRQEORFNV\PERO
IN
t0 t1 t2 t3 t4 t5
Q
t0+PT t1 t4+PT t5
(PT)
ET
t0 t1 t2 t3 t4 t5
)LJXUH 2QGHOD\WLPLQJ
58
Substation Automation Generic Base Elements
)LJXUH )XQFWLRQEORFNV\PERO
IN
t0 t1 t2 t3 t4 t5 t6 t7
Q
t0 t0+PT t2 t2+PT t6 t6+PT
(PT)
ET
t0 t1 t2 t6 t7 0
)LJXUH 3XOVHWLPLQJ
59
Generic Base Elements Substation Automation
The time duration for TOF, TON and TP is configured in the Relay Configuration
Tool. The time duration can be defined in the range 0...49.7 days, in steps of one
millisecond. The desired time duration can be given in milliseconds (ms), seconds (s),
minutes (m) , hours (h) or days (d).
"TIME#1000ms"
"time#1s"
"T#1000ms"
"t#1s"
"T#1d 2h 3m 4s 5ms"
"T#1d_2h_3m_4s_5ms"
"T#25h_15m"
is equivalent to
"T#1d_1h_15m"
)LJXUH ([DPSOHRISXOVHZLGWKFRQILJXUDWLRQ
60
Substation Automation Generic Base Elements
11.1.1 Application
)LJXUH )XQFWLRQEORFNV\PERO
61
Generic Base Elements Substation Automation
BOOL2INT returns the integer output Q, the value of which is equal to the 16 input
bits.
62
Substation Automation Generic Base Elements
BYTE
DINT
DWORD
INT
REAL
SINT
UDINT
UINT
USINT
WORD
The BOOL type of data is converted e.g. to the BYTE type.
63
Generic Base Elements Substation Automation
DWORD
WORD
The BYTE type of data is converted e.g. to the DWORD type.
64
Substation Automation Generic Base Elements
65
Generic Base Elements Substation Automation
INT
REAL
SINT
When the DINT type of data is converted e.g. to the INT type:
Data type DINT: -2 147 483 648 ... 2 147 483 647
Data type INT: -32 768 ... 32 767
For example:
DINT_TO_INT(10) = 10
DINT_TO_INT(-10) = -10
DINT_TO_INT(32768) = -32 768
DINT_TO_INT(-32769) = 32 767
When the DINT type of data is converted to the SINT type:
Data type DINT: -2 147 483 648 ... 2 147 483 647
Data type SINT: -128 ... 127
For example:
DINT_TO_SINT(10) = 10
DINT_TO_SINT(-10) = -10
DINT_TO_SINT(128) = -128
DINT_TO_SINT(-129) = 127
66
Substation Automation Generic Base Elements
BYTE
WORD
The DWORD type of data is converted to the BYTE or WORD type.
For example:
DWORD_TO_BYTE(0xFFFFFFFF) = 0xFF
DWORD_TO_WORD(0xFFFFFFFF) = 0xFFFF
67
Generic Base Elements Substation Automation
11.7.1 Application
)LJXUH )XQFWLRQEORFNV\PERO
68
Substation Automation Generic Base Elements
The input value IN is separated to a bit format and the status of each of the 16 bits is
returned as an output.
For example: the output B0 is equal to the status of the first bit of input IN.
69
Generic Base Elements Substation Automation
DINT
REAL
The INT type of data is converted e.g. to the DINT type.
70
Substation Automation Generic Base Elements
DINT
INT
SINT
UDINT
UINT
USINT
The REAL type of data is converted e.g. to the DINT type.
REAL_TO_DINT(2147483647.1) = 2147483647
REAL_TO_DINT(-2147483648.1) = -2147483648
REAL_TO_DINT(10.4) = 10
REAL_TO_DINT(10.5) = 11
REAL_TO_DINT(-10.4) = -10
REAL_TO_DINT(-10.5) = -11
71
Generic Base Elements Substation Automation
REAL_TO_INT(32767.1) = 32767
REAL_TO_INT(-32768.1) = -32768
REAL_TO_INT(10.4) = 10
REAL_TO_INT(10.5) = 11
REAL_TO_INT(-10.4) = -10
REAL_TO_INT(-10.5) = -11
SINT values are -128...127, for example:
REAL_TO_SINT(127.1) = 127
REAL_TO_SINT(-128.1) = -128
REAL_TO_SINT(10.4) = 10
REAL_TO_SINT(10.5) = 11
REAL_TO_SINT(-10.4) = -10
REAL_TO_SINT(-10.5) = -11
UDINT values are 0...4294967295, for example:
REAL_TO_UDINT(4294967295.1) = 4294967295
REAL_TO_UDINT(-0.1) = 0
REAL_TO_UDINT(10.4) = 10
REAL_TO_UDINT(10.5) = 11
REAL_TO_UDINT(-10.4) = 0
REAL_TO_UDINT(-10.5) = 0
UINT values are 0...65535, for example:
REAL_TO_UINT(65535.1) = 65535
REAL_TO_UINT(-0.1) = 0
REAL_TO_UINT(10.4) = 10
REAL_TO_UINT(10.5) = 11
REAL_TO_UINT(-10.4) = 0
REAL_TO_UINT(-10.5) = 0
USINT values are 0 ... 255, for example:
REAL_TO_USINT(255.1) = 255
REAL_TO_USINT(-0.1) = 0
REAL_TO_USINT(10.4) = 10
REAL_TO_USINT(10.5) = 11
REAL_TO_USINT(-10.4) = 0
REAL_TO_USINT(-10.5) = 0
72
Substation Automation Generic Base Elements
DINT
INT
REAL
The SINT type of data is converted e.g. to the DINT type.
73
Generic Base Elements Substation Automation
REAL
TOD
UDINT
The TIME type of data is converted e.g. to the REAL type.
74
Substation Automation Generic Base Elements
REAL
TIME
UDINT
The TOD type of data is converted e.g. to the TIME type.
75
Generic Base Elements Substation Automation
REAL
UINT
USINT
The UDINT type of data is converted e.g. to the REAL type.
76
Substation Automation Generic Base Elements
BOOL
REAL
UDINT
USINT
The UINT type of data is converted e.g. to the BOOL type.
77
Generic Base Elements Substation Automation
REAL
UDINT
UINT
The USINT type of data is converted to the REAL type.
78
Substation Automation Generic Base Elements
BYTE
DWORD
The WORD type of data is converted e.g. to the BYTE type.
For example:
WORD_TO_BYTE(0xFFFF) = 0xFF
79
Generic Base Elements Substation Automation
12.1 TRUNC_REAL_TO_**
DINT
INT
SINT
UDINT
UINT
USINT
DINT values are in the range -2147483648...2147483647, for example:
TRUNC_REAL_TO_DINT(2147483647.1) = 2147483647
TRUNC_REAL_TO_DINT(-2147483648.1) = -2147483648
TRUNC_REAL_TO_DINT(10.4) = 10
TRUNC_REAL_TO_DINT(10.5) = 10
TRUNC_REAL_TO_DINT(-10.4) = -10
80
Substation Automation Generic Base Elements
TRUNC_REAL_TO_INT(32767.1) = 32767
TRUNC_REAL_TO_INT(-32768.1) = -32768
TRUNC_REAL_TO_INT(10.4) = 10
TRUNC_REAL_TO_INT(10.5) = 10
TRUNC_REAL_TO_INT(-10.4) = -10
TRUNC_REAL_TO_INT(-10.5) = -10
SINT values are in the range -128...127, for example:
TRUNC_REAL_TO_SINT(127.1) = 127
TRUNC_REAL_TO_SINT(-128.1) = -128
TRUNC_REAL_TO_SINT(10.4) = 10
TRUNC_REAL_TO_SINT(10.5) = 10
TRUNC_REAL_TO_SINT(-10.4) = -10
TRUNC_REAL_TO_SINT(-10.5) = -10
UDINT values are in the range 0...4294967295, for example:
TRUNC_REAL_TO_UDINT(4294967295.1) = 4294967295
TRUNC_REAL_TO_UDINT(-0.1) = 0
TRUNC_REAL_TO_UDINT(10.4) = 10
TRUNC_REAL_TO_UDINT(10.5) = 10
TRUNC_REAL_TO_UDINT(-10.4) = 0
TRUNC_REAL_TO_UDINT(-10.5) = 0
UINT values are in the range 0...65535, for example:
TRUNC_REAL_TO_UINT(65535.1) = 65535
TRUNC_REAL_TO_UINT(-0.1) = 0
TRUNC_REAL_TO_UINT(10.4) = 10
TRUNC_REAL_TO_UINT(10.5) = 10
TRUNC_REAL_TO_UINT(-10.4) = 0
TRUNC_REAL_TO_UINT(-10.5) = 0
USINT values are in the range 0...255, for example:
TRUNC_REAL_TO_USINT(255.1) = 255
TRUNC_REAL_TO_USINT(-0.1) = 0
TRUNC_REAL_TO_USINT(10.4) = 10
TRUNC_REAL_TO_USINT(10.5) = 10
TRUNC_REAL_TO_USINT(-10.4) = 0
TRUNC_REAL_TO_USINT(-10.5) = 0
81
1MRS752372-MUM INDRESET
Issued: 10/1997
Version: D/7.2.2002
Operation Indication, Relay
Data subject to change without notice
and Register Reset
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 2
2. Description of Operation.......................................................................... 3
2.1 General ............................................................................................... 3
1. Introduction
1.1 Features
1.2 Application
This manual specifies the function of the reset function block INDRESET used in
products based on the RED 500 Platform.
Digital inputs can be used for resetting the operation indicators, latched output
signals, registers and waveforms i.e. the recordings of the disturbance recorder.
)LJXUH )XQFWLRQEORFNV\PERORI,1'5(6(7
2
Substation Automation INDRESET
2.1 General
The rising edges of IND, IND_REL and IND_REL_REG have the following effects:
The reaction is prioritized so that the IND input has the lowest priority while the
IND_REL_REG input has the highest priority. Thus, if different inputs are activated
at the same time, the effect with the highest priority will be executed.
3
INDRESET Substation Automation
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for INDRESET is 29.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
4
Substation Automation INDRESET
3.3 Events
5
INDRESET Substation Automation
6
1MRS100034 RE_5_ _
Issued: 10/1997
Version: E
Three-Phase Transformer Inrush and
Data subject to change without notice Motor Start-Up Current Detector
(Inrush3)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 3
2. Description of Operation.......................................................................... 4
2.1 Configuration....................................................................................... 4
2.2 Measuring mode ................................................................................. 4
2.2.1 Transformer inrush mode ........................................................... 4
2.2.2 Motor start-up mode................................................................... 5
2.3 Operation criteria................................................................................. 5
2.3.1 Transformer inrush mode ........................................................... 5
2.3.2 Motor start-up mode................................................................... 6
2.4 Setting groups ..................................................................................... 7
2.5 Test mode ........................................................................................... 7
2.6 START and TRIP outputs.................................................................... 8
2.7 Resetting............................................................................................. 8
3. Parameters and Events ............................................................................ 9
1. Introduction
1.1 Features
Fast output signal for stabilizing the protection stages in a transformer inrush or at
motor start-up
Transformer inrush detection
Motor start-up detection
Current measurement with conventional current transformers or Rogowski coils
Single-phase (e.g. neutral current), two-phase or three-phase operation
1.2 Application
This document specifies the function of the three-phase transformer inrush and motor
start-up detection function block Inrush3 used in products based on the RED 500
Platform.
The function block Inrush3 can be used for doubling the set start current of
overcurrent protection in a transformer magnetizing inrush situation or at motor start-
up, or for blocking (stabilization) overcurrent protection in a transformer magnetizing
inrush situation.
3 I2f/I1f>
3 dI/dt>
)LJXUH )XQFWLRQEORFNV\PERORI,QUXVK
2
ABB Automation Inrush3 RE_5_ _
3
RE_5_ _ Inrush3 ABB Automation
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The phase currents IL1, IL2 and IL3 are
connected to the corresponding IL1, IL2 and IL3 inputs of the function block. Digital
inputs are connected to the boolean inputs of the function block and in the same way,
the outputs of the function block are connected to the output signals.
The blocking function in transformer inrush situations can also be based on measuring
the neutral current I0 or the residual current Ios (= I L1+I L2+I L3). Then the neutral
current I0 (or the residual current Ios) is connected to one of the inputs IL1, IL2 or IL3
of the function block.
There are two operation modes available. The measuring mode depends on the
operation mode selected.
At transformer inrush mode, the operation is based on the ratio between the digitally
filtered second harmonic phase current and the fundamental frequency phase current:
4
ABB Automation Inrush3 RE_5_ _
At motor start-up mode, the operation is based on momentary values and consecutive
peak-to-peak values of phase currents. Harmonics are not suppressed.
The setting parameter Operation mode is used for selecting the operation mode.
There are two modes available: the transformer inrush mode and the motor start-up
mode.
)LJXUH 7KHIXQFWLRQEORFN,QUXVKFDQEHXVHGIRUEORFNLQJRYHUFXUUHQW
SURWHFWLRQDWWUDQVIRUPHUPDJQHWL]LQJLQUXVK
Transformer inrush detection is based on the traditional principle: the output signal
START is activated once the numerically derived ratio I2f/I1f between the amplitudes
of the second harmonic and the fundamental frequency current in one phase exceeds
the value set for the Ratio I2f/I1f> parameter.
The blocking function in inrush situations can also be based on the ratio between the
second harmonic and the fundamental component of the neutral current I0.
The signal START can be activated only if the amplitude of the fundamental
frequency current of the corresponding phase is above 2.0% In. A control parameter is
used for setting the minimum pulse width of the output signal START. However, the
signal START remains active until the ratio I2f/I1f drops below the value set for the
Ratio I2f/I1f> parameter in all phases, i.e. until the inrush situation is over, even if
the pulse counter has elapsed earlier.
5
RE_5_ _ Inrush3 ABB Automation
I1f
I2f
2% In
I2f/I1f
Ratio
I2f/I1f
1
0 START signal
Inrush1
Min. pulse width
)LJXUH )XQFWLRQDOLW\RIWKHWUDQVIRUPHULQUXVKPRGH
)LJXUH 7KHIXQFWLRQEORFN,QUXVKFDQEHXVHGIRUEORFNLQJRYHUFXUUHQW
SURWHFWLRQDWPRWRUVWDUWXS
The motor start-up is defined as a situation in which the initial three phase currents
stay below 5.0% In for about 60 ms, i.e. the motor is at standstill, and in which the
value of at least one phase current rises from 5.0 % In above the set start current
within the set rising time. If a phase current exceeds the set current level within the
set time, the START signal is immediately set to 1, i.e. the START output can be
activated before the set rising time has elapsed.
6
ABB Automation Inrush3 RE_5_ _
A control parameter is used for setting the minimum pulse width of the output signal
START. However, the START signal remains active until all the three phase currents
fall below 0.9 x Start current and remain below that level for about 150 ms, i.e. until
the start-up situation is over, even if the pulse counter has elapsed earlier.
Rising time
Start current
0.9 x Start current
5% In
1
0 START signal
Inrush2
Min. pulse width
)LJXUH )XQFWLRQDOLW\RIWKHPRWRUVWDUWXSPRGH
Two different groups of setting values, group 1 and group 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
7
RE_5_ _ Inrush3 ABB Automation
The protection functions operate normally while the outputs are tested.
A separate parameter on the MMI or via the serial communication is used for setting
the minimum pulse width of the output signal START.
2.7 Resetting
The TRIP output signal and the registers can be reset either via the RESET input, or
over the serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
8
ABB Automation Inrush3 RE_5_ _
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for Inrush3 is 34.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
9
RE_5_ _ Inrush3 ABB Automation
Start current S43 0.10 ...5.00 x In 0.10 R/W Motor start current
1)
Operation mode 0 = Not in use; 1 = Inrush mode; 2 = Start-up mode
Start current S73 0.10 ...5.00 x In 0.10 R/W Motor start current
1)
Operation mode 0 = Not in use; 1 = Inrush mode; 2 = Start-up mode
10
ABB Automation Inrush3 RE_5_ _
The registers are triggered when an inrush or start-up situation is detected. The time
stamp indicates the moment of detection, i.e. the moment when the second harmonic
content of the current in one phase exceeds the value set for the Ratio I2f/I1f>
parameter or when a phase current exceeds the set start current when a motor start-up
situation is detected.
When the set Ratio I2f/I1f> is exceeded in one phase or when the value of at least
one of the phase currents rises from 5.0 % In above the set start current in less time
than the set Rising time, the function block starts calculating the average of each
phase current IL1, I L2 and I L3, and the minimum value of the ratio I2f/I1f in each phase.
The average currents and the minimum values of I2f/I1f will be updated when the
START signal resets. The values of the phase currents IL1, I L2 and I L3 are recorded as
multiples of the rated current In. The recorded I2f/I1f ratios are percentage values.
The duration of the transformer inrush situation is defined as the time during which
the set I2f/I1f value is exceeded. The duration of a motor start-up situation is defined
as the time from the moment when the first phase current exceeds 5.0% In until all
three currents fall below 0.9 x Start current and remain below that value for about 50
ms. The duration is updated when the START signal resets.
The data of three last operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation.
11
RE_5_ _ Inrush3 ABB Automation
12
ABB Automation Inrush3 RE_5_ _
3.3.4 Events
13
RE_5_ _ Inrush3 ABB Automation
current measurement:
14
1MRS752306-MUM Inrush3
Issued: 10/1997
Version: F/27.3.2002
Three-Phase Transformer Inrush and
Data subject to change without notice Motor Start-Up Current Detector
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 3
2. Description of Operation.......................................................................... 4
2.1 Configuration....................................................................................... 4
2.2 Measuring mode ................................................................................. 4
2.2.1 Transformer inrush mode ........................................................... 4
2.2.2 Motor start-up mode................................................................... 5
2.3 Operation criteria................................................................................. 5
2.3.1 Transformer inrush mode ........................................................... 5
2.3.2 Motor start-up mode................................................................... 6
2.4 Setting groups ..................................................................................... 7
2.5 Test mode ........................................................................................... 7
2.6 START output ..................................................................................... 8
2.7 Resetting............................................................................................. 8
3. Parameters and Events ............................................................................ 9
3.1 General ............................................................................................... 9
3.2 Setting values.................................................................................... 10
3.2.1 Actual settings.......................................................................... 10
3.2.2 Setting group 1......................................................................... 10
3.2.3 Setting group 2......................................................................... 10
3.2.4 Control settings ........................................................................ 11
3.3 Measurement values ......................................................................... 11
3.3.1 Input data ................................................................................. 11
3.3.2 Output data .............................................................................. 12
3.3.3 Recorded data.......................................................................... 12
3.3.4 Events ...................................................................................... 14
1. Introduction
1.1 Features
Fast output signal for stabilizing the protection stages in a transformer inrush or at
motor start-up
Transformer inrush detection
Motor start-up detection
Current measurement with conventional current transformers or Rogowski coils
Single-phase, two-phase or three-phase operation
1.2 Application
This document specifies the function of the three-phase transformer inrush and motor
start-up detection function block Inrush3 used in products based on the RED 500
Platform.
The function block Inrush3 can be used for doubling the set start current of
overcurrent protection in a transformer magnetizing inrush situation or at motor start-
up, or for blocking (stabilization) overcurrent protection in a transformer magnetizing
inrush situation.
3 I2f/I1f>
3 dI/dt>
)LJXUH )XQFWLRQEORFNV\PERORI,QUXVK
2
Substation Automation Inrush3
3
Inrush3 Substation Automation
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The phase currents IL1, IL2 and IL3 are
connected to the corresponding IL1, IL2 and IL3 inputs of the function block. Digital
inputs are connected to the boolean inputs of the function block and in the same way,
the outputs of the function block are connected to the output signals.
Note! When the function block Inrush3 is used, the 2nd harmonic restraint must be
selected for the channels connected to the IL_ inputs of the function block from the
special measurements dialogue box of the configuration tool, regardless of whether
the transformer inrush mode or the motor startup mode is used.
There are two operation modes available. The measuring mode depends on the
operation mode selected.
In transformer inrush mode, the operation is based on the ratio between the digitally
filtered second harmonic phase current and the fundamental frequency phase current:
4
Substation Automation Inrush3
In motor start-up mode, the operation is based on momentary values and consecutive
peak-to-peak values of phase currents. Harmonics are not suppressed.
The setting parameter Operation mode is used for selecting the operation mode.
There are two modes available: the transformer inrush mode and the motor start-up
mode.
)LJXUH 7KHIXQFWLRQEORFN,QUXVKFDQEHXVHGIRUEORFNLQJRYHUFXUUHQW
SURWHFWLRQDWWUDQVIRUPHUPDJQHWL]LQJLQUXVK
Transformer inrush detection is based on the traditional principle: the output signal
START is activated once the numerically derived ratio I2f/I1f between the amplitudes
of the second harmonic and the fundamental frequency current in one phase exceeds
the value set for the Ratio I2f/I1f> parameter.
The signal START can be activated only if the amplitude of the fundamental
frequency current of the corresponding phase is above 3% In. A control parameter1 is
used for setting the minimum pulse width of the output signal START. However, the
signal START remains active until the ratio I2f/I1f drops below the value set for the
Ratio I2f/I1f> parameter in all phases, i.e. until the inrush situation is over, even if
the start pulse timer has elapsed earlier.
1
Start pulse
5
Inrush3 Substation Automation
I1f
I2f
2% In
I2f/I1f
Ratio
I2f/I1f
1
0 START signal
Inrush1
Min. pulse width
)LJXUH )XQFWLRQDOLW\RIWKHWUDQVIRUPHULQUXVKPRGH
)LJXUH 7KHIXQFWLRQEORFN,QUXVKFDQEHXVHGIRUEORFNLQJRYHUFXUUHQW
SURWHFWLRQDWPRWRUVWDUWXS
The motor start-up is defined as a situation in which the initial three phase currents
stay below 5.0% In for about 60 ms, i.e. the motor is at standstill, and in which the
value of at least one phase current rises from 5.0 % In above the set start current
within the set rising time. If a phase current exceeds the set current level within the
set time, the START signal is immediately set to TRUE, i.e. the START output can be
activated before the set rising time has elapsed.
6
Substation Automation Inrush3
A control parameter Start pulse is used for setting the minimum pulse width of the
output signal START. However, the START signal remains active until all the three
phase currents fall below 0.9 x Start current and remain below that level for about 150
ms, i.e. until the start-up situation is over, even if the START pulse timer has elapsed
earlier.
Rising time
Start current
0.9 x Start current
5% In
1
0 START signal
Inrush2
Min. pulse width
)LJXUH )XQFWLRQDOLW\RIWKHPRWRUVWDUWXSPRGH
Two different groups of setting values, group 1 and group 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time. The settings that are active can be read from the Actual settings view.
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
7
Inrush3 Substation Automation
The protection functions operate normally while the outputs are tested.
A separate parameter on the MMI or via the serial communication is used for setting
the minimum pulse width of the output signal START.
2.7 Resetting
The TRIP output signal and the registers can be reset either via the RESET input, or
over the serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
8
Substation Automation Inrush3
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for Inrush3 is 34.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
9
Inrush3 Substation Automation
Start current S33) 0.10 ...5.00 x In 0.10 R/M Motor start current
1)
Operation mode 0 = Not in use; 1 = Inrush mode; 2 = Start-up mode
2)
Active only in transformer inrush mode
3)
Active only in motor start-up mode
10
Substation Automation Inrush3
11
Inrush3 Substation Automation
The registers are triggered when an inrush or start-up situation is detected. The time
stamp indicates the moment of detection, i.e. the moment when the second harmonic
content of the current in one phase exceeds the value set for the Ratio I2f/I1f>
parameter or when a phase current exceeds the set start current when a motor start-up
situation is detected.
When the set Ratio I2f/I1f> is exceeded in one phase or when the value of at least
one of the phase currents rises from 5.0 % In above the set start current in less time
than the set Rising time, the function block starts calculating the average of each
phase current IL1, I L2 and I L3, and the minimum value of the ratio I2f/I1f in each phase.
The average currents and the minimum values of I2f/I1f will be updated when the
START signal resets. The values of the phase currents IL1, I L2 and I L3 are recorded as
multiples of the rated current In. The recorded I2f/I1f ratios are percentage values.
The duration of the transformer inrush situation is defined as the time during which
the set I2f/I1f value is exceeded. The duration of a motor start-up situation is defined
as the time from the moment when the first phase current exceeds 5.0% In until all
three currents fall below 0.9 x Start current and remain below that value for about 50
ms. The duration is updated when the START signal resets.
The data of three last operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation.
12
Substation Automation Inrush3
13
Inrush3 Substation Automation
3.3.4 Events
14
Substation Automation Inrush3
current measurement:
15
1MRS752337-MUM MEAI _
General Measurement /
Issued: 03/1999
Version: B/30.1.2002 Analogue Input on
Data subject to change without notice RTD/Analogue Module
Contents
1 Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description .................................................................................. 3
1.4 Output description ............................................................................... 3
2 Description of Operation.......................................................................... 4
2.1 Configuration....................................................................................... 4
2.2 Measuring mode ................................................................................. 5
2.3 Registers............................................................................................. 5
2.4 IV input................................................................................................ 5
2.5 Zero value supervision and zero value detection ................................. 6
2.6 Limit value supervision ........................................................................ 6
2.7 Threshold supervision with absolute threshold .................................... 7
2.8 Threshold supervision with integrator algorithm................................... 8
2.9 Scaling of SysAI input ......................................................................... 9
3 Parameters and Events .......................................................................... 10
3.1 General ............................................................................................. 10
3.2 Control settings ................................................................................. 11
3.3 Measurement values ......................................................................... 12
3.3.1 Input data ................................................................................. 12
3.3.2 Recorded data.......................................................................... 12
3.3.3 Events ...................................................................................... 12
4 Technical Data ........................................................................................ 13
MEAI_ Substation Automation
1 Introduction
1.1 Features
General measurement by means of sensor inputs or an input of the RTD/analogue
module
Measured signal can be DC (average measurement) or AC (true RMS
measurement) when sensor inputs are used
Measured value displayed as absolute value
User-defined scaling of input signals
Limit value monitoring with up to four adjustable limits
Separate user-settable starting and resetting delay for the warning and alarm signals
The outputs MeasOut, HighAlarm, HighWarning, LowAlarm and LowWarning
can be used in freely programmable logic in the Relay Configuration Tool
1.2 Application
This document specifies the function of the eight general measurement function
blocks MEAI1MEAI8 that are identical in operation.
The general measurement function blocks can be used in such products based on the
RED 500 Platform that are equipped with a sensor input module or an RTD/analogue
module. The function blocks can be applied to various applications, for instance to
measure temperature as well as level of the transformers oil and level of overflow
reservoir.
)LJXUH $VDQH[DPSOHWKHIXQFWLRQEORFNV\PERORI0($,
2
Substation Automation MEAI_
3
MEAI_ Substation Automation
2 Description of Operation
2.1 Configuration
If a sensor input is used as the signal source, the SysAI input is to be used. The
analogue channel number is selected for one of the generic inputs, GE1...GE3, via a
dialogue box in the Relay Configuration Tool. The corresponding global variable
GE1...GE3 is then connected to the SysAI input by using the Relay Configuration
Tool.
If the RTD/analogue module is used as the signal source, the global variable
corresponding to the input of the module is connected to the RawAI input by using the
Relay Configuration Tool. The global variable corresponding to the invalidity signal
of the RTD/analogue input is connected to the IV input.
)LJXUH 7HPSHUDWXUHPRQLWRULQJXVLQJDQLQSXWRIWKH57'DQDORJXHPRGXOH
If no RTD/analogue inputs are available, a sensor input can be used to monitor the
temperature if a temperature sensor with a voltage transducer output is used. One of
the general inputs, e.g. GE1, is configured for the sensor input to be used, and the
general input is connected to the SysAI input of the function block. The invalid input
IV is still functional, but as no validity information is available, the input is left
floating.
4
Substation Automation MEAI_
)LJXUH 7HPSHUDWXUHPRQLWRULQJXVLQJDVHQVRULQSXW
The values are updated once a fundamental frequency cycle, i.e. the integration time
for true RMS calculation is one fundamental cycle (e.g. 20 ms at 50 Hz).
The input is filtered with a 10 sample average filter, where a new sample is added to
the filter every execution task cycle.
2.3 Registers
2.4 IV input
The IV input is used to signal to the function block that the input value is not valid. On
the rising edge of the IV input the measured value is locked to the value reported at
the previous task cycle. This means that the MeasOut output will show the locked
value as long as the IV input is high, and that the state of the alarm and warning
outputs, as well as the threshold event generation, are based on the locked value. The
IV input can be left unconnected and the measured value is then considered always
valid.
5
MEAI_ Substation Automation
An input value below the absolute threshold value, which can be set with the
parameter Zero force limit, is forced to zero. This allows noise in the measured
value to be ignored. The zero value supervision is deactivated when the threshold
value is zero.
Four different limits can be monitored: high alarm, high warning, low alarm and low
warning limits. The parameters LowAlarm, LowWarning, HighAlarm and
HighWarning are used to specify the limits to be supervised and monitored. Which
limits are in use can be specified with the parameter Limit selection. Each limit is
checked independently. If the value exceeds several limits within an execution task
cycle, each exceeding of limit is reported to the master device independently. The
hysteresis of the limits is programmable by setting an absolute threshold value. Limits
can be changed on-line. Separate starting and resetting times can be given to the
limits. The meaning of the start and reset delay parameters (e.g. HW start delay) is
that the output will not be activated until the condition has been TRUE for the time
specified in the start delay parameter, and the output will not be deactivated until the
condition has been FALSE for the time specified in the reset delay parameter.
Measured value
(2)
(3)
Hysteresis
High alarm limit
(1)
(4)
High warn. limit
Normal zone
(5)
(8)
)LJXUH 2SHUDWLRQRIOLPLWYDOXHPRQLWRULQJ
6
Substation Automation MEAI_
Two different methods can be used for the threshold supervision and the method to be
used is selected with the parameter Threshold select.
The function block compares the actual input value with the last reported value. If the
actual value exceeds the last reported value plus the set Threshold value, or is below
the last reported value minus the set Threshold value, the actual value is
spontaneously reported to the master device and will replace the last reported value.
Measured value
Reported value
+ Threshold value
- Threshold value Reported value
Thsabso5
Execution task cycle
)LJXUH 2SHUDWLRQRIWKUHVKROGVXSHUYLVLRQZLWKDEVROXWHWKUHVKROG
7
MEAI_ Substation Automation
When threshold supervision with integrator algorithm is used, the function block
calculates the difference between the last reported value and the actual value for each
task cycle. The difference is added to the internal accumulated (integrated) value
register. If the accumulated delta exceeds the set Threshold value, the actual value is
spontaneously reported to the master device. The actual value then replaces the last
reported value, and the internal accumulated value register is set to zero.
Measured value
Value update Value update
40
Reported value
30
20 Reported value
0
Threshold cycle
(execution cycle)
+ Threshold value
Reference level
- Threshold value
Thsinte5
)LJXUH 2SHUDWLRQRIWKUHVKROGVXSHUYLVLRQZLWKLQWHJUDWRUDOJRULWKP
8
Substation Automation MEAI_
The generic inputs GEx are factory scaled in the following way:
Sensor input:
Input voltage 0 mV; reading 0.0
Input voltage 150 mV; reading 1.0
4 - 20 mA input:
Input current 4 mA; reading 4.0
Input current 20 mA; reading 20.0
Each generic input can be scaled to any range by means of two parameters:
GE_x correction factor (F003V5x1) (-10000.00000...10000.00000)
GE_x offset correction (F003V5x2) (-10000.00000...10000.00000)
Note that offset correction only is possible when measuring the DC component of the
signal, i.e. the GE_x offset correction parameter has no meaning when the measuring
mode is set to AC. Moreover, the GE_x correction factor parameter is limited to a
positive range when the measuring mode is set to AC.
The scaling and offset correction of a DC signal can be done for instance in the
following way:
The parameters are scaled with default values, GE_x Corr. factor = 1.0 and GE_x
Offset corr. = 0.0.
A signal is connected to the relay with such a value that the measured value
should be 0.0.
The value reported as measured value is written to the GE_x offset correction
parameter Offset corr..
The parameters are stored, after which the relay is reset.
A signal is connected to the relay with such a value that the measured value
should be 1.0.
The inverse (1/measured value) of the value reported as measured value is
written to the GE_x correction factor parameter Corr. factor.
The parameters are stored , after which the relay is reset.
9
MEAI_ Substation Automation
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel numbers are listed in the following table.
Function MEAI1 MEAI2 MEAI3 MEAI4 MEAI5 MEAI6 MEAI8 MEAI8
block
Channel 213 214 215 216 217 218 219 220
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or in serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
10
Substation Automation MEAI_
11
MEAI_ Substation Automation
3.3.3 Events
Code Weighting Default Event reason Event state
coefficient mask
E0 1 0 Value High warning reset
E1 2 0 Value High warning activated
E2 4 0 Value High alarm reset
E3 8 0 Value High alarm activated
E4 16 0 Value Low warning reset
E5 32 0 Value Low warning activated
E6 64 0 Value Low alarm reset
E7 128 0 Value Low alarm activated
E8 256 0 Value Value is valid
E9 512 0 Value Value is invalid
E10 1024 0 - -
E11 2048 0 Value Delta
12
Substation Automation MEAI_
4 Technical Data
Operation accuracy (SysAI input) The accuracy depends on the frequency of the measured
quantity
AC measurement, sensor input f/fn = 0.95...1.05: 1.0% of set value or 1.5mV
DC measurement, sensor input 3.0% of set value or 7mV
AC measurement, 4 - 20 mA input f/fn = 0.95...1.05: 3.0% of set value
DC measurement, 4 - 20 mA input 3.0% of set value
13
1MRS752338-MUM MEAO _
Issued: 3/2000
Version: A/30.1.2002
Analogue Output on
Data subject to change without notice
RTD/Analogue Module
Contents
1 Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 2
1.4 Output description ............................................................................... 2
2 Description of Operation.......................................................................... 3
2.1 Configuration....................................................................................... 3
2.2 General ............................................................................................... 3
2.3 Threshold supervision with integrator algorithm .................................. 4
3 Parameters................................................................................................ 5
3.1 General ............................................................................................... 5
3.2 Control settings ................................................................................... 5
3.3 Measurement values ........................................................................... 5
3.3.1 Output data ................................................................................ 5
1 Introduction
1.1 Features
User-defined scaling of the input data
Threshold detection with integrator algorithm for updating the value on the
RTD/analogue module
1.2 Application
This document specifies the function of the analogue output function blocks
MEAO1...MEAO4 that are identical in operation.
The analogue output function blocks can be used to generate a 4...20 mA or 0...20 mA
signal to an external device in such products based on the RED 500 Platform that are
equipped with an RTD/analogue module.
)LJXUH $VDQH[DPSOHWKHIXQFWLRQEORFNV\PERORI0($2
2
Substation Automation MEAO _
2 Description of Operation
2.1 Configuration
The input signal IN can be connected to any REAL type variable using the Relay
Configuration Tool.
The output signal OUT must be connected to the corresponding output variable of the
RTD/analogue module on the global variable sheet of the configuration tool.
2.2 General
The preferred output range, 0...20 mA or 4...20 mA, is selected via the parameter
Output range. The input is scaled to the selected output range with the parameters
Input high limit and Input low limit so that when the input value equals Input
low limit, the output value is 0 or 4 mA depending on which range is selected, and
when the input value equals Input high limit, the output value is 20 mA. The value
of the parameter Input low limit is allowed to be greater than the value of the
parameter Input high limit, which will cause the output to be inverted.
The output is, however, not limited to the selected output range, i.e. if the input value
is outside the range defined by the limit parameters, the output value will also be
outside the specified output range.
The maximum and minimum value of the physical output is defined by a separate
Output range parameter, found in the menu of the MMI or the Relay Setting Tool
under Configuration\RTD1\Output N\. The default value of the parameter is 0...20
mA, but it can also be set to 4...20 mA. The range of the physical output is limited to
this range so that whenever the value connected to the physical output is outside the
defined range, the physical output will be set to 0 or 20 mA, depending on which is
closer to the connected value (see the table below). The corresponding invalid signal
will be set to TRUE to indicate the situation. Note that the physical output is also
forced to zero when the connected output is below 4 mA and the 4...20 mA range is
selected, which can be used to indicate a fault to the receiver.
The output behaviour when the value attribute is outside the defined limits:
Output range Value of AO# Output current Invalidity
attribute AO#IV
020 mA >20 20 mA TRUE
0..20 0..20 mA FALSE
<0 0 mA TRUE
420 mA >20 20 mA TRUE
4..20 4..20 mA FALSE
<4 0 mA TRUE
3
MEAO _ Substation Automation
The function block calculates the difference between the last output value and the
scaled input value for each task cycle. The difference is added to the internal
accumulated (integrated) value register. If the accumulated delta exceeds the set
Threshold value, the output is set to the current scaled input value and the internal
accumulated value register is set to zero. Further output changes are then blocked for
a period of 400 ms.
20
Output value
15
10 Output value
Threshold cycle
(execution cycle)
+ Threshold value
Reference level
- Threshold value
Thsinte6
)LJXUH 2SHUDWLRQRIWKHWKUHVKROGVXSHUYLVLRQZLWKLQWHJUDWRUDOJRULWKP
4
Substation Automation MEAO _
3 Parameters
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel numbers are listed in the following table.
Function MEAO1 MEAO2 MEAO3 MEAO4
block
Channel 456 457 458 459
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
5
MEAO _ Substation Automation
4 Technical Data
Configuration data The task execution interval (Relay Configuration Tool):
40 ms at the rated frequency fn = 50 Hz
6
1MRS752339-MUM MECU1_
Issued: 10/1997
Version: E/30.1.2002
Neutral Current Measurement
Data subject to change without notice
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 3
2. Description of Operation.......................................................................... 4
2.1 Configuration....................................................................................... 4
2.2 Measuring mode ................................................................................. 4
2.3 Registers............................................................................................. 4
2.4 Actual neutral current measurement ................................................... 4
2.5 Maximum neutral current..................................................................... 4
2.6 Zero value supervision and zero value detection................................. 5
2.7 Threshold supervision with absolute threshold .................................... 5
2.8 Threshold supervision with integrator algorithm .................................. 5
2.9 Limit value supervision ........................................................................ 7
3. Parameters and events ............................................................................ 8
3.1 General ............................................................................................... 8
3.2 Control settings ................................................................................... 9
3.3 Measurement values ........................................................................... 9
3.3.1 Input data ................................................................................... 9
3.3.2 Recorded data.......................................................................... 10
3.3.3 Events ...................................................................................... 10
1. Introduction
1.1 Features
1.2 Application
This document specifies the functions of the neutral current measurement function
blocks MECU1A and MECU1B used in products based on the RED 500 Platform,
e.g. feeder terminals, in-feeder terminals, motor protection terminals and transformer
protection terminals. The function blocks are identical in operation.
)LJXUH )XQFWLRQEORFNV\PEROVRI0(&8$DQG0(&8%
2
Substation Automation MECU1_
3
MECU1_ Substation Automation
2.1 Configuration
The analogue channel number for the I0 input is selected by means of the Relay
Configuration Tool.
The function block measures the true RMS neutral current, i.e. harmonics are not
suppressed. Note that RMS measurement must be selected for the current inputs via
the Special Measurements dialogue of the configuration tool.
The current values are updated once a fundamental frequency cycle, i.e. the
integration time for the true RMS calculation is one fundamental cycle.
2.3 Registers
The maximum peak value of neutral current is recorded with date and time stamps.
The registers can be reset via the RESET input, or over the serial bus or the local
MMI.
Actual neutral current values are displayed in amperes and as p.u. values.
The maximum peak value of neutral current is recorded after the last reset of registers.
The maximum peak value is calculated by means of slightly filtered values of neutral
current. The maximum current value is cleared by resetting the register.
4
Substation Automation MECU1_
A neutral current below 0.5% In is forced to 0% In. This allows the noise in the input
current to be ignored. The zero value supervision is fixed to 0.5% In and is always
active.
The zero value detection function is used to force a neutral current value update if the
neutral current deviates slightly from zero or is zero. Zero value detection operates so
that once a neutral current passes (upwards or downwards) the limit 0.5% In, the new
neutral current value is spontaneously reported to the master device (MicroSCADA)
provided the threshold supervision with the absolute threshold method or the
integration method is in use (see the control parameter Threshold select).
Two different methods can be used for threshold supervision and the method to be
used is selected with the parameter Threshold select.
If the absolute threshold supervision is used, the function block compares the actual
neutral current value with the last reported value. If the actual value exceeds the last
reported value plus the set Threshold value or is below the last reported value
minus the set Threshold value, the actual value is spontaneously reported to the
master device and will replace the last reported value.
Current % In
40
30
Reported value
+ Threshold value
20
- Threshold value Reported value
10
Minimum
threshold
0.2 % In 0
Execution task cycle
)LJXUH 2SHUDWLRQRIWKUHVKROGVXSHUYLVLRQZLWKDEVROXWHWKUHVKROG
When threshold supervision with integrator algorithm is used, the function block
calculates the difference between the last reported neutral current value and the actual
value for each task cycle. The difference is added to the internal accumulated
(integrated) value register. If the accumulated delta exceeds the parameterized
Threshold value, the actual value is spontaneously reported to the master device.
5
MECU1_ Substation Automation
The actual value replaces the last reported value. The internal threshold difference
register is set to zero.
Current % In
Current value update Current value update
40
Reported value
30
20 Reported value
+ Threshold value
Reference level
- Threshold value
)LJXUH 2SHUDWLRQRIWKUHVKROGVXSHUYLVLRQZLWKLQWHJUDWRUDOJRULWKP
The threshold difference register is cleared if the accumulated current value exceeds
the set Threshold value.
6
Substation Automation MECU1_
For neutral current up to two different limits can be monitored. The parameter Limit
selection is used to specify the limits to be supervised and monitored. Each limit is
checked independently. If the current exceeds several limits within an execution task
cycle, each exceeding of limit is reported to the master device independently. The
hysteresis of each limit is fixed to 1% of the nominal value and taken into account as
shown below. Each exceeding of limit with a time stamp is stored with the FIFO
method. The warning and alarm limits can be changed on-line.
Current % In
(2)
(3)
Hysteresis
20
High alarm limit
(1)
(4)
18
High warn. limit
16
10
0
Outputs
High warning
High alarm
Curlimi3
)LJXUH 2SHUDWLRQRIOLPLWYDOXHPRQLWRULQJ
7
MECU1_ Substation Automation
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for MECU1A is 201 and that for MECU1B
203.
The data direction of the parameters defines the use of each parameter as follows:
Data Description
direction
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
8
Substation Automation MECU1_
9
MECU1_ Substation Automation
3.3.3 Events
E4 0 0 - -
E5 32 0 I0 Delta
10
Substation Automation MECU1_
Event reason and event state in the event table changed as follows (an example):
Event reason: I0 high warning I0
Event state: Reset High warning reset
11
1MRS752340-MUM MECU3_
Issued: 10/1997
Version: E/30.1.2002
Three-Phase Current Measurement
Data subject to change without notice
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 3
2. Description of Operation.......................................................................... 4
2.1 Configuration....................................................................................... 4
2.2 Measuring mode ................................................................................. 4
2.3 Registers............................................................................................. 4
2.4 Actual phase current measurement..................................................... 4
2.5 Maximum current demand................................................................... 5
2.6 Zero value supervision and zero value detection................................. 5
2.7 Threshold supervision with absolute threshold .................................... 6
2.8 Threshold supervision with integrator algorithm .................................. 7
2.9 Limit value supervision ........................................................................ 8
3. Parameters and Events ............................................................................ 9
3.1 General ............................................................................................... 9
3.2 Control settings ................................................................................. 10
3.3 Measurement values ......................................................................... 11
3.3.1 Input data ................................................................................. 11
3.3.2 Recorded data.......................................................................... 12
3.3.3 Events ...................................................................................... 13
1. Introduction
1.1 Features
1.2 Application
)LJXUH )XQFWLRQEORFNV\PEROVRI0(&8$DQG0(&8%
2
Substation Automation MECU3_
3
MECU3_ Substation Automation
2.1 Configuration
The analogue channel numbers for the corresponding IL1, IL2 and IL3 inputs are
selected by means of the Relay Configuration Tool. Two current inputs can also be
left unconnected. However, if all three current inputs are unconnected, the output
signal ERR is set to TRUE.
Conventional current transformers or Rogowski coils can be used for measuring the
phase currents. The function block automatically adapts its operation to the channels
and measuring devices selected in the configuration tool.
The function block measures the true RMS phase currents, i.e. harmonics are not
suppressed. Note that RMS measurement must be selected for the current inputs via
the Special Measurements dialogue of the configuration tool.
The current values are updated once a fundamental frequency cycle, i.e. the
integration time for the true RMS calculation is one fundamental cycle.
2.3 Registers
The maximum phase current demand for each phase with date and time stamps is
recorded.
The registers can be reset via the RESET input, or over the serial bus or the local
MMI.
Actual phase current values are displayed in amperes and as p.u. values. The
parameter Phase selection is used for selecting the phase currents to be measured. If
a phase current has not been selected, the actual current value will be zero and the
supervision functions are not executed on that particular phase.
4
Substation Automation MECU3_
If the new current demand value exceeds the maximum current demand value
recorded for that phase, the actual demand value will replace the maximum demand
value recorded. Maximum values are provided with date and time stamps.
A phase current below 1.0% In is forced to 0% In. This allows the noise in the input
current to be ignored. The zero value supervision is fixed to 1.0% In and is always
active.
The zero value detection function is used to force a phase current value update if the
phase current deviates slightly from zero or is zero. Zero value detection operates so
that once a phase current passes (upwards or downwards) the limit 1.0% In, the new
phase current value is spontaneously reported to the master device (MicroSCADA)
provided the threshold supervision with the absolute threshold method or the
integration method is in use (see the control parameter Threshold select).
5
MECU3_ Substation Automation
Two different methods can be used for threshold supervision and the method to be
used is selected with the parameter Threshold select.
If the absolute threshold supervision is used, the function block compares the actual
phase current value with the last reported value. If the actual value exceeds the last
reported value plus the set Threshold value or is below the last reported value
minus the set Threshold value, the actual value is spontaneously reported to the
master device and will replace the last reported value.
Current % In
40
30
Reported value
+ Threshold value
20
- Threshold value Reported value
10
Minimum
threshold
0.2 % In 0
Execution task cycle
)LJXUH 2SHUDWLRQRIWKUHVKROGVXSHUYLVLRQZLWKDEVROXWHWKUHVKROG
6
Substation Automation MECU3_
When threshold supervision with integrator algorithm is used, the function block
calculates the difference between the last reported phase current value and the actual
value for each task cycle. The difference is added to the internal accumulated
(integrated) value register. If the accumulated delta exceeds the parameterized
Threshold value, the actual value is spontaneously reported to the master device.
The actual value replaces the last reported value. The internal threshold difference
register is set to zero.
Current % In
Current value update Current value update
40
Reported value
30
20 Reported value
+ Threshold value
Reference level
- Threshold value
)LJXUH 2SHUDWLRQRIWKUHVKROGVXSHUYLVLRQZLWKLQWHJUDWRUDOJRULWKP
The threshold difference register is cleared if:
7
MECU3_ Substation Automation
For all three phase currents, up to four different limits can be monitored. The
parameter Limit selection is used to specify the limits to be supervised and
monitored. Each phase and limit is checked independently, which means that if a
phase current exceeds several limits during an execution task cycle, each exceeding of
limit will be reported to the master device independently. The hysteresis of each limit
is fixed to 1% of the nominal value and taken into account as shown below. Each
exceeding of limit with a time stamp is stored with the FIFO method. The outputs
HighWarning, HighAlarm, LowWarning and LowAlarm are activated as shown
below. The warning and alarm limits can be changed on-line.
Current % In
(2)
(3)
120 Hysteresis
High alarm limit
(1)
110 (4)
High warn. limit
100
60
50
(5)
(8)
40
Low warn. limit
(7)
(6)
30
Low alarm limit
20
10
High warning
Outputs
High alarm
Low warning
Low alarm
Curlim02
)LJXUH 2SHUDWLRQRIOLPLWYDOXHPRQLWRULQJ
8
Substation Automation MECU3_
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for MECU3A is 200 and that for MECU3B
202.
The data direction of the parameters defines the use of each parameter as follows:
Data Description
direction
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
9
MECU3_ Substation Automation
10
Substation Automation MECU3_
11
MECU3_ Substation Automation
IL1 maximum time V202 hh:mm:ss.000 - - R/M Time of IL1 max demand
IL1 maximum (A) V203 0.0...20000.0 A 0.0 R/M Maximum demand for IL1
in amperes
IL1 maximum (%) V204 0.0...1000.0 % In 0.0 R/M Maximum demand for IL1
in percent
IL2 maximum date V205 YYYY-MM-DD - - R/M Date of IL2 max demand
IL2 maximum time V206 hh:mm:ss.000 - - R/M Time of IL2 max demand
IL2 maximum (A) V207 0.0...20000.0 A 0.0 R/M Maximum demand for IL2
in amperes
IL2 maximum (%) V208 0.0...1000.0 % In 0.0 R/M Maximum demand for IL2
in percent
IL3 maximum date V209 YYYY-MM-DD - - R/M Date of IL3 max demand
IL3 maximum time V210 hh:mm:ss.000 - - R/M Time of IL3 max demand
IL3 maximum (A) V211 0.0...20000.0 A 0.0 R/M Maximum demand for IL3
in amperes
IL3 maximum (%) V212 0.0...1000.0 % In 0.0 R/M Maximum demand for IL3
in percent
12
Substation Automation MECU3_
3.3.3 Events
E24 0 0 - -
E26 0 0 - -
E28 0 0 - -
13
MECU3_ Substation Automation
Event reason and event state in the event table changed as follows (an
example):
Event reason: IL1 high warning IL1
Event state: Reset High warning reset
MECU3B A -
14
1MRS100225 RE_5_ _
Issued: 10/1998
Version: C
Transient Disturbance Recorder
Data subject to change without notice
(MEDREC16)
Contents
1. Introduction .............................................................................................. 3
1.1 Features.............................................................................................. 3
1.2 Application........................................................................................... 3
1.3 Input description.................................................................................. 5
1.4 Output description ............................................................................... 6
2. Description of Operation.......................................................................... 7
2.1 General ............................................................................................... 7
2.2 Configuration....................................................................................... 7
2.3 Setting the recorder identification ...................................................... 10
2.4 Selection of recorded analogue inputs .............................................. 10
2.5 Triggering alternatives....................................................................... 11
2.5.1 Triggering by digital inputs ....................................................... 11
2.5.2 Triggering by analogue inputs .................................................. 12
2.5.3 Manual triggering ..................................................................... 13
2.5.4 Periodic triggering .................................................................... 14
2.6 Length of recordings.......................................................................... 14
2.7 Sampling frequencies........................................................................ 15
2.8 Pre- and post-trigger data ................................................................. 15
2.9 Operation modes............................................................................... 15
2.9.1 Saturation mode....................................................................... 15
2.9.2 Overwrite mode........................................................................ 16
2.9.3 Extension mode ....................................................................... 16
2.10 Exclusion mode................................................................................. 17
2.11 Uploading .......................................................................................... 17
2.12 Resetting of recordings ..................................................................... 18
4. Technical Data.........................................................................................24
2
ABB Automation MEDREC16 RE_5_ _
1. Introduction
1.1 Features
1.2 Application
MEDREC16 is used for recording the current and voltage waveforms as well as the
status data of internal IEC 61131-3 -based logic signals and digital inputs connected
to the relay terminals. The maximum number of analogue inputs as well as that of
logic signals is 16.
3
RE_5_ _ MEDREC16 ABB Automation
)LJXUH )XQFWLRQEORFNV\PERORI0('5(&
4
ABB Automation MEDREC16 RE_5_ _
5
RE_5_ _ MEDREC16 ABB Automation
6
ABB Automation MEDREC16 RE_5_ _
2.1 General
The transient disturbance recorder MEDREC16 can record 16 signal types of the
analogue channels of the relay and the status values of digital input signals connected
to the inputs BI1...BI16. The analogue inputs are recorded as instantaneous values and
converted to primary peak value units1. The recordings can be uploaded with a
DR_Collector tool, which converts the data to a COMTRADE format (refer to section
Uploading).
1RWHThe signals of derivative sensors such as the Rogowski coil are sampled as
derivative signals as sampled originally by the relay.
The digital inputs are sampled once per task execution of the recorder. In the upload
program the latest digital values are repeated so that the analogue and digital samples
correspond to each other. The external digital signals are first sampled by the digital
I/O cards and the synchronisation with the analogue inputs depends on the filter time
of the digital inputs. If the filter time is approximately as long as the task interval, the
analogue values and external digital values will correspond to each other.
2.2 Configuration
The transient disturbance recorder is configured with the Relay Configuration Tool.
At the rated frequency of 50 Hz, the recorder can only be configured to the task
interval of 10 ms (at 60 Hz 8.33 ms), otherwise an error event E5 is sent.
Each of the 16 analogue inputs of the recorder has its own signal type that can be
connected to it. For example, only the signal IL1 can be connected to the IL1 input of
the recorder. If certain signal types are not present, the corresponding inputs are left
unconnected and these inputs are not recorded. Also a connected input can be left out
of the recording via the parameter AI chs used (see Selection of recorded analogue
inputs). The names of the analogue intputs are fixed, but they can be viewed via the
AI texts menu.
Any external or internal digital signals (type BOOL), such as the start and trip signals
from protection function blocks or the external digital inputs of the relay, can be
connected to the digital inputs. The digital outputs of the function blocks in the same
program can be connected directly to the inputs of the recorder, whereas the digital
outputs of the function blocks from other tasks are connected to the recorder by global
variables. It should be noted, however, that in some cases the use of global variables
will cause a delay to the signal. The delay will not be more than the task execution
1
In products with the revisions D and E of MEDREC16, signals from derivative sensors such
as Rogowski coil are recorded as derivative signals
7
RE_5_ _ MEDREC16 ABB Automation
interval of the slower one of the two tasks. Moreover, if a digital signal from a 5 ms
task is connected to the recorder, it should be ensured that the signal will stay active
for at least 10 ms. For example the protection function blocks provide pulse width
settings that can be used to set the minimum pulse widths of the start and trip outputs.
The standard logic functions (AND, OR, etc. ports) can be used to form any kind of
boolean functions from the digital signals. If a digital input is only used to trigger the
recorder, several digital inputs can be combined to one digital input, provided the
digital inputs are first connected via the R_TRIG function block and then combined
by the OR function (see Figure 2 below). This kind of connection preserves the rising
edges of the signals, so that the digital input configured to rising edge active can be
used to trigger the recorder.
)LJXUH &RPELQLQJVHYHUDOWULJJHULQJVRXUFHVWRRQHGLJLWDOLQSXW
The status values of all digital inputs are recorded, including those of the inputs not
connected. The information which inputs are actually connected is forwarded to the
upload program by writing a constant to the BI_USED input, the bits of which
indicate the digital inputs used. This value is seen directly in the parameter BI chs
used. The BI_USED input is 65535 by default, which indicates that all the digital
inputs are connected. The names of the digital inputs can be set in the BI texts menu
of the Relay Setting Tool.
8
ABB Automation MEDREC16 RE_5_ _
)LJXUH ([DPSOHRIWKHXVDJHRIWKH%,B86('LQSXW
EXT_TRG is a rising edge active external trigger input. The only difference between
a digital input which is set to rising edge active and EXT_TRG is that the EXT_TRG
input is not recorded. The push-button F on the front panel of the relay controls the
parameter F001V021, which is activated for a short time when the button is pressed
and can thus be used to trigger the recorder, provided the parameter is connected to
the EXT_TRG input.
The outputs of the recorder can be used to control the alarm indication LEDs of the
relay. For example, if the NUM_RECS output of the recorder is connected to the EQ
function, which is a standard function block that compares whether the inputs are
equal, and zero to another input of the EQ function, and the inverted output of EQ is
connected to a non-latched alarm indication LED control, the LED indicates whether
there are any recordings left in the recorder (see Figure 4 below).
)LJXUH ([DPSOHRIFRQILJXULQJWKHRXWSXWVRIWKHUHFRUGHUWRFRQWUROWKH
LQGLFDWLRQ/('VLQGLFDWLRQRIWKHH[LVWHQFHRIDUHFRUGLQJ
The function block sends a configuration error event E5 if the connected analogue
input is not correct or if the task interval is other than 10 ms. The operation of the
recorder is halted and the ERR ouput is activated in those cases.
9
RE_5_ _ MEDREC16 ABB Automation
The identification number and the textual name of the recorder can be set via the
parameters Identification and Main header (for example the station name) in the
General input menu. The main header can be 15 characters long. The header and the
identification number are included in the recording file produced by the upload
program (refer to section Uploading).
Each analogue input has its own signal type that can be connected to it. The recorded
inputs are selected by the bits of the parameter Al chs used (see table below). If the
input is not connected but the corresponding bit is set in the parameter, the bit is reset
immediately. By default, all the connected signals are recorded and the bits of the
parameter Al chs used indicate which inputs are connected. If the parameter is
changed, all the recordings in the memory are reset.
10
ABB Automation MEDREC16 RE_5_ _
The recording can be triggered by any (or several) of the alternatives listed below:
triggering on the rising or falling edge of any (or several) of the digital inputs
BI1...BI16
triggering on overcurrent, overvoltage or undervoltage
manual triggering via the menu or with the push-button F on the front panel (if
configured)
triggering via serial communication or via a parameter
periodic triggering
Regardless of the triggering type, each recording generates the event E31 and the
triggering time and reason are included in the recording.
The digital signals can be formed from the start, trip and block signals of the function
blocks with the relay configuration tool. A change in the status of a monitored signal
triggers the recorder according to the configuration and settings. Triggering on the
rising edge of a digital input signal means that the recording sequence starts when the
input signal is activated. Correspondingly, triggering on the falling edge means that
the recording sequence starts when the active input signal resets.
A digital input is used as a triggering source if the corresponding bit is set in the
parameter BI enable. An input is taken into use by adding the corresponding weight
factor to the parameter value. The bits of the parameter BI mode control the edge
activity of the triggering. If the bit is set, the input is rising edge active and if the bit is
zero, the input is falling edge active. The weight factors of the inputs for the
parameters BI enable and BI mode are given in the following table.
11
RE_5_ _ MEDREC16 ABB Automation
Note: Even though the signals of derivative sensors are recorded as derivatives, the
triggering limits are set as for actual signals.
12
ABB Automation MEDREC16 RE_5_ _
Inputs for which triggering Weight factors for the Setting parameter for
on overcurrent or parameter "Over lim. overcurrent or
overvoltage is active enab." overvoltage limit
IL1 1 Over limit ILx
IL2 2 Over limit ILx
IL3 4 Over limit ILx
Io 8 Over limit Io
Iob 16 Over limit Iob
Uo 32 Over limit Uo
U1 64 Over limit Ux
U2 128 Over limit Ux
U3 256 Over limit Ux
U12 512 Over limit Uxy
U23 1024 Over limit Uxy
U31 2048 Over limit Uxy
U12b 4096 Over limit U12b
IL1b 8192 Over limit ILxb
IL2b 16384 Over limit ILxb
IL3b 32768 Over limit ILxb
1)
Inputs for which triggering Weight factors for the Setting parameter for
on undervoltage is active parameter "Under lim. undervoltage limit
enab."
U1 64 Under limit Ux
U2 128 Under limit Ux
U3 256 Under limit Ux
U12 512 Under limit Uxy
U23 1024 Under limit Uxy
U31 2048 Under limit Uxy
1)
Other weight factors are ignored
The recorder can be triggered manually via the MMI or via serial communication by
setting the parameter Remote trigger to Trigger. The recorder may also be
triggered manually by pressing the push-button F on the front panel, provided the
parameter F001V021 has been connected to the EXT_TRG input of MEDREC16 with
the relay configuration tool (refer to section Configuration).
13
RE_5_ _ MEDREC16 ABB Automation
Periodic triggering means that the recorder automatically makes a recording at certain
time intervals. The interval can be adjusted with the parameter Periodic time. If the
value of the parameter is changed, the new setting takes effect when the next periodic
triggering occurs. Setting the parameter to zero disables the triggering alternative and
the setting becomes valid immediately. If a new non-zero setting is wanted to be valid
immediately, the parameter Periodic time should first be set to zero and then to the
new value. The time remaining to the next triggering can be monitored via the
parameter Time to trigger that counts downwards.
The length of a recording is defined with the parameter Record length. According to
the memory available and the number of inputs used, the function block determines
the possible number of recordings and reduces the defined length of a recording if
needed. The number of recordings is written to the parameter Max # records and the
validated length is updated to the parameter Record length. The fixed memory size
allocated for the recorder is 50 000 samples.
Nr = M / (L * Ns * Nc).
where
Nr Number of recordings
L Length of one recording in cycles (setting parameter)
Ns Number of samples in a cycle (= 40)
Nc Number of recorded analogue inputs (defined by the parameter AI chs
used)
M Amount of memory allocated for the recorder (= 50 000 samples)
For example the following combinations of length - number of recordings - number of
inputs are available (the given times are valid provided the rated frequency is 50 Hz):
# recordings \ # inputs 1 3 10
1 1066 cyc. 399 cyc. 125 cyc.
21.3 s 7.9 s 2.5 s
5 212 cyc. 79 cyc. 25 cyc.
4.2 s 1.5 s 0.5 s
10 106 cyc. 39 cyc. 12 cyc.
2.1 s 0.7 s 0.24 s
14
ABB Automation MEDREC16 RE_5_ _
The sampling frequency fs of the analogue inputs depends on the set rated frequency
fn so that one fundamental cycle always contains 40 samples. This means that the
sampling frequency is 2 kHz at the rated frequency of 50 Hz and 2.4 kHz at the rated
frequency of 60 Hz. Since the internal digital values are sampled once per task
execution and the task interval is fixed to 10 ms, the sampling frequency of digital
signals is 100 Hz.
The rated frequency fn of the relay or the feeder terminal is set via a dialogue box in
the relay configuration tool. Both the rated frequency and the sampling frequency can
be monitored via the General info menu.
The waveforms of analogue inputs are constantly recorded into the history memory of
the recorder. The duration of the data preceding the triggering, i.e. the so-called pre-
trigger time, is adjustable in percent via the parameter Pre-trg time. The duration of
the data following the triggering, i.e. the so-called post-trigger time, is the difference
between the recording length and the pre-trigger time. Changing the pre-trigger time
resets the history data and the current recording under collection.
)LJXUH 5HFRUGLQJPHPRU\XVDJHLQVDWXUDWLRQPRGH
15
RE_5_ _ MEDREC16 ABB Automation
When the operation mode is Overwrite and the recording memory is full, the oldest
recording will be overwritten by the pre-trigger data collected for the next recording
(see Figure 6 below). Thus the recorder can store one recording less in overwrite
mode than the Max # records parameter indicates. Each time a recording is
overwritten, the event E3 is generated. The overwrite mode is recommended if it is
more important to have the latest (newest) recordings in the memory. On the other
hand, the saturation mode is preferred when the oldest recordings are more important.
)LJXUH 5HFRUGLQJPHPRU\XVDJHLQRYHUZULWHPRGH
In the extension mode a new triggering during an on-going recording interrupts the
current recording and starts a new one. Accordingly, the former recording only
contains the pre-trigger samples of the first triggering and the post-trigger samples up
to the new triggering, whereas the new recording, which is called an extension to the
first one, includes the post-trigger samples after the new triggering. Consequently,
both the recordings will be shorter than the defined length, but all the samples
between the pre-trigger time before the first triggering and the post-trigger time after
the second triggering are covered by the two recordings. An extension recording is
made only provided there is room for a new recording. If the memory becomes full,
the last recording is always a full recording, i.e. it will not be interrupted by a new
triggering during the post-trigger data collection.
In other cases, i.e. when new triggerings do not occur during an on-going recording,
the operation in extension mode is similar to that in saturation mode (see Figure 7
below).
Unlike in extension mode, new triggerings are not allowed in the saturation or
overwrite mode before the previous recording is completed. However, if a new
triggering follows the previous recording before all the pre-trigger samples are
collected for the new recording, the triggering is accepted and the recording will be as
much shorter as there were pre-trigger samples lacking.
16
ABB Automation MEDREC16 RE_5_ _
The extension recordings are combined to the previous recordings by the upload
program.
)LJXUH 5HFRUGLQJPHPRU\XVDJHLQH[WHQVLRQPRGH
In the exclusion mode, which is on when the value of the control parameter
Exclusion time is >0, new triggerings are ignored if the triggering reason is the
same as in the previous recording. The parameter Exclusion time controls how long
the exclusion of the same type of triggerings is active after a triggering. The exclusion
mode only applies to the analogue and digital channel triggerings, not to periodic and
manual triggerings.
When the control parameter Exclusion time is zero, the exclusion mode is off and
there are no restrictions on the triggering types of successive recordings.
The remaining exclusion time can be monitored via the output parameter Exclusion
time in the Output data menu.
2.11 Uploading
The data of the disturbance recorder are uploaded with the DR-Collector Tool. The
program only sees the oldest data in the recorder and the data can be either uploaded
or deleted depending on the information included in the recording (see Figure 8
below). Accordingly, the older recording must be uploaded or deleted before the
newest recording can be read. The uploaded recording is valid even if the recorder is
reset during the upload process.
17
RE_5_ _ MEDREC16 ABB Automation
)LJXUH 5HFRUGLQJPHPRU\XVDJHGXULQJWKHXSORDGSURFHVV
The recorder can be reset by any (or several) of the methods listed below:
18
ABB Automation MEDREC16 RE_5_ _
3.1 General
Each function block has a specific channel number. The channel for MEDREC16
is 225.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Event masks) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
19
RE_5_ _ MEDREC16 ABB Automation
Record length M11 10...65535 cyc. 50 R/W Size of the recording memory in
cycles
Exclusion time V2 0...86 400 s 0 R/W Time how long triggerings for the
same reason are ignored
1)
Operation mode 0 = Saturation; 1 = Owerwrite; 2 = Extension
2)
Remote trigger 0 = No trigger; 1 = Trigger
3)
Reset memory 0 = No reset; 1 = Reset
Under lim. enab V9 0...65535 - 0 R/W Bit mask for analogue input
under limit triggering
AI filter time V20 0.000...60.000 s 0.050 R/W Filtering time for analogue
input limit triggerings
20
ABB Automation MEDREC16 RE_5_ _
Over limit Iob V12 0.00...40.00 x In 10.00 R/W Over limit for Iob
Over limit Ux V14 0.00...2.00 x Un 2.00 R/W Over limit for U1, U2 and U3
Over limit Uxy V15 0.00...2.00 x Un 2.00 R/W Over limit for U12, U23 and
U31
Over limit U12b V16 0.00...2.00 x Un 2.00 R/W Over limit for U12b
Over limit ILxb V17 0.00...40.00 x In 10.00 R/W Over limit for IL1b, IL2b and
IL3b
Under limit Ux V18 0.00...2.00 x Un 0.00 R/W Under limit for U1, U2 and U3
Under limit Uxy V19 0.00...2.00 x Un 0.00 R/W Under limit for U12, U23 and
U31
Main header M20 a 15-character - Default header R/W Main header for recordings
string
21
RE_5_ _ MEDREC16 ABB Automation
3.2.6 BI texts
Text of BI2 M41 a 15-character string - BI2 R/W Text of digital input BI2
Text of BI3 M42 a 15-character string - BI3 R/W Text of digital input BI3
Text of BI4 M43 a 15-character string - BI4 R/W Text of digital input BI4
Text of BI5 M44 a 15-character string - BI5 R/W Text of digital input BI5
Text of BI6 M45 a 15-character string - BI6 R/W Text of digital input BI6
Text of BI7 M46 a 15-character string - BI7 R/W Text of digital input BI7
Text of BI8 M47 a 15-character string - BI8 R/W Text of digital input BI8
Text of BI9 M48 a 15-character string - BI9 R/W Text of digital input BI9
Text of BI10 M49 a 15-character string - BI10 R/W Text of digital input BI10
Text of BI11 M50 a 15-character string - BI11 R/W Text of digital input BI11
Text of BI12 M51 a 15-character string - BI12 R/W Text of digital input BI12
Text of BI13 M52 a 15-character string - BI13 R/W Text of digital input BI13
Text of BI14 M53 a 15-character string - BI14 R/W Text of digital input BI14
Text of BI15 M54 a 15-character string - BI15 R/W Text of digital input BI15
Text of BI16 M55 a 15-character string - BI16 R/W Text of digital input BI16
3.2.7 AI texts
22
ABB Automation MEDREC16 RE_5_ _
3.3.2 Events
E3 8 1 Overwrite of recording On
E5 32 1 Configuration error On
23
RE_5_ _ MEDREC16 ABB Automation
Operation accuracies Analogue channel triggering level: 2.5% of set value or 0.01 x In
analogue signals 10 ms
E The Identification and Main header parameters in the menu General info and the
digital input names in the menu BI texts can be set via both the MMI and the Relay
Setting Tool, whereas in earlier revisions they could only be set via the Relay Setting Tool.
The conversion factor values, which were provided as background information in earlier
revisions, are no longer visible for the user.
F Signals from derivative sensors such as Rogowski coil are recorded as original signals
(not as derivatives as in earlier revisions of MEDREC16)
24
1MRS752341-MUM MEDREC16
Issued: 10/1998
Version: D/13.2.2002
Transient Disturbance Recorder
Data subject to change without notice
Contents
1. Introduction .............................................................................................. 3
1.1 Features.............................................................................................. 3
1.2 Application........................................................................................... 3
1.3 Input description.................................................................................. 5
1.4 Output description ............................................................................... 6
2. Description of Operation.......................................................................... 7
2.1 General ............................................................................................... 7
2.2 Configuration....................................................................................... 7
2.3 Setting the recorder identification ...................................................... 10
2.4 Selection of recorded analogue inputs .............................................. 10
2.5 Triggering alternatives....................................................................... 11
2.5.1 Triggering by digital inputs ....................................................... 11
2.5.2 Triggering by analogue inputs .................................................. 12
2.5.3 Manual triggering ..................................................................... 13
2.5.4 Periodic triggering .................................................................... 14
2.6 Length of recordings.......................................................................... 14
2.7 Sampling frequencies........................................................................ 15
2.8 Pre- and post-trigger data ................................................................. 15
2.9 Operation modes............................................................................... 15
2.9.1 Saturation mode....................................................................... 15
2.9.2 Overwrite mode........................................................................ 16
2.9.3 Extension mode ....................................................................... 16
2.10 Exclusion mode................................................................................. 17
2.11 Uploading .......................................................................................... 17
2.12 Resetting of recordings ..................................................................... 18
4. Technical Data.........................................................................................24
2
Substation Automation MEDREC16
1. Introduction
1.1 Features
1.2 Application
MEDREC16 is used for recording the current and voltage waveforms as well as the
status data of internal IEC 61131-3 -based logic signals and digital inputs connected
to the relay terminals. The maximum number of analogue inputs as well as that of
logic signals is 16.
3
MEDREC16 Substation Automation
)LJXUH )XQFWLRQEORFNV\PERORI0('5(&
4
Substation Automation MEDREC16
5
MEDREC16 Substation Automation
6
Substation Automation MEDREC16
2.1 General
The transient disturbance recorder MEDREC16 can record 16 signal types of the
analogue channels of the relay and the status values of digital input signals connected
to the inputs BI1...BI16. The analogue inputs are recorded as instantaneous values and
converted to primary peak value units1. The recordings can be uploaded with
a DR-Collector tool, which converts the data to a COMTRADE format (refer to
section Uploading).
The digital inputs are sampled once per task execution of the recorder. In the upload
program the latest digital values are repeated so that the analogue and digital samples
correspond to each other. The external digital signals are first sampled by the digital
I/O cards and the synchronisation with the analogue inputs depends on the filter time
of the digital inputs. If the filter time is approximately as long as the task interval, the
analogue values and external digital values will correspond to each other.
2.2 Configuration
The transient disturbance recorder is configured with the Relay Configuration Tool.
At the rated frequency of 50 Hz, the recorder can only be configured to the task
interval of 10 ms (at 60 Hz 8.33 ms), otherwise an error event E5 is sent.
Each of the 16 analogue inputs of the recorder has its own signal type that can be
connected to it. For example, only the signal IL1 can be connected to the IL1 input of
the recorder. If certain signal types are not present, the corresponding inputs are left
unconnected and these inputs are not recorded. Also a connected input can be left out
of the recording via the parameter AI chs used (see Selection of recorded analogue
inputs). The names of the analogue intputs are fixed, but they can be viewed via the
AI texts menu.
Any external or internal digital signals (type BOOL), such as the start and trip signals
from protection function blocks or the external digital inputs of the relay, can be
connected to the digital inputs. The digital outputs of the function blocks in the same
program can be connected directly to the inputs of the recorder, whereas the digital
outputs of the function blocks from other tasks are connected to the recorder by global
variables. It should be noted, however, that in some cases the use of global variables
will cause a delay to the signal. The delay will not be more than the task execution
interval of the slower one of the two tasks. Moreover, if a digital signal from a 5 ms
task is connected to the recorder, it should be ensured that the signal will stay active
1
In products with the revisions D and E of MEDREC16, signals from derivative sensors such
as Rogowski coil are recorded as derivative signals as sampled originally by the relay
7
MEDREC16 Substation Automation
for at least 10 ms. For example the protection function blocks provide pulse width
settings that can be used to set the minimum pulse widths of the start and trip outputs.
The standard logic functions (AND, OR, etc. ports) can be used to form any kind of
boolean functions from the digital signals. If a digital input is only used to trigger the
recorder, several digital inputs can be combined to one digital input, provided the
digital inputs are first connected via the R_TRIG function block and then combined
by the OR function (see Figure 2 below). This kind of connection preserves the rising
edges of the signals, so that the digital input configured to rising edge active can be
used to trigger the recorder.
)LJXUH &RPELQLQJVHYHUDOWULJJHULQJVRXUFHVWRRQHGLJLWDOLQSXW
The status values of all digital inputs are recorded, including those of the inputs not
connected. The information which inputs are actually connected is forwarded to the
upload program by writing a constant to the BI_USED input, the bits of which
indicate the digital inputs used. This value is seen directly in the parameter BI chs
used. The BI_USED input is 65535 by default, which indicates that all the digital
inputs are connected. The names of the digital inputs can be set in the BI texts menu
of the Relay Setting Tool.
8
Substation Automation MEDREC16
)LJXUH ([DPSOHRIWKHXVDJHRIWKH%,B86('LQSXW
EXT_TRG is a rising edge sensitive external trigger input. The only difference
between a digital input which is set to rising edge sensitive and EXT_TRG, is that the
EXT_TRG input is not recorded. The push-button F on the front panel of the relay
controls the parameter F001V021, which is activated for a short time when the button
is pressed and can thus be used to trigger the recorder, provided the parameter is
connected to the EXT_TRG input.
The outputs of the recorder can be used to control the alarm indication LEDs of the
relay. For example, if the NUM_RECS output of the recorder is connected to the EQ
function, which is a standard function block that compares whether the inputs are
equal, and zero to another input of the EQ function, and the inverted output of EQ is
connected to a non-latched alarm indication LED control, the LED indicates whether
there are any recordings left in the recorder (see Figure 4 below).
)LJXUH ([DPSOHRIFRQILJXULQJWKHRXWSXWVRIWKHUHFRUGHUWRFRQWUROWKH
LQGLFDWLRQ/('VLQGLFDWLRQRIWKHH[LVWHQFHRIDUHFRUGLQJ
The function block sends a configuration error event E5 if the connected analogue
input is not correct or if the task interval is other than 10 ms. The operation of the
recorder is halted and the ERR ouput is activated in those cases.
9
MEDREC16 Substation Automation
The identification number and the textual name of the recorder can be set via the
parameters Identification and Main header (for example the station name) in the
General input menu. The main header can be 15 characters long. The header and the
identification number are included in the recording file produced by the upload
program (refer to section Uploading).
Each analogue input has its own signal type that can be connected to it. The recorded
inputs are selected by the bits of the parameter Al chs used (see table below). If the
input is not connected but the corresponding bit is set in the parameter, the bit is reset
immediately. By default, all the connected signals are recorded and the bits of the
parameter Al chs used indicate which inputs are connected. If the parameter is
changed, all the recordings in the memory are reset.
10
Substation Automation MEDREC16
The recording can be triggered by any (or several) of the alternatives listed below:
triggering on the rising or falling edge of any (or several) of the digital inputs
BI1...BI16
triggering on overcurrent, overvoltage or undervoltage
manual triggering via the menu or with the push-button F on the front panel (if
configured)
triggering via serial communication or via a parameter
periodic triggering
Regardless of the triggering type, each recording generates the event E31 and the
triggering time and reason are included in the recording.
The digital signals can be formed from the start, trip and block signals of the function
blocks with the relay configuration tool. A change in the status of a monitored signal
triggers the recorder according to the configuration and settings. Triggering on the
rising edge of a digital input signal means that the recording sequence starts when the
input signal is activated. Correspondingly, triggering on the falling edge means that
the recording sequence starts when the active input signal resets.
A digital input is used as a triggering source if the corresponding bit is set in the
parameter BI enable. An input is taken into use by adding the corresponding weight
factor to the parameter value. The bits of the parameter BI mode control the edge
activity of the triggering. If the bit is set, the input is rising edge active and if the bit is
zero, the input is falling edge active. The weight factors of the inputs for the
parameters BI enable and BI mode are given in the following table.
11
MEDREC16 Substation Automation
12
Substation Automation MEDREC16
Inputs for which triggering Weight factors for the Setting parameter for
on overcurrent or parameter "Over lim. overcurrent or
overvoltage is active enab." overvoltage limit
IL1 1 Over limit ILx
IL2 2 Over limit ILx
IL3 4 Over limit ILx
Io 8 Over limit Io
Iob 16 Over limit Iob
Uo 32 Over limit Uo
U1 64 Over limit Ux
U2 128 Over limit Ux
U3 256 Over limit Ux
U12 512 Over limit Uxy
U23 1024 Over limit Uxy
U31 2048 Over limit Uxy
U12b 4096 Over limit U12b
IL1b 8192 Over limit ILxb
IL2b 16384 Over limit ILxb
IL3b 32768 Over limit ILxb
1)
Inputs for which triggering Weight factors for the Setting parameter for
on undervoltage is active parameter "Under lim. undervoltage limit
enab."
U1 64 Under limit Ux
U2 128 Under limit Ux
U3 256 Under limit Ux
U12 512 Under limit Uxy
U23 1024 Under limit Uxy
U31 2048 Under limit Uxy
1)
Other weight factors are ignored
The recorder can be triggered manually via the MMI or via serial communication by
setting the parameter Remote trigger to Trigger. The recorder may also be
triggered manually by pressing the push-button F on the front panel, provided the
parameter F001V021 has been connected to the EXT_TRG input of MEDREC16 with
the relay configuration tool (refer to section Configuration).
13
MEDREC16 Substation Automation
Periodic triggering means that the recorder automatically makes a recording at certain
time intervals. The interval can be adjusted with the parameter Periodic time. If the
value of the parameter is changed, the new setting takes effect when the next periodic
triggering occurs. Setting the parameter to zero disables the triggering alternative and
the setting becomes valid immediately. If a new non-zero setting is wanted to be valid
immediately, the parameter Periodic time should first be set to zero and then to the
new value. The time remaining to the next triggering can be monitored via the
parameter Time to trigger that counts downwards.
The length of a recording is defined with the parameter Record length. According to
the memory available and the number of inputs used, the function block determines
the possible number of recordings and reduces the defined length of a recording if
needed. The number of recordings is written to the parameter Max # records and the
validated length is updated to the parameter Record length. The fixed memory size
allocated for the recorder is 100 kB, matching about 50 000 samples.
where
Nr Number of recordings
L Length of one recording in cycles (setting parameter)
NC Number of recorded analogue inputs (defined by the parameter AI chs
used)
Ns Number of bytes in a cycle (= 80)
NB Number of bytes for binary signals in a cycle (= 8)
NH Size of header information per recording in bytes (= 56)
M Amount of memory allocated for the recorder (= 100 kB)
For example the following combinations of length - number of recordings - number of
inputs are available (the given times are valid provided the rated frequency is 50 Hz):
# recordings \ # inputs 1 3 10
1 1163 cyc. 412 cyc. 126 cyc.
23.2 s 8.2 s 2.5 s
5 232 cyc. 82 cyc. 25 cyc.
4.6 s 1.6 s 0.5 s
10 115 cyc. 41 cyc. 12 cyc.
2.3 s 0.8 s 0.24 s
14
Substation Automation MEDREC16
The sampling frequency fs of the analogue inputs depends on the set rated frequency
fn so that one fundamental cycle always contains 40 samples. This means that the
sampling frequency is 2 kHz at the rated frequency of 50 Hz and 2.4 kHz at the rated
frequency of 60 Hz. Since the internal digital values are sampled once per task
execution and the task interval is fixed to 10 ms, the sampling frequency of digital
signals is 100 Hz.
The rated frequency fn of the relay or the feeder terminal is set via a dialogue box in
the relay configuration tool. Both the rated frequency and the sampling frequency can
be monitored via the General info menu.
The waveforms of analogue inputs are constantly recorded into the history memory of
the recorder. The duration of the data preceding the triggering, i.e. the so-called pre-
trigger time, is adjustable in percent via the parameter Pre-trg time. The duration of
the data following the triggering, i.e. the so-called post-trigger time, is the difference
between the recording length and the pre-trigger time. Changing the pre-trigger time
resets the history data and the current recording under collection.
)LJXUH 5HFRUGLQJPHPRU\XVDJHLQVDWXUDWLRQPRGH
15
MEDREC16 Substation Automation
When the operation mode is Overwrite and the recording memory is full, the oldest
recording will be overwritten by the pre-trigger data collected for the next recording
(see Figure 6 below). Thus the recorder can store one recording less in overwrite
mode than the Max # records parameter indicates. Each time a recording is
overwritten, the event E3 is generated. The overwrite mode is recommended if it is
more important to have the latest (newest) recordings in the memory. On the other
hand, the saturation mode is preferred when the oldest recordings are more important.
)LJXUH 5HFRUGLQJPHPRU\XVDJHLQRYHUZULWHPRGH
In the extension mode a new triggering during an on-going recording interrupts the
current recording and starts a new one. Accordingly, the former recording only
contains the pre-trigger samples of the first triggering and the post-trigger samples up
to the new triggering, whereas the new recording, which is called an extension to the
first one, includes the post-trigger samples after the new triggering. Consequently,
both the recordings will be shorter than the defined length, but all the samples
between the pre-trigger time before the first triggering and the post-trigger time after
the second triggering are covered by the two recordings. An extension recording is
made only provided there is room for a new recording. If the memory becomes full,
the last recording is always a full recording, i.e. it will not be interrupted by a new
triggering during the post-trigger data collection.
In other cases, i.e. when new triggerings do not occur during an on-going recording,
the operation in extension mode is similar to that in saturation mode (see Figure 7
below).
Unlike in extension mode, new triggerings are not allowed in the saturation or
overwrite mode before the previous recording is completed. However, if a new
triggering follows the previous recording before all the pre-trigger samples are
collected for the new recording, the triggering is accepted and the recording will be as
much shorter as there were pre-trigger samples lacking.
16
Substation Automation MEDREC16
The extension recordings are combined to the previous recordings by the upload
program.
)LJXUH 5HFRUGLQJPHPRU\XVDJHLQH[WHQVLRQPRGH
In the exclusion mode, which is on when the value of the control parameter
Exclusion time is >0, new triggerings are ignored if the triggering reason is the
same as in the previous recording. The parameter Exclusion time controls how long
the exclusion of the same type of triggerings is active after a triggering. The exclusion
mode only applies to the analogue and digital channel triggerings, not to periodic and
manual triggerings.
When the control parameter Exclusion time is zero, the exclusion mode is off and
there are no restrictions on the triggering types of successive recordings.
The remaining exclusion time can be monitored via the output parameter Exclusion
time in the Output data menu.
2.11 Uploading
The data of the disturbance recorder are uploaded with the DR-Collector Tool. The
program only sees the oldest data in the recorder and the data can be either uploaded
or deleted depending on the information included in the recording (see Figure 8
below). Accordingly, the older recording must be uploaded or deleted before the
newest recording can be read. The uploaded recording is valid even if the recorder is
reset during the upload process. Please refer to DR-Collector Tool, Operators
Manual (1MRS751869-MUM) for more information about the tool.
17
MEDREC16 Substation Automation
)LJXUH 5HFRUGLQJPHPRU\XVDJHGXULQJWKHXSORDGSURFHVV
The recorder can be reset by any (or several) of the methods listed below:
18
Substation Automation MEDREC16
3.1 General
Each function block has a specific channel number. The channel for MEDREC16
is 225.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Event masks) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
19
MEDREC16 Substation Automation
Record length M11 10...65535 cyc. 50 R/W Size of the recording memory in
cycles
Exclusion time V2 0...86 400 s 0 R/W Time how long triggerings for the
same reason are ignored
1)
Operation mode 0 = Saturation; 1 = Overwrite; 2 = Extension
2)
Remote trigger 0 = No trigger; 1 = Trigger
3)
Reset memory 0 = No reset; 1 = Reset
Under lim. enab V9 0...65535 - 0 R/W Bit mask for analogue input
under limit triggering
AI filter time V20 0.000...60.000 s 0.050 R/W Filtering time for analogue
input limit triggerings
20
Substation Automation MEDREC16
Over limit Iob V12 0.00...40.00 x In 10.00 R/W Over limit for Iob
Over limit Ux V14 0.00...2.00 x Un 2.00 R/W Over limit for U1, U2 and U3
Over limit Uxy V15 0.00...2.00 x Un 2.00 R/W Over limit for U12, U23 and
U31
Over limit U12b V16 0.00...2.00 x Un 2.00 R/W Over limit for U12b
Over limit ILxb V17 0.00...40.00 x In 10.00 R/W Over limit for IL1b, IL2b and
IL3b
Under limit Ux V18 0.00...2.00 x Un 0.00 R/W Under limit for U1, U2 and U3
Under limit Uxy V19 0.00...2.00 x Un 0.00 R/W Under limit for U12, U23 and
U31
Event mask 2 V103 0... 2147483691 - 2147483691 R/W Event mask 2 for
event transmission
Event mask 3 V105 0... 2147483691 - 2147483691 R/W Event mask 3 for
event transmission
Event mask 4 V107 0... 2147483691 - 2147483691 R/W Event mask 4 for
event transmission
Main header M20 a 15-character - Default header R/W Main header for recordings
string
21
MEDREC16 Substation Automation
3.2.6 BI texts
Text of BI2 M41 a 15-character string - BI2 R/W Text of digital input BI2
Text of BI3 M42 a 15-character string - BI3 R/W Text of digital input BI3
Text of BI4 M43 a 15-character string - BI4 R/W Text of digital input BI4
Text of BI5 M44 a 15-character string - BI5 R/W Text of digital input BI5
Text of BI6 M45 a 15-character string - BI6 R/W Text of digital input BI6
Text of BI7 M46 a 15-character string - BI7 R/W Text of digital input BI7
Text of BI8 M47 a 15-character string - BI8 R/W Text of digital input BI8
Text of BI9 M48 a 15-character string - BI9 R/W Text of digital input BI9
Text of BI10 M49 a 15-character string - BI10 R/W Text of digital input BI10
Text of BI11 M50 a 15-character string - BI11 R/W Text of digital input BI11
Text of BI12 M51 a 15-character string - BI12 R/W Text of digital input BI12
Text of BI13 M52 a 15-character string - BI13 R/W Text of digital input BI13
Text of BI14 M53 a 15-character string - BI14 R/W Text of digital input BI14
Text of BI15 M54 a 15-character string - BI15 R/W Text of digital input BI15
Text of BI16 M55 a 15-character string - BI16 R/W Text of digital input BI16
3.2.7 AI texts
22
Substation Automation MEDREC16
3.3.2 Events
E3 8 1 Overwrite of recording On
E5 32 1 Configuration error On
23
MEDREC16 Substation Automation
Operation accuracies Analogue channel triggering level: 2.5% of set value or 0.01 x In
analogue signals 10 ms
E The Identification and Main header parameters in the menu General info and the
digital input names in the menu BI texts can be set via both the MMI and the Relay
Setting Tool, whereas in earlier revisions they could only be set via the Relay Setting Tool.
The conversion factor values, which were provided as background information in earlier
revisions, are no longer visible for the user.
F Signals from derivative sensors such as Rogowski coil are recorded as original signals
(not as derivatives as in earlier revisions of MEDREC16)
G -
24
1MRS752342-MUM MEFR1
Issued: 10/1997
Version: E/30.1.2002
System Frequency Measurement
Data subject to change without notice
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 3
2. Description of Operation.......................................................................... 4
2.1 Configuration....................................................................................... 4
2.2 Measuring mode ................................................................................. 4
2.3 Registers............................................................................................. 4
2.4 Actual frequency measurement........................................................... 4
2.5 Maximum and minimum average frequency ........................................ 5
2.6 Zero value supervision, zero value detection and undervoltage
blocking............................................................................................... 5
2.7 Threshold supervision with absolute threshold .................................... 6
2.8 Threshold supervision with integrator algorithm .................................. 7
2.9 Limit value supervision ........................................................................ 8
1. Introduction
1.1 Features
1.2 Application
This document specifies the function of the system frequency measurement function
block MEFR1 used in products based on the RED 500 Platform, e.g. feeder terminals,
in-feeder terminals, motor protection terminals and transformer protection terminals.
)LJXUH )XQFWLRQEORFNV\PERORI0()5
2
Substation Automation MEFR1
3
MEFR1 Substation Automation
2.1 Configuration
The analogue channel number for the corresponding U input is selected by means of
the Relay Configuration Tool.
The frequency measurement for the voltage input is selected via a special dialogue
box in the Relay Configuration Tool.
2.3 Registers
4
Substation Automation MEFR1
If the new average frequency value exceeds the maximum average frequency, the
actual average value will replace the maximum average value recorded. Should the
new frequency average be smaller than the minimum average recorded, the actual
average value will replace the recorded minimum average. Maximum and minimum
values are provided with date and time stamps.
Maximum and minimum values are cleared when the registers are reset.
A frequency below 10 Hz is forced to 0 Hz. This allows the noise in the input voltage
to be ignored and is needed because the lowest frequency of the measuring range is 10
Hz. The zero value supervision is fixed to 10 Hz and it is always active. The
frequency measurement is also forced to 0 Hz in an undervoltage situation. The
undervoltage limit value is set according to the requirements of the application
(parameter Voltage limit).
The zero value detection function is used to force a frequency value update if it
deviates less than 10 Hz from zero or is zero. Zero value detection operates so that
once a frequency passes (upwards or downwards) the limit 10 Hz, the new frequency
value is spontaneously reported to the master device (MicroSCADA) if the threshold
supervision with the absolute threshold method or the integration method is in use
(see the control parameter Threshold select).
5
MEFR1 Substation Automation
Two different methods can be used for threshold supervision and the method to be
used is selected with the parameter Threshold select.
If the absolute threshold supervision is used, the function block compares the actual
phase current value with the last reported value. If the actual value exceeds the last
reported value plus the set Threshold value or is below the last reported value
minus the set Threshold value, the actual value is spontaneously reported to the
master device and will replace the last reported value.
Frequency / Hz
51
50
Reported value
+ T hreshold value
49
- Threshold value Reported value
48
0
Execution task cycle
)LJXUH 2SHUDWLRQRIWKUHVKROGVXSHUYLVLRQZLWKDEVROXWHWKUHVKROG
6
Substation Automation MEFR1
When threshold supervision with integrator algorithm is used, the function block
calculates the difference between the last reported system frequency value and the
actual value for each task cycle. The difference is added to the internal accumulated
(integrated) value register. If the accumulated deltas exceed the parameterized
Threshold value, the actual value is spontaneously reported to the master device.
The actual value replaces the last reported value. The internal threshold difference
register is set to zero.
Frequency / Hz
Frequency value update Frequency value update
52
Reported value
51
50 Reported value
0
Execution task cycle
+ Threshold value
Reference level
- Threshold value
)LJXUH 2SHUDWLRQRIWKUHVKROGVXSHUYLVLRQZLWKLQWHJUDWRUDOJRULWKP
The threshold difference register is cleared if:
7
MEFR1 Substation Automation
For the system frequency, up to four different limits can be monitored. The parameter
Limit selection is used to specify the limits to be supervised and monitored. Each
limit is checked independently, which means that if a frequency exceeds several limits
during an execution task cycle, each exceeding of limit is reported to the master
device independently. The hysteresis of each limit is fixed to 0,01 Hz and taken into
account as shown below. Each exceeding of limit is stored with a time stamp with the
FIFO method. The warning and alarm limits can be changed on-line.
Frequency
(2)
(3)
Hysteresis
High alarm limit
(1)
(4)
High warn. limit
(5)
(8)
High warning
Outputs
High alarm
Low warning
Low alarm
Frelim02
)LJXUH 2SHUDWLRQRIOLPLWYDOXHPRQLWRULQJ
8
Substation Automation MEFR1
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for MEFR1 is 208.
The data direction of the parameters defines the use of each parameter as follows:
Data Description
direction
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
9
MEFR1 Substation Automation
10
Substation Automation MEFR1
3.3.3 Events
E8 0 0 - -
11
MEFR1 Substation Automation
Event reason and event state in the event table changed as follows (an example):
Event reason: Frequency high warning Frequency
Event state: Reset High warning reset
12
1MRS100207 RE_5_ _
Issued: 10/1997
Version: E
Three-Phase Power and Energy
Data subject to change without notice
Measurement
(MEPE7)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 3
2. Description of Operation.......................................................................... 4
2.1 Configuration....................................................................................... 4
2.1.1 Analogue input selection for configuration.................................. 4
2.2 Measuring mode ................................................................................. 5
2.3 Registers............................................................................................. 5
2.4 Actual load measurements .................................................................. 6
2.5 Maximum active and reactive power demand...................................... 7
2.6 Active and reactive energy .................................................................. 7
2.7 Zero value supervision and zero value detection................................. 7
2.8 Threshold supervision ......................................................................... 7
2.8.1 Threshold supervision with absolute threshold ........................... 8
2.8.2 Threshold supervision with integrator algorithm ......................... 8
2.8.3 Threshold supervision with time-based function ......................... 9
2.9 Limit value supervision ...................................................................... 10
3. Parameters and Events .......................................................................... 11
1. Introduction
1.1 Features
1.2 Application
This document specifies the function of the three-phase power and energy
measurement function block MEPE7 used in products based on the RED 500
Platform, e.g. feeder terminals, in-feeder terminals, motor protection terminals and
transformer protection terminals.
2
ABB Automation MEPE7 RE_5_ _
)LJXUH )XQFWLRQEORFNV\PERORI0(3(
3
RE_5_ _ MEPE7 ABB Automation
2.1 Configuration
The analogue inputs are configured in the Relay Configuration Tool. A special
dialogue box in the configuration tool is also used for selecting the analogue input
combination for power and energy measurement.
Note that RMS measurement must be selected for MEPE7 via the Special
Measurements dialogue of the configuration tool.
The following analogue input combinations are available in the dialogue box of the
configuration tool. It is important to notice that three-phase power is accurately
measured in situations of asymmetry only when all the phase currents and phase
voltages are known. The correct input combination is selected via the configuration
tool.
U12, U23, U0 and IL1, IL2, IL3 Three-phase power in situations of symmetry and asymmetry
U23, U31, U0 and IL1, IL2, IL3 Three-phase power in situations of symmetry and asymmetry
U12, U31, U0 and IL1, IL2, IL3 Three-phase power in situations of symmetry and asymmetry
U12, U23 and IL1, IL2, IL3 Aron power; phase currents are assumed to be symmetric (i.e. I0 = 0)
U23, U31 and IL1, IL2, IL3 Aron power; phase currents are assumed to be symmetric (i.e. I0 = 0)
U12, U31 and IL1, IL2, IL3 Aron power; phase currents are assumed to be symmetric (i.e. I0 = 0)
U12 and IL3 Phase currents and voltages are assumed to be symmetric
U23 and IL1 Phase currents and voltages are assumed to be symmetric
U31 and IL2 Phase currents and voltages are assumed to be symmetric
4
ABB Automation MEPE7 RE_5_ _
The function block measures the true RMS and fundamental frequency currents and
voltages.
The available analogue channel combinations are shown in the dialogue box of the
Relay Configuration Tool (Figure 2).
)LJXUH $YDLODEOHDQDORJXHFKDQQHOFRPELQDWLRQVLQWKH5HOD\&RQILJXUDWLRQ7RRO
The suppression of harmonics for the fundamental frequency measurement is at least
-50 dB at the frequencies f = n x fn, where n = 2, 3, 4, 5,... and fn is the rated
frequency.
2.3 Registers
maximum three-phase active and reactive power demand with date and time
stamps
accumulated three-phase active and reactive energy, forward and reversed
the 50 last three-phase energy values, forward and reversed; each value is
integrated over a settable time interval
The user can reset the registers via the RESET input, or over the serial bus or the local
MMI. When the measurement view is selected and there are no active indications, the
accumulated energy measurements can be reset by pressing the C button for 5 s.
5
RE_5_ _ MEPE7 ABB Automation
D
S
S1
)LJXUH 7KUHHGLPHQVLRQDOSRZHUWULDQJOH
Explanations to Figure 3:
S = P 2 + Q 2 +D 2 = URMSIRMS
P P
cos() = =
S1 P +Q 2
2
The power factor (PF) is calculated on the basis of total apparent power:
P
PF =
S
6
ABB Automation MEPE7 RE_5_ _
If the new demand power value exceeds the maximum demand value recorded for
three-phase power, the actual demand value will replace the maximum demand value
recorded. Maximum values are provided with date and time stamps.
The function block calculates active and reactive energy by integrating the measured
active and reactive power values over a settable time interval, starting daily at 00.00.
The user defines the interval, i.e. how the 1440 minutes per day are divided, with the
parameter Energy interval. Each new demand value is obtained at the end of the
corresponding time interval. The latest 50 values of active and reactive energy are
available. Accumulated energy values are derived for wye-connected VTs and VDs,
and delta-connected VTs.
The zero value supervision function forces an active or reactive power value below
3 x 0.2% x Un x In to 0. This allows the noise in the input voltage to be ignored. The
function is fixed to 3 x 0.2% x Un x In and it is always active.
The zero value detection function forces a value update if the three-phase active or
reactive power deviates slightly from zero or is zero. Once the active or reactive
power passes (upwards or downwards) the limit 3 x 0.2% x Un x In, the new phase
current value is spontaneously reported to the master device (MicroSCADA). The
function is active when threshold supervision with the absolute threshold method or
the integration method is in use (see the control parameter Threshold select).
Three different methods can be used for the threshold supervision (also known as
delta supervision) and the parameter Threshold select is used for selecting the
method to be used. The methods are absolute, integrated and time based.
7
RE_5_ _ MEPE7 ABB Automation
In absolute threshold supervision, the function block compares the actual values of
three-phase active and reactive power with the last reported values. If the actual value
exceeds the last reported value plus the set Threshold value, or is below the last
reported value minus the set Threshold value, the actual value is spontaneously
reported to the master device and will replace the last reported value.
Three-phase power
Reported value
+ Threshold value
- Threshold value Reported value
Minimum
threshold
0
Execution task cycle
)LJXUH 2SHUDWLRQRIWKUHVKROGVXSHUYLVLRQZLWKDEVROXWHWKUHVKROG
In threshold supervision with integrator algorithm, the function block calculates the
difference between the last reported voltage value and the actual value for each task
cycle. The difference is added to the internal accumulated (integrated) value register.
If the accumulated deltas exceed the set Threshold value, the actual value is
spontaneously reported to the master device and will replace the last reported value.
The internal threshold difference register is set to zero.
8
ABB Automation MEPE7 RE_5_ _
Three-phase power
Power value update Power value update
Reported value
Reported value
Minimum
threshold
0
Execution task cycle
+ Threshold value x
Time interval
Reference level
- Threshold value x
Time interval
Thsinte5
)LJXUH 2SHUDWLRQRIWKUHVKROGVXSHUYLVLRQZLWKLQWHJUDWRUDOJRULWKP
The threshold difference register is cleared if:
Example 1:
Measurement value has changed 1% after the last sent measurement value
Threshold value = 1% and Time interval = 1s new measurement value is sent after
1 second
Example 2:
Measurement value has changed 1% after the last sent measurement value
Threshold value = 1% and Time interval = 2s new measurement value is sent after
2 seconds
Example 3:
Measurement value has changed 2% after the last sent measurement value
Threshold value = 10% and Time interval = 2s new measurement value is sent
after 10 seconds
If the time-based threshold supervision is used, the function block sends the values to
the master device at intervals selected with the control parameter Time interval.
9
RE_5_ _ MEPE7 ABB Automation
The limit value supervision function monitors up to four different limits for both
three-phase active power and three-phase reactive power. The user specifies the
warning and alarm limits to be supervised and monitored with the parameter Limit
selection. The limits can also be changed on-line.
The function checks each limit independently, which means that if the active or
reactive power exceeds several limits during a task execution cycle, each exceeding of
limit is reported to the master device independently. The hysteresis of each limit is
fixed to 1% of the nominal value (Un In) and taken into account as shown below. Each
exceeding of limit with a time stamp is stored with the FIFO method.
Three-phase power
(2)
(3)
Hysteresis
High alarm limit
(1)
(4)
High warn. limit
(5)
(8)
High warning
Outputs
High alarm
Low warning
Low alarm Powlimi2
)LJXUH 2SHUDWLRQRIOLPLWYDOXHPRQLWRULQJ
10
ABB Automation MEPE7 RE_5_ _
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for MEPE7 is 207.
The data direction of the parameters defines the use of each parameter as follows:
Data Description
direction
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
11
RE_5_ _ MEPE7 ABB Automation
P3 high alarm V10 -999999...999999 kW 0 R/W High alarm limit value for active
power
P3 low warning V11 -999999...999999 kW 0 R/W Low warning limit value for
active power
P3 low alarm V12 -999999...999999 kW 0 R/W Low alarm limit value for active
power
Q3 high warning V13 -999999...999999 kvar 0 R/W High warning limit value for
reactive power
Q3 high alarm V14 -999999...999999 kvar 0 R/W High alarm limit value for
reactive power
Q3 low warning V15 -999999...999999 kvar 0 R/W Low warning limit value for
reactive power
Q3 low alarm V16 -999999...999999 kvar 0 R/W Low alarm limit value for
reactive power
12
ABB Automation MEPE7 RE_5_ _
13
RE_5_ _ MEPE7 ABB Automation
14
ABB Automation MEPE7 RE_5_ _
15
RE_5_ _ MEPE7 ABB Automation
3.3.3 Events
E16 0 0 - -
E18 0 0 - -
E20 0 0 - -
E22 0 0 - -
E24 0 0 - -
E26 0 0 - -
E28 0 0 - -
E30 0 0 - -
16
ABB Automation MEPE7 RE_5_ _
C Event reason and event state in the event table changed as follows (an example):
- Event reason: P3 high warning P3
- Event state: Reset High warning reset
Events E20E31 added: total power S, power factor DPF and energy measurement
17
1MRS752343-MUM MEPE7
Issued: 10/1997
Version: F/21.2.2002
Three-Phase Power and Energy
Data subject to change without notice
Measurement
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 3
2. Description of Operation.......................................................................... 4
2.1 Configuration....................................................................................... 4
2.1.1 Analogue input selection for configuration.................................. 4
2.2 Measuring mode ................................................................................. 5
2.3 Registers............................................................................................. 5
2.4 Actual load measurements .................................................................. 6
2.5 Maximum active and reactive power demand...................................... 7
2.6 Active and reactive energy .................................................................. 7
2.7 Zero value supervision and zero value detection................................. 7
2.8 Threshold supervision ......................................................................... 7
2.8.1 Threshold supervision with absolute threshold ........................... 8
2.8.2 Threshold supervision with integrator algorithm ......................... 8
2.8.3 Threshold supervision with time-based function ......................... 9
2.9 Limit value supervision ...................................................................... 10
3. Parameters and Events .......................................................................... 11
1. Introduction
1.1 Features
1.2 Application
This document specifies the function of the three-phase power and energy
measurement function block MEPE7 used in products based on the RED 500
Platform, e.g. feeder terminals, in-feeder terminals and motor protection terminals.
2
Substation Automation MEPE7
)LJXUH )XQFWLRQEORFNV\PERORI0(3(
3
MEPE7 Substation Automation
2.1 Configuration
The analogue inputs are configured in the Relay Configuration Tool. A special
dialogue box in the configuration tool is also used for selecting the analogue input
combination for power and energy measurement.
Note that RMS measurement must be selected for MEPE7 via the Special
Measurements dialogue of the configuration tool.
The following analogue input combinations are available in the dialogue box of the
configuration tool. It is important to notice that three-phase power is accurately
measured in situations of asymmetry only when all the phase currents and phase
voltages are known. The correct input combination is selected via the configuration
tool.
U12, U23, U0 and IL1, IL2, IL3 Three-phase power in situations of symmetry and asymmetry
U23, U31, U0 and IL1, IL2, IL3 Three-phase power in situations of symmetry and asymmetry
U12, U31, U0 and IL1, IL2, IL3 Three-phase power in situations of symmetry and asymmetry
U12, U23 and IL1, IL2, IL3 Aron power; phase currents are assumed to be symmetric (i.e. I0 = 0)
U23, U31 and IL1, IL2, IL3 Aron power; phase currents are assumed to be symmetric (i.e. I0 = 0)
U12, U31 and IL1, IL2, IL3 Aron power; phase currents are assumed to be symmetric (i.e. I0 = 0)
U12 and IL3 Phase currents and voltages are assumed to be symmetric
U23 and IL1 Phase currents and voltages are assumed to be symmetric
U31 and IL2 Phase currents and voltages are assumed to be symmetric
4
Substation Automation MEPE7
The function block measures the true RMS and fundamental frequency currents and
voltages.
The available analogue channel combinations are shown in the dialogue box of the
Relay Configuration Tool (Figure 2).
)LJXUH $YDLODEOHDQDORJXHFKDQQHOFRPELQDWLRQVLQWKH5HOD\&RQILJXUDWLRQ7RRO
The suppression of harmonics for the fundamental frequency measurement is at least
-50 dB at the frequencies f = n x fn, where n = 2, 3, 4, 5,... and fn is the rated
frequency.
2.3 Registers
maximum three-phase active and reactive power demand with date and time
stamps
accumulated three-phase active and reactive energy, forward and reversed
the 50 last three-phase energy values, forward and reverse; each value is integrated
over a settable time interval
The user can reset the registers via the RESET input, or over the serial bus or the local
MMI. When the measurement view is selected and there are no active indications, the
accumulated energy measurements can be reset by pressing the C button for 5 s.
5
MEPE7 Substation Automation
D
S
S1
)LJXUH 7KUHHGLPHQVLRQDOSRZHUWULDQJOH
Explanations to Figure 3:
S = P 2 + Q 2 +D 2 = URMSIRMS
P P
cos() = =
S1 P +Q 2
2
The power factor (PF) is calculated on the basis of total apparent power:
P
PF =
S
6
Substation Automation MEPE7
If the new demand power value exceeds the maximum demand value recorded for
three-phase power, the actual demand value will replace the maximum demand value
recorded. Maximum values are provided with date and time stamps.
The function block calculates active and reactive energy by integrating the measured
active and reactive power values over a settable time interval, starting daily at 00.00.
The user defines the interval, i.e. how the 1440 minutes per day are divided, with the
parameter Energy interval. Each new demand value is obtained at the end of the
corresponding time interval. The energy values can be spontaneously reported to the
master device (MicroSCADA). The latest 50 values of active and reactive energy are
stored in a cyclical buffer. Accumulated energy values are derived for wye-connected
VTs and VDs, and delta-connected VTs.
The zero value supervision function forces an active or reactive power value below
3 x 0.2% x Un x In to 0. This allows the noise in the input voltage to be ignored. The
function is fixed to 3 x 0.2% x Un x In and it is always active.
The zero value detection function forces a value update if the three-phase active or
reactive power deviates slightly from zero or is zero. Once the active or reactive
power passes (upwards or downwards) the limit 3 x 0.2% x Un x In, the new active or
reactive power values is spontaneously reported to the master device (MicroSCADA).
The function is active when threshold supervision with the absolute threshold method
or the integration method is in use (see the control parameter Threshold select).
Three different methods can be used for the threshold supervision (also known as
delta supervision) and the parameter Threshold select is used for selecting the
method to be used. The methods are absolute, integrated and time based.
7
MEPE7 Substation Automation
In absolute threshold supervision, the function block compares the actual values of
three-phase active and reactive power with the last reported values. If the actual value
exceeds the last reported value plus the set Threshold value, or is below the last
reported value minus the set Threshold value, the actual value is spontaneously
reported to the master device and will replace the last reported value.
Three-phase power
Reported value
+ Threshold value
- Threshold value Reported value
Minimum
threshold
0
Execution task cycle
)LJXUH 2SHUDWLRQRIWKUHVKROGVXSHUYLVLRQZLWKDEVROXWHWKUHVKROG
In threshold supervision with integrator algorithm, the function block calculates the
difference between the last reported power value and the actual value for each task
cycle. The difference is added to the internal accumulated (integrated) value register.
If the accumulated deltas exceed the set Threshold value, the actual value is
spontaneously reported to the master device and will replace the last reported value.
The internal threshold difference register is set to zero.
8
Substation Automation MEPE7
Three-phase power
Power value update Power value update
Reported value
Reported value
Minimum
threshold
0
Execution task cycle
+ Threshold value x
Time interval
Reference level
- Threshold value x
Time interval
Thsinte5
)LJXUH 2SHUDWLRQRIWKUHVKROGVXSHUYLVLRQZLWKLQWHJUDWRUDOJRULWKP
The threshold difference register is cleared if:
Example 1:
Measurement value has changed 1% after the last sent measurement value
Threshold value = 1% and Time interval = 1s new measurement value is sent after
1 second
Example 2:
Measurement value has changed 1% after the last sent measurement value
Threshold value = 1% and Time interval = 2s new measurement value is sent after
2 seconds
Example 3:
Measurement value has changed 2% after the last sent measurement value
Threshold value = 10% and Time interval = 2s new measurement value is sent
after 10 seconds
If the time-based threshold supervision is used, the function block sends the values to
the master device at intervals selected with the control parameter Time interval.
9
MEPE7 Substation Automation
The limit value supervision function monitors up to four different limits for both
three-phase active power and three-phase reactive power. The user specifies the
warning and alarm limits to be supervised and monitored with the parameter Limit
selection. The limits can also be changed on-line.
The function checks each limit independently, which means that if the active or
reactive power exceeds several limits during a task execution cycle, each exceeding of
limit is reported to the master device independently. The hysteresis of each limit is
fixed to 1% of the nominal value (Un In) and taken into account as shown below. Each
exceeding of limit with a time stamp is stored with the FIFO method.
Three-phase power
(2)
(3)
Hysteresis
High alarm limit
(1)
(4)
High warn. limit
(5)
(8)
High warning
Outputs
High alarm
Low warning
Low alarm Powlimi2
)LJXUH 2SHUDWLRQRIOLPLWYDOXHPRQLWRULQJ
10
Substation Automation MEPE7
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for MEPE7 is 207.
The data direction of the parameters defines the use of each parameter as follows:
Data Description
direction
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
11
MEPE7 Substation Automation
P3 high alarm V10 -999999...999999 kW 0 R/W High alarm limit value for active
power
P3 low warning V11 -999999...999999 kW 0 R/W Low warning limit value for
active power
P3 low alarm V12 -999999...999999 kW 0 R/W Low alarm limit value for active
power
Q3 high warning V13 -999999...999999 kvar 0 R/W High warning limit value for
reactive power
Q3 high alarm V14 -999999...999999 kvar 0 R/W High alarm limit value for
reactive power
Q3 low warning V15 -999999...999999 kvar 0 R/W Low warning limit value for
reactive power
Q3 low alarm V16 -999999...999999 kvar 0 R/W Low alarm limit value for
reactive power
12
Substation Automation MEPE7
Event mask 2 V103 0... 2863333375 - 0 R/W Event mask 1 for event
transmission (E0 ... E31)
Event mask 3 V105 0... 2863333375 - 0 R/W Event mask 1 for event
transmission (E0 ... E31)
Event mask 4 V107 0... 2863333375 - 0 R/W Event mask 1 for event
transmission (E0 ... E31)
1)
Power detection 0 = Forward; 1 = Reverse
2)
Demand interval 0 = 1 min; 1 = 5 min; 2 = 10 min; 3 = 15 min; 4 = 30 min; 5 = 60 min
3)
Energy interval 0 = 1 min; 1 = 5 min; 2 = 10 min; 3 = 15 min; 4 = 30 min; 5 = 60 min;
6 = 120 min
4)
Threshold select 0 = Not in use; 1 = Absolute alg.; 2 = Integrat. alg.; 3 = Time interval
5)
Power limits 0 = Not in use; 1 = HW,HA, LW, LA; 2 = HW, HA; 3 = LW, LA; 4 = HW, LW;
5 = HA, LA; 6 = HW; 7 = HA; 8 = LW; 9 = LA
6)
Energy meas. 0 = No energy reg.; 1 = Energy reg. on
7)
MEPEmode 0 = Not in use; 1 = U1, U2, U3 & I1, I2, I3; 2 = U12, U23, U0 & I1, I2, I3;
3=U23, U31, U0 & I1, I2, I3; 4 = U12, U31, U0 & I1, I2, I3; 5 = U12, U23 & I1,
I2, I3; 6 = U23, U31 & I1, I2, I3; 7 = U12, U31 & I1, I2, I3; 8 = U1 & I1; 9 = U2
& I2; 10 = U3 & I3; 11 = U12 & I3; 12 = U23 & I1; 13 = U31 & I2
13
MEPE7 Substation Automation
14
Substation Automation MEPE7
15
MEPE7 Substation Automation
3.3.3 Events
16
Substation Automation MEPE7
C Event reason and event state in the event table changed as follows (an example):
- Event reason: P3 high warning P3
- Event state: Reset High warning reset
Events E20E31 added: total power S, power factor DPF and energy measurement
- DPF event E23 has been added to LON general interrogation (GI)
17
1MRS752344-MUM MEVO1_
Issued: 10/1997 Residual Voltage Measurement
Version: E/30.1.2002
Data subject to change without notice
Contents
1 Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description .................................................................................. 3
1.4 Output description ............................................................................... 3
2 Description of Operation.......................................................................... 4
2.1 Configuration....................................................................................... 4
2.2 Measuring mode ................................................................................. 4
2.3 Registers............................................................................................. 4
2.4 Actual residual voltage measurement.................................................. 4
2.5 Maximum residual voltage................................................................... 4
2.6 Zero value supervision and zero value detection ................................. 4
2.7 Threshold supervision with absolute threshold .................................... 5
2.8 Threshold supervision with integrator algorithm................................... 6
2.9 Limit value supervision ........................................................................ 7
3 Parameters and Events ............................................................................ 8
3.1 General ............................................................................................... 8
3.2 Control settings ................................................................................... 9
3.3 Measurement values ........................................................................... 9
3.3.1 Input data ................................................................................... 9
3.3.2 Recorded data............................................................................ 9
3.3.3 Events ........................................................................................ 9
4 Technical Data ........................................................................................ 10
MEVO1_ Substation Automation
1 Introduction
1.1 Features
True RMS measurement of residual voltage
Actual residual voltage values displayed in voltages and as p.u. values
Threshold supervision using the integration method or the absolute threshold
method
Limit value monitoring with up to two adjustable limits
Residual voltage to be measured by means of a conventional voltage transformer or
a voltage divider
Residual voltage output to be used in the freely programmable logic of the Relay
Configuration Tool included in the CAP 505 Tool Box
1.2 Application
This document specifies the function of the residual voltage measurement function
blocks MEVO1A and MEVO1B that are identical in operation.
MEVO1A and MEVO1B can be used in various applications and products based on
the RED 500 Platform, e.g. feeder terminals, in-feeder terminals, motor protection
terminals and transformer protection terminals.
)LJXUH )XQFWLRQEORFNV\PEROVRI0(92$DQG0(92%
2
Substation Automation MEVO1_
3
MEVO1_ Substation Automation
2 Description of Operation
2.1 Configuration
The analogue channel number for the U0 input is selected by means of the Relay
Configuration Tool.
Conventional voltage transformers or voltage dividers can be used for measuring the
residual voltages. The function block automatically adapts its operation to the
channels and measuring devices selected in the configuration tool.
The function block measures the true RMS residual voltage. Note that RMS
measurement must be selected for the voltage inputs via the Special Measurements
dialogue of the configuration tool.
The voltage value is updated once a fundamental frequency cycle, i.e. the integration
time for the true RMS calculation is one fundamental cycle.
2.3 Registers
The maximum peak value of the residual voltage is recorded with date and time
stamps.
The registers can be reset via the RESET input, or over the serial bus or the local
MMI.
The actual residual voltage value is displayed in voltages and as a p.u. value.
The maximum peak value of the residual voltage is recorded after the last reset of
registers. The maximum peak value is calculated by means of slightly filtered values
of residual voltage. The maximum residual voltage is cleared by resetting the register.
A residual voltage below 0.5% Un is forced to 0% Un. This allows the noise in the
input voltage to be ignored. The zero value supervision is fixed to 0.5% Un, and is
always active.
The zero value detection function is used to force a voltage value update if it deviates
slightly from zero or is zero. Zero value detection operates so that once a residual
voltage passes (upwards or downwards) the limit 0.5% Un, the new residual voltage
value is spontaneously reported to the master device (MicroSCADA) provided the
threshold supervision with the absolute threshold method or the integration method is
in use (see the control parameter Threshold select).
4
Substation Automation MEVO1_
Two different methods can be used for threshold supervision and the method to be
used is selected with the parameter Threshold select.
If the absolute threshold supervision is used, the function block compares the actual
residual voltage value with the last reported value. If the actual value exceeds the last
reported value plus the set Threshold value or is below the last reported value minus
the set Threshold value, the actual value is spontaneously reported to the master
device and will replace the last reported value.
Voltage
Reported value
+ Threshold value
- Threshold value Reported value
Minimum
threshold
0
Execution task cycle
)LJXUH 2SHUDWLRQRIWKUHVKROGVXSHUYLVLRQZLWKDEVROXWHDOJRULWKP
5
MEVO1_ Substation Automation
When threshold supervision with integrator algorithm is used, the function block
calculates the difference between the last reported voltage value and the actual value
for each task cycle. The difference is added to the internal accumulated (integrated)
value register. If the accumulated delta exceeds the set Threshold value, the actual
value is spontaneously reported to the master device. The actual value replaces the last
reported value. The internal threshold difference register is set to zero.
Voltage
Voltage value update Voltage value update
Reported value
Reported value
Minimum
threshold
0
Execution task cycle
+ Threshold value
Reference level
- Threshold value
)LJXUH 2SHUDWLRQRIWKUHVKROGVXSHUYLVLRQZLWKLQWHJUDWRUDOJRULWKP
The threshold difference register is cleared if the accumulated voltage value exceeds
the set Threshold value.
6
Substation Automation MEVO1_
For residual voltage, up to two different limits can be monitored. The parameter
Limit selection is used to specify the limits to be supervised and monitored. Each
limit is checked independently. If the residual voltage exceeds several limits during an
execution task cycle, each exceeding of limit is reported to the master device
independently. The hysteresis of each limit is fixed to 1% of the nominal value and
taken into account as shown below. Each exceeding of limit with a time stamp is
stored with the FIFO method. The outputs HighWarning and HighAlarm are activated
as shown below. Warning and alarm limits can be changed on-line.
Voltage % Un
(2)
(3)
Hysteresis
20
High alarm limit
(1)
(4)
18
High warn. limit
16
10
0
Outputs
High warning
High alarm
Vollimi3
)LJXUH 2SHUDWLRQRIOLPLWYDOXHPRQLWRULQJ
7
MEVO1_ Substation Automation
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for MEVO1A is 205 and that for MEVO1B
226.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the relay
terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask 1
parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
8
Substation Automation MEVO1_
3.3.3 Events
Code Weighting Default Event reason Event state
coefficient mask
E0 1 0 U0 High warning reset
E1 2 0 U0 High warning activated
E2 4 0 U0 High alarm reset
E3 8 0 U0 High alarm activated
E4 0 0 - -
E5 32 0 U0 Delta
9
MEVO1_ Substation Automation
4 Technical Data
Operation accuracies Depends on the frequency of the voltage measured:
C Event reason and event state in the event table changed as follows (an
example):
Uo (V) Uo
Uo (%) Uo
MEVO1B A -
Uo (V) Uo
Uo (%) Uo
10
1MRS752345-MUM MEVO3_
Issued: 10/1997
Version: E/30.1.2002
Three-Phase Voltage Measurement
Data subject to change without notice
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 3
2. Description of Operation.......................................................................... 4
2.1 Configuration....................................................................................... 4
2.2 Measuring mode ................................................................................. 4
2.3 Registers............................................................................................. 4
2.4 Actual voltage measurement ............................................................... 5
2.5 Maximum and minimum average voltages .......................................... 5
2.6 Zero value supervision and zero value detection................................. 5
2.7 Threshold supervision with absolute threshold .................................... 6
2.8 Threshold supervision with integrator algorithm .................................. 7
2.9 Limit value supervision ........................................................................ 8
3. Parameters and Events ............................................................................ 9
3.1 General ............................................................................................... 9
3.2 Control settings ................................................................................. 10
3.3 Measurement values ......................................................................... 11
3.3.1 Input data ................................................................................. 11
3.3.2 Recorded data.......................................................................... 12
3.3.3 Events ...................................................................................... 13
1. Introduction
1.1 Features
1.2 Application
)LJXUH )XQFWLRQEORFNV\PEROV0(92$DQG0(92%
2
Substation Automation MEVO3_
3
MEVO3_ Substation Automation
2.1 Configuration
The analogue channel numbers for the corresponding UL1_U12, UL2_U23 and
UL3_U31 inputs are selected by means of the Relay Configuration Tool.
Conventional voltage transformers or voltage dividers can be used for measuring the
voltages. The function block automatically adapts its operation to the channels and
measuring devices selected in the configuration tool.
The voltage values are updated once per fundamental frequency cycle, i.e. the
integration time for true RMS calculation is one fundamental cycle.
2.3 Registers
maximum average voltage for each channel with date and time stamps
minimum average voltage for each channel with date and time stamps
The registers can be reset via the RESET input, or over the serial bus or the local
MMI.
4
Substation Automation MEVO3_
Actual voltage values are displayed in voltages and as p.u. values. The parameter
Phase selection is used for selecting the voltages to be measured. If a voltage has
not been selected, the actual voltage value will be zero and the supervision functions
are not executed on that particular voltage.
If the new average voltage value exceeds the maximum average value recorded, the
actual average value will replace the maximum average value recorded. Should the
new actual average be smaller than the minimum average recorded, the actual average
value will replace the recorded minimum average. Maximum and minimum values are
provided with date and time stamps.
Maximum and minimum values are cleared when the registers are reset.
A voltage below 1.0% Un is forced to 0% Un. This allows the noise in the input
voltage to be ignored. The zero value supervision is fixed to 1.0% Un and is always
active.
The zero value detection function is used to force a voltage value update if it deviates
slightly from zero or is zero. Zero value detection operates so that once a voltage
passes (upwards or downwards) the limit 1.0% Un, the new voltage value is
spontaneously reported to the master device (MicroSCADA), provided the threshold
supervision with an absolute threshold or the integration method is in use (see the
control parameter Threshold select).
5
MEVO3_ Substation Automation
Two different methods can be used for threshold supervision (also known as delta
supervision) and the method to be used is selected with the parameter Threshold
select.
If the absolute threshold supervision is used, the function block compares the actual
voltage value with the last reported value. If the actual value exceeds the last reported
value plus the set Threshold value or is below the last reported value minus the set
Threshold value, the actual value is spontaneously reported to the master device and
will replace the last reported value.
Voltage
Reported value
+ T hreshold value
- Threshold value Reported value
Minimum
threshold
0
Execution task cycle
)LJXUH 2SHUDWLRQRIWKUHVKROGVXSHUYLVLRQZLWKDEVROXWHDOJRULWKP
6
Substation Automation MEVO3_
When threshold supervision with integrator algorithm is used, the function block
calculates the difference between the last reported voltage value and the actual value
for each task cycle. The difference is added to the internal accumulated (integrated)
value register. If the accumulated delta exceeds the set Threshold value, the actual
value is spontaneously reported to the master device. The actual value replaces the
last reported value. The internal threshold difference register is set to zero.
Voltage
Voltage value update Voltage value update
Reported value
Reported value
Minimum
threshold
0
Execution task cycle
+ Threshold value
Reference level
- Threshold value
)LJXUH 2SHUDWLRQRIWKUHVKROGVXSHUYLVLRQZLWKLQWHJUDWRUDOJRULWKP
The threshold difference register is cleared if:
7
MEVO3_ Substation Automation
For all three phase voltages, up to four different limits can be monitored. The
parameter Limit selection is used to specify the limit to be supervised and
monitored. Each phase and limit is checked independently, which means that if a
phase voltage exceeds several limits during an execution task cycle, each exceeding of
limit is reported to the master device independently. The hysteresis of each limit is
fixed to 1% of the nominal value and taken into account as shown below. Each
exceeding of limit with a time stamp is stored with the FIFO method. The outputs
HighWarning, HighAlarm, LowWarning and LowAlarm are activated as shown
below. The warning and alarm limits can be changed on-line.
Voltage x Un
(2)
(3)
1.20 Hysteresis
High alarm limit
(1)
1.10 (4)
High warn. limit
1.00
0.60
0.50
(5)
(8)
0.40
Low warn. limit
(7)
(6)
0.30
Low alarm limit
0.20
0.10
0.00
High warning
Outputs
High alarm
Low warning
Low alarm
Vollim03
)LJXUH 2SHUDWLRQRIOLPLWYDOXHPRQLWRULQJ
8
Substation Automation MEVO3_
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for MEVO3A is 204 and that for MEVO3B
206.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
9
MEVO3_ Substation Automation
10
Substation Automation MEVO3_
11
MEVO3_ Substation Automation
U1_12 Max (kV) V203 0.00...999.99 kV 0.00 R/M Maximum average of UL1_U12
in voltages
U1_12 Max (pu) V204 0.00...2.00 x Un 0.00 R/M Maximum average of UL1_U12
in percent
U2_23 Max (kV) V207 0.00...999.99 kV 0.00 R/M Maximum average of UL2_U23
in voltages
U3_23 Max (pu) V208 0.00...2.00 x Un 0.00 R/M Maximum average of UL2_U23
in percent
U3_31 Max (kV) V211 0.00...999.99 kV 0.00 R/M Maximum average of UL3_U31
in voltages
U3_31 Max (pu) V212 0.00...2.00 x Un 0.00 R/M Maximum average of UL3_U31
in percent
U1_12 Min (kV) V215 0.00...999.99 kV 0.00 R/M Minimum average of UL1_U12 in
voltages
U1_12 Min (pu) V216 0.00...2.00 x Un 0.00 R/M Minimum average of UL1_U12 in
percent
U2_23 Min (kV) V219 0.00...999.99 kV 0.00 R/M Minimum average of UL2_U23 in
voltages
12
Substation Automation MEVO3_
U3_31 Min Date V221 YYYY-MM-DD - - R/M Date of UL3_U31 minimum average
voltage
U3_31 Min (kV) V223 0.00...999.99 kV 0.00 R/M Minimum average of UL3_U31 in
voltages
U3_31 Min (pu) V224 0.00...2.00 x Un 0.00 R/M Minimum average of UL3_U31 in
percent
3.3.3 Events
Events 0...31:
13
MEVO3_ Substation Automation
E24 0 0 - -
E26 0 0 - -
E28 0 0 - -
E30 0 0 - -
E31 0 0 - -
14
Substation Automation MEVO3_
Events 32...61:
E56 0 0 - -
E58 0 0 - -
E60 0 0 - -
15
MEVO3_ Substation Automation
C Event reason and event state in the event table changed as follows (an
example):
16
1MRS100162 RE_5_ _
1MRS100169 Alarm
Issued: 10/1997
Version: C (MMI, remote)
Data subject to change without notice (MMIALAR1MMIALAR8)
Contents
1. Introduction............................................................................................... 2
2. Description of Operation.......................................................................... 3
2.1 Configuration ....................................................................................... 3
2.2 Non-latched alarm ............................................................................... 3
2.3 Latched alarm, steady LEDs................................................................ 4
2.4 Latched alarm, blinking LEDs .............................................................. 5
1. Introduction
1.1 Features
Controls the alarm LED and sends the indications to the MMI alarm view
Latched or non-latched alarm
Different colours and blink modes to be defined in the Relay Mimic Editor
Alarm to be acknowledged remotely, locally or by logic
1.2 Application
This document specifies the function of the eight alarm function blocks
MMIALAR1...MMIALAR8 used in products based on the RED 500 Platform. The
function blocks are identical in operation.
The function block MMIALAR_ handles the MMI alarm LED and sends the
indications to the MMI alarm view. The activation and acknowledgement of the
function block is controlled by logic signals. Different LED indicators can be selected
according to the requirements.
)LJXUH $VDQH[DPSOHWKHIXQFWLRQEORFNV\PERORI00,$/$5
2
ABB Automation MMIALAR1MMIALAR8 RE_5_ _
2.1 Configuration
The visible alarm indication on the alarm view and the alarm LED configurations can
be defined in the alarm dialogue box of the Relay Mimic Editor. The logical behavior
is configured in the Relay Configuration Tool.
The ON signal defines the alarm status. Each alarm can be acknowledged separately
via the logic ACK signal or the remote acknowledgement command. Locally, all
alarms can be acknowledged with the C button in the alarm view. Each alarm can be
configured in the alarm view of the Relay Mimic Editor. Three basic modes for
alarms are supported regarding latching: non-latched, latched with steady LED and
latched with blinking LED. The audible alarm signal (AALARM) is activated when
an alarm is activated (non-latched alarm is a special case) and deactivated when the
alarm is acknowledged remotely, locally or via the logic ACK signal.
In the non-latched mode, the ON-signal state toggles the ON and OFF state texts and
the corresponding LED colours. Alarm acknowledgement clears the last time stamp
line from the alarm view but leaves the corresponding alarm LED state unchanged.
An event is generated by the rising and falling edge of the ON signal and the
acknowledgement.
3
RE_5_ _ MMIALAR1MMIALAR8 ABB Automation
On text
09-24 12:40:00
On color f or steady led
ACK
ON
AALARM
ACK
ON
AALARM
)LJXUH 1RQODWFKHGDODUP
Latched, steady alarms can be acknowledged only when the ON signal is not active.
The time stamp of the first alarm is registered. A successfull acknowledgement clears
the time stamp line from the alarm view and the corresponding alarm LED. An event
is generated by the rising and falling edge of the ON signal and the acknowledgement.
(The alarm mode is compatible with the SPTO 1D6 relay module).
Latched, steady
ACK
ON
AALARM
)LJXUH /DWFKHGDODUPZLWKVWHDG\/('
4
ABB Automation MMIALAR1MMIALAR8 RE_5_ _
Latched, blinking alarms can be acknowledged after the rising edge of the ON signal.
The time stamp of the first alarm is registered. If the ON signal is not active, the
acknowledgement clears the time stamp line from the alarm view and the
corresponding alarm LED. However, if the ON signal is active during the
acknowledgement, the alarm LED mode changes to stable and the time stamp is
cleared. Later, when the ON signal is inactive, the alarm LED colour will
automatically change to OFF colour. An event is generated by the rising and falling
edge of the ON signal and the acknowledgement. (The visual indication, visual
indication resetting and audible alarm of this alarm mode are compatible with the
ISA-A standard).
Latched, blinking (example 1)
A CK
ON
AA LA RM
ACK
ON
AA LARM
)LJXUH /DWFKHGDODUPZLWKEOLQNLQJ/('V
5
RE_5_ _ MMIALAR1MMIALAR8 ABB Automation
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channels for the alarm function blocks are the
following:
Function block Channel
MMIALAR1 162
MMIALAR2 163
MMIALAR3 164
MMIALAR4 165
MMIALAR5 166
MMIALAR6 167
MMIALAR7 168
MMIALAR8 169
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen seen on the MMI of
the relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event
mask 1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
6
ABB Automation MMIALAR1MMIALAR8 RE_5_ _
3.4 Events
E2 4 0 - -
7
RE_5_ _ MMIALAR1MMIALAR8 ABB Automation
8
1MRS752355-MUM MMIALAR_
Issued: 10/1997
Version: D/11.2.2002
Alarm
Data subject to change without notice (MMI, remote)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 2
1.4 Output description ............................................................................... 2
2. Description of Operation.......................................................................... 3
2.1 Configuration....................................................................................... 3
2.2 Non-latched alarm ............................................................................... 3
2.3 Latched alarm, steady LEDs ............................................................... 4
2.4 Latched alarm, blinking LEDs.............................................................. 5
1. Introduction
1.1 Features
Controls the alarm LED and sends the indications to the MMI alarm view
Latched or non-latched alarm
Different colours and blink modes to be defined in the Relay Mimic Editor
Alarm to be acknowledged remotely, locally or by logic
1.2 Application
This document specifies the function of the eight alarm function blocks
MMIALAR1...MMIALAR8 used in products based on the RED 500 Platform. The
function blocks are identical in operation.
The function block MMIALAR_ handles the MMI alarm LED and sends the
indications to the MMI alarm view. The activation and acknowledgement of the
function block is controlled by logic signals. Different LED indicators can be selected
according to the requirements.
)LJXUH $VDQH[DPSOHWKHIXQFWLRQEORFNV\PERORI00,$/$5
2
Substation Automation MMIALAR_
2.1 Configuration
The visible alarm indication on the alarm view and the alarm LED configurations can
be defined in the alarm dialogue box of the Relay Mimic Editor. The logical behavior
is configured in the Relay Configuration Tool.
The ON signal defines the alarm status. Each alarm can be acknowledged separately
via the logic ACK signal or the remote acknowledgement command. Locally, all
alarms can be acknowledged with the C button in the alarm view. Each alarm can be
configured in the alarm view of the Relay Mimic Editor. Three basic modes for
alarms are supported regarding latching: non-latched, latched with steady LED and
latched with blinking LED. The audible alarm signal (AALARM) is activated when
an alarm is activated (non-latched alarm is a special case) and deactivated when the
alarm is acknowledged remotely, locally or via the logic ACK signal.
In the non-latched mode, the ON-signal state toggles the ON and OFF state texts and
the corresponding LED colours. Alarm acknowledgement clears the last time stamp
line from the alarm view but leaves the corresponding alarm LED state unchanged.
An event is generated by the rising and falling edge of the ON signal and the
acknowledgement.
3
MMIALAR_ Substation Automation
On text
09-24 12:40:00
On color f or steady led
ACK
ON
AALARM
ACK
ON
AALARM
)LJXUH 1RQODWFKHGDODUP
Latched, steady alarms can be acknowledged only when the ON signal is not active.
The time stamp of the first alarm is registered. A successfull acknowledgement clears
the time stamp line from the alarm view and the corresponding alarm LED. An event
is generated by the rising and falling edge of the ON signal and the acknowledgement.
(The alarm mode is compatible with the SPTO 1D6 relay module).
Latched, steady
ACK
ON
AALARM
)LJXUH /DWFKHGDODUPZLWKVWHDG\/('
4
Substation Automation MMIALAR_
Latched, blinking alarms can be acknowledged after the rising edge of the ON signal.
The time stamp of the first alarm is registered. If the ON signal is not active, the
acknowledgement clears the time stamp line from the alarm view and the
corresponding alarm LED. However, if the ON signal is active during the
acknowledgement, the alarm LED mode changes to stable and the time stamp is
cleared. Later, when the ON signal is inactive, the alarm LED colour will
automatically change to OFF colour. An event is generated by the rising and falling
edge of the ON signal and the acknowledgement. (The visual indication, visual
indication resetting and audible alarm of this alarm mode are compatible with the
ISA-A standard).
Latched, blinking (example 1)
A CK
ON
AA LA RM
ACK
ON
AA LARM
)LJXUH /DWFKHGDODUPZLWKEOLQNLQJ/('V
5
MMIALAR_ Substation Automation
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channels for the alarm function blocks are the
following:
Function block Channel
MMIALAR1 162
MMIALAR2 163
MMIALAR3 164
MMIALAR4 165
MMIALAR5 166
MMIALAR6 167
MMIALAR7 168
MMIALAR8 169
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen seen on the MMI of
the relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event
mask 1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
6
Substation Automation MMIALAR_
3.4 Events
E2 4 0 - -
7
MMIALAR_ Substation Automation
8
1MRS752356-MUM MMIDATA_
Issued: 10/1997
Version: C/1.2.2002
MIMIC Dynamic Datapoint
Data subject to change without notice
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 2
2. Description of Operation.......................................................................... 2
3. Parameters................................................................................................ 3
1. Introduction
1.1 Features
1.2 Application
This document specifies the functions of the five dynamic data point function blocks
MMIDATA1...MMIDATA5 used in products based on the RED 500 Platform. The
function blocks are identical in operation.
)LJXUH )XQFWLRQEORFNV\PEROVRI00,'$7$00,'$7$00,'$7$
00,'$7$DQG00,'$7$
2
Substation Automation MMIDATA_
3. Parameters
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channels for the dynamic data point function blocks
are the following:
Function block Channel
MMIDATA1 157
MMIDATA 2 158
MMIDATA 3 159
MMIDATA 4 160
MMIDATA 5 161
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
3
MMIDATA_ Substation Automation
4
1MRS752373-MUM MMIWAKE
Issued: 10/1997
Version: D/7.2.2002
Activation of MMI Backlight
Data subject to change without notice
Contents
1. Description................................................................................................ 2
1.1 Features.............................................................................................. 2
1.2 Input description.................................................................................. 2
2. Description of Operation.......................................................................... 3
3. Setting Values........................................................................................... 4
1. Description
1.1 Features
)LJXUH )XQFWLRQEORFNLPDJHRI00,:$.(
2
Substation Automation MMIWAKE
2.1 General
The rising edge of the input signal WAKE activates the MMI backlight. The MMI
display timeout defines how long the display backlight stays active.
3
MMIWAKE Substation Automation
4
Substation Automation MMIWAKE
4.1 Events
5
MMIWAKE Substation Automation
6
1MRS100054 RE_5_ _
Issued: 10/1998
Version: C
Three-phase
Data subject to change without notice Start-Up Supervision for Motors
(MotStart)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 3
2. Description of Operation.......................................................................... 4
2.1 Configuration....................................................................................... 4
2.2 Setting the rated values of the protected unit ...................................... 4
2.3 Measuring mode ................................................................................. 4
2.4 Operation mode .................................................................................. 4
2.4.1 I2 * t mode.................................................................................. 5
2.4.2 I2 * t & stall mode ....................................................................... 6
2.5 Start-up counter .................................................................................. 6
2.6 Setting groups ..................................................................................... 7
2.7 Test mode ........................................................................................... 7
2.8 START, TRIP and STALL outputs ....................................................... 8
2.9 Resetting............................................................................................. 8
3. Parameters and Events ............................................................................ 9
3.1 General ............................................................................................... 9
3.2 Setting values.................................................................................... 10
3.2.1 Actual settings.......................................................................... 10
3.2.2 Setting group 1......................................................................... 10
3.2.3 Setting group 2......................................................................... 10
3.2.4 Control settings ........................................................................ 11
3.3 Measurement values ......................................................................... 12
3.3.1 Input data ................................................................................. 12
3.3.2 Output data .............................................................................. 12
3.3.3 Recorded data.......................................................................... 12
3.3.4 Events ...................................................................................... 15
1. Introduction
1.1 Features
1.2 Application
This document specifies the function of the three-phase start-up supervision function
block MotStart used in products based on the RED 500 Platform.
)LJXUH )XQFWLRQEORFNV\PERORI0RW6WDUW
2
ABB Automation MotStart RE_5_ _
3
RE_5_ _ MotStart ABB Automation
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The phase currents IL1, IL2 and IL3 are
connected to the corresponding IL1, IL2 and IL3 inputs of the function block. Digital
inputs are connected to the boolean inputs of the function block, and the outputs of
the function block are connected to the output signals in the same way.
A separate scaling factor can be set for each analogue channel. The factors enable
differences between the ratings of the protected unit and those of the measuring
device (CTs, VTs, etc.). A setting of 1.00 means that the rated value of the protected
unit is exactly the same as that of the measuring device. For more information refer to
Technical Reference Manual for REM 54_.
The calculation of the thermal stress (I2 x t) for the motor is based on the TRUE RMS
measuring principle. The start-up situation for the motor is detected by the PEAK
measuring principle. Harmonics are not suppressed.
The setting parameter Operation mode is used for selecting one of the three
operation modes available. Mode 0 (Not in use) sets the function out of use, whereas
in mode 1 (IIt) MotStart calculates the thermal stress for the motor and in mode 2 (IIt
& Stall) protects the motor against stalling during a motor start-up.
4
ABB Automation MotStart RE_5_ _
2.4.1 I2 * t mode
The thermal stress during any single start-up is monitored by the start-up supervision
MotStart, which calculates the product I2 x t, i.e. the thermal stress, during a normal
start-up of a motor.
The motor start-up situation is a sequence, where each of the initial three phase
currents is less than 0.05 x In for 60 ms, i.e. the motor is at standstill, and where at
least one phase current within the rising time (60 ms) rises from a value below 0.05 x
In to a value higher than the start value (1.5 x In). If a phase current sample exceeds
the current level within the rising time, the START signal is immediately set to
TRUE, i.e. the START output can be activated before the rising time has elapsed.
The START signal remains active until all the three phase currents fall below 0.9 x
Start current (0.9 x 1.5 x In = 1.35 x In) and remain below that level for 150 ms, i.e.
until the start-up situation is over.
During the motor start-up MotStart measures the start current, raises the value to a
power of 2 and multiplies it by the running time, i.e. calculates the product I2 x t. If
the calculated value exceeds the set value, the function block trips immediately.
Note! The set I2 x t comes from the value set for the Start current parameter raised
to a power of two and multiplied by the value set for the Start time parameter.
)LJXUH )XQFWLRQDOLW\RIVWDUWXSVXSHUYLVLRQEDVHGRQ,[W
5
RE_5_ _ MotStart ABB Automation
In this mode, stall protection operates in parallel to the I2 x t function. The function
stalls during the motor start-up (STALL active) if the stall indication input signal
(STALL_IND) remains active longer than set stall time. An active STALL signal is
indicated by a steady trip LED (red) on the MMI.
Note! The trip and stall functions will both continue protecting the motor even though
the other function has operated.
Every time the motor is started, the start-up time is added to a register. If the contents
of the register exceed the preset level, i.e. the value set for the Time limit
parameter, the signal Output RESTART is deactivated. When the start-up situation
is over, the value of the register decreases at a certain speed, which is set via the
parameter Countdown rate. When the value of the register falls below the set time
limit, the signal Output RESTART is activated again. Note that the RESTART
output is normally activated, i.e. a new start is possible, even though its default value
is zero.
For example, the motor manufacturer may state that three starts at the maximum are
allowed within 8 hours and the start-up situation time is 20 s. By initiating three
successive starts we reach the situation illustrated below. As a result, the value of the
register adds up to a total of 60 seconds. Right after the third start has been initiated,
the RESTART output is deactivated and the fourth start will not be allowed, provided
the time limit has been set to 41 seconds.
Furthermore, the maximum of three starts in 8 hours means that the value of the
register should reach the set time limit within 8 hours to allow a new start.
Accordingly, the countdown rate should be 20 seconds in 8 hours and should thus be
set to 20 s / 8 h = 2.5 s / h.
6
ABB Automation MotStart RE_5_ _
)LJXUH 2SHUDWLRQRIWKHVWDUWXSWLPHFRXQWHU
The parameter Time to restart estimates in minutes the time remaining to the
moment when the next start is possible. The parameter is updated when the motor is
not running, i.e. all the phase currents are below 0.05 x In. The parameter Start
counter calculates the number of motor start-ups and is updated at the rising edge of
the START signal.
The two different groups of setting values, group 1 and 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
7
RE_5_ _ MotStart ABB Automation
The minimum pulse width of the corresponding output signal is set via a separate
parameter on MMI (control setting) or serial communication. If the start situation is
longer than the set pulse width, the START signal stays active until the start situation
is over. The output signal TRIP may have a non-latching or latching feature. When the
latching mode has been selected, the TRIP signal remains continuously active though
the operation criteria have reset, until the output is reset.
Note! The values set for the control parameters Trip signal (non-latching or
latching) and Trip pulse (minimum pulse width) apply to both the TRIP output and
the STALL output.
An active STALL signal is indicated by a steady trip LED (red) on the MMI. Active
TRIP and START signals are indicated as normally, i.e. TRIP with a steady trip LED
(red) and START with a steady start LED (yellow).
2.9 Resetting
The TRIP output signal and the registers can be reset either via the RESET input, over
the serial bus or via the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
8
ABB Automation MotStart RE_5_ _
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for MotStart is 54.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
9
RE_5_ _ MotStart ABB Automation
Countdown rate S5 2.0...250.0 s/h 60.0 R Countdown rate for the time counter
Start current S42 1.0...10.0 x In 2.0 R/W Starting current for motor
Start time S43 0.3...250.0 s 5.0 R/W Starting time for motor
Time limit S44 1.0...500.0 s 10.0 R/W Time-based restart inhibit limit
Countdown rate S45 2.0...250.0 s/h 60.0 R/W Countdown rate for the time counter
Stall time S46 2.0...120.0 s 10.0 R/W Permitted stalling time for rotor
1)
Operation mode 0 = Not in use; 1 = IIt; 2 = IIt & Stall
Start current S72 1.0...10.0 x In 2.0 R/W Starting current for motor
Start time S73 0.3...250.0 s 5.0 R/W Starting time for motor
Time limit S74 1.0...500.0 s 10.0 R/W Time-based restart inhibit limit
Countdown rate S75 2.0...250.0 s/h 60.0 R/W Countdown rate for the time counter
Stall time S76 2.0...120.0 s 10.0 R/W Permitted stalling time for rotor
1)
Operation mode 0 = Not in use; 1 = IIt; 2 = IIt & Stall
10
ABB Automation MotStart RE_5_ _
Event mask 1 V101 0...255 - 63 R/W Event mask 1 for event transmission
(E0 ... E7)
Event mask 2 V103 0...255 - 63 R/W Event mask 2 for event transmission
(E0 ... E7)
Event mask 3 V105 0...255 - 63 R/W Event mask 3 for event transmission
(E0 ... E7)
Event mask 4 V107 0...255 - 63 R/W Event mask 4 for event transmission
(E0 ... E7)
1)
Group selection 0 = Group 1; 1 = Group 2; 2 = GROUP input
2)
Active group 0 = Group 1; 1 = Group 2
3)
Trip signal 0 = Non-latching; 1 = Latching
4)
Testing 0 = Do not activate; 1 = Activate
11
RE_5_ _ MotStart ABB Automation
3.3.3.1 General
The information required for later fault analysis is recorded at the rising and falling
edge of start or when the function block trips. Tripping can be caused by either the I2
x t function or the stalling function. In case both the I2 x t function and the stalling
function operate, only the first one is recorded.
The data of three last operations (operation 1...3) are recorded and the values of the
latest operation always replace the data of the oldest operation. The registers are
updated in the following order: Operation 1, Operation 2, Operation 3, Operation 1,
Operation 2,...
12
ABB Automation MotStart RE_5_ _
The time stamp indicates the rising edge of the START signal and will be updated in
case the function block trips or stalls.
The duration of the start-up situation is recorded both in seconds and as a percentage
of the set operate time. The duration is updated for both IIT and STALL either at the
falling edge of the START signal i.e. when the motor start-up situation is over, or
when the TRIP or STALL output becomes active.
3.3.3.4 Currents
An average for each of the phase currents IL1, IL2 and IL3 is calculated during the start
situation i.e. the time from the rising edge of the START signal until its falling edge
or until the function block trips or stalls. The values of the phase currents IL1, IL2 and
Iy are recorded as multiples of the rated current In.
The status data of the Active group parameter, which indicates the setting group
valid for the recorded data, is recorded at the moment of triggering.
13
RE_5_ _ MotStart ABB Automation
14
ABB Automation MotStart RE_5_ _
3.3.4 Events
15
RE_5_ _ MotStart ABB Automation
16
1MRS752307-MUM MotStart
Issued: 10/1998
Version: D/15.3.2002
Three-phase
Data subject to change without notice Start-Up Supervision for Motors
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 3
2. Description of Operation.......................................................................... 4
2.1 Configuration....................................................................................... 4
2.2 Setting the rated values of the protected unit ...................................... 4
2.3 Measuring mode ................................................................................. 4
2.4 Operation mode .................................................................................. 4
2.4.1 I2 * t mode.................................................................................. 5
2.4.2 I2 * t & stall mode ....................................................................... 6
2.5 Start-up counter .................................................................................. 6
2.6 Setting groups ..................................................................................... 7
2.7 Test mode ........................................................................................... 7
2.8 START, TRIP and STALL outputs ....................................................... 8
2.9 Resetting............................................................................................. 8
3. Parameters and Events ............................................................................ 9
1. Introduction
1.1 Features
1.2 Application
This document specifies the function of the three-phase start-up supervision function
block MotStart used in products based on the RED 500 Platform.
)LJXUH )XQFWLRQEORFNV\PERORI0RW6WDUW
2
Substation Automation MotStart
3
MotStart Substation Automation
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The phase currents IL1, IL2 and IL3 are
connected to the corresponding IL1, IL2 and IL3 inputs of the function block. Digital
inputs are connected to the boolean inputs of the function block, and the outputs of
the function block are connected to the output signals in the same way.
A separate scaling factor can be set for each analogue channel. The factors enable
differences between the ratings of the protected unit and those of the measuring
device (CTs, VTs, etc.). A setting of 1.00 means that the rated value of the protected
unit is exactly the same as that of the measuring device. For more information refer to
Technical Reference Manual for REM 54_.
The calculation of the thermal stress (I2 x t) for the motor is based on the TRUE RMS
measuring principle. The start-up situation for the motor is detected by the PEAK
measuring principle. Harmonics are not suppressed.
The setting parameter Operation mode is used for selecting one of the three
operation modes available. Mode 0 (Not in use) sets the function out of use, whereas
in mode 1 (IIt) MotStart calculates the thermal stress for the motor and in mode 2 (IIt
& Stall) protects the motor against stalling during a motor start-up.
4
Substation Automation MotStart
2.4.1 I2 * t mode
The thermal stress during any single start-up is monitored by the start-up supervision
MotStart, which calculates the product I2 x t, i.e. the thermal stress, during a normal
start-up of a motor.
The motor start-up situation is a sequence, where each of the initial three phase
currents is less than 0.05 x In for 60 ms, i.e. the motor is at standstill, and where at
least one phase current within the rising time (60 ms) rises from a value below 0.05 x
In to a value higher than the start value (1.5 x In). If a phase current sample exceeds
the current level within the rising time, the START signal is immediately set to
TRUE, i.e. the START output can be activated before the rising time has elapsed.
The START signal remains active until all the three phase currents fall below 0.9 x
Start current (0.9 x 1.5 x In = 1.35 x In) and remain below that level for 150 ms, i.e.
until the start-up situation is over.
During the motor start-up MotStart measures the start current, raises the value to a
power of 2 and multiplies it by the running time, i.e. calculates the product I2 x t. If
the calculated value exceeds the set value, the function block trips immediately.
Note! The set I2 x t comes from the value set for the Start current parameter raised
to a power of two and multiplied by the value set for the Start time parameter.
)LJXUH )XQFWLRQDOLW\RIVWDUWXSVXSHUYLVLRQEDVHGRQ,[W
5
MotStart Substation Automation
In this mode, stall protection operates in parallel to the I2 x t function. The function
stalls during the motor start-up (STALL active) if the stall indication input signal
(STALL_IND) remains active longer than set stall time. An active STALL signal is
indicated by a steady trip LED (red) on the MMI.
Note! The trip and stall functions will both continue protecting the motor even though
the other function has operated.
Every time the motor is started, the start-up time is added to a register. If the contents
of the register exceed the preset level, i.e. the value set for the Time limit
parameter, the signal Output RESTART is deactivated. When the start-up situation
is over, the value of the register decreases at a certain speed, which is set via the
parameter Countdown rate. When the value of the register falls below the set time
limit, the signal Output RESTART is activated again. Note that the RESTART
output is normally activated, i.e. a new start is possible, even though its default value
is zero.
For example, the motor manufacturer may state that three starts at the maximum are
allowed within 8 hours and the start-up situation time is 20 s. By initiating three
successive starts we reach the situation illustrated below. As a result, the value of the
register adds up to a total of 60 seconds. Right after the third start has been initiated,
the RESTART output is deactivated and the fourth start will not be allowed, provided
the time limit has been set to 41 seconds.
Furthermore, the maximum of three starts in 8 hours means that the value of the
register should reach the set time limit within 8 hours to allow a new start.
Accordingly, the countdown rate should be 20 seconds in 8 hours and should thus be
set to 20 s / 8 h = 2.5 s / h.
6
Substation Automation MotStart
)LJXUH 2SHUDWLRQRIWKHVWDUWXSWLPHFRXQWHU
The parameter Time to restart estimates in minutes the time remaining to the
moment when the next start is possible. The parameter is updated when the motor is
not running, i.e. all the phase currents are below 0.05 x In. The parameter Start
counter calculates the number of motor start-ups and is updated at the rising edge of
the START signal.
The two different groups of setting values, group 1 and 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
7
MotStart Substation Automation
The minimum pulse width of the corresponding output signal is set via a separate
parameter on MMI (control setting) or serial communication. If the start situation is
longer than the set pulse width, the START signal stays active until the start situation
is over. The output signal TRIP may have a non-latching or latching feature. When the
latching mode has been selected, the TRIP signal remains continuously active though
the operation criteria have reset, until the output is reset.
Note! The values set for the control parameters Trip signal (non-latching or
latching) and Trip pulse (minimum pulse width) apply to both the TRIP output and
the STALL output.
An active STALL signal is indicated by a steady trip LED (red) on the MMI. Active
TRIP and START signals are indicated as normally, i.e. TRIP with a steady trip LED
(red) and START with a steady start LED (yellow).
2.9 Resetting
The TRIP output signal and the registers can be reset either via the RESET input, over
the serial bus or via the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
8
Substation Automation MotStart
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for MotStart is 54.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
9
MotStart Substation Automation
Countdown rate S5 2.0...250.0 s/h 60.0 R Countdown rate for the time counter
Start current S42 1.0...10.0 x In 2.0 R/W Starting current for motor
Start time S43 0.3...250.0 s 5.0 R/W Starting time for motor
Time limit S44 1.0...500.0 s 10.0 R/W Time-based restart inhibit limit
Countdown rate S45 2.0...250.0 s/h 60.0 R/W Countdown rate for the time counter
Stall time S46 2.0...120.0 s 10.0 R/W Permitted stalling time for rotor
1)
Operation mode 0 = Not in use; 1 = IIt; 2 = IIt & Stall
Start current S72 1.0...10.0 x In 2.0 R/W Starting current for motor
Start time S73 0.3...250.0 s 5.0 R/W Starting time for motor
Time limit S74 1.0...500.0 s 10.0 R/W Time-based restart inhibit limit
Countdown rate S75 2.0...250.0 s/h 60.0 R/W Countdown rate for the time counter
Stall time S76 2.0...120.0 s 10.0 R/W Permitted stalling time for rotor
1)
Operation mode 0 = Not in use; 1 = IIt; 2 = IIt & Stall
10
Substation Automation MotStart
Event mask 1 V101 0...255 - 63 R/W Event mask 1 for event transmission
(E0 ... E7)
Event mask 2 V103 0...255 - 63 R/W Event mask 2 for event transmission
(E0 ... E7)
Event mask 3 V105 0...255 - 63 R/W Event mask 3 for event transmission
(E0 ... E7)
Event mask 4 V107 0...255 - 63 R/W Event mask 4 for event transmission
(E0 ... E7)
1)
Group selection 0 = Group 1; 1 = Group 2; 2 = GROUP input
2)
Active group 0 = Group 1; 1 = Group 2
3)
Trip signal 0 = Non-latching; 1 = Latching
4)
Testing 0 = Do not activate; 1 = Activate
11
MotStart Substation Automation
3.3.3.1 General
The information required for later fault analysis is recorded at the rising and falling
edge of start or when the function block trips. Tripping can be caused by either the I2
x t function or the stalling function. In case both the I2 x t function and the stalling
function operate, only the first one is recorded.
The data of three last operations (operation 1...3) are recorded and the values of the
latest operation always replace the data of the oldest operation. The registers are
updated in the following order: Operation 1, Operation 2, Operation 3, Operation 1,
Operation 2,...
12
Substation Automation MotStart
The time stamp indicates the rising edge of the START signal and will be updated in
case the function block trips or stalls.
The duration of the start-up situation is recorded both in seconds and as a percentage
of the set operate time. The duration is updated for both IIT and STALL either at the
falling edge of the START signal i.e. when the motor start-up situation is over, or
when the TRIP or STALL output becomes active.
3.3.3.4 Currents
An average for each of the phase currents IL1, IL2 and IL3 is calculated during the start
situation i.e. the time from the rising edge of the START signal until its falling edge
or until the function block trips or stalls. The values of the phase currents IL1, IL2 and
Iy are recorded as multiples of the rated current In.
The status data of the Active group parameter, which indicates the setting group
valid for the recorded data, is recorded at the moment of triggering.
13
MotStart Substation Automation
14
Substation Automation MotStart
3.3.4 Events
15
MotStart Substation Automation
F -
16
1MRS100038 (NEF1Low) RE_5_ _
1MRS100039 (NEF1High) Non-Directional
1MRS100090 (NEF1Inst)
Issued: 10/1997 Earth-Fault Protection
Version: E
Low-Set Stage (NEF1Low)
Data subject to change without notice
High-Set Stage (NEF1High)
Instantaneous Stage (NEF1Inst)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 3
2. Description of Operation.......................................................................... 4
2.1 Configuration....................................................................................... 4
2.2 Measuring mode ................................................................................. 4
2.3 Operation criteria................................................................................. 4
2.4 Delayed reset facility and drop-off time in DT mode ............................ 5
2.5 IDMT type operation of NEF1Low ....................................................... 6
2.5.1 Standard curve groups ............................................................... 6
2.5.2 RI curve groups.......................................................................... 8
2.5.3 RD curve groups ........................................................................ 8
2.6 Setting groups ..................................................................................... 8
2.7 Test mode ........................................................................................... 9
2.8 START, TRIP and CBFP outputs ........................................................ 9
2.9 Resetting........................................................................................... 10
3. Parameters and Events .......................................................................... 11
3.1 General ............................................................................................. 11
3.2 Setting values.................................................................................... 12
3.2.1 Actual settings.......................................................................... 12
3.2.2 Setting group 1......................................................................... 13
3.2.3 Setting group 2......................................................................... 14
3.2.4 Control settings ........................................................................ 15
3.3 Measurement values ......................................................................... 17
3.3.1 Input data ................................................................................. 17
3.3.2 Output data .............................................................................. 18
3.3.3 Recorded data.......................................................................... 18
3.3.4 Events ...................................................................................... 23
4. Technical Data ........................................................................................ 24
RE_5_ _ NEF1Low, NEF1High, NEF1Inst ABB Automation
1. Introduction
1.1 Features
1.2 Application
The non-directional earth-fault protection function blocks are designed for non-
directional earth-fault protection whenever the DT characteristic or, as concerns
NEF1Low, the IDMT (Inverse Definite Minimum Time) characteristic is appropriate.
Suppression of harmonics is possible.
2
ABB Automation NEF1Low, NEF1High, NEF1Inst RE_5_ _
)LJXUH )XQFWLRQEORFNV\PEROVRI1()/RZ1()+LJKDQG1(),QVW
3
RE_5_ _ NEF1Low, NEF1High, NEF1Inst ABB Automation
2.1 Configuration
The measuring devices and signal types for analogue channels are selected and
configured in a special dialogue box of the Relay Configuration Tool included in the
CAP 505 Tool Box. Digital inputs are configured in the same programming
environment (the number of selectable analogue inputs, digital inputs and digital
outputs depends on the type of the hardware used).
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The neutral current I0 can be connected to
the Io input of the function block. Furthermore, digital inputs are connected to the
boolean inputs of the function block and in the same way, the outputs of the function
block are connected to the output signals.
The operation of the function block is based on two alternative measuring principles:
the average value of consecutive instantaneous peak-to-peak values or the numerically
calculated fundamental frequency component of the neutral current. The measuring
mode is selected by means of an MMI parameter or a serial communication
parameter.
With both the measuring principles, the operation is insensitive to the DC component
and the operation accuracy is defined in the frequency range f/fn=0.95...1.05. In peak-
to-peak measurement, the harmonics of the neutral current are not suppressed,
whereas in fundamental frequency measurement the harmonics suppression is about
-50 dB at f = n x fn, where n = 2, 3, 4, 5,...
The function block starts if the neutral current exceeds the set start current. When the
function block starts, the START signal is set to TRUE. Should the duration of the
earth fault exceed the set definite operate time or, at the inverse-time operation, the
4
ABB Automation NEF1Low, NEF1High, NEF1Inst RE_5_ _
time determined by the level of the measured current, the function block operates. The
delay of the heavy-duty output relay is included in the total operate time. When the
function block operates, the TRIP signal is set to TRUE.
The DT or IDMT timer is allowed to run only if the blocking signal BS1 is inactive,
i.e. its value is FALSE. When the signal becomes active, i.e. its value turns to TRUE,
the timer will be stopped (frozen).
When the blocking signal BS2 is active, the TRIP signal cannot be activated. The
TRIP signal can be blocked by activating the signal BS2 until the function block
drops off.
The purpose of the delayed reset function is to enable fast clearance of intermittent
faults, e.g. self-sealing insulation faults, and severe faults which may produce high
asymmetrical fault currents that partially saturate the current transformers. It is typical
for an intermittent fault that the fault current contains so-called drop-off periods
during which the fault current is below the set start current. Without the delayed reset
function the DT timer would reset once the current drops off. In the same way, an
apparent drop-off period of the secondary current of the saturated current transformer
might reset the DT timer. The adjustable delayed reset function also enables closer
co-ordination with electromechanical induction disc relays.
When the DT timer has started, it goes on running as normally even if the current
drops off, provided the drop-off period is shorter than the set drop-off time. If the
drop-off period is longer than the set drop-off time, the DT timer will reset when the
drop-off time elapses (Figure 3).
In Figures 3 and 4 the input signal IN of the DT timer is TRUE when the current is
above the set start value and FALSE when the current is below the set start value.
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff1.fh7
Operate time
Operate
timer
)LJXUH 7KHGURSRIISHULRGLVORQJHUWKDQWKHVHWGURSRIIWLPH
5
RE_5_ _ NEF1Low, NEF1High, NEF1Inst ABB Automation
If the drop-off period is shorter than the set drop-off time and the DT timer time has
elapsed during the drop-off period, the function block will trip once the current
exceeds the set value again (Figure 4).
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff2.fh7
Operate time
Operate
timer
)LJXUH 7KHGURSRIISHULRGLVVKRUWHUWKDQWKHVHWGURSRIIWLPH
At the inverse-time mode of NEF1Low, the operate time is a function of the current;
the higher the current, the shorter is the operate time. Six time/current curve groups
are available. Four of the groups comply with the standards BS 142 and IEC 60255,
whereas the two curve groups RI and RD (RXIDG) are special type of curve groups
corresponding to the ABB praxis. The setting Operation mode is used for selecting
the desired operate time characteristic.
6
ABB Automation NEF1Low, NEF1High, NEF1Inst RE_5_ _
The relationship between time and current is in accordance with the standard IEC
60255-4 and can be expressed as follows
kx
t[s] =
I
( ) 1
I>
where
Inverse-time
characteristic
Normal inverse 0.02 0.14
Very inverse 1.0 13.5
Extremely inverse 2.0 80.0
Long-time inverse 1.0 120
According to the standard BS 142: 1966 the effective current range is defined as
2...20 times the set start current. If the time/current characteristic is normal inverse,
very inverse or extremely inverse, the function has to start at the latest when the
current exceeds the set start current by 1.3 times. For the long-time inverse
characteristic, the effective current range is specified to be 2...7 times the set start
current and the relay is to start at the latest when the current exceeds the setting value
by 1.1 times. The function block NEF1Low will start and the IDMT integration will
begin once the current exceeds the set start current.
The operate time tolerances specified by the standard BS 142 : 1966 are the following
(E denotes the accuracy in per cent):
7
RE_5_ _ NEF1Low, NEF1High, NEF1Inst ABB Automation
The tolerance factors have to be smaller than those defined by the standard BS 142:
1966 for currents 2 and 5 times the setting. The NEF1Low complies with the
tolerances of class 5 (E = 5.0%) for all inverse-time curves.
For example:
k
t s =
I>
0. 339 0. 236 x
I
I
t[s] = 5. 8 -1. 35 x ln
k x I>
The accuracy of the RI- and RD-type characteristics is 5%. Also with the RI- and RD-
type characteristics, the function block will start and the IDMT integration will begin
once the current exceeds the set start current.
Two different groups of setting values, group 1 and group 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
8
ABB Automation NEF1Low, NEF1High, NEF1Inst RE_5_ _
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The output signal START is always pulse-shaped. The minimum pulse width of the
corresponding output signal is set via a separate parameter on the MMI or on serial
communication. If the start situation is longer than the set pulse width, the START
signal remains active until the start situation is over. The output signal TRIP may
have a non-latching or latching feature. When the latching mode has been selected,
the TRIP signal remains active until the output is reset even if the operation criteria
have reset.
The circuit-breaker failure protection function provides a delayed trip signal CBFP
after the TRIP signal unless the fault has disappeared during the set CBFP time delay.
The CBFP output can be used to operate a circuit breaker in front of the circuit
breaker of the feeder. The control parameter Trip pulse also sets the pulse width of
the CBFP output signal.
9
RE_5_ _ NEF1Low, NEF1High, NEF1Inst ABB Automation
2.9 Resetting
The TRIP output signal and the registers can be reset either via the RESET input, or
over the serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
10
ABB Automation NEF1Low, NEF1High, NEF1Inst RE_5_ _
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for NEF1Low is 38, that for NEF1High 39 and
that for NEF1Inst 90.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
11
RE_5_ _ NEF1Low, NEF1High, NEF1Inst ABB Automation
NEF1Low
12
ABB Automation NEF1Low, NEF1High, NEF1Inst RE_5_ _
NEF1Low
13
RE_5_ _ NEF1Low, NEF1High, NEF1Inst ABB Automation
NEF1Low
14
ABB Automation NEF1Low, NEF1High, NEF1Inst RE_5_ _
NEF1Low
15
RE_5_ _ NEF1Low, NEF1High, NEF1Inst ABB Automation
16
ABB Automation NEF1Low, NEF1High, NEF1Inst RE_5_ _
NEF1Low
17
RE_5_ _ NEF1Low, NEF1High, NEF1Inst ABB Automation
3.3.3.1 General
The information required for later fault analysis is recorded when the function block
starts or trips, or when the recording function is triggered via an external triggering
input.
The data of three last operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
The recording function can be blocked via the BSREG input. For example, if an auto-
reclose sequence is initiated by the trip signal of the function block, the values most
reliable for later fault analysis are those recorded just before Shot 1. When the auto-
reclose sequence has started, no recordings are needed at the moment of tripping. The
output signal ACTIVE in AR5Func indicating AR in progress is connected to the
BSREG input to prevent useless recording.
The time stamp indicates the rising edge of the START, TRIP or TRIGG signal.
3.3.3.3 Duration
If the function block trips, the current values are updated at the moment of tripping
i.e. on the rising edge of the signal TRIP. For external triggering the current values are
18
ABB Automation NEF1Low, NEF1High, NEF1Inst RE_5_ _
updated at the moment of triggering i.e. on the rising edge of the input signal TRIGG.
If the function block starts but does not trip, the neutral current value captured one
fundamental cycle (20 ms at rated frequency 50 Hz) after the beginning of the start
situation is recorded. The value of the neutral current I0 is recorded as a multiple of
the rated current In.
The status data of the input signals BS1 and BS2 as well as the Active group
parameter are recorded at the moment of triggering. The Active group parameter
indicates the setting group valid for the recorded data.
3.3.3.6 Priority
1 Tripping
2 Starting
3 External triggering,
which means that if the function block has started, it will neglect an external
triggering request.
19
RE_5_ _ NEF1Low, NEF1High, NEF1Inst ABB Automation
NEF1Low
20
ABB Automation NEF1Low, NEF1High, NEF1Inst RE_5_ _
NEF1Low
21
RE_5_ _ NEF1Low, NEF1High, NEF1Inst ABB Automation
NEF1Low
22
ABB Automation NEF1Low, NEF1High, NEF1Inst RE_5_ _
3.3.4 Events
23
RE_5_ _ NEF1Low, NEF1High, NEF1Inst ABB Automation
NEF1Low:
Reset time 40...1000 ms (depends on the set minimum output pulse width)
NEF1High B -
NEF1Inst B -
24
1MRS752308-MUM NEF1_
Issued: 10/1997
Version: F/03.05.2002
Non-Directional
Earth-Fault Protection
Low-Set Stage (NEF1Low)
High-Set Stage (NEF1High)
Data subject to change without notice Instantaneous Stage (NEF1Inst)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 3
2. Description of operation .......................................................................... 4
2.1 Configuration....................................................................................... 4
2.2 Measuring mode ................................................................................. 4
2.3 Operation criteria................................................................................. 4
2.4 Delayed reset facility and drop-off time in DT and IDMT modes.......... 5
2.5 IDMT type operation of NEF1Low ....................................................... 6
2.5.1 Standard curve groups ............................................................... 7
2.5.2 RI curve groups.......................................................................... 8
2.5.3 RD curve groups ........................................................................ 8
2.5.4 IEEE curve groups ..................................................................... 9
2.6 Setting groups ..................................................................................... 9
2.7 Test mode ......................................................................................... 10
2.8 START, TRIP and CBFP outputs ...................................................... 10
2.9 Resetting........................................................................................... 11
3. Parameters and events .......................................................................... 12
3.1 General ............................................................................................. 12
3.2 Setting values.................................................................................... 13
3.2.1 Actual settings.......................................................................... 13
3.2.2 Setting group 1......................................................................... 14
3.2.3 Setting group 2......................................................................... 15
3.2.4 Control settings ........................................................................ 16
3.3 Measurement values ......................................................................... 18
3.3.1 Input data ................................................................................. 18
3.3.2 Output data .............................................................................. 19
3.3.3 Recorded data.......................................................................... 19
3.3.4 Events ...................................................................................... 24
4. Technical data ........................................................................................ 25
NEF1_ Substation Automation
1. Introduction
1.1 Features
1.2 Application
The non-directional earth-fault protection function blocks are designed for non-
directional earth-fault protection whenever the DT characteristic or, as concerns
NEF1Low, the IDMT (Inverse Definite Minimum Time) characteristic is appropriate.
Suppression of harmonics is possible.
2
Substation Automation NEF1_
)LJXUH )XQFWLRQEORFNV\PEROVRI1()/RZ1()+LJKDQG1(),QVW
3
NEF1_ Substation Automation
2.1 Configuration
The measuring devices and signal types for analogue channels are selected and
configured in a special dialogue box of the Relay Configuration Tool included in the
CAP 505 Tool Box. Digital inputs are configured in the same programming
environment (the number of selectable analogue inputs, digital inputs and digital
outputs depends on the type of the hardware used).
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The neutral current I0 can be connected to
the Io input of the function block. Furthermore, digital inputs are connected to the
Boolean inputs of the function block and in the same way, the outputs of the function
block are connected to the output signals.
The operation of the function block is based on two alternative measuring principles:
the average value of consecutive instantaneous peak-to-peak values or the numerically
calculated fundamental frequency component of the neutral current. The measuring
mode is selected by means of an HMI parameter or a serial communication parameter.
With both the measuring principles, the operation is insensitive to the DC component
and the operation accuracy is defined in the frequency range f/fn=0.95...1.05. In peak-
to-peak measurement, the harmonics of the neutral current are not suppressed,
whereas in fundamental frequency measurement the harmonics suppression is at least
-50 dB at f = n x fn, where n = 2, 3, 4, 5,...
The function block starts if the neutral current exceeds the set start current. When the
function block starts, the START signal is set to TRUE. Should the duration of the
earth fault exceed the set definite operate time or, at the inverse-time operation, the
time determined by the level of the measured current, the function block operates. The
4
Substation Automation NEF1_
internal delay of the heavy-duty output relay is included in the total operate time.
When the function block operates, the TRIP signal is set to TRUE. Operation mode
instantaneous is selectable in the function blocks NEF1High and NEF1Inst. In
instantaneous mode the TRIP signal is immediately activated.
The DT or IDMT timer is allowed to run only if the blocking signal BS1 is inactive,
i.e. its value is FALSE. When the signal becomes active, i.e. its value turns to TRUE,
the timer will be stopped (frozen).
When the blocking signal BS2 is active, the TRIP signal cannot be activated. The
TRIP signal can be blocked by activating the signal BS2 until the function block
drops off.
2.4 Delayed reset facility and drop-off time in DT and IDMT modes
The purpose of the delayed reset function is to enable fast clearance of intermittent
faults, e.g. self-sealing insulation faults, and severe faults which may produce high
asymmetrical fault currents that partially saturate the current transformers. It is typical
for an intermittent fault that the fault current contains so-called drop-off periods
during which the fault current is below the set start current. Without the delayed reset
function the DT or the IDMT timer would reset once the current drops off. In the
same way, an apparent drop-off period of the secondary current of the saturated
current transformer might reset the DT or the IDMT timer. The adjustable delayed
reset function also enables closer co-ordination with electromechanical induction disc
relays.
When the DT timer has started, it goes on running normally even if the current drops
off, provided the drop-off period is shorter than the set drop-off time. In the same
situation, the IDMT timer is frozen. If the drop-off period is longer than the set drop-
off time, the DT or the IDMT timer will be reset when the drop-off time elapses. The
situation in the case of the DT timer is described in Figure 2.4.-1.
In Figures 2.4.-1 and 2.4.-2 the input signal IN of the DT timer is TRUE when the
current is above the set start value and FALSE when the current is below the set start
value.
5
NEF1_ Substation Automation
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff1.fh7
Operate time
Operate
timer
)LJXUH 7KHGURSRIISHULRGLVORQJHUWKDQWKHVHWGURSRIIWLPH
If the drop-off period is shorter than the set drop-off time and the DT timer time has
elapsed during the drop-off period, the function block will trip once the current
exceeds the set value again (Figure 2.4.-2).
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff2.fh7
Operate time
Operate
timer
)LJXUH 7KHGURSRIISHULRGLVVKRUWHUWKDQWKHVHWGURSRIIWLPH
In the inverse-time mode, the operate time of the stage is a function of the current.
The higher the current, the shorter the operate time is. Fourteen time/current curve
groups are available. Four of the groups comply with the BS 142 and IEC 60255
standards, whereas the two curve groups RI and RD (RXIDG) are special type of
curve groups corresponding to the ABB praxis. Eight IEEE curves comply with the
IEEE C37.112 standard. The setting "Operation mode" is used for selecting the
desired operate time characteristic.
6
Substation Automation NEF1_
The relationship between time and current is in accordance with the standard IEC
60255-4 and can be expressed as follows
kx
t[s] =
I
( ) 1
I>
where
I phase current
Inverse-time
characteristic
Normal inverse 0.02 0.14
Very inverse 1.0 13.5
Extremely inverse 2.0 80.0
Long-time inverse 1.0 120
According to the standard BS 142: 1966 the effective current range is defined as
2...20 times the set start current. If the time/current characteristic is normal inverse,
7
NEF1_ Substation Automation
very inverse or extremely inverse, the function has to start at the latest when the
current exceeds the set start current by 1.3 times. For the long-time inverse
characteristic, the effective current range is specified to be 2...7 times the set start
current and the relay is to start at the latest when the current exceeds the setting value
by 1.1 times. The function block NEF1Low will start and the IDMT integration will
begin once the current exceeds the set start current.
The operate time tolerances specified by the standard BS 142 : 1966 are the following
(E denotes the accuracy in percent):
The tolerance factors are in accordance to those defined by the standard BS 142: 1966
for currents 2 and 5 times the setting. The NEF1Low complies with the tolerances of
class 5 (E = 5.0%) for all inverse-time curves.
For example:
k
t s =
I>
0. 339 0. 236 x
I
8
Substation Automation NEF1_
I
t[s] = 5. 8 -1. 35 x ln
k x I>
The accuracy of the RI- and RD-type characteristics is 5%. Also with the RI- and RD-
type characteristics, the function block will start and the IDMT integration will begin
once the current exceeds the set start current.
IEEE time overcurrent curve equation according to the standard IEEE C37.112:
$
t[s] = 3
+ % Q
, 1
,>
where
n adjustable IEEE time dial setting, parameters S5, S45 and S75
Curve A B p
IEEE Extremely Inverse 6.407 0.025 2.0
IEEE Very Inverse 2.855 0.0712 2.0
IEEE Inverse 0.0086 0.0185 0.02
IEEE Short Time Inverse 0.00172 0.0037 0.02
IEEE Short Time Ext. Inverse 1.281 0.005 2.0
IEEE Long Time Ext. Inv. 64.07 0.250 2.0
IEEE Long Time Very Inv. 28.55 0.712 2.0
IEEE Long Time Inverse 0.086 0.185 0.02
Two different groups of setting values, group 1 and group 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
9
NEF1_ Substation Automation
3 By means of the input signal GROUP when allowed via the parameter Group
selection (i.e. when V3 = 21)).
1)
Group selection (V3): 0 = Group 1; 1 = Group 2; 2 = GROUP input
The group settings come into effect immediately after selection. The control
parameter "Active group" indicates that the setting group is valid at a given time.
The digital outputs of the function block can be activated with separate control
settings for each output either locally via the HMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The output signal START is always pulse-shaped. The minimum pulse width of the
corresponding output signal is set via a separate parameter on the HMI or on serial
communication. If the start situation is longer than the set pulse width, the START
signal remains active until the start situation is over. The output signal TRIP may
have a non-latching or latching feature. When the latching mode has been selected,
the TRIP signal remains active until the output is reset even if the operation criteria
have reset.
The circuit-breaker failure protection function provides a delayed trip signal CBFP
after the TRIP signal unless the fault has disappeared during the set CBFP time delay.
The CBFP output can be used to operate a circuit breaker in front of the circuit
breaker of the feeder. The control parameter Trip pulse also sets the pulse width of
the CBFP output signal.
10
Substation Automation NEF1_
2.9 Resetting
The TRIP output signal and the registers can be reset either via the RESET input, or
over the serial bus or the local HMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
11
NEF1_ Substation Automation
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for NEF1Low is 38, that for NEF1High 39 and
that for NEF1Inst 90.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the HMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / HMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the HMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
12
Substation Automation NEF1_
NEF1Low
13
NEF1_ Substation Automation
NEF1Low
IEEE time dial S45 0.5...15.0 - 0.5 R/W IEEE time dial n in IDMT
mode
1)
Operation mode 0 = Not in use; 1 = Definite time; 2 = Extremely inv.; 3 = Very inv.;
4 = Normal inv.; 5 = Long time inv.; 6 = RI-type inv.; 7 = RD-type inv.; 8 =
IEEE Ext.; 9 = IEEE Very inv.; 10 = IEEE Inverse; 11 = IEEE S.T. inv.; 12 =
IEEE S.T.E. inv; 13 = IEEE L.T.E. inv.; 14 = IEEE L.T.V. inv.; 15 = IEEE L.T.
inv.
14
Substation Automation NEF1_
NEF1Low
IEEE time dial S75 0.5...15.0 - 0.5 R/W IEEE time dial n in IDMT
mode
1)
Operation mode 0 = Not in use; 1 = Definite time; 2 = Extremely inv.; 3 = Very inv.;
4 = Normal inv.; 5 = Long time inv.; 6 = RI-type inv.; 7 = RD-type inv.; 8 =
IEEE Ext.; 9 = IEEE Very inv.; 10 = IEEE Inverse; 11 = IEEE S.T. inv.; 12 =
IEEE S.T.E. inv; 13 = IEEE L.T.E. inv.; 14 = IEEE L.T.V. inv.; 15 = IEEE L.T.
inv.
15
NEF1_ Substation Automation
NEF1Low
16
Substation Automation NEF1_
17
NEF1_ Substation Automation
NEF1Low
18
Substation Automation NEF1_
3.3.3.1 General
The information required for later fault analysis is recorded when the function block
starts or trips, or when the recording function is triggered via an external triggering
input.
The data of three last operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
The recording function can be blocked via the BSREG input. For example, if an auto-
reclose sequence is initiated by the trip signal of the function block, the values most
reliable for later fault analysis are those recorded just before Shot 1. When the auto-
reclose sequence has started, no recordings are needed at the moment of tripping. The
output signal ACTIVE in AR5Func indicating AR in progress is connected to the
BSREG input to prevent useless recording.
The time stamp indicates the rising edge of the START, TRIP or TRIGG signal.
3.3.3.3 Duration
If the function block trips, the current values are updated at the moment of tripping
i.e. on the rising edge of the signal TRIP. For external triggering the current values are
19
NEF1_ Substation Automation
updated at the moment of triggering i.e. on the rising edge of the input signal TRIGG.
If the function block starts but does not trip, the neutral current value captured one
fundamental cycle (20 ms at rated frequency 50 Hz) after the beginning of the start
situation is recorded. The value of the neutral current I0 is recorded as a multiple of
the rated current In.
The status data of the input signals BS1 and BS2 as well as the Active group
parameter are recorded at the moment of recording. The Active group parameter
indicates the setting group valid for the recorded data.
3.3.3.6 Priority
1 Tripping
2 Starting
3 External triggering,
which means that if the function block has started, it will neglect an external
triggering request.
20
Substation Automation NEF1_
NEF1Low
21
NEF1_ Substation Automation
NEF1Low
22
Substation Automation NEF1_
NEF1Low
23
NEF1_ Substation Automation
3.3.4 Events
24
Substation Automation NEF1_
NEF1Low:
Reset time 40...1000 ms (depends on the set minimum output pulse width)
0 No suppression
C -
NEF1High B -
C -
NEF1Inst B -
D -
25
1MRS100031 (NOC3Low) RE_5_ _
1MRS100032 (NOC3High) Three-Phase Non-Directional
1MRS100033 (NOC3Inst)
Issued: 10/1997 Overcurrent Protection
Version: E
Low-Set Stage (NOC3Low)
Data subject to change without notice
High-Set Stage (NOC3High)
Instantaneous Stage (NOC3Inst)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 4
1.4 Output description ............................................................................... 5
2. Description of Operation.......................................................................... 6
2.1 Configuration....................................................................................... 6
2.2 Measuring mode ................................................................................. 6
2.3 Operation criteria................................................................................. 6
2.4 Delayed reset facility and drop-off time in DT mode ............................ 7
2.5 IDMT type operation of NOC3Low ...................................................... 9
2.5.1 Standard curve groups ............................................................... 9
2.5.2 RI curve groups........................................................................ 10
2.5.3 RD curve groups ...................................................................... 11
2.6 Setting groups ................................................................................... 11
2.7 Test mode ......................................................................................... 11
2.8 START, TRIP, BSOUT and CBFP outputs ........................................ 12
2.9 Resetting........................................................................................... 12
3. Parameters and Events .......................................................................... 13
3.1 General ............................................................................................. 13
3.2 Setting values.................................................................................... 14
3.2.1 Actual settings.......................................................................... 14
3.2.2 Setting group 1......................................................................... 15
3.2.3 Setting group 2......................................................................... 16
3.2.4 Control settings ........................................................................ 17
3.3 Measurement values ......................................................................... 19
3.3.1 Input data ................................................................................. 19
3.3.2 Output data .............................................................................. 19
3.3.3 Recorded data.......................................................................... 20
3.3.4 Events ...................................................................................... 24
4. Technical Data ........................................................................................ 25
RE_5_ _ NOC3Low, NOC3High, NOC3Inst ABB Automation
1. Introduction
1.1 Features
1.2 Application
The three-phase non-directional overcurrent function blocks are designed for non-
directional two-phase and three-phase overcurrent and short-circuit protection
whenever the DT characteristic or, as concerns NOC3Low, the IDMT (Inverse
Definite Minimum Time) characteristic is appropriate. Suppression of harmonics is
possible.
2
ABB Automation NOC3Low, NOC3High, NOC3Inst RE_5_ _
)LJXUH )XQFWLRQEORFNV\PEROVRI12&/RZ12&+LJKDQG12&,QVW
3
RE_5_ _ NOC3Low, NOC3High, NOC3Inst ABB Automation
4
ABB Automation NOC3Low, NOC3High, NOC3Inst RE_5_ _
NOC3Low
5
RE_5_ _ NOC3Low, NOC3High, NOC3Inst ABB Automation
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The phase currents IL1, IL2 and IL3 are
connected to the corresponding IL1, IL2 and IL3 inputs of the function block.
Furthermore, digital inputs are connected to the boolean inputs of the function block
and in the same way, the outputs of the function block are connected to the output
signals.
The function block operates on two alternative measuring principles: the average
value of consecutive instantaneous peak-to-peak values or the numerically calculated
fundamental frequency component of the short-circuit current. The measuring mode is
selected by means of either an MMI parameter or a serial communication parameter.
With both the measuring principles, the operation is insensitive to the DC component
and the operation accuracy is defined in the frequency range f/fn=0.95...1.05. In peak-
to-peak measurement, the harmonics of the phase currents are not suppressed,
whereas in fundamental frequency measurement the harmonics suppression is about
-50 dB at f = n x fn, where n = 2, 3, 4, 5,...
The function starts if the current in one or more phases exceeds the set start current.
The set start current is automatically doubled when the signal connected to the input
DOUBLE is active. The automatic doubling function can be used, e.g. during a
magnetizing inrush or at start-up.
6
ABB Automation NOC3Low, NOC3High, NOC3Inst RE_5_ _
)LJXUH )XQFWLRQRIWKH'28%/(LQSXW
When the function block starts, the START signal is set to TRUE. Should the
overcurrent situation exceed the set definite operate time or, at the inverse-time
operation, the time determined by the level of the measured current, the function
block operates. The delay of the heavy-duty output relay is included in the total
operate time. When the function block operates, the TRIP signal is set to TRUE.
Additionally, the function blocks NOC3High and NOC3Inst have a fast blocking
output to be used in interlocking-based busbar protection. Once a phase current
exceeds the set start current, the BSOUT signal is set to TRUE. The BSOUT signal
remains active for at least 20 ms. The START output is set to TRUE if at least one
digitally filtered phase current exceeds the start current. If the START signal is not
activated within the 20 ms, the signal BSOUT will reset.
The DT ot IDMT timer is allowed to run only if the blocking signal BS1 is inactive,
i.e. its value is FALSE. When the signal becomes active, i.e. its value turns to TRUE,
the timer will be stopped (frozen).
When the blocking signal BS2 is active, the TRIP signal cannot be activated. The
TRIP signal can be blocked by activating the signal BS2 until the function block
drops off.
The purpose of the delayed reset function is to enable fast clearance of intermittent
faults, e.g. self-sealing insulation faults, and severe faults which may produce high
asymmetrical fault currents that partially saturate the current transformers. It is typical
for an intermittent fault that the fault current contains so- called drop-off periods
during which the fault current is below the set start current. Without the delayed reset
function the DT timer would reset once the current drops off. In the same way, an
apparent drop-off period of the secondary current of the saturated current transformer
7
RE_5_ _ NOC3Low, NOC3High, NOC3Inst ABB Automation
might reset the DT timer. The adjustable delayed reset function also enables closer
co-ordination with electromechanical induction disc relays.
When the DT timer has started, it goes on running as normally even if the current
drops off, provided the drop-off period is shorter than the set drop-off time. If the
drop-off period is longer than the set drop-off time, the DT timer will reset when the
drop-off time elapses (Figure 4).
In Figures 4 and 5 the input signal IN of the DT timer is TRUE when the current is
above the set start value and FALSE when the current is below the set start value.
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff1.fh7
Operate time
Operate
timer
)LJXUH 7KHGURSRIISHULRGLVORQJHUWKDQWKHVHWGURSRIIWLPH
If the drop-off period is shorter than the set drop-off time and the DT timer time has
elapsed during the drop-off period, the function block will trip once the current
exceeds the set value again (Figure 5).
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff2.fh7
Operate time
Operate
timer
)LJXUH 7KHGURSRIISHULRGLVVKRUWHUWKDQWKHVHWGURSRIIWLPH
8
ABB Automation NOC3Low, NOC3High, NOC3Inst RE_5_ _
At the inverse-time mode of NOC3Low the operate time is a function of the current;
the higher the current, the shorter is the operate time. Six time/current curve groups
are available. Four of the groups comply with the BS 142 and IEC 60255 standards,
whereas the two curve groups RI and RD (RXIDG) are special type of curve groups
corresponding to the ABB praxis. The setting Operation mode is used for selecting
the desired operate time characteristic. (For a graphical presentation of the curves,
refer to the manual Technical Descriptions of Functions, Introduction.)
kx
t[s] =
I
( ) 1
I>
where
9
RE_5_ _ NOC3Low, NOC3High, NOC3Inst ABB Automation
Inverse-time
characteristic
Normal inverse 0.02 0.14
Very inverse 1.0 13.5
Extremely inverse 2.0 80.0
Long-time inverse 1.0 120
According to the standard BS 142: 1966 the effective current range is defined as
2...20 times the set start current. If the time/current characteristic is normal inverse,
very inverse or extremely inverse, the function has to start at the latest when the
current exceeds the set start current by 1.3 times. For the long-time inverse
characteristic, the effective current range is specified to be 2...7 times the set start
current and the relay is to start at the latest when the current exceeds the setting value
by 1.1 times. The three-phase non-directional overcurrent function block NOC3Low
will start and the IDMT integration will begin once the current exceeds the set start
value.
The operate time tolerances specified by the standard BS 142 : 1966 are the following
(E denotes the accuracy in per cent):
The tolerance factors have to be smaller than those defined by the standard BS 142:
1966 for currents 2 and 5 times the setting. The function block NOC3Low complies
with the tolerances of class 5 (E = 5.0%) for all inverse-time curves.
For example:
10
ABB Automation NOC3Low, NOC3High, NOC3Inst RE_5_ _
k
t s =
I>
0. 339 0. 236 x
I
I
t[s] = 5. 8 -1. 35 x ln
k x I>
The accuracy of the RI- and RD-type characteristics is 5%. Also with the RI- and RD-
type characteristics, the function block will start and the IDMT integration will begin
once the current exceeds the set start current.
Two different groups of setting values, group 1 and group 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
11
RE_5_ _ NOC3Low, NOC3High, NOC3Inst ABB Automation
The output signal START is always pulse-shaped. The minimum pulse width of the
START and TRIP output signals is set via a separate parameter on the MMI or on
serial communication. If the start situation is longer than the set pulse width, the
START signal remains active until the start situation is over. The output signal TRIP
may have a non-latching or latching feature. When the latching mode has been
selected, the TRIP signal remains active until the output is reset even if the operation
criteria have reset.
The output signal BSOUT of NOC3High and NOC3Inst is always pulse-shaped with
the minimum width of 20 ms.
The function block provides a delayed trip signal CBFP after the TRIP signal unless
the fault has disappeared during the set CBFP time delay. In circuit-breaker failure
protection, the CBFP output can be used to operate a circuit breaker in front of the
circuit breaker of the feeder. The control parameter Trip pulse also sets the width of
the CBFP output signal.
2.9 Resetting
The TRIP output signal and the registers can be reset either via the RESET input, or
over the serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
12
ABB Automation NOC3Low, NOC3High, NOC3Inst RE_5_ _
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for NOC3Low is 31, that for NOC3High 32
and that for NOC3Inst 33.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
13
RE_5_ _ NOC3Low, NOC3High, NOC3Inst ABB Automation
NOC3Low
14
ABB Automation NOC3Low, NOC3High, NOC3Inst RE_5_ _
NOC3Low
15
RE_5_ _ NOC3Low, NOC3High, NOC3Inst ABB Automation
NOC3Low
16
ABB Automation NOC3Low, NOC3High, NOC3Inst RE_5_ _
NOC3Low
17
RE_5_ _ NOC3Low, NOC3High, NOC3Inst ABB Automation
18
ABB Automation NOC3Low, NOC3High, NOC3Inst RE_5_ _
NOC3Low
19
RE_5_ _ NOC3Low, NOC3High, NOC3Inst ABB Automation
3.3.3.1 General
The information required for later fault analysis is recorded when the function block
starts or trips, or when the recording function is triggered via an external triggering
input.
The data of three last operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
The recording function can be blocked via the BSREG input. For example, if an auto-
reclose sequence is initiated by the trip signal of the function block, the values most
reliable for later fault analysis are those recorded just before Shot 1. When the auto-
reclose sequence has started, no recordings are needed at the moment of tripping. The
output signal ACTIVE in AR5Func indicating AR in progress is connected to the
BSREG input to prevent useless recording.
The time stamp indicates the rising edge of the START, TRIP or TRIGG signal.
3.3.3.3 Duration
20
ABB Automation NOC3Low, NOC3High, NOC3Inst RE_5_ _
3.3.3.4 Currents
If the function block trips, the current values are updated at the moment of tripping
i.e. on the rising edge of the TRIP signal. For external triggering, the current values
are updated at the moment of triggering i.e. on the rising edge of the input signal
TRIGG. If the function block starts but does not trip, the current values captured one
fundamental cycle (20 ms at rated frequency 50 Hz) after the beginning of the start
situation are recorded. So the values of the phase currents IL1, I L2 and I L3 always
originate from the same moment and are recorded as multiples of the rated current In.
The status data of the input signals BS1, BS2 and DOUBLE as well as the Active
group parameter are recorded at the moment of triggering. The Active group
parameter indicates the setting group valid for the recorded data.
3.3.3.6 Priority
1 Tripping
2 Starting
3 External triggering,
which means that if the function block has started, it will neglect an external
triggering request.
21
RE_5_ _ NOC3Low, NOC3High, NOC3Inst ABB Automation
22
ABB Automation NOC3Low, NOC3High, NOC3Inst RE_5_ _
23
RE_5_ _ NOC3Low, NOC3High, NOC3Inst ABB Automation
3.3.4 Events
NOC3Low
24
ABB Automation NOC3Low, NOC3High, NOC3Inst RE_5_ _
f/fn = 0.95...1.05
Reset time 40...1000 ms (depends on the minimum pulse width set for the
TRIP output)
25
1MRS752309-MUM NOC3_
Issued: 10/1997
Version: F/03.05.2002
Three-Phase Non-Directional
Overcurrent Protection
Low-Set Stage (NOC3Low)
High-Set Stage (NOC3High)
Data subject to change without notice Instantaneous Stage (NOC3Inst)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 4
2. Description of operation .......................................................................... 5
2.1 Configuration....................................................................................... 5
2.2 Measuring mode ................................................................................. 5
2.3 Operation criteria................................................................................. 5
2.4 Delayed reset facility and drop-off time in DT and IDMT modes.......... 6
2.5 IDMT type operation of NOC3Low ...................................................... 8
2.5.1 Standard curve groups ............................................................... 8
2.5.2 RI curve groups........................................................................ 10
2.5.3 RD curve groups ...................................................................... 10
2.5.4 IEEE curve groups ................................................................... 10
2.6 Setting groups ................................................................................... 11
2.7 Test mode ......................................................................................... 11
2.8 START, TRIP, BSOUT and CBFP outputs ........................................ 12
2.9 Resetting........................................................................................... 12
3. Parameters and events .......................................................................... 13
3.1 General ............................................................................................. 13
3.2 Setting values.................................................................................... 14
3.2.1 Actual settings.......................................................................... 14
3.2.2 Setting group 1......................................................................... 15
3.2.3 Setting group 2......................................................................... 16
3.2.4 Control settings ........................................................................ 17
3.3 Measurement values ......................................................................... 19
3.3.1 Input data ................................................................................. 19
3.3.2 Output data .............................................................................. 19
3.3.3 Recorded data.......................................................................... 20
3.3.4 Events ...................................................................................... 24
4. Technical data ........................................................................................ 25
NOC3_ Substation Automation
1. Introduction
1.1 Features
1.2 Application
The three-phase non-directional overcurrent function blocks are designed for non-
directional two-phase and three-phase overcurrent and short-circuit protection
whenever the DT characteristic or, as concerns NOC3Low, the IDMT (Inverse
Definite Minimum Time) characteristic is appropriate. Suppression of harmonics is
possible.
2
Substation Automation NOC3_
)LJXUH )XQFWLRQEORFNV\PEROVRI12&/RZ12&+LJKDQG12&,QVW
3
NOC3_ Substation Automation
NOC3Low
4
Substation Automation NOC3_
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The phase currents IL1, IL2 and IL3 are
connected to the corresponding IL1, IL2 and IL3 inputs of the function block. At least
one phase current is required to be connected. Furthermore, digital inputs are
connected to the Boolean inputs of the function block and in the same way, the
outputs of the function block are connected to the output signals.
The function block operates on two alternative measuring principles: the average
value of consecutive instantaneous peak-to-peak values or the numerically calculated
fundamental frequency component of the short-circuit current. The measuring mode is
selected by means of either an HMI parameter or a serial communication parameter.
With both the measuring principles, the operation is insensitive to the DC component
and the operation accuracy is defined in the frequency range f/fn=0.95...1.05. In peak-
to-peak measurement, the harmonics of the phase currents are not suppressed,
whereas in fundamental frequency measurement the harmonics suppression is at least
-50 dB at f = n x fn, where n = 2, 3, 4, 5,...
The function starts if the current in one or more phases exceeds the set start current.
The set start current is automatically doubled when the signal connected to the input
DOUBLE is active. The function block Inrush3 can be used for doubling, e.g. during a
magnetizing inrush or at start-up.
5
NOC3_ Substation Automation
)LJXUH )XQFWLRQRI12&/RZ12&+LJKDQG12&,QVWZKHQWKH'28%/(
LQSXWLVDFWLYDWHGE\WKH,QUXVKIXQFWLRQEORFN
When the function block starts, the START signal is set to TRUE. Should the
overcurrent situation exceed the set definite operate time or, at the inverse-time
operation, the time determined by the level of the measured current, the function
block operates. The internal delay of the heavy-duty output relay is included in the
total operate time. When the function block operates, the TRIP signal is set to TRUE.
Operation mode instantaneous is selectable in the function blocks NOC3High and
NOC3Inst. In instantaneous mode the TRIP signal is set active immediately.
Additionally, the function blocks NOC3High and NOC3Inst have a fast blocking
output to be used in interlocking-based busbar protection. Once a phase current
exceeds the set start current, the BSOUT signal is set to TRUE. The BSOUT signal
remains active for at least 20 ms. The START output is set to TRUE if at least one
digitally filtered phase current exceeds the start current. If the START signal is not
activated within the 20 ms, the signal BSOUT will reset.
The DT or IDMT timer is allowed to run only if the blocking signal BS1 is inactive,
i.e. its value is FALSE. When the signal becomes active, i.e. its value turns to TRUE,
the timer will be stopped (frozen).
When the blocking signal BS2 is active, the TRIP signal cannot be activated. The
TRIP signal can be blocked by activating the signal BS2 until the function block
drops off.
2.4 Delayed reset facility and drop-off time in DT and IDMT modes
The purpose of the delayed reset function is to enable fast clearance of intermittent
faults, e.g. self-sealing insulation faults, and severe faults which may produce high
asymmetrical fault currents that partially saturate the current transformers. It is typical
for an intermittent fault that the fault current contains so called drop-off periods
during which the fault current is below the set start current. Without the delayed reset
6
Substation Automation NOC3_
function the DT or the IDMT timer would reset once the current drops off. In the
same way, an apparent drop-off period of the secondary current of the saturated
current transformer might reset the DT or the IDMT timer. The adjustable delayed
reset function also enables closer co-ordination with electromechanical induction disc
relays.
When the DT timer has started, it goes on running as normally even if the current
drops off, provided the drop-off period is shorter than the set drop-off time. In the
same situation, the IDMT timer is frozen. If the drop-off period is longer than the set
drop-off time, the DT or the IDMT timer will be reset when the drop-off time elapses.
The situation in the case of the DT timer is described in Figure 2.4.-1.
In Figures 2.4.-1 and 2.4.-2 the input signal IN of the DT or the IDMT timer is TRUE
when the current is above the set start value and FALSE when the current is below the
set start value.
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
)LJXUH 7KHGURSRIISHULRGLVORQJHUWKDQWKHVHWGURSRIIWLPH
If the drop-off period is shorter than the set drop-off time and the DT timer time has
elapsed during the drop-off period, the function block will trip once the current
exceeds the set value again (Figure 2.4.-2).
7
NOC3_ Substation Automation
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff2.fh7
Operate time
Operate
timer
)LJXUH 7KHGURSRIISHULRGLVVKRUWHUWKDQWKHVHWGURSRIIWLPH
In the inverse-time mode the operate time of the stage is a function of the current; the
higher the current, the shorter is the operate time. Fourteen time/current curve groups
are available. Four of the groups comply with the BS 142 and IEC 60255 standards,
whereas the two curve groups RI and RD (RXIDG) are special type of curve groups
corresponding to the ABB praxis. Eight IEEE curves comply with the IEEE C37.112
standard. The setting "Operation mode" is used for selecting the desired operate time
characteristic.
8
Substation Automation NOC3_
kx
t[s] =
I
( ) 1
I>
where
I phase current
Inverse-time
characteristic
Normal inverse 0.02 0.14
Very inverse 1.0 13.5
Extremely inverse 2.0 80.0
Long-time inverse 1.0 120
According to the standard BS 142: 1966 the effective current range is defined as
2...20 times the set start current. If the time/current characteristic is normal inverse,
very inverse or extremely inverse, the function has to start at the latest when the
current exceeds the set start current by 1.3 times. For the long-time inverse
characteristic, the effective current range is specified to be 2...7 times the set start
current and the relay is to start at the latest when the current exceeds the setting value
by 1.1 times. The three-phase non-directional overcurrent function block NOC3Low
will start and the IDMT integration will begin once the current exceeds the set start
value.
The operate time tolerances specified by the standard BS 142 : 1966 are the following
(E denotes the accuracy in percent):
The tolerance factors are in accordance to those defined by the standard BS 142: 1966
for currents 2 and 5 times the setting. The function block NOC3Low complies with
the tolerances of class 5 (E = 5.0%) for all inverse-time curves.
9
NOC3_ Substation Automation
For example:
k
t s =
I>
0. 339 0. 236 x
I
I
t[s] = 5. 8 -1. 35 x ln
k x I>
The accuracy of the RI- and RD-type characteristics is 5%. Also with the RI- and RD-
type characteristics, the function block will start and the IDMT integration will begin
once the current exceeds the set start current.
IEEE time overcurrent curve equation according to the standard IEEE C37.112:
$
t[s] = S
+ % Q
, 1
,>
10
Substation Automation NOC3_
where I> adjustable start current, parameters S2, S42 and S72
Curve A B p
IEEE Extremely Inverse 6.407 0.025 2.0
IEEE Very Inverse 2.855 0.0712 2.0
IEEE Inverse 0.0086 0.0185 0.02
IEEE Short Time Inverse 0.00172 0.0037 0.02
IEEE Short Time Ext. Inverse 1.281 0.005 2.0
IEEE Long Time Ext. Inv. 64.07 0.250 2.0
IEEE Long Time Very Inv. 28.55 0.712 2.0
IEEE Long Time Inverse 0.086 0.185 0.02
Two different groups of setting values, group 1 and group 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
The group settings come into effect immediately after the selection. The control
parameter "Active group" indicates the setting group, which is valid at a given time.
The digital outputs of the function block can be activated with separate control
settings for each output either locally via the HMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
11
NOC3_ Substation Automation
The output signal START is always pulse-shaped. The minimum pulse width of the
START and TRIP output signals is set via a separate parameter on the HMI or on
serial communication. If the start situation is longer than the set pulse width, the
START signal remains active until the start situation is over. The output signal TRIP
may have a non-latching or latching feature. When the latching mode has been
selected, the TRIP signal remains active until the output is reset even if the operation
criteria have reset.
The output signal BSOUT of NOC3High and NOC3Inst is always pulse-shaped with
the minimum width of 20 ms.
The function block provides a delayed trip signal CBFP after the TRIP signal unless
the fault has disappeared during the set CBFP time delay. In circuit-breaker failure
protection, the CBFP output can be used to operate a circuit breaker in front of the
circuit breaker of the feeder. The control parameter Trip pulse also sets the width of
the CBFP output signal.
2.9 Resetting
The TRIP output signal and the registers can be reset either via the RESET input, or
over the serial bus or the local HMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
12
Substation Automation NOC3_
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for NOC3Low is 31, that for NOC3High 32
and that for NOC3Inst 33.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the HMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / HMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the HMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
13
NOC3_ Substation Automation
NOC3Low
14
Substation Automation NOC3_
NOC3Low
IEEE time dial S45 0.5...15.0 - 0.5 R/W IEEE time dial n in IDTM
mode
1)
Operation mode 0 = Not in use; 1 = Definite time; 2 = Extremely inv.; 3 = Very inv.;
4 = Normal inv.; 5 = Long time inv.; 6 = RI-type inv.; 7 = RD-type inv. .; 8 =
IEEE Ext.; 9 = IEEE Very inv.; 10 = IEEE Inverse; 11 = IEEE S.T. inv.; 12 =
IEEE S.T.E. inv; 13 = IEEE L.T.E. inv.; 14 = IEEE L.T.V. inv.; 15 = IEEE L.T.
inv.
15
NOC3_ Substation Automation
NOC3Low
IEEE time dial S75 0.5...15.0 - 0.5 R/W IEEE time dial n in IDMT
mode
1)
Operation mode 0 = Not in use; 1 = Definite time; 2 = Extremely inv.; 3 = Very inv.;
4 = Normal inv.; 5 = Long time inv.; 6 = RI-type inv.; 7 = RD-type inv. .; 8 =
IEEE Ext.; 9 = IEEE Very inv.; 10 = IEEE Inverse; 11 = IEEE S.T. inv.; 12 =
IEEE S.T.E. inv; 13 = IEEE L.T.E. inv.; 14 = IEEE L.T.V. inv.; 15 = IEEE L.T.
inv.
16
Substation Automation NOC3_
NOC3Low
17
NOC3_ Substation Automation
18
Substation Automation NOC3_
NOC3Low
19
NOC3_ Substation Automation
3.3.3.1 General
The information required for later fault analysis is recorded when the function block
starts or trips, or when the recording function is triggered via an external triggering
input.
The data of three last operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
The recording function can be blocked via the BSREG input. For example, if an auto-
reclose sequence is initiated by the trip signal of the function block, the values most
reliable for later fault analysis are those recorded just before Shot 1. When the auto-
reclose sequence has started, no recordings are needed at the moment of tripping. The
output signal ACTIVE in AR5Func indicating AR in progress is connected to the
BSREG input to prevent useless recording.
The time stamp indicates the rising edge of the START, TRIP or TRIGG signal.
3.3.3.3 Duration
20
Substation Automation NOC3_
3.3.3.4 Currents
If the function block trips, the current values are updated at the moment of tripping
i.e. on the rising edge of the TRIP signal. For external triggering, the current values
are updated at the moment of triggering i.e. on the rising edge of the input signal
TRIGG. If the function block starts but does not trip, the current values captured one
fundamental cycle (20 ms at rated frequency 50 Hz) after the beginning of the start
situation are recorded. So the values of the phase currents IL1, I L2 and I L3 always
originate from the same moment and are recorded as multiples of the rated current In.
The status data of the input signals BS1, BS2 and DOUBLE as well as the Active
group parameter are recorded at the moment of recording. The Active group
parameter indicates the setting group valid for the recorded data.
3.3.3.6 Priority
1 Tripping
2 Starting
3 External triggering,
which means that if the function block has started, it will neglect an external
triggering request.
21
NOC3_ Substation Automation
22
Substation Automation NOC3_
23
NOC3_ Substation Automation
3.3.4 Events
NOC3Low
24
Substation Automation NOC3_
f/fn = 0.95...1.05
Reset time 40...1000 ms (depends on the minimum pulse width set for the
TRIP output)
0 No suppression
NOC3High C
NOC3Inst C
25
1MRS100077 (NPS3Low) RE_5_ _
1MRS100078 (NPS3High) Negative-Phase-Sequence Protection
Issued: 10/1998
Version: C Low-Set Stage (NPS3Low)
Data subject to change without notice High-Set Stage (NPS3High)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 4
1.4 Output description ............................................................................... 4
2. Description of Operation.......................................................................... 5
2.1 Configuration....................................................................................... 5
2.2 Configuration error checking ............................................................... 6
2.3 Measuring mode ................................................................................. 6
2.4 Operation criteria................................................................................. 7
2.4.1 Definite-time operation ............................................................... 7
2.4.2 Inverse-time operation ............................................................... 9
2.5 Setting groups ................................................................................... 11
2.6 Test mode ......................................................................................... 11
2.7 START, TRIP and CBFP outputs ...................................................... 11
2.8 Resetting........................................................................................... 12
1. Introduction
1.1 Features
Negative-phase-sequence protection
Definite-time (DT) or inverse-time (IDMT) operation
Definite minimum time for high-level negative-sequence currents in inverse-time
operation
Limited maximum operate time for long-time low-level negative-sequence currents
in inverse-time operation
Adjustable start delay in inverse-time operation
Backwards counting when overload disappears in inverse-time mode
Current measurement with conventional current transformers or Rogowski coils
Two- or three-phase negative-sequence current measurement
Input signal for selecting the direction of rotation
Delayed trip output for the circuit-breaker failure protection (CBFP) function
Output for blocking the reconnection of an overheated machine
Wide setting ranges
1.2 Application
The function blocks NPS3Low and NPS3High are designed for negative-phase-
sequence protection whenever the operating characteristic is appropriate. They are
applied for the protection of power generators or synchronous motors against thermal
stress and damage.
(See Figure 5).
I2>
I2>>
)LJXUH 3URWHFWLRQGLDJUDPV\PEROVRI136/RZDQG136+LJK)RU,(&
V\PEROVXVHGLQVLQJOHOLQHGLDJUDPVUHIHUWRWKHPDQXDO7HFKQLFDO
'HVFULSWLRQVRI)XQFWLRQV,QWURGXFWLRQ056080
2
ABB Automation NPS3Low RE_5_ _
NPS3High
)LJXUH )XQFWLRQEORFNV\PEROVRI136/RZDQG136+LJK
3
RE_5_ _ NPS3Low ABB Automation
NPS3High
4
ABB Automation NPS3Low RE_5_ _
NPS3High
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool.
In case of three phase currents (Figure 3), the phase currents IL1, IL2 and IL3 are
connected to the corresponding IL1, IL2 and IL3 inputs of the function block, whereas
in case of two phase currents (Figure 4), the phase currents are connected to the first
two phase current inputs and the third analogue input is left unconnected.
Digital inputs are connected to the boolean inputs of the function block and in the
same way, the outputs of the function block are connected to the output signals.
)LJXUH &RQILJXUDWLRQH[DPSOHLQFDVHRIWKUHHSKDVHFXUUHQWV
)LJXUH $QDORJXHFKDQQHOFRQQHFWLRQVLQFDVHRIWZRSKDVHFXUUHQWV
5
RE_5_ _ NPS3Low ABB Automation
NPS3High
In the input data and recorded data fields, the monitored phase currents are those
actually connected to the corresponding inputs. For example, if the analogue channel
IL3 is connected to the input IL1, the value of the Current IL1 parameter is actually
the value of phase current IL3.
The ROT_DIR input is used for motor protection. If status information about the
motor rotation direction is available, it can be connected to the ROT_DIR input of the
function block. In this case the control setting parameter Dir. selection must be set
to value Input rot.dir., which means the measured negative-sequence current and the
operation of the function block are independent of the motor rotation direction.
When the relay is started, the function block checks that at least two phase currents
are connected to the first two analogue inputs. If two currents are not connected, the
ERR output is activated and the error event E13 is sent.
If the phase currents are connected in a different order compared to the configuration
examples, the error event is not sent and the ERR output is not activated. In these
cases, however, the control setting parameter Dir. selection must be set to
Reverse value to achieve correct operation.
When three phase currents are used, the negative-sequence current is calculated as
follows:
, 2 = , 5 + , 6 240 + , 7 120
where IR, IS and IT are phase currents.
In case of two phase currents, value of the neutral current is assumed to be 0 ie.
IR+IS+IT=0. Thus the negative-sequence current is calculated as follows:
,2 =
3
(, 5 + , 7 30 )
3
6
ABB Automation NPS3Low RE_5_ _
NPS3High
The function block has the two operation modes Definite time and Inverse time.
The type of operation is selected via the setting parameter Operation mode.
In both operation modes the function block starts if the calculated negative phase-
sequence exceeds the set start current, which is set via the Start value parameter.
The parameter is common to the two operation modes.
Note! The default value of the Start value parameter is 20% of nominal, which is
usual for motor protection. Generators are more sensitive to current unbalance and the
negative sequence current value that a generator can stand continuously is usually
between 5% and 10%. Therefore in case of generator protection a safer value for the
Start value parameter is 5%.
The function block trips when the measured negative phase-sequence has remained
over the set limit for the time set via the Operate time parameter. The Operate
time parameter is used only in the definite-time operation.
When the function block trips, the BLOCK_OUT output is activated and will remain
active for the set time. The cooling time is set via the Cooling time parameter. The
same parameter is also used in the inverse-time operation. The BLOCK_OUT signal
is used to prevent the auto-reclosing of an overheated generator.
TRIP
Cooling time
BLOCK_OUT
)LJXUH 8VHRIWKH&RROLQJWLPHSDUDPHWHU
For intermittent faults, the definite-time operation includes the delayed reset function.
Without the delayed reset function the DT timer would reset once the negative-
sequence current drops off.
When the DT timer has started, it goes on running normally even if the current drops
off, provided the drop-off period is shorter than the set drop-off time. If the drop-off
period is longer than the set drop-off time, the DT timer will reset when the drop-off
time elapses (Figure 6).
7
RE_5_ _ NPS3Low ABB Automation
NPS3High
In Figures 6 and 7 the input signal IN of the DT timer is TRUE when the current is
above the set start value and FALSE when the current is below the set start value.
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff1.fh7
Operate time
Operate
timer
)LJXUH 7KHGURSRIISHULRGLVORQJHUWKDQWKHVHWGURSRIIWLPH
If the drop-off period is shorter than the set drop-off time and the DT timer time has
elapsed during the drop-off period, the function block will trip once the current
exceeds the set value again (Figure 7).
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff2.fh7
Operate time
Operate
timer
)LJXUH 7KHGURSRIISHULRGLVVKRUWHUWKDQWKHVHWGURSRIIWLPH
8
ABB Automation NPS3Low RE_5_ _
NPS3High
The operate time of the function block in the inverse-time mode is expressed
mathematically as follows :
.
W= 2
,2
6WDUW9DOXH 2
,1
where
t relay operate time in seconds
I2 negative-sequence current
IN rated current of the machine
Start value Setting parameter that corresponds to the continuous negative-
sequence current withstand of the machine, the I2 current
expressed in xIN (rated current of the machine)
K Setting parameter that corresponds to the machine constant,
equal to the I22t constant of the machine, as stated by the
machine manufacturer
0.5
I2 (xIn)
Start value=0.2
0.1
Start value=0.05
)LJXUH 7KHWLPHQHJDWLYHVHTXHQFHFXUUHQWFKDUDFWHULVWLFVRI136/RZDQG
136+LJK
When the measured negative-sequence current exceeds the set start current I2, the
function block starts accumulating a sum, the accumulate rate being proportional to
the subtraction of the squared value of the actual negative-sequence current and the
9
RE_5_ _ NPS3Low ABB Automation
NPS3High
squared value of the Start value parameter. When the sum exceeds the level
corresponding to the setting parameter K, the function block operates. The higher the
degree of current unbalance, the faster the sum increases, and as the operate level of
the sum is defined only by the constant K, the negative-sequence relay will have an
inverse-time operating characteristic which conforms to the thermal load
characteristic of a rotating machine. When the overload disappears, the subtraction
(I22 - StartValue2) becomes negative and the sum decreases. Thus, decrease of the sum
indicates cooling of the machine, and the cooling speed depends on the value of the I2
current. When the sum reaches 0, the accumulation is stopped.
The accumulation is also stopped and the sum is set to 0 if the negative-sequence
current remains below the set limit for the set cooling time. Another purpose of the
Cooling time parameter is to keep the BLOCK_OUT signal active after tripping for
the set time. The BLOCK_OUT signal is used to prevent the auto-reclosing of the
overheated generator.
In inverse-time operation, the delay of the START output can be set via the parameter
Start delay. The start delay can be used for definite-time alarming when the START
output is used as an alarm output. The set start delay does not affect the operate time
of the function block.
I2 /IN
Operating curve
t= K
(I2/IN)2- Start value 2
Start value
t
Minimum time Maximum time
)LJXUH 2SHUDWLQJFKDUDFWHULVWLF
The setting parameters K, Start delay, Minimum time and Maximum time do
not affect the definite-time mode.
10
ABB Automation NPS3Low RE_5_ _
NPS3High
Two different groups of setting values, group 1 and group 2, are available for each
function block. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The output signal START is always pulse-shaped. The minimum pulse width of the
corresponding output signal is set via a separate parameter on the MMI or on serial
communication. If the start situation is longer than the set pulse width, the START
signal remains active until the start situation is over.
The output signal TRIP may have a non-latching or latching feature. When the
latching mode has been selected, the TRIP signal remains active until the output is
reset even if the operation criteria have reset.
Each function block provides a delayed trip signal CBFP after the TRIP signal unless
the fault has disappeared during the set CBFP time delay. In circuit-breaker failure
protection, the CBFP output can be used to operate a circuit breaker in front of the
circuit breaker of the machine. The control parameter Trip pulse also sets the width
of the CBFP output signal.
11
RE_5_ _ NPS3Low ABB Automation
NPS3High
2.8 Resetting
The TRIP output signal and the registers can be reset either via the RESET input, or
over the serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
12
ABB Automation NPS3Low RE_5_ _
NPS3High
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for NPS3Low is 77 and that for NPS3High 78.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
13
RE_5_ _ NPS3Low ABB Automation
NPS3High
Operate time S43 0.1...120.0 s 1.0 R/W Operate time in definite-time mode
Start delay S45 0.1...60.0 s 1.0 R/W Definite start time in inverse-time
mode
Minimum time S46 0.1...120.0 s 0.1 R/W Definite minimum operate time
Maximum time S47 500...10000 s 1000 R/W Maximum operate time regardless
of the inverse characteristic
Cooling time S48 5...10000 s 50 R/W Time required to cool the machine
1)
Operation mode 0 = Not in use; 1 = Definite time; 2 = Inverse time
14
ABB Automation NPS3Low RE_5_ _
NPS3High
Operate time S73 0.1...120.0 s 1.0 R/W Operate time in definite-time mode
Start delay S75 0.1...60.0 s 1.0 R/W Definite start time in inverse-time
mode
Minimum time S76 0.1...120.0 s 0.1 R/W Definite minimum operate time
Maximum time S77 500...10000 s 1000 R/W Maximum operate time regardless
of the inverse characteristic
Cooling time S78 5...10000 s 50 R/W Time required to cool the machine
1)
Operation mode 0 = Not in use; 1 = Definite time; 2 = Inverse time
15
RE_5_ _ NPS3Low ABB Automation
NPS3High
CBFP time V10 100...1000 ms 100 R/W Operate time of the delayed trip
CBFP
Event mask 1 V101 0...8191 - 4159 R/W Event mask 1 for event
transmission (E0... E13)
Event mask 2 V103 0...8191 - 4159 R/W Event mask 2 for event
transmission (E0... E13)
Event mask 3 V105 0...8191 - 4159 R/W Event mask 3 for event
transmission (E0... E13)
Event mask 4 V107 0...8191 - 4159 R/W Event mask 4 for event
transmission (E0... E13)
1)
Group selection 0 = Group 1; 1 = Group 2; 2 = GROUP input
2)
Active group 0 = Group 1; 1 = Group 2
3)
Dir. selection 0 = Forward; 1 = Reverse; 2 = Input rot.dir.
4)
Rotation dir. 0 = Forward; 1 = Reverse
5)
Trip signal 0 = Non-latching; 1 = Latching
6)
Test 0 = Do not activate; 1 = Activate
16
ABB Automation NPS3Low RE_5_ _
NPS3High
3.3.3.1 General
The information required for later fault analysis is recorded when the function block
starts or trips.
The data of three last operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
17
RE_5_ _ NPS3Low ABB Automation
NPS3High
The time stamp indicates the rising edge of the START or TRIP signal.
3.3.3.3 Duration
The duration of the start situation is recorded as a percentage of the calculated operate
time.
3.3.3.4 Currents
If the function block trips or starts, the negative-sequence current is updated at the
moment of tripping or starting i.e. on the rising edge of the TRIP or START signal.
The negative-sequence current is recorded as a multiple of the rated current In.
The status data of the input signal BLOCK (Active or Not active) and the parameters
Rotation dir. and Active group are recorded at the moment of triggering.The
Rotation dir. parameter indicates the rotation direction of the machine and the
Active group parameter the setting group valid for the recorded data.
3.3.3.6 Priority
1 Tripping
2 Starting
18
ABB Automation NPS3Low RE_5_ _
NPS3High
19
RE_5_ _ NPS3Low ABB Automation
NPS3High
3.3.4 Events
E12 0 0 - -
20
ABB Automation NPS3Low RE_5_ _
NPS3High
21
1MRS752310-MUM NPS3_
Issued: 10/1998
Version: D/21.1.2002
Negative-Phase-Sequence Protection
Low-Set Stage (NPS3Low)
Data subject to change without notice High-Set Stage (NPS3High)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 4
1.4 Output description ............................................................................... 4
2. Description of Operation.......................................................................... 5
2.1 Configuration....................................................................................... 5
2.2 Configuration error checking ............................................................... 6
2.3 Measuring mode ................................................................................. 6
2.4 Operation criteria................................................................................. 7
2.4.1 Definite-time operation ............................................................... 7
2.4.2 Inverse-time operation ............................................................... 9
2.5 Setting groups ................................................................................... 11
2.6 Test mode ......................................................................................... 11
2.7 START, TRIP and CBFP outputs ...................................................... 11
2.8 Resetting........................................................................................... 12
1. Introduction
1.1 Features
Negative-phase-sequence protection
Definite-time (DT) or inverse-time (IDMT) operation
Definite minimum time for high-level negative-sequence currents in inverse-time
operation
Limited maximum operate time for long-time low-level negative-sequence currents
in inverse-time operation
Adjustable start delay in inverse-time operation
Backwards counting when overload disappears in inverse-time mode
Current measurement with conventional current transformers or Rogowski coils
Two- or three-phase negative-sequence current measurement
Input signal for selecting the direction of rotation
Delayed trip output for the circuit-breaker failure protection (CBFP) function
Output for blocking the reconnection of an overheated machine
Wide setting ranges
1.2 Application
The function blocks NPS3Low and NPS3High are designed for negative-phase-
sequence protection whenever the operating characteristic is appropriate. They are
applied for the protection of power generators or synchronous motors against thermal
stress and damage.
(See Figure 5).
I2>
I2>>
)LJXUH 3URWHFWLRQGLDJUDPV\PEROVRI136/RZDQG136+LJK)RU,(&
V\PEROVXVHGLQVLQJOHOLQHGLDJUDPVUHIHUWRWKHPDQXDO7HFKQLFDO
'HVFULSWLRQVRI)XQFWLRQV,QWURGXFWLRQ056080
2
Substation Automation NPS3 _
)LJXUH )XQFWLRQEORFNV\PEROVRI136/RZDQG136+LJK
3
NPS3 _ Substation Automation
4
Substation Automation NPS3 _
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool.
In case of three phase currents (Figure 3), the phase currents IL1, IL2 and IL3 are
connected to the corresponding IL1, IL2 and IL3 inputs of the function block, whereas
in case of two phase currents (Figure 4), the phase currents are connected to the first
two phase current inputs and the third analogue input is left unconnected.
Digital inputs are connected to the boolean inputs of the function block and in the
same way, the outputs of the function block are connected to the output signals.
)LJXUH &RQILJXUDWLRQH[DPSOHLQFDVHRIWKUHHSKDVHFXUUHQWV
)LJXUH $QDORJXHFKDQQHOFRQQHFWLRQVLQFDVHRIWZRSKDVHFXUUHQWV
5
NPS3 _ Substation Automation
In the input data and recorded data fields, the monitored phase currents are those
actually connected to the corresponding inputs. For example, if the analogue channel
IL3 is connected to the input IL1, the value of the Current IL1 parameter is actually
the value of phase current IL3.
The ROT_DIR input is used for motor protection. If status information about the
motor rotation direction is available, it can be connected to the ROT_DIR input of the
function block. In this case the control setting parameter Dir. selection must be set
to value Input rot.dir., which means the measured negative-sequence current and the
operation of the function block are independent of the motor rotation direction.
When the relay is started, the function block checks that at least two phase currents
are connected to the first two analogue inputs. If two currents are not connected, the
ERR output is activated and the error event E13 is sent.
If the phase currents are connected in a different order compared to the configuration
examples, the error event is not sent and the ERR output is not activated. In these
cases, however, the control setting parameter Dir. selection must be set to
Reverse value to achieve correct operation.
When three phase currents are used, the negative-sequence current is calculated as
follows:
,2 = 1
3 , 5 + , 6 240 + , 7 120
In case of two phase currents, value of the neutral current is assumed to be 0 ie.
IR+IS+IT=0. Thus the negative-sequence current is calculated as follows:
,2 =
3
(, 5 + , 7 30 )
3
6
Substation Automation NPS3 _
The function block has the two operation modes Definite time and Inverse time.
The type of operation is selected via the setting parameter Operation mode.
In both operation modes the function block starts if the calculated negative phase-
sequence exceeds the set start current, which is set via the Start value parameter.
The parameter is common to the two operation modes.
Note! The default value of the Start value parameter is 20% of nominal, which is
usual for motor protection. Generators are more sensitive to current unbalance and the
negative sequence current value that a generator can stand continuously is usually
between 5% and 10%. Therefore in case of generator protection a safer value for the
Start value parameter is 5%.
The function block trips when the measured negative phase-sequence has remained
over the set limit for the time set via the Operate time parameter. The Operate
time parameter is used only in the definite-time operation.
When the function block trips, the BLOCK_OUT output is activated and will remain
active for the set time. The cooling time is set via the Cooling time parameter. The
same parameter is also used in the inverse-time operation. The BLOCK_OUT signal
is used to prevent the auto-reclosing of an overheated generator.
TRIP
Cooling time
BLOCK_OUT
)LJXUH 8VHRIWKH&RROLQJWLPHSDUDPHWHU
For intermittent faults, the definite-time operation includes the delayed reset function.
Without the delayed reset function the DT timer would reset once the negative-
sequence current drops off.
When the DT timer has started, it goes on running normally even if the current drops
off, provided the drop-off period is shorter than the set drop-off time. If the drop-off
period is longer than the set drop-off time, the DT timer will reset when the drop-off
time elapses (Figure 6).
7
NPS3 _ Substation Automation
In Figures 6 and 7 the input signal IN of the DT timer is TRUE when the current is
above the set start value and FALSE when the current is below the set start value.
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff1.fh7
Operate time
Operate
timer
)LJXUH 7KHGURSRIISHULRGLVORQJHUWKDQWKHVHWGURSRIIWLPH
If the drop-off period is shorter than the set drop-off time and the DT timer time has
elapsed during the drop-off period, the function block will trip once the current
exceeds the set value again (Figure 7).
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff2.fh7
Operate time
Operate
timer
)LJXUH 7KHGURSRIISHULRGLVVKRUWHUWKDQWKHVHWGURSRIIWLPH
8
Substation Automation NPS3 _
The operate time of the function block in the inverse-time mode is expressed
mathematically as follows :
.
W= 2
,2
6WDUW9DOXH 2
,1
where
t relay operate time in seconds
I2 negative-sequence current
IN rated current of the machine
Start value Setting parameter that corresponds to the continuous negative-
sequence current withstand of the machine, the I2 current
expressed in xIN (rated current of the machine)
K Setting parameter that corresponds to the machine constant,
equal to the I22t constant of the machine, as stated by the
machine manufacturer
0.5
I2 (xIn)
Start value=0.2
0.1
Start value=0.05
)LJXUH 7KHWLPHQHJDWLYHVHTXHQFHFXUUHQWFKDUDFWHULVWLFVRI136/RZDQG
136+LJK
When the measured negative-sequence current exceeds the set start current I2, the
function block starts accumulating a sum, the accumulate rate being proportional to
the subtraction of the squared value of the actual negative-sequence current and the
9
NPS3 _ Substation Automation
squared value of the Start value parameter. When the sum exceeds the level
corresponding to the setting parameter K, the function block operates. The higher the
degree of current unbalance, the faster the sum increases, and as the operate level of
the sum is defined only by the constant K, the negative-sequence relay will have an
inverse-time operating characteristic which conforms to the thermal load
characteristic of a rotating machine. When the overload disappears, the subtraction
(I22 - StartValue2) becomes negative and the sum decreases. Thus, decrease of the sum
indicates cooling of the machine, and the cooling speed depends on the value of the I2
current. When the sum reaches 0, the accumulation is stopped.
The accumulation is also stopped and the sum is set to 0 if the negative-sequence
current remains below the set limit for the set cooling time. Another purpose of the
Cooling time parameter is to keep the BLOCK_OUT signal active after tripping for
the set time. The BLOCK_OUT signal is used to prevent the auto-reclosing of the
overheated generator.
In inverse-time operation, the delay of the START output can be set via the parameter
Start delay. The start delay can be used for definite-time alarming when the START
output is used as an alarm output. The set start delay does not affect the operate time
of the function block.
I2 /IN
Operating curve
t= K
(I2/IN)2- Start value 2
Start value
t
Minimum time Maximum time
)LJXUH 2SHUDWLQJFKDUDFWHULVWLF
The setting parameters K, Start delay, Minimum time and Maximum time do
not affect the definite-time mode.
10
Substation Automation NPS3 _
Two different groups of setting values, group 1 and group 2, are available for each
function block. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The output signal START is always pulse-shaped. The minimum pulse width of the
corresponding output signal is set via a separate parameter on the MMI or on serial
communication. If the start situation is longer than the set pulse width, the START
signal remains active until the start situation is over.
The output signal TRIP may have a non-latching or latching feature. When the
latching mode has been selected, the TRIP signal remains active until the output is
reset even if the operation criteria have reset.
Each function block provides a delayed trip signal CBFP after the TRIP signal unless
the fault has disappeared during the set CBFP time delay. In circuit-breaker failure
protection, the CBFP output can be used to operate a circuit breaker in front of the
circuit breaker of the machine. The control parameter Trip pulse also sets the width
of the CBFP output signal.
11
NPS3 _ Substation Automation
2.8 Resetting
The TRIP output signal and the registers can be reset either via the RESET input, or
over the serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
12
Substation Automation NPS3 _
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for NPS3Low is 77 and that for NPS3High 78.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
13
NPS3 _ Substation Automation
Operate time S43 0.1...120.0 s 1.0 R/W Operate time in definite-time mode
Start delay S45 0.1...60.0 s 1.0 R/W Definite start time in inverse-time
mode
Minimum time S46 0.1...120.0 s 0.1 R/W Definite minimum operate time
Maximum time S47 500...10000 s 1000 R/W Maximum operate time regardless
of the inverse characteristic
Cooling time S48 5...10000 s 50 R/W Time required to cool the machine
1)
Operation mode 0 = Not in use; 1 = Definite time; 2 = Inverse time
14
Substation Automation NPS3 _
Operate time S73 0.1...120.0 s 1.0 R/W Operate time in definite-time mode
Start delay S75 0.1...60.0 s 1.0 R/W Definite start time in inverse-time
mode
Minimum time S76 0.1...120.0 s 0.1 R/W Definite minimum operate time
Maximum time S77 500...10000 s 1000 R/W Maximum operate time regardless
of the inverse characteristic
Cooling time S78 5...10000 s 50 R/W Time required to cool the machine
1)
Operation mode 0 = Not in use; 1 = Definite time; 2 = Inverse time
15
NPS3 _ Substation Automation
CBFP time V10 100...1000 ms 100 R/W Operate time of the delayed trip
CBFP
Event mask 1 V101 0...12287 - 8255 R/W Event mask 1 for event
transmission (E0... E13)
Event mask 2 V103 0... 12287 - 8255 R/W Event mask 2 for event
transmission (E0... E13)
Event mask 3 V105 0... 12287 - 8255 R/W Event mask 3 for event
transmission (E0... E13)
Event mask 4 V107 0... 12287 - 8255 R/W Event mask 4 for event
transmission (E0... E13)
1)
Group selection 0 = Group 1; 1 = Group 2; 2 = GROUP input
2)
Active group 0 = Group 1; 1 = Group 2
3)
Dir. selection 0 = Forward; 1 = Reverse; 2 = Input rot.dir.
4)
Rotation dir. 0 = Forward; 1 = Reverse
5)
Trip signal 0 = Non-latching; 1 = Latching
6)
Test 0 = Do not activate; 1 = Activate
16
Substation Automation NPS3 _
3.3.3.1 General
The information required for later fault analysis is recorded when the function block
starts or trips.
The data of three last operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
17
NPS3 _ Substation Automation
The time stamp indicates the rising edge of the START or TRIP signal.
3.3.3.3 Duration
The duration of the start situation is recorded as a percentage of the calculated operate
time.
3.3.3.4 Currents
If the function block trips or starts, the negative-sequence current is updated at the
moment of tripping or starting i.e. on the rising edge of the TRIP or START signal.
The negative-sequence current is recorded as a multiple of the rated current In.
The status data of the input signal BLOCK (Active or Not active) and the parameters
Rotation dir. and Active group are recorded at the moment of triggering.The
Rotation dir. parameter indicates the rotation direction of the machine and the
Active group parameter the setting group valid for the recorded data.
3.3.3.6 Priority
1 Tripping
2 Starting
18
Substation Automation NPS3 _
19
NPS3 _ Substation Automation
3.3.4 Events
E12 0 0 - -
20
Substation Automation NPS3 _
F -
21
1MRS100088 (Stage 1) RE_5_ _
1MRS100089 (Stage 2) Three-Phase Non-Directional
Issued: 10/1998
Version: C Undercurrent Protection
Data subject to change without notice Stage 1 (NUC3St1)
Stage 2 (NUC3St2)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 4
2. Description of Operation.......................................................................... 5
2.1 Configuration....................................................................................... 5
2.2 Setting the rated values of the protected unit ...................................... 5
2.3 Measuring mode ................................................................................. 5
2.4 Operation criteria................................................................................. 6
2.5 Delayed reset facility and drop-off time in DT mode .......................... 10
2.6 Setting groups ................................................................................... 11
2.7 Test mode ......................................................................................... 12
2.8 START, ALARM, TRIP and CBFP outputs ........................................ 12
2.9 Resetting........................................................................................... 13
3. Parameters and Events .......................................................................... 14
3.1 General ............................................................................................. 14
3.2 Setting values.................................................................................... 15
3.2.1 Actual settings.......................................................................... 15
3.2.2 Setting group 1......................................................................... 15
3.2.3 Setting group 2......................................................................... 16
3.2.4 Control settings ........................................................................ 17
3.3 Measurement values ......................................................................... 18
3.3.1 Input data ................................................................................. 18
3.3.2 Output data .............................................................................. 18
3.3.3 Recorded data.......................................................................... 18
3.3.4 Events ...................................................................................... 21
4. Technical Data ........................................................................................ 22
RE_5_ _ NUC3St1 ABB Automation
NUC3St2
1. Introduction
1.1 Features
1.2 Application
3I<
)LJXUH 3URWHFWLRQGLDJUDPV\PERORI18&6WB)RU,(&V\PEROVXVHGLQVLQJOH
OLQHGLDJUDPVUHIHUWRWKHPDQXDO7HFKQLFDO'HVFULSWLRQVRI)XQFWLRQV
,QWURGXFWLRQ056080
2
ABB Automation NUC3St1 RE_5_ _
NUC3St2
)LJXUH )XQFWLRQEORFNV\PEROVRI18&6WDQG18&6W
3
RE_5_ _ NUC3St1 ABB Automation
NUC3St2
4
ABB Automation NUC3St1 RE_5_ _
NUC3St2
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The phase currents IL1, IL2 and IL3 are
connected to the corresponding IL1, IL2 and IL3 inputs of the function block. Digital
inputs are connected to the boolean inputs of the function block and in the same way,
the outputs of the function block are connected to the output signals.
A separate scaling factor can be set for each analogue channel. The factors enable
differences between the ratings of the protected unit and those of the measuring
device (CTs, VTs, etc.). A setting of 1.00 means that the rated value of the protected
unit is exactly the same as that of the measuring device. For more information refer to
Technical Reference Manual for REM 54_.
The function block operates on two alternative measuring principles: the average
value of consecutive intantaneous peak-to-peak values or the numerically calculated
fundamental frequency component of the current. The measuring mode can be
selected via either an MMI parameter or a serial communication parameter.
With both the measuring principles, the operation is insensitive to the DC component
and the operation accuracy is defined in the frequency range f/fn=0.95...1.05. In peak-
to-peak measurement, the harmonics of the phase currents are not suppressed,
whereas in fundamental frequency measurement the harmonics suppression is about
-50 dB at f = n x fn, where n = 2, 3, 4, 5,...
5
RE_5_ _ NUC3St1 ABB Automation
NUC3St2
The function block includes two different operation criteria for undercurrent
protection. The setting parameters with their features are described below.
Operation mode
Alarm: The alarm mode is based on the DT timer. An alarm causes specific text
indications and events as well as an output signal. If the alarm is selected to be non-
latching, the yellow start indicator LED keeps blinking as long as the fault is active,
whereas in the latching mode the indication has to be reset (see section Resetting).
Trip: The trip mode is also based on the DT timer. A trip causes common indications,
events and an output signal.
Operation criteria
1,2,3-phase: The function starts after a short delay*) if the current enters the operating
range in one or more phases (Figures 4 and 5).
3-phase: Similar to 1,2,3-phase criterion, but the function starts only if the current
enters the operating range in all three phases.
*) The short delay (approximately 40 ms) is set to avoid unnecessary starts when the
motor current is switched off (stop) or switched on (start-up) normally and internal
blocking is enabled.
Start current
Start current defines the upper limit for the operating range. The Start current
parameter is usually given a value slightly under the normal current range.
Operate time
When the function block starts, the START signal is set to TRUE. Should the
undercurrent situation exceed the set definite operate time, the function block
operates. The delay of the heavy-duty output relay is included in the total operate
time. When the function block operates, the selected signal, TRIP or ALARM, is set
to TRUE. In Figure 3, the input signal IN of the DT timer is TRUE when the selected
operation criterion is true and FALSE when the criterion is false.
The DT timer is allowed to run only if the Ext. BLOCK and Int. BLOCK signals are
inactive, i.e their values are FALSE. When the blocking signals Ext. BLOCK and Int.
BLOCK are active, i.e. their values are TRUE, the timer will be stopped (frozen).
6
ABB Automation NUC3St1 RE_5_ _
NUC3St2
1
IN 0
START
ALARM/TRIP
)LJXUH 2SHUDWLRQRIWKH'7WLPHUZKHQWKHVLJQDOV,QW%/2&.DQG([W%/2&.
DUHXVHG
Intern. blocking
Enabled: If internal blocking is enabled, the operating range is between the set start
current and the internal blocking current (8% of the In), which makes it possible to
stop the motor or switch off other protected units without making the function block
operate (see figure below).
The input parameter Intern. BLOCK is activated when all currents are below the
blocking current, but the indication BLOCK will not appear because the currents are
outside the operating range.
1.0 x In
Operation
)LJXUH 2SHUDWLQJUDQJHLILQWHUQDOEORFNLQJLVHQDEOHG
Disabled: If internal blocking is disabled, the operating range is between the set start
current and zero (0% of the In), which allows the external blocking signal to be used
instead of internal blocking. The external blocking signal may come e.g. from a
circuit breaker, a control function block or the process (see figure below).
7
RE_5_ _ NUC3St1 ABB Automation
NUC3St2
1.0 x In
Operation
)LJXUH 2SHUDWLQJUDQJHLILQWHUQDOEORFNLQJLVGLVDEOHG
Blocking time
The blocking time from motor start-up can be set provided internal blocking is
enabled. The motor is assumed to be stopped if all phase currents are less than 8.0%
of the nominal current for about 60 ms. A motor start-up is assumed to begin when the
current exceeds the internal blocking current at least in one phase and the signal Inter.
BLOCK remains active until the set blocking time has elapsed (Figure 3). If the
operation criterion becomes true during the blocking time, the indication, event and
registration features are similar to those of the Extern. BLOCK signal.
The Intern. BLOCK signal can be deactivated before the set time has elapsed by
resetting the blocking time to value 0 s or by setting the Intern. Blocking parameter
to disabled. Note: if the parameter is set to disabled, the operating range changes.
This feature may be used to allow the motor start without load in various processes or
to allow for the pump to build up liquid pressure. (Figure 6)
I
normal motor stopped start-up without load load is switched on
situation
)LJXUH 0RWRUVWDUWXSDQGEORFNLQJWLPH
8
ABB Automation NUC3St1 RE_5_ _
NUC3St2
Setting examples
Example1:
A pump is cooled by the liquid it pumps and a current under 0.6 x In means that there
is not enough load for cooling.
NUC3St1 NUC3St2
Blocking time: 0s 0s
Example 2:
In the beginning of the process start, the motor is started up and the load is expected
to come on after 15 minutes. Loss of load means that the current falls below 0.5 x In,
which is to be indicated.
NUC3St_
9
RE_5_ _ NUC3St1 ABB Automation
NUC3St2
Example 3:
If the internal blocking current is not suitable and the internal blocking needs to be
disabled, the blocking can be done externally in two different ways:
1 The Extern. BLOCK signal is usually used for external blocking. Status of the
circuit breaker can be brought from the circuit breaker itself or from the circuit-
breaker function block (CBFB) to the BLOCK input of NUC3St_.
2 If BLOCK indications need to be avoided, NUC3St_ can be set to Not in use via
the GROUP input. In this case the setting group is selected according to the status
of the circuit breaker (see also section Setting groups).
(GROUP input = FALSE <=> setting group 1 is active)
(GROUP input = TRUE <=> setting group 2 is active)
Blocking time: 0s 0s
Without the delayed reset function the DT timer would reset once the negative
sequence current drops off. This feature may be useful for example when the liquid of
the pump application is drying up.
When the DT timer has started, it goes on running as normally even if the current
drops off, provided the drop-off period is shorter than the set drop-off time. If the
drop-off period is longer than the set drop-off time, the DT timer will reset when the
drop-off time elapses (Figure 7).
In Figures 7 and 8, the input signal IN of the DT timer is TRUE when the current is
above the set start value and FALSE when the current is below the set start value.
10
ABB Automation NUC3St1 RE_5_ _
NUC3St2
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff1.fh7
Operate time
Operate
timer
)LJXUH 7KHGURSRIISHULRGLVORQJHUWKDQWKHVHWGURSRIIWLPH
If the drop-off period is shorter than the set drop-off time and the DT timer has
elapsed during the drop-off period, the function block will trip once the current
exceeds the set value again (Figure 8).
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff2.fh7
Operate time
Operate
timer
)LJXUH 7KHGURSRIISHULRGLVVKRUWHUWKDQWKHVHWGURSRIIWLPH
Two different groups of setting values, group 1 and group 2, are available for
NUC3St_. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
11
RE_5_ _ NUC3St1 ABB Automation
NUC3St2
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The output signal START is always pulse-shaped. The minimum pulse width of the
corresponding output signal is set via a separate parameter on the MMI or the serial
communication. If the start situation is longer than the set pulse width, the START
signal remains active until the start situation is over. The output signal TRIP may
have a non-latching or latching feature. When the latching mode has been selected,
the TRIP signal remains active until the output is reset even if the operation criterion
has reset.
The ALARM output signal is an alternative for the TRIP signal. If it is used instead of
the TRIP signal, the CBFP is also ignored. The ALARM signal may have a non-
latching or latching feature. When the non-latching mode has been selected, the
ALARM signal remains active until the START situation is over and the active signal
is indicated by a blinking start LED (yellow). The latching mode of the ALARM
signal is similar to that of the TRIP signal.
The function block provides a delayed trip signal CBFP after the TRIP signal unless
the fault has disappeared during the set CBFP time delay. In circuit-breaker failure
protection, the CBFP output can be used to operate a circuit breaker in front of the
circuit breaker of the motor. The control parameter Trip pulse also sets the width of
the CBFP output signal. Please note that circuit-breaker failure protection (CBFP) is
not available if internal blocking is disabled.
12
ABB Automation NUC3St1 RE_5_ _
NUC3St2
2.9 Resetting
The TRIP output signal, the ALARM output signal and the registers can be reset
either via the RESET input, or over the serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
13
RE_5_ _ NUC3St1 ABB Automation
NUC3St2
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for NUC3St1 is 88 and that for NUC3St2 89.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
14
ABB Automation NUC3St1 RE_5_ _
NUC3St2
Operate time S44 0.1...600.0 s 2.0 R/W Operate time at ALARM and
TRIP modes
15
RE_5_ _ NUC3St1 ABB Automation
NUC3St2
Operate time S74 0.1...600.0 s 2.0 R/W Operate time at ALARM and
TRIP modes
16
ABB Automation NUC3St1 RE_5_ _
NUC3St2
CBFP time V8 100...1000 ms 100 R/W Operate time of the delayed trip
CBFP
Event mask 1 V101 0...16383 - 255 R/W Event mask 1 for event
transmission (E0 ... E13)
Event mask 2 V103 0...16383 - 255 R/W Event mask 2 for event
transmission (E0 ... E13)
Event mask 3 V105 0...16383 - 255 R/W Event mask 3 for event
transmission (E0 ... E13)
Event mask 4 V107 0...16383 - 255 R/W Event mask 4 for event
transmission (E0 ... E13)
1)
Measuring mode 0 = Peak-to-peak; 1 = Fundam.freq.
2)
Group selection 0 = Group 1; 1 = Group 2; 2 = GROUP input
3)
Active group 0 = Group 1; 1 = Group 2
4)
Trip signal 0 = Non-latching; 1 = Latching
5)
Alarm signal 0 = Non-latching; 1 = Latching
6)
Test 0 = Do not activate; 1 = Activate
17
RE_5_ _ NUC3St1 ABB Automation
NUC3St2
3.3.3.1 General
The information required for later fault analysis is recorded when the function block
starts, alarms or trips, or when the recording function is triggered via an external
triggering input. The recording function can be blocked via the BSREG input.
The data of three last operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
18
ABB Automation NUC3St1 RE_5_ _
NUC3St2
The time stamp indicates the rising edge of the START or TRIGG signal. If the
START signal is followed by the ALARM or TRIP signal, the time stamp will be
updated.
3.3.3.3 Duration
3.3.3.4 Currents
If the function block alarms or trips, the current values are updated at the moment of
alarming or tripping, i.e. on the rising edge of the ALARM or TRIP signal. For
external triggering, the current values are updated at the moment of triggering, i.e. on
the rising edge of the input signal TRIGG. If the function block starts but does not
alarm or trip, the current values captured one fundamental cycle (20 ms at rated
frequency 50 Hz) after the beginning of the start situation are recorded. So the values
of the phase currents IL1, IL2 and IL3 always originate from the same moment and are
recorded as multiples of the rated current In.
The status data of the inputs Extern. BLOCK and Intern. BLOCK and the Active
group parameter are recorded at the moment of triggering. The Active group
parameter indicates the setting group valid for the recorded data.
3.3.3.6 Priority
1 Alarming or tripping
2 Starting
3 External triggering,
which means that if the function block has started, it will neglect an external
triggering request.
19
RE_5_ _ NUC3St1 ABB Automation
NUC3St2
20
ABB Automation NUC3St1 RE_5_ _
NUC3St2
3.3.4 Events
21
RE_5_ _ NUC3St1 ABB Automation
NUC3St2
Reset time 40...1000 ms (depends on the minimum pulse width set for the
TRIP output)
22
1MRS752311-MUM NUC3St _
Three-Phase Non-Directional
Issued: 10/1998
Version: D/22.1.2002 Undercurrent Protection
Stage 1 (NUC3St1)
Data subject to change without notice Stage 2 (NUC3St2)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 4
2. Description of Operation.......................................................................... 5
2.1 Configuration....................................................................................... 5
2.2 Setting the rated values of the protected unit ...................................... 5
2.3 Measuring mode ................................................................................. 5
2.4 Operation criteria................................................................................. 6
2.5 Delayed reset facility and drop-off time in DT mode .......................... 10
2.6 Setting groups ................................................................................... 11
2.7 Test mode ......................................................................................... 12
2.8 START, ALARM, TRIP and CBFP outputs ........................................ 12
2.9 Resetting........................................................................................... 13
3. Parameters and Events .......................................................................... 14
3.1 General ............................................................................................. 14
3.2 Setting values.................................................................................... 15
3.2.1 Actual settings.......................................................................... 15
3.2.2 Setting group 1......................................................................... 15
3.2.3 Setting group 2......................................................................... 16
3.2.4 Control settings ........................................................................ 17
3.3 Measurement values ......................................................................... 18
3.3.1 Input data ................................................................................. 18
3.3.2 Output data .............................................................................. 18
3.3.3 Recorded data.......................................................................... 18
3.3.4 Events ...................................................................................... 21
4. Technical Data ........................................................................................ 22
NUC3St _ Substation Automation
1. Introduction
1.1 Features
1.2 Application
3I<
)LJXUH 3URWHFWLRQGLDJUDPV\PERORI18&6WB)RU,(&V\PEROVXVHGLQVLQJOH
OLQHGLDJUDPVUHIHUWRWKHPDQXDO7HFKQLFDO'HVFULSWLRQVRI)XQFWLRQV
,QWURGXFWLRQ056080
2
Substation Automation NUC3St _
)LJXUH )XQFWLRQEORFNV\PEROVRI18&6WDQG18&6W
3
NUC3St _ Substation Automation
4
Substation Automation NUC3St _
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The phase currents IL1, IL2 and IL3 are
connected to the corresponding IL1, IL2 and IL3 inputs of the function block. Digital
inputs are connected to the boolean inputs of the function block and in the same way,
the outputs of the function block are connected to the output signals.
A separate scaling factor can be set for each analogue channel. The factors enable
differences between the ratings of the protected unit and those of the measuring
device (CTs, VTs, etc.). A setting of 1.00 means that the rated value of the protected
unit is exactly the same as that of the measuring device. For more information refer to
Technical Reference Manual for REM 54_.
The function block operates on two alternative measuring principles: the average
value of consecutive intantaneous peak-to-peak values or the numerically calculated
fundamental frequency component of the current. The measuring mode can be
selected via either an MMI parameter or a serial communication parameter.
With both the measuring principles, the operation is insensitive to the DC component
and the operation accuracy is defined in the frequency range f/fn=0.95...1.05. In peak-
to-peak measurement, the harmonics of the phase currents are not suppressed,
whereas in fundamental frequency measurement the harmonics suppression is about
-50 dB at f = n x fn, where n = 2, 3, 4, 5,...
5
NUC3St _ Substation Automation
The function block includes two different operation criteria for undercurrent
protection. The setting parameters with their features are described below.
Operation mode
Alarm: The alarm mode is based on the DT timer. An alarm causes specific text
indications and events as well as an output signal. If the alarm is selected to be non-
latching, the yellow start indicator LED keeps blinking as long as the fault is active,
whereas in the latching mode the indication has to be reset (see section Resetting).
Trip: The trip mode is also based on the DT timer. A trip causes common indications,
events and an output signal.
Operation criteria
1,2,3-phase: The function starts after a short delay*) if the current enters the operating
range in one or more phases (Figures 4 and 5).
3-phase: Similar to 1,2,3-phase criterion, but the function starts only if the current
enters the operating range in all three phases.
*) The short delay (approximately 40 ms) is set to avoid unnecessary starts when the
motor current is switched off (stop) or switched on (start-up) normally and internal
blocking is enabled.
Start current
Start current defines the upper limit for the operating range. The Start current
parameter is usually given a value slightly under the normal current range.
Operate time
When the function block starts, the START signal is set to TRUE. Should the
undercurrent situation exceed the set definite operate time, the function block
operates. The delay of the heavy-duty output relay is included in the total operate
time. When the function block operates, the selected signal, TRIP or ALARM, is set
to TRUE. In Figure 3, the input signal IN of the DT timer is TRUE when the selected
operation criterion is true and FALSE when the criterion is false.
The DT timer is allowed to run only if the Ext. BLOCK and Int. BLOCK signals are
inactive, i.e their values are FALSE. When the blocking signals Ext. BLOCK and Int.
BLOCK are active, i.e. their values are TRUE, the timer will be stopped (frozen).
6
Substation Automation NUC3St _
1
IN 0
START
ALARM/TRIP
)LJXUH 2SHUDWLRQRIWKH'7WLPHUZKHQWKHVLJQDOV,QW%/2&.DQG([W%/2&.
DUHXVHG
Intern. blocking
Enabled: If internal blocking is enabled, the operating range is between the set start
current and the internal blocking current (8% of the In), which makes it possible to
stop the motor or switch off other protected units without making the function block
operate (see figure below).
The input parameter Intern. BLOCK is activated when all currents are below the
blocking current, but the indication BLOCK will not appear because the currents are
outside the operating range.
1.0 x In
Operation
)LJXUH 2SHUDWLQJUDQJHLILQWHUQDOEORFNLQJLVHQDEOHG
Disabled: If internal blocking is disabled, the operating range is between the set start
current and zero (0% of the In), which allows the external blocking signal to be used
instead of internal blocking. The external blocking signal may come e.g. from a
circuit breaker, a control function block or the process (see figure below).
7
NUC3St _ Substation Automation
1.0 x In
Operation
)LJXUH 2SHUDWLQJUDQJHLILQWHUQDOEORFNLQJLVGLVDEOHG
Blocking time
The blocking time from motor start-up can be set provided internal blocking is
enabled. The motor is assumed to be stopped if all phase currents are less than 8.0%
of the nominal current for about 60 ms. A motor start-up is assumed to begin when the
current exceeds the internal blocking current at least in one phase and the signal Inter.
BLOCK remains active until the set blocking time has elapsed (Figure 3). If the
operation criterion becomes true during the blocking time, the indication, event and
registration features are similar to those of the Extern. BLOCK signal.
The Intern. BLOCK signal can be deactivated before the set time has elapsed by
resetting the blocking time to value 0 s or by setting the Intern. Blocking parameter
to disabled. Note: if the parameter is set to disabled, the operating range changes.
This feature may be used to allow the motor start without load in various processes or
to allow for the pump to build up liquid pressure. (Figure 6)
I
normal motor stopped start-up without load load is switched on
situation
)LJXUH 0RWRUVWDUWXSDQGEORFNLQJWLPH
8
Substation Automation NUC3St _
Setting examples
Example1:
A pump is cooled by the liquid it pumps and a current under 0.6 x In means that there
is not enough load for cooling.
NUC3St1 NUC3St2
Blocking time: 0s 0s
Example 2:
In the beginning of the process start, the motor is started up and the load is expected
to come on after 15 minutes. Loss of load means that the current falls below 0.5 x In,
which is to be indicated.
NUC3St_
9
NUC3St _ Substation Automation
Example 3:
If the internal blocking current is not suitable and the internal blocking needs to be
disabled, the blocking can be done externally in two different ways:
1 The Extern. BLOCK signal is usually used for external blocking. Status of the
circuit breaker can be brought from the circuit breaker itself or from the circuit-
breaker function block (CBFB) to the BLOCK input of NUC3St_.
2 If BLOCK indications need to be avoided, NUC3St_ can be set to Not in use via
the GROUP input. In this case the setting group is selected according to the status
of the circuit breaker (see also section Setting groups).
(GROUP input = FALSE <=> setting group 1 is active)
(GROUP input = TRUE <=> setting group 2 is active)
Blocking time: 0s 0s
Without the delayed reset function the DT timer would reset once the negative
sequence current drops off. This feature may be useful for example when the liquid of
the pump application is drying up.
When the DT timer has started, it goes on running as normally even if the current
drops off, provided the drop-off period is shorter than the set drop-off time. If the
drop-off period is longer than the set drop-off time, the DT timer will reset when the
drop-off time elapses (Figure 7).
In Figures 7 and 8, the input signal IN of the DT timer is TRUE when the current is
above the set start value and FALSE when the current is below the set start value.
10
Substation Automation NUC3St _
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff1.fh7
Operate time
Operate
timer
)LJXUH 7KHGURSRIISHULRGLVORQJHUWKDQWKHVHWGURSRIIWLPH
If the drop-off period is shorter than the set drop-off time and the DT timer has
elapsed during the drop-off period, the function block will trip once the current
exceeds the set value again (Figure 8).
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff2.fh7
Operate time
Operate
timer
)LJXUH 7KHGURSRIISHULRGLVVKRUWHUWKDQWKHVHWGURSRIIWLPH
Two different groups of setting values, group 1 and group 2, are available for
NUC3St_. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
11
NUC3St _ Substation Automation
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The output signal START is always pulse-shaped. The minimum pulse width of the
corresponding output signal is set via a separate parameter on the MMI or the serial
communication. If the start situation is longer than the set pulse width, the START
signal remains active until the start situation is over. The output signal TRIP may
have a non-latching or latching feature. When the latching mode has been selected,
the TRIP signal remains active until the output is reset even if the operation criterion
has reset.
The ALARM output signal is an alternative for the TRIP signal. If it is used instead of
the TRIP signal, the CBFP is also ignored. The ALARM signal may have a non-
latching or latching feature. When the non-latching mode has been selected, the
ALARM signal remains active until the START situation is over and the active signal
is indicated by a blinking start LED (yellow). The latching mode of the ALARM
signal is similar to that of the TRIP signal.
The function block provides a delayed trip signal CBFP after the TRIP signal unless
the fault has disappeared during the set CBFP time delay. In circuit-breaker failure
protection, the CBFP output can be used to operate a circuit breaker in front of the
circuit breaker of the motor. The control parameter Trip pulse also sets the width of
the CBFP output signal. Please note that circuit-breaker failure protection (CBFP) is
not available if internal blocking is disabled.
12
Substation Automation NUC3St _
2.9 Resetting
The TRIP output signal, the ALARM output signal and the registers can be reset
either via the RESET input, or over the serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
13
NUC3St _ Substation Automation
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for NUC3St1 is 88 and that for NUC3St2 89.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
14
Substation Automation NUC3St _
Operate time S44 0.1...600.0 s 2.0 R/W Operate time in ALARM and
TRIP modes
15
NUC3St _ Substation Automation
Operate time S74 0.1...600.0 s 2.0 R/W Operate time in ALARM and
TRIP modes
16
Substation Automation NUC3St _
CBFP time V8 100...1000 ms 100 R/W Operate time of the delayed trip
CBFP
Event mask 1 V101 0...16383 - 255 R/W Event mask 1 for event
transmission (E0 ... E13)
Event mask 2 V103 0...16383 - 255 R/W Event mask 2 for event
transmission (E0 ... E13)
Event mask 3 V105 0...16383 - 255 R/W Event mask 3 for event
transmission (E0 ... E13)
Event mask 4 V107 0...16383 - 255 R/W Event mask 4 for event
transmission (E0 ... E13)
1)
Measuring mode 0 = Peak-to-peak; 1 = Fundam.freq.
2)
Group selection 0 = Group 1; 1 = Group 2; 2 = GROUP input
3)
Active group 0 = Group 1; 1 = Group 2
4)
Trip signal 0 = Non-latching; 1 = Latching
5)
Alarm signal 0 = Non-latching; 1 = Latching
6)
Test 0 = Do not activate; 1 = Activate
17
NUC3St _ Substation Automation
3.3.3.1 General
The information required for later fault analysis is recorded when the function block
starts, alarms or trips, or when the recording function is triggered via an external
triggering input. The recording function can be blocked via the BSREG input.
The data of three last operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
18
Substation Automation NUC3St _
The time stamp indicates the rising edge of the START or TRIGG signal. If the
START signal is followed by the ALARM or TRIP signal, the time stamp will be
updated.
3.3.3.3 Duration
3.3.3.4 Currents
If the function block alarms or trips, the current values are updated at the moment of
alarming or tripping, i.e. on the rising edge of the ALARM or TRIP signal. For
external triggering, the current values are updated at the moment of triggering, i.e. on
the rising edge of the input signal TRIGG. If the function block starts but does not
alarm or trip, the current values captured one fundamental cycle (20 ms at rated
frequency 50 Hz) after the beginning of the start situation are recorded. So the values
of the phase currents IL1, IL2 and IL3 always originate from the same moment and are
recorded as multiples of the rated current In.
The status data of the inputs Extern. BLOCK and Intern. BLOCK and the Active
group parameter are recorded at the moment of triggering. The Active group
parameter indicates the setting group valid for the recorded data.
3.3.3.6 Priority
1 Alarming or tripping
2 Starting
3 External triggering,
which means that if the function block has started, it will neglect an external
triggering request.
19
NUC3St _ Substation Automation
20
Substation Automation NUC3St _
3.3.4 Events
21
NUC3St _ Substation Automation
Reset time 40...1000 ms (depends on the minimum pulse width set for the
TRIP output)
22
1MRS100068 RE_5_ _
1MRS100069 Overexcitation Protection
Issued: 3/2000
Version: A Low-Set Stage (OE1Low)
Data subject to change without notice High-Set Stage (OE1High)
Contents
1 Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 3
2 Description of Operation.......................................................................... 4
2.1 Configuration....................................................................................... 4
2.2 Measuring mode ................................................................................. 4
2.3 Operation criteria................................................................................. 5
2.4 Delayed reset facility and drop-off time in DT mode ............................ 7
2.5 IDMT type operation............................................................................ 8
2.6 Setting groups ................................................................................... 14
2.7 Test mode ......................................................................................... 15
2.8 START, TRIP and CBFP outputs ...................................................... 15
2.9 Resetting........................................................................................... 15
3 Parameters and Events .......................................................................... 16
3.1 General ............................................................................................. 16
3.2 Setting values.................................................................................... 17
3.2.1 Actual settings.......................................................................... 17
3.2.2 Setting group 1......................................................................... 17
3.2.3 Setting group 2......................................................................... 18
3.2.4 Control settings ........................................................................ 19
3.3 Measurement values ......................................................................... 19
3.3.1 Input data ................................................................................. 19
3.3.2 Output data .............................................................................. 20
3.3.3 Recorded data.......................................................................... 20
4 Technical Data ........................................................................................ 23
RE_5_ _ OE1Low, OE1High ABB Automation
1 Introduction
1.1 Features
Single-phase overexcitation (Volts/Hertz) protection for generators and
transformers
Phase-to-phase or phase-to-earth voltage
Definite-time (DT) operation and two inverse-time characteristics
Maximum and minimum time settings in inverse-time modes
Voltage and its frequency can be measured with a conventional voltage
transformer or a voltage divider
Delayed trip output for the circuit-breaker failure protection (CBFP) function
1.2 Application
This document specifies the functions of the overexcitation function blocks OE1Low
and OE1High used in products based on the RED 500 Platform. The function blocks
are identical in operation.
The overexcitation protection function blocks OE1Low and OE1High are used to
protect generators and power transformers against the excessive flux density and
saturation of the magnetic core. The saturation leads to a stray flux which may cause
eddy currents and severe overheating in nonlaminated parts of a generator or a
transformer. Note that the terms (over)excitation level or U/f ratio are commonly used
to denote the flux density.
U/f> U/f>>
CBFP CBFP
)LJXUH 3URWHFWLRQGLDJUDPV\PEROVRIWKHIXQFWLRQEORFNV2(/RZDQG2(+LJK
)RU,(&V\PEROVXVHGLQVLQJOHOLQHGLDJUDPVUHIHUWRWKHPDQXDO
7HFKQLFDO'HVFULSWLRQVRI)XQFWLRQV,QWURGXFWLRQ056
080
)LJXUH )XQFWLRQEORFNV\PEROVRI2(/RZDQG2(+LJK
2
ABB Automation OE1Low, OE1High RE_5_ _
3
RE_5_ _ OE1Low, OE1High ABB Automation
2 Description of Operation
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The voltage is connected to the input U
of the function block. This voltage can be any of the available phase-to-phase or
phase-to-earth voltages. Digital inputs are connected to the boolean inputs of the
function block, and the outputs of the function block are connected to the output
signals in the same way. The function block automatically detects the signal type of
the connected analogue input. The operation of the function block is prevented if the
signal type is not correct, i.e. if the input is something else than a phase-to-phase or
phase-to-earth voltage.
The frequency protection must be selected for the voltage input via the special
measurements dialogue box in the configuration tool. For further information, please
refer to Technical Reference Manual, Part 3, Configuration Guideline,
1MRS750745-MUM. If the frequency protection is not selected, the ERR output of
the function block will be activated and a channel supervision error for the voltage
channel will be sent.
The excecution interval of the program the function block OE1Low and OE1High is
instantiated within, must be 10 ms at 50 Hz. Otherwise, the ERR output of the
function block will be activated and an error event E11 is sent.
Voltage should be taken from the generator or power inlet side of the transformer.
Only if there is a tap-changer on this side of the transformer, the voltage connected to
this protection function should be taken from the other side.
The operation of the function blocks OE1Low and OE1High is based on calculating
the U/f (Volts/Hertz) ratio of the voltage input because the flux density in the
magnetic core is directly proportional to the voltage and inversely proportional to the
frequency. The function block uses a special algorithm which is based on the
integrated value of the voltage signal. This algorithm enables a wide frequency range
and high insensitivity to harmonics at the same time.
4
ABB Automation OE1Low, OE1High RE_5_ _
The protection function block calculates the relative U/f ratio proportional to the
excitation level of the generator/transformer and compares this value to the setting
value. The function block picks up when the excitation exceeds the setting value and
trips when the set operate time has elapsed.
The calculated U/f ratio is scaled so that the value is 1.00 when the voltage and the
frequency are at nominal level. However, the user can define the highest allowed
continuous voltage (in p.u.) by setting the parameter U max cont. to change the
basis of the voltage. The measured voltage is then compared to this new base value to
obtain the excitation level. The same can be expressed as follows:
8P
IP 8 P IQ
0 = =
8 Q 8 max FRQW 8 Q 8 max FRQW I P
IQ
where:
0 = the excitation level (U/f ratio)
8m = measured voltage
Im = measured frequency
8n = nominal voltage
In = nominal frequency
8max cont = settable voltage base for excitation level
([DPSOH
Nominal values of the generator:
Un = 11 kV
fn = 50 Hz
Settings:
U max cont. = 1.00
Lets assume that the voltage of the generator terminal is 11.77 kV and the frequency
of the system is 49.98 Hz. The excitation level M of the generator is now
11.77 kV 50 Hz
M= = 1.07
11 kV 1.00 49.98 Hz
5
RE_5_ _ OE1Low, OE1High ABB Automation
([DPSOH
The situation and the data is equal to the example 1. The manufacturer of the
generator allows the continuous operation 105 % of the rated voltage at the rated load
and this value is wanted to be used as the base for overexcitation. Note that usually
the U/f characteristics are specified so that the ratio is 1.00 at the rated voltage and the
rated frequency and therefore the value 1.00 for U max cont. is recommended.
Settings:
U max cont. = 1.05
The calculated excitation level M of the generator is therefore:
11.77 kV 50 Hz
M= = 1.02
11 kV 1.05 49.98 Hz
Note also that the scaling factors for the analogue channels have an influence on the
values seen by the protection function blocks. In this example, it is assumed that the
scaling factor for the voltage channel is equal to 1.00. For further information, please
refer to Technical Reference Manual, Part 1, General, 1MRS750915-MUM.
U/f start DT
hysteresis
Time
OE_DT1
Operate time
)LJXUH 'HILQLWHWLPHRSHUDWLRQZKHQWKH8IUDWLRUHPDLQVDERYHWKH8I6WDUW'7
VHWWLQJLQFOXGLQJK\VWHUHVLV0LVHTXDOWR8PIP8QIQ
The function block is equipped with a BLOCK input, activation of which will force
the TRIP and CBFP outputs in FALSE state. Note that the START output is not
influenced by the BLOCK input. Blocking will also prevent the definite-time counter
and the inverse-time integrator from increasing, while decreasing during drop-off is
still carried out normally. U/f ratio is calculated as normally even if the function block
is blocked.
6
ABB Automation OE1Low, OE1High RE_5_ _
The function block starts to measure the U/f ratio when the peak value of the voltage
exceeds the low limit (20% of the nominal voltage when phase-to-phase voltage is
used, 35% when phase-to-earth voltage is used). The operation of the function block
is prevented until this limit is exceeded.
Oscillation of the U/f ratio around a value specified by U/f Start DT would cause
the START signal to alternate between TRUE and FALSE. This would ultimately
prevent a long lasting non-stabile fault situation from being detected if the function
block were reset every time the U/f ratio drops below a specified limit. The delayed
reset facility is used to prevent this.
When the DT timer has started, it goes on running as normally even if the U/f ratio
drops below a specified limit (U/f Start DT-hysteresis), provided the drop-off period
is shorter than the set drop-off time. If the drop-off period is longer than the set drop-
off time, the DT timer will reset when the drop-off time elapses (Figure 4).
In Figure 4 and Figure 5 the input signal IN of the DT timer is TRUE when the
relative U/f ratio is above the set start value, and FALSE when the U/f ratio is below
the set start value.
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff1.fh7
Operate time
Operate
timer
)LJXUH 7KHVHWGURSRIIWLPHLVVKRUWHUWKDQWKHGURSRIISHULRG
7
RE_5_ _ OE1Low, OE1High ABB Automation
If the drop-off period is shorter than the set drop-off time and the DT timer time has
elapsed during the drop-off period, the function block will trip once the current
exceeds the set value again (Figure 5).
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff2.fh7
Operate time
Operate
timer
)LJXUH 7KHVHWGURSRIIWLPHLVORQJHUWKDQWKHGURSRIISHULRG
The pick-up and drop-off sequence may occur several times before the TRIP is
activated. Note that the drop-off timer is reset every time the IN signal becomes
active.
Inverse-time operation is used when the operate time is wanted to depend on the level
of overexcitation. The higher the level of overexcitation, the higher the risk of
damage. Therefore, shorter operate times at high overexcitation levels might be
reasonable.
There are two types of curves available. They are named Curve #1 and Curve #2.
These curves approximate the shapes of the curves presented in the standard IEEE
C37.91-1985 but the setting parameters of the curves also enable different forms to
be obeyed. The curves can be classified as inverse definite minimum time (IDMT)
curves since both of them include a setting which allows the minimum time limit to be
set.
There are common setting parameters for the curves. Note that even though the same
parameters are used, the operate time of the function block is totally changed when
the operation mode is switched between these curves.
The definite-time (DT) operation is always present at both inverse-time modes. This
enables composite curves with one stage. Two stages can be used to fit the curve even
better to the characteristic of the protected device. In general, an IDMT curve
determines the operate times at a low level of overexcitation and a DT curve sets the
limit at a high level of overexcitation. If, however, the DT operation in IDMT mode is
not desired, it is possible to eliminate it by setting the Operate time and/or U/f start
DT above the selected IDMT curve.
8
ABB Automation OE1Low, OE1High RE_5_ _
The parameter U/f start IDMT determines the U/f ratio which is needed before the
function picks up in the inverse-time mode. The parameter U max cont. influences
the calculated U/f ratio as mentioned in the subsection Operation criteria. The
parameter k is used to set the sharpness of the IDMT curve and the parameter
Constant delay is used to set a constant time delay parameter. The parameter
Maximum time is used to limit the operate time to a reasonable level at low degrees
of overexcitation, and the parameter Cooling time models the thermal properties of
a transformer.
When the inverse-time operation is selected, the function block trips whenever the
built-in inverse-time integrator or the definite-time counter exceeds the limits. Note,
however, that in the inverse-time operation mode the definite-time counter is reset
whenever the U/f ratio drops below the limit specified by U/f start DT. This means
that the drop-off time facility described above will not be utilised in the IDMT mode.
The hysteresis of the DT mode is not used either, so the DT operation will reset
exactly when the U/f ratio falls below the U/f start DT value. Therefore, it is
essential that the U/f start DT setting is always bigger than the U/f start IDMT
setting at the IDMT mode; otherwise the function block will operate at the U/f start
DT setting with no hysteresis.
To prevent infinite start situations, the Maximum time setting is used to ensure a
trip after the set time if the overexcitation level remains slightly above the setting U/f
Start IDMT.
The built-in inverse-time integrator is decreased when the U/f ratio drops below a
value defined by U/f Start IDMT including hysteresis. This mimics the cooling
process of the transformer or the generator. Rate of decrease is linear and it is
determined by the setting parameter Cooling time. This setting is equal to the time
required for the device to fully recover from the overheating caused by overexcitation
(see Figure 6 and Figure 7).
TRIP LEVEL
IDMT MODE
100 %
2.
X
1.
Time
Moment Cooling time = Tc
U_f_cool1
Moment
of Start of Trip
9
RE_5_ _ OE1Low, OE1High ABB Automation
TRIP LEVEL
IDMT MODE
100 %
40 %
1. 2.
Time
Moment 40 % Tc
of Start
U_f_cool2
Moment Cooling time = Tc
of Drop-off
Note that the U/f ratio during the cooling process has no influence as long as it stays
below the U/f Start IDMT setting. Note also that the cooling process is included in
the IDMT mode only; the parameter Cooling time is not used in the DT mode.
&XUYH
The inverse time curve Curve #1 complies with the following equation:
0.18N
W = &G +
(0 1)2
where &G is the setting parameter Constant delayNis the setting parameter k and
0 is the excitation level as stated in the chapter Operation criteria.
10
ABB Automation OE1Low, OE1High RE_5_ _
2000
1000
600
200
100
Operate time, s
60 k
20 100
10 50
6.0
20
10
2.0
5
3
1.0 1
0.6
0.2
0.1
1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 1.9 2.0
Excitation level, M
)LJXUH 2SHUDWLRQFKDUDFWHULVWLFVRI&XUYH$FRQVWDQWYDOXHLVXVHGIRU
WKHSDUDPHWHU&RQVWDQWGHOD\&GWKURXJKRXWWKHSORW6HYHQGLIIHUHQW
YDOXHVRINDUHXVHG
([DPSOH
The operation mode is Curve #1. Settings are as follows:
U/f start DT = 1.6
U/f start IDMT = 1.1
U max cont. = 1.00
Operate time = 0.5 s
k =5
Maximum time = 3600 s ( = 60 min = 1 h )
Constant delay = 0.8 s
Cooling time = 100 s
11
RE_5_ _ OE1Low, OE1High ABB Automation
2000
1000
600
200
100
Operate time, s
60
20
10
6.0
2.0
1.0
0.6
0.2
0.1
1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 1.9
Excitation level, M
)LJXUH 2SHUDWLQJFXUYHRI&XUYHEDVHGRQWKHVHWWLQJVVSHFLILHGLQ
([DPSOH7KHWZRGRWVPDUNHGRQWKHFXUYHDUHUHIHUUHGWRLQWKHWH[W
If the overexcitation level stayed at 1.25, a trip would occur after 15.20 s. At the
overexcitation level of 1.42 the time to trip would be 5.90 seconds. These operating
points can also be found in Figure 9. Note that in this case the setting Maximum
time = 3600 s doesnt limit the maximum operate time because the operate time at
U/f start IDMT = 1.1 is approximately 75 s.
&XUYH
The inverse time curve Curve #2 complies with the following equation:
N
113.5+ 2 .5 100 0
W=H 3.04
whereNis the setting parameter k and 0 is the excitation level as stated in the
chapter Operation criteria. The setting parameter Constant delay is used as a
minimum time limit for Curve #2, i.e. operate times shorter than Constant delay
are not allowed.
12
ABB Automation OE1Low, OE1High RE_5_ _
20000
10000
6000
2000
1000
Operate time, s 600
200
100
60
20
10
6.0
2.0
1.0
0.6
0.2
1 2 4 7 11 16 k
0.1
1.0 1.1 1.2 1.3 1.4 1.5 1.6
Excitation level, M
)LJXUH 2SHUDWLRQFKDUDFWHULVWLFVRI&XUYH6L[GLIIHUHQWYDOXHVRINDUH
XVHG1RWHWKDWWKHPLQLPXPRSHUDWHWLPHLVOLPLWHGE\WKHSDUDPHWHU
&RQVWDQWGHOD\
([DPSOH
The operation mode is Curve #2. Settings are as follows:
U/f start DT = 1.5
U/f start IDMT = 1.1
U max cont. = 1.00
Operate time = 0.5 s
k =8
Maximum time = 600 s ( = 10 min )
Constant delay = 1.0 s ( = minimum time )
Cooling time = 200 s
13
RE_5_ _ OE1Low, OE1High ABB Automation
2000
1000
600
200
100
Operate time, s
60
20
10
6.0
2.0
1.0
0.6
0.2
0.1
1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8
Excitation level, M
)LJXUH 2SHUDWLQJFXUYHRI&XUYHEDVHGRQWKHVHWWLQJVVSHFLILHGLQ
([DPSOH7KHWZRGRWVPDUNHGRQWKHFXUYHDUHUHIHUUHGWRLQWKHWH[W
A trip would occur after 22.76 s if the overexcitation level remained at 1.24. At the
overexcitation level of 1.38, the equation would give 0.23 s but now the Constant
delay setting limits the minimum operate time to 1.0 s. Note also that the setting
Maximum time would limit the operate time to 600 s, if the overexcitation level
stayed between 1.1 and 1.14.
In general, however, the overexcitation level seldom remains constant and for that
reason exact operate times in any inverse-time mode are difficult to predict.
Two different groups of setting values, group 1 and group 2, are available for the
function block. Switching between the two groups can be done in following three
ways:
1) Locally via the control parameter Group selection1) of the MMI
2) Over the communication bus by writing the parameter V3 1)
3) By means of the input signal GROUP, when allowed via Group selection
(i.e. when V3 = 2 1)).
1)
Group selection (V3): 0 = Group 1; 1 = Group 2; 2 = GROUP input
The control parameter Active group indicates the setting group valid at a given
time.
14
ABB Automation OE1Low, OE1High RE_5_ _
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The output signal START is always pulse-shaped. The minimum pulse width of the
corresponding output signal is set via a separate parameter on the MMI or through the
serial communication. If the START condition lasts longer than the set pulse width,
the START signal remains active until the START condition is over. The output
signal TRIP may have a non-latching or latching feature. When the latching mode has
been selected, the TRIP signal remains active until the output is reset, even though the
operation criteria have reset.
The function block provides a delayed trip signal CBFP after the TRIP signal unless
the fault has disappeared during the set CBFP time delay. In circuit-breaker failure
protection, the CBFP output can be used to operate a circuit breaker in front of the
circuit breaker of the machine. The control parameter Trip pulse also sets the width
of the CBFP output signal.
2.9 Resetting
The TRIP output signal and the recorded data can be reset via the RESET input, or
over the serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
Operation Latched trip Recorded
indicators signal data
1)
RESET input of the function block x x
1)
Parameter F068V013 for OE1Low x x
1)
Parameter F069V013 for OE1High x x
2)
General parameter F001V011 x
2)
General parameter F001V012 x x
2)
General parameter F001V013 x x x
2)
Push-button C x
2)
Push-buttons C + E (2 s) x x
2)
Push-buttons C + E (5 s) x x x
1)
Local reset: resets the latched trip signal or recorded data of the particular function block.
2)
Affects all function blocks.
15
RE_5_ _ OE1Low, OE1High ABB Automation
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for OE1Low is 68 and for OE1High 69.
The data direction of the parameters defines the use of each parameter as follows:
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the relay
terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask 1
parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
16
ABB Automation OE1Low, OE1High RE_5_ _
17
RE_5_ _ OE1Low, OE1High ABB Automation
18
ABB Automation OE1Low, OE1High RE_5_ _
19
RE_5_ _ OE1Low, OE1High ABB Automation
3.3.3.1 General
The information required for later fault analysis is recorded when the function block
starts or trips.
The data of last three operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
The time stamp indicates the rising edge of the START or TRIP signal.
3.3.3.3 Duration
The duration of the START condition is recorded as a percentage of the set operate
time at the DT mode of operation. When the inverse-time operation mode is selected,
the function block estimates the presumable operate time and updates the duration
according to the momentary level of overexcitation. Hence, the duration indicates
how near (in percent) the tripping will be since the activation of START.
The duration can be 100% only if the function block has tripped. If, for example, the
Drop-off time setting causes the start situation to be active over the set operate time
but a new exceeding of the operate value does not occur during the set drop-off time,
the duration will be 99%.
If the function block trips, the U/f ratio is updated at the moment of tripping i.e. on
the rising edge of the TRIP signal. If the function block starts but does not trip, the
U/f ratio captured one fundamental cycle (20 ms at rated frequency 50 Hz) after the
beginning of the start situation is recorded.
The status data of BLOCK signal and the active setting group are recorded at the
moment of triggering.
20
ABB Automation OE1Low, OE1High RE_5_ _
3.3.3.6 Priority
21
RE_5_ _ OE1Low, OE1High ABB Automation
3.3.3.10 Events
Code Weighting Default Event reason Event state
coefficient mask
E0 1 1 START signal from U/f> or U/f>> Reset
E1 2 1 START signal from U/f> or U/f>> Activated
E2 4 1 TRIP signal from U/f> or U/f >> Reset
E3 8 1 TRIP signal from U/f> or U/f>> Activated
E4 16 1 CBFP signal from U/f> or U/f>> Reset
E5 32 1 CBFP signal from U/f> or U/f>> Activated
E6 64 0 BLOCK signal from U/f> or U/f>> Reset
E7 128 0 BLOCK signal of U/f> or U/f>> Activated
E8 256 0 Test mode of the function block Off
E9 512 0 Test mode of the function block On
E10 0 0 - -
E11 2048 1 Configuration error signal from the Activated
function block
22
ABB Automation OE1Low, OE1High RE_5_ _
4 Technical Data
Operation accuracies Depends on the frequency as follows:
20 < f < 40 Hz: 4% of set value
f 40 Hz: 2% of set value
Start time Injected U/f > 2.0 x Un/fn internal time <60 ms
total time 1) <70 ms
Reset time 1001060 ms (depends on the set minimum pulse width for the TRIP
output)
Reset ratio 20 < f < 40 Hz: typ. 0.99 (range 0.97...0.99)
f 40 Hz: typ 0.97 (range 0.95...0.98)
Retardation time Total retardation time when the measured U/f drops below the setting
value <105 ms 2)
Operate time accuracy at Over the frequency range 20...80 Hz:
definite-time mode 4% of set value or 40 ms 2)
Operate time accuracy at 100 ms 2) or the accuracy appearing when the measured voltage
inverse-time modes varies 1.0%
Configuration data Task execution interval (Relay Configuration Tool):
10 ms, at the rated frequency fn = 50 Hz
1)
Includes the delay of the signal relay
2)
Includes the delay of the heavy-duty output relay
23
1MRS 752319-MUM OE1_
Issued: 3/2000
Version: B/12.2.2002
Overexcitation Protection
Low-Set Stage (OE1Low)
Data subject to change without notice High-Set Stage (OE1High)
Contents
1 Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 3
2 Description of Operation.......................................................................... 4
2.1 Configuration....................................................................................... 4
2.2 Measuring mode ................................................................................. 4
2.3 Operation criteria................................................................................. 5
2.4 Delayed reset facility and drop-off time in DT mode ............................ 7
2.5 IDMT type operation............................................................................ 8
2.6 Setting groups ................................................................................... 14
2.7 Test mode ......................................................................................... 15
2.8 START, TRIP and CBFP outputs ...................................................... 15
2.9 Resetting........................................................................................... 15
3 Parameters and Events .......................................................................... 16
3.1 General ............................................................................................. 16
3.2 Setting values.................................................................................... 17
3.2.1 Actual settings.......................................................................... 17
3.2.2 Setting group 1......................................................................... 17
3.2.3 Setting group 2......................................................................... 18
3.2.4 Control settings ........................................................................ 19
3.3 Measurement values ......................................................................... 19
3.3.1 Input data ................................................................................. 19
3.3.2 Output data .............................................................................. 20
3.3.3 Recorded data.......................................................................... 20
1 Introduction
1.1 Features
Single-phase overexcitation (Volts/Hertz) protection for generators and
transformers
Phase-to-phase or phase-to-earth voltage
Definite-time (DT) operation and two inverse-time characteristics
Maximum and minimum time settings in inverse-time modes
Voltage and its frequency can be measured with a conventional voltage
transformer or a voltage divider
Delayed trip output for the circuit-breaker failure protection (CBFP) function
1.2 Application
This document specifies the functions of the overexcitation function blocks OE1Low
and OE1High used in products based on the RED 500 Platform. The function blocks
are identical in operation.
The overexcitation protection function blocks OE1Low and OE1High are used to
protect generators and power transformers against the excessive flux density and
saturation of the magnetic core. The saturation leads to a stray flux which may cause
eddy currents and severe overheating in nonlaminated parts of a generator or a
transformer. Note that the terms (over)excitation level or U/f ratio are commonly used
to denote the flux density.
U/f> U/f>>
CBFP CBFP
)LJXUH 3URWHFWLRQGLDJUDPV\PEROVRIWKHIXQFWLRQEORFNV2(/RZDQG2(+LJK
)RU,(&V\PEROVXVHGLQVLQJOHOLQHGLDJUDPVUHIHUWRWKHPDQXDO
7HFKQLFDO'HVFULSWLRQVRI)XQFWLRQV,QWURGXFWLRQ056
080
)LJXUH )XQFWLRQEORFNV\PEROVRI2(/RZDQG2(+LJK
2
Substation Automation OE1_
3
OE1 _ Substation Automation
2 Description of Operation
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The voltage is connected to the input U
of the function block. This voltage can be any of the available phase-to-phase or
phase-to-earth voltages. Digital inputs are connected to the boolean inputs of the
function block, and the outputs of the function block are connected to the output
signals in the same way. The function block automatically detects the signal type of
the connected analogue input. The operation of the function block is prevented if the
signal type is not correct, i.e. if the input is something else than a phase-to-phase or
phase-to-earth voltage.
The frequency protection must be selected for the voltage input via the special
measurements dialogue box in the configuration tool. For further information, please
refer to Technical Reference Manual, Part 3, Configuration Guideline,
1MRS750745-MUM. If the frequency protection is not selected, the ERR output of
the function block will be activated and a channel supervision error for the voltage
channel will be sent.
The excecution interval of the program the function block OE1Low and OE1High is
instantiated within, must be 10 ms at 50 Hz. Otherwise, the ERR output of the
function block will be activated and an error event E11 is sent.
Voltage should be taken from the generator or power inlet side of the transformer.
Only if there is a tap-changer on this side of the transformer, the voltage connected to
this protection function should be taken from the other side.
The operation of the function blocks OE1Low and OE1High is based on calculating
the U/f (Volts/Hertz) ratio of the voltage input because the flux density in the
magnetic core is directly proportional to the voltage and inversely proportional to the
frequency. The function block uses a special algorithm which is based on the
integrated value of the voltage signal. This algorithm enables a wide frequency range
and high insensitivity to harmonics at the same time.
4
Substation Automation OE1_
The protection function block calculates the relative U/f ratio proportional to the
excitation level of the generator/transformer and compares this value to the setting
value. The function block picks up when the excitation exceeds the setting value and
trips when the set operate time has elapsed.
The calculated U/f ratio is scaled so that the value is 1.00 when the voltage and the
frequency are at nominal level. However, the user can define the highest allowed
continuous voltage (in p.u.) by setting the parameter U max cont. to change the
basis of the voltage. The measured voltage is then compared to this new base value to
obtain the excitation level. The same can be expressed as follows:
8P
IP 8 P IQ
0 = =
8 Q 8 max FRQW 8 Q 8 max FRQW I P
IQ
where:
0 = the excitation level (U/f ratio)
8m = measured voltage
Im = measured frequency
8n = nominal voltage
In = nominal frequency
8max cont = settable voltage base for excitation level
([DPSOH
Nominal values of the generator:
Un = 11 kV
fn = 50 Hz
Settings:
U max cont. = 1.00
Lets assume that the voltage of the generator terminal is 11.77 kV and the frequency
of the system is 49.98 Hz. The excitation level M of the generator is now
11.77 kV 50 Hz
M= = 1.07
11 kV 1.00 49.98 Hz
5
OE1 _ Substation Automation
([DPSOH
The situation and the data is equal to the example 1. The manufacturer of the
generator allows the continuous operation 105 % of the rated voltage at the rated load
and this value is wanted to be used as the base for overexcitation. Note that usually
the U/f characteristics are specified so that the ratio is 1.00 at the rated voltage and the
rated frequency and therefore the value 1.00 for U max cont. is recommended.
Settings:
U max cont. = 1.05
The calculated excitation level M of the generator is therefore:
11.77 kV 50 Hz
M= = 1.02
11 kV 1.05 49.98 Hz
Note also that the scaling factors for the analogue channels have an influence on the
values seen by the protection function blocks. In this example, it is assumed that the
scaling factor for the voltage channel is equal to 1.00. For further information, please
refer to Technical Reference Manual, Part 1, General, 1MRS750915-MUM.
U/f start DT
hysteresis
Time
OE_DT1
Operate time
)LJXUH 'HILQLWHWLPHRSHUDWLRQZKHQWKH8IUDWLRUHPDLQVDERYHWKH8I6WDUW'7
VHWWLQJLQFOXGLQJK\VWHUHVLV0LVHTXDOWR8PIP8QIQ
The function block is equipped with a BLOCK input, activation of which will force
the TRIP and CBFP outputs in FALSE state. Note that the START output is not
influenced by the BLOCK input. Blocking will also prevent the definite-time counter
and the inverse-time integrator from increasing, while decreasing during drop-off is
still carried out normally. U/f ratio is calculated as normally even if the function block
is blocked.
6
Substation Automation OE1_
The function block starts to measure the U/f ratio when the peak value of the voltage
exceeds the low limit (20% of the nominal voltage when phase-to-phase voltage is
used, 35% when phase-to-earth voltage is used). The operation of the function block
is prevented until this limit is exceeded.
Oscillation of the U/f ratio around a value specified by U/f Start DT would cause
the START signal to alternate between TRUE and FALSE. This would ultimately
prevent a long lasting non-stabile fault situation from being detected if the function
block were reset every time the U/f ratio drops below a specified limit. The delayed
reset facility is used to prevent this.
When the DT timer has started, it goes on running as normally even if the U/f ratio
drops below a specified limit (U/f Start DT-hysteresis), provided the drop-off period
is shorter than the set drop-off time. If the drop-off period is longer than the set drop-
off time, the DT timer will reset when the drop-off time elapses (Figure 4).
In Figure 4 and Figure 5 the input signal IN of the DT timer is TRUE when the
relative U/f ratio is above the set start value, and FALSE when the U/f ratio is below
the set start value.
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff1.fh7
Operate time
Operate
timer
)LJXUH 7KHVHWGURSRIIWLPHLVVKRUWHUWKDQWKHGURSRIISHULRG
7
OE1 _ Substation Automation
If the drop-off period is shorter than the set drop-off time and the DT timer time has
elapsed during the drop-off period, the function block will trip once the current
exceeds the set value again (Figure 5).
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff2.fh7
Operate time
Operate
timer
)LJXUH 7KHVHWGURSRIIWLPHLVORQJHUWKDQWKHGURSRIISHULRG
The pick-up and drop-off sequence may occur several times before the TRIP is
activated. Note that the drop-off timer is reset every time the IN signal becomes
active.
Inverse-time operation is used when the operate time is wanted to depend on the level
of overexcitation. The higher the level of overexcitation, the higher the risk of
damage. Therefore, shorter operate times at high overexcitation levels might be
reasonable.
There are two types of curves available. They are named Curve #1 and Curve #2.
These curves approximate the shapes of the curves presented in the standard IEEE
C37.91-1985 but the setting parameters of the curves also enable different forms to
be obeyed. The curves can be classified as inverse definite minimum time (IDMT)
curves since both of them include a setting which allows the minimum time limit to be
set.
There are common setting parameters for the curves. Note that even though the same
parameters are used, the operate time of the function block is totally changed when
the operation mode is switched between these curves.
The definite-time (DT) operation is always present in both inverse-time modes. This
enables composite curves with one stage. Two stages can be used to fit the curve even
better to the characteristic of the protected device. In general, an IDMT curve
determines the operate times at a low level of overexcitation and a DT curve sets the
limit at a high level of overexcitation. If, however, the DT operation in IDMT mode is
not desired, it is possible to eliminate it by setting the Operate time and/or U/f start
DT above the selected IDMT curve.
8
Substation Automation OE1_
The parameter U/f start IDMT determines the U/f ratio which is needed before the
function picks up in the inverse-time mode. The parameter U max cont. influences
the calculated U/f ratio as mentioned in the subsection Operation criteria. The
parameter k is used to set the sharpness of the IDMT curve and the parameter
Constant delay is used to set a constant time delay parameter. The parameter
Maximum time is used to limit the operate time to a reasonable level at low degrees
of overexcitation, and the parameter Cooling time models the thermal properties of
a transformer.
When the inverse-time operation is selected, the function block trips whenever the
built-in inverse-time integrator or the definite-time counter exceeds the limits. Note,
however, that in the inverse-time operation mode the definite-time counter is reset
whenever the U/f ratio drops below the limit specified by U/f start DT. This means
that the drop-off time facility described above will not be utilised in the IDMT mode.
The hysteresis of the DT mode is not used either, so the DT operation will reset
exactly when the U/f ratio falls below the U/f start DT value. Therefore, it is
essential that the U/f start DT setting is always bigger than the U/f start IDMT
setting in the IDMT mode; otherwise the function block will operate at the U/f start
DT setting with no hysteresis.
To prevent infinite start situations, the Maximum time setting is used to ensure a
trip after the set time if the overexcitation level remains slightly above the setting U/f
Start IDMT.
The built-in inverse-time integrator is decreased when the U/f ratio drops below a
value defined by U/f Start IDMT including hysteresis. This mimics the cooling
process of the transformer or the generator. Rate of decrease is linear and it is
determined by the setting parameter Cooling time. This setting is equal to the time
required for the device to fully recover from the overheating caused by overexcitation
(see Figure 6 and Figure 7).
TRIP LEVEL
IDMT MODE
100 %
2.
X
1.
Time
Moment Cooling time = Tc
U_f_cool1
Moment
of Start of Trip
9
OE1 _ Substation Automation
TRIP LEVEL
IDMT MODE
100 %
40 %
1. 2.
Time
Moment 40 % Tc
of Start
U_f_cool2
Moment Cooling time = Tc
of Drop-off
Note that the U/f ratio during the cooling process has no influence as long as it stays
below the U/f Start IDMT setting. Note also that the cooling process is included in
the IDMT mode only; the parameter Cooling time is not used in the DT mode.
&XUYH
The inverse time curve Curve #1 complies with the following equation:
0.18N
W = &G +
(0 1)2
where &G is the setting parameter Constant delayNis the setting parameter k and
0 is the excitation level as stated in the chapter Operation criteria.
10
Substation Automation OE1_
2000
1000
600
200
100
Operate time, s
60 k
20 100
10 50
6.0
20
10
2.0
5
3
1.0 1
0.6
0.2
0.1
1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 1.9 2.0
Excitation level, M
)LJXUH 2SHUDWLRQFKDUDFWHULVWLFVRI&XUYH$FRQVWDQWYDOXHLVXVHGIRU
WKHSDUDPHWHU&RQVWDQWGHOD\&GWKURXJKRXWWKHSORW6HYHQGLIIHUHQW
YDOXHVRINDUHXVHG
([DPSOH
The operation mode is Curve #1. Settings are as follows:
U/f start DT = 1.6
U/f start IDMT = 1.1
U max cont. = 1.00
Operate time = 0.5 s
k =5
Maximum time = 3600 s ( = 60 min = 1 h )
Constant delay = 0.8 s
Cooling time = 100 s
11
OE1 _ Substation Automation
2000
1000
600
200
100
Operate time, s
60
20
10
6.0
2.0
1.0
0.6
0.2
0.1
1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 1.9
Excitation level, M
)LJXUH 2SHUDWLQJFXUYHRI&XUYHEDVHGRQWKHVHWWLQJVVSHFLILHGLQ
([DPSOH7KHWZRGRWVPDUNHGRQWKHFXUYHDUHUHIHUUHGWRLQWKHWH[W
If the overexcitation level stayed at 1.25, a trip would occur after 15.20 s. At the
overexcitation level of 1.42 the time to trip would be 5.90 seconds. These operating
points can also be found in Figure 9. Note that in this case the setting Maximum
time = 3600 s doesnt limit the maximum operate time because the operate time at
U/f start IDMT = 1.1 is approximately 75 s.
&XUYH
The inverse time curve Curve #2 complies with the following equation:
N
113.5+ 2 .5 100 0
W=H 3.04
whereNis the setting parameter k and 0 is the excitation level as stated in the
chapter Operation criteria. The setting parameter Constant delay is used as a
minimum time limit for Curve #2, i.e. operate times shorter than Constant delay
are not allowed.
12
Substation Automation OE1_
20000
10000
6000
2000
1000
Operate time, s 600
200
100
60
20
10
6.0
2.0
1.0
0.6
0.2
1 2 4 7 11 16 k
0.1
1.0 1.1 1.2 1.3 1.4 1.5 1.6
Excitation level, M
)LJXUH 2SHUDWLRQFKDUDFWHULVWLFVRI&XUYH6L[GLIIHUHQWYDOXHVRINDUH
XVHG1RWHWKDWWKHPLQLPXPRSHUDWHWLPHLVOLPLWHGE\WKHSDUDPHWHU
&RQVWDQWGHOD\
([DPSOH
The operation mode is Curve #2. Settings are as follows:
U/f start DT = 1.5
U/f start IDMT = 1.1
U max cont. = 1.00
Operate time = 0.5 s
k =8
Maximum time = 600 s ( = 10 min )
Constant delay = 1.0 s ( = minimum time )
Cooling time = 200 s
13
OE1 _ Substation Automation
2000
1000
600
200
100
Operate time, s
60
20
10
6.0
2.0
1.0
0.6
0.2
0.1
1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8
Excitation level, M
)LJXUH 2SHUDWLQJFXUYHRI&XUYHEDVHGRQWKHVHWWLQJVVSHFLILHGLQ
([DPSOH7KHWZRGRWVPDUNHGRQWKHFXUYHDUHUHIHUUHGWRLQWKHWH[W
A trip would occur after 22.76 s if the overexcitation level remained at 1.24. At the
overexcitation level of 1.38, the equation would give 0.23 s but now the Constant
delay setting limits the minimum operate time to 1.0 s. Note also that the setting
Maximum time would limit the operate time to 600 s, if the overexcitation level
stayed between 1.1 and 1.14.
In general, however, the overexcitation level seldom remains constant and for that
reason exact operate times in any inverse-time mode are difficult to predict.
Two different groups of setting values, group 1 and group 2, are available for the
function block. Switching between the two groups can be done in following three
ways:
1) Locally via the control parameter Group selection1) of the MMI
2) Over the communication bus by writing the parameter V3 1)
3) By means of the input signal GROUP, when allowed via Group selection
(i.e. when V3 = 2 1)).
1)
Group selection (V3): 0 = Group 1; 1 = Group 2; 2 = GROUP input
The control parameter Active group indicates the setting group valid at a given
time.
14
Substation Automation OE1_
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The output signal START is always pulse-shaped. The minimum pulse width of the
corresponding output signal is set via a separate parameter on the MMI or through the
serial communication. If the START condition lasts longer than the set pulse width,
the START signal remains active until the START condition is over. The output
signal TRIP may have a non-latching or latching feature. When the latching mode has
been selected, the TRIP signal remains active until the output is reset, even though the
operation criteria have reset.
The function block provides a delayed trip signal CBFP after the TRIP signal unless
the fault has disappeared during the set CBFP time delay. In circuit-breaker failure
protection, the CBFP output can be used to operate a circuit breaker in front of the
circuit breaker of the machine. The control parameter Trip pulse also sets the width
of the CBFP output signal.
2.9 Resetting
The TRIP output signal and the recorded data can be reset via the RESET input, or
over the serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
Operation Latched trip Recorded
indicators signal data
1)
RESET input of the function block x x
1)
Parameter F068V013 for OE1Low x x
1)
Parameter F069V013 for OE1High x x
2)
General parameter F001V011 x
2)
General parameter F001V012 x x
2)
General parameter F001V013 x x x
2)
Push-button C x
2)
Push-buttons C + E (2 s) x x
2)
Push-buttons C + E (5 s) x x x
1)
Local reset: resets the latched trip signal or recorded data of the particular function block.
2)
Affects all function blocks.
15
OE1 _ Substation Automation
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for OE1Low is 68 and for OE1High 69.
The data direction of the parameters defines the use of each parameter as follows:
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the relay
terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask 1
parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
16
Substation Automation OE1_
17
OE1 _ Substation Automation
18
Substation Automation OE1_
19
OE1 _ Substation Automation
3.3.3.1 General
The information required for later fault analysis is recorded when the function block
starts or trips.
The data of last three operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
The time stamp indicates the rising edge of the START or TRIP signal.
3.3.3.3 Duration
The duration of the START condition is recorded as a percentage of the set operate
time in the DT mode of operation. When the inverse-time operation mode is selected,
the function block estimates the presumable operate time and updates the duration
according to the momentary level of overexcitation. Hence, the duration indicates
how near (in percent) the tripping will be since the activation of START.
The duration can be 100% only if the function block has tripped. If, for example, the
Drop-off time setting causes the start situation to be active over the set operate time
but a new exceeding of the operate value does not occur during the set drop-off time,
the duration will be 99%.
If the function block trips, the U/f ratio is updated at the moment of tripping i.e. on
the rising edge of the TRIP signal. If the function block starts but does not trip, the
U/f ratio captured one fundamental cycle (20 ms at rated frequency 50 Hz) after the
beginning of the start situation is recorded.
The status data of BLOCK signal and the active setting group are recorded at the
moment of triggering.
20
Substation Automation OE1_
3.3.3.6 Priority
21
OE1 _ Substation Automation
3.3.3.10 Events
Code Weighting Default Event reason Event state
coefficient mask
E0 1 1 START signal from U/f> or U/f>> Reset
E1 2 1 START signal from U/f> or U/f>> Activated
E2 4 1 TRIP signal from U/f> or U/f >> Reset
E3 8 1 TRIP signal from U/f> or U/f>> Activated
E4 16 1 CBFP signal from U/f> or U/f>> Reset
E5 32 1 CBFP signal from U/f> or U/f>> Activated
E6 64 0 BLOCK signal from U/f> or U/f>> Reset
E7 128 0 BLOCK signal of U/f> or U/f>> Activated
E8 256 0 Test mode of the function block Off
E9 512 0 Test mode of the function block On
E10 0 0 - -
E11 2048 1 Configuration error signal from the Activated
function block
22
Substation Automation OE1_
4 Technical Data
Operation accuracies Depends on the frequency as follows:
20 < f < 40 Hz: 4% of set value
f 40 Hz: 2.5% of set value
Start time Injected U/f > 2.0 x Un/fn internal time <90 ms
total time 1) <100 ms
Reset time 1001060 ms (depends on the set minimum pulse width for the TRIP
output)
Reset ratio 20 < f < 40 Hz: typ. 0.99 (range 0.97...0.99)
f 40 Hz: typ 0.97 (range 0.95...0.98)
Retardation time Total retardation time when the measured U/f drops below the setting
value <105 ms 2)
Operate time accuracy in Over the frequency range 20...80 Hz:
definite-time mode 4% of set value or 40 ms 2)
Operate time accuracy in 100 ms 2) or the accuracy appearing when the measured voltage
inverse-time modes varies 1.0%
Configuration data Task execution interval (Relay Configuration Tool):
10 ms, at the rated frequency fn = 50 Hz
1)
Includes the delay of the signal relay
2)
Includes the delay of the heavy-duty output relay
23
1MRS752320-MUM OL3Cap
Issued: 3/2000
Version: A/23.1.2002
Three-Phase Overload Protection
Data subject to change without notice
for Shunt Capacitor Banks
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 4
2. Description of Operation.......................................................................... 5
2.1 Configuration....................................................................................... 5
2.2 Setting the rated values of the protected unit ...................................... 5
2.3 Measuring mode ................................................................................. 6
2.4 Operation criteria................................................................................. 6
2.4.1 Overload protection.................................................................... 6
2.4.2 Reconnection inhibit ................................................................... 9
2.5 Setting groups ................................................................................... 10
2.6 Test mode ......................................................................................... 10
2.7 START, ALARM, TRIP and CBFP outputs ........................................ 11
2.8 Resetting........................................................................................... 11
1. Introduction
1.1 Features
1.2 Application
This document specifies the functions of the three-phase capacitor bank overload
protection function block OL3Cap used in products based on the RED 500 Platform.
The application area for the function block is the protection of power capacitor banks
intended for reactive power compensation and filtering of the harmonics. According
to the standards, a high voltage capacitor shall be able to withstand 10 % overload.
The function block OL3Cap is specially designed for the protection against overload
produced by harmonic currents and overvoltage. Furthermore, the protection against
reconnection of a charged capacitor to a live network is included.
2
Substation Automation OL3Cap
3I>
3I<
CBFP
Cap
)LJXUH )XQFWLRQEORFNV\PERORIWKHWKUHHSKDVHFDSDFLWRUEDQNRYHUORDG
SURWHFWLRQIXQFWLRQEORFN2/&DS
3
OL3Cap Substation Automation
4
Substation Automation OL3Cap
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The phase currents IL1, IL2 and IL3 are
connected to the corresponding IL1, IL2 and IL3 inputs of the function block. Digital
inputs are connected to the Boolean inputs of the function block and, in the same way,
the outputs of the function block are connected to the output signals. It is also possible
to use only one or two phase currents. However, the phase currents have to be
connected to the corresponding inputs, i.e. it is not possible to connect the phase
current IL1 to the input IL2 etc. If a configuration is not correct, the output ERR is
activated. The output should be connected to an indication, i.e. an MMIALARM_
function block. A configuration error will force the function block to the Not in use
mode.
Please note that the task execution interval of the funtion block must be configured to
the fastest task, i.e. 5ms (fn = 50 Hz). A slower task execution interval will cause a
configuration error.
A separate scaling factor can be set for each analogue channel. The factors enable
differences between the ratings of the protected unit and those of the measuring
device (CTs, VTs, etc.). A setting of 1.00 means that the rated value of the protected
unit is exactly the same as that of the measuring device. For more information refer to
Technical Reference Manual for REF54_.
5
OL3Cap Substation Automation
The operation of the tripping (Ib>) and alarm (Ia>) stages is based on peak value of the
integrated current. Thus the filtered currents will be directly proportional to the
voltage over the capacitor. The operation accuracy is defined in the frequency range
f/fn=0.95...1.05. In the peak measurement, the harmonics of the phase currents are not
suppressed. However, the operation of the undercurrent (I<) stage is based on the
numerically calculated fundamental frequency component of phase currents. The
operation is insensitive to the DC component and the operation accuracy is defined in
the frequency range f/fn=0.95...1.05. In fundamental frequency measurement the
harmonics suppression is at least -50 dB at f = k x fn, where k = 2, 3, 4, 5,...
Amplitude/dB
filter.CNV
Frequency/Hz
The tripping stage Ib> is based on an inverse-time characteristic and the inverse curve
is based on ANSI/IEEE 37.99 and IEC 60871-1 recommendations for the time-related
voltage withstand of the capacitor banks. The gradient of the curve can be changed by
a k-factor (parameter: Time multiplier). The set current value of the tripping stage
is normally 1.0 x In (2.2 Setting the rated values of the protected unit). If the current in
6
Substation Automation OL3Cap
one of the phases exceeds the setting value of stage Ib> by 10%, the stage starts and an
IDMT timer is started. The operate time depends on two factors, the degree of
overload and the inverse time multiplier k. If the overload situation lasts long enough
to exceed the operate time, the stage trips. However, the overload protection is
internally blocked for one second during the capacitor bank switching and, if the
overload situation persists, the function block will start after the blocking period.
7
OL3Cap Substation Automation
remains then in the hysteresis area for 24 hours, the timer and the output ST_Ib are
reset. The following figure will clarify the functionality:
I>
24h
1.1Ib>
Hysteresis limit
it-timer t
Output ST_Ib t
it-timer.cnv
1
0
t
)LJXUH 7KHEHKDYLRXURIWKH,'07WLPHUDQGWKHRXWSXW67B,E
The alarm stage (Ia>) has a definite-time characteristic. The stage is set as a p.u. value
of the setting value of the tripping stage (Ib>). If the current in one of the phases
exceeds the setting value of the stage Ia>, the stage starts and a DT timer is started. If
the overload period exceeds the set operate time, the stage provides an alarm signal.
The alarm signal is indicated by a blinking start LED (yellow).
The setting parameter Operation mode is used to select the operation mode of the
function as follows:
Operation mode
In use: The alarm and the tripping stages function simultaneously. Both stages cause
specific text indications and events as well as corresponding output signals.
Operate time
When the tripping, alarm or undercurrent stage starts, the corresponding start signal is
set to TRUE. Should the specific situation exceed the set inverse (Ib>) or definite (Ia>,
I<) operate time, the stage operates. The delay of the heavy-duty output relay is
included in the total operate time. When the stage operates, the specific trip signal is
set to TRUE.
The DT or IDMT timer is allowed to run only if the blocking signal BS1 is inactive,
i.e. its value is FALSE. When the signal becomes active, i.e. its value turns to TRUE,
the timer will be stopped (frozen). When the blocking signal BS2 is active, no trip
signal can be activated.
8
Substation Automation OL3Cap
It should be noted that the output signal TRIP_Imin should always be connected to the
OPENDIR input of the circuit-breaker function block (COCBx) of the capacitor bank.
This way it can be ensured that the breaker of the capacitor bank is opened before the
reconnection inhibit timer will be started.
After a loss of auxiliary supply or whenever powered up, the output signal AR_INH is
activated and the timer is started to ensure that the relay will not reclose the breaker
until the capacitor bank is discharged to an acceptable level.
9
OL3Cap Substation Automation
Two different groups of setting values, group 1 and group 2, are available for
OL3Cap. Switching between the two groups can be done in the following three ways:
The control parameter Active group indicates the setting group valid at a given
time.
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
10
Substation Automation OL3Cap
The start output signals ST_Ib, ST_Ia and ST_Imin are always pulse-shaped. The
minimum pulse width of the corresponding output signal is set via a separate
parameter on the MMI or the serial communication. If the start situation is longer than
the set pulse width, the specific start signal remains active until the start situation is
over. The output signals TRIP_Ib, ALARM and TRIP_Imin may have a non-latching
or latching feature. When the latching mode has been selected, the specific trip signal
remains active until the output is reset even if the operation criterion has reset.
The function block provides a delayed trip signal CBFP after the TRIP_Ib signal
unless the overload condition has disappeared during the set CBFP time delay. In
circuit-breaker failure protection, the CBFP output can be used to operate a circuit
breaker in front of the circuit breaker of the capacitor bank. The control parameter
Trip pulse also sets the width of the CBFP output signal.
2.8 Resetting
The TRIP_Ib, ALARM, TRIP_Imin output signals and the registers can be reset either
via the RESET input, or over the serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
11
OL3Cap Substation Automation
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for OL3Cap is 116.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
12
Substation Automation OL3Cap
Start current Ib S42 0.30...1.50 x In 1.00 R/W Start current of Ib> stage
Time multiplier S43 0.052.0 - 1.00 R/W Time multiplier k for stage Ib>
Start current Ia S44 0.80...1.20 x Ib 1.05 R/W Start current of Ia> stage
Operate time Ia S45 0.5...6000.0 s 300 R/W Operate time of Ia> stage
Start current I< S46 0.100.70 x Ib 0.50 R/W Start current of I< stage
Operate time I< S47 0.1...120 s 1.0 R/W Operate time of I< stage
13
OL3Cap Substation Automation
Start current Ib S72 0.30...1.50 x In 1.00 R/W Start current of Ib> stage
Time multiplier S73 0.052.0 - 1.00 R/W Time multiplier k for stage Ib>
Start current Ia S74 0.80...1.20 x Ib 1.05 R/W Start current of Ia> stage
Operate time Ia S75 0.5...6000.0 s 300 R/W Operate time of Ia> stage
Start current I< S76 0.100.70 x Ib 0.50 R/W Start current of I< stage
Operate time I< S77 0.1...120 s 1.0 R/W Operate time of I< stage
14
Substation Automation OL3Cap
CBFP time V6 100...1000 ms 100 R/W Operate time of the delayed trip
CBFP
Event mask 1 V101 0...4194304 - 49983 R/W Event mask 1 for event
transmission (E0 ... E21)
Event mask 2 V103 0...4194304 - 49983 R/W Event mask 2 for event
transmission (E0 ... E21)
Event mask 3 V105 0...4194304 - 49983 R/W Event mask 3 for event
transmission (E0 ... E21)
Event mask 4 V107 0...4194304 - 49983 R/W Event mask 4 for event
transmission (E0 ... E21)
1)
Group selection 0 = Group 1; 1 = Group 2; 2 = GROUP input
2)
Active group 0 = Group 1; 1 = Group 2
3)
Trip signal 0 = Non-latching; 1 = Latching
4)
Register I< 0 = OFF; 1 = ON
5)
Test 0 = Do not activate; 1 = Activate
15
OL3Cap Substation Automation
16
Substation Automation OL3Cap
3.3.3.1 General
The information required for later fault analysis is recorded when the function block
starts, alarms or trips, or when the recording function is triggered via an external
triggering input. However, the start or the trip of the undercurrent stage will cause a
registration only if the control parameter Register I< is set to ON.
The data of the last three operations (operation 1...3) are recorded and the values of
the most recent operation always replace the data of the oldest operation. The
registers are updated in the following order: Operation 1, Operation 2, Operation 3,
Operation 1, Operation 2,...
The time stamp indicates the rising edge of the ST_Ib, ST_Ia, ST_Imin or TRIGG
signal. If the ALARM or TRIP signal follows the START signal, the time stamp will
be updated.
3.3.3.3 Duration
In the DT mode of operation (Ia>, I<), the duration of the start situation is recorded as
a percentage of the set operate time and in the IDMT mode of operation (Ib>) as a
percentage of the calculated operate time.
3.3.3.4 Currents
If the function block alarms or trips, the current values are updated at the moment of
alarming or tripping, i.e. on the rising edge of the ALARM, TRIP_Ib or TRIP_Imin (if
enabled) signal. For external triggering, the current values are updated at the moment
of triggering, i.e. on the rising edge of the input signal TRIGG. If the function block
starts but does not alarm or trip, the current values captured one fundamental cycle
(20 ms at rated frequency 50 Hz) after the beginning of the start situation are
recorded. Thus the values of the phase currents IL1, IL2 and IL3 always originate from
the same moment and are recorded as multiples of the rated current In.
Note! If the stage Ia> alarms and the stage Ib> starts but does not trip, the current
values are captured at the moment of starting of the Ib> stage.
17
OL3Cap Substation Automation
The status data of the inputs BS1 and BS2 and the parameter Active group are
recorded at the moment of triggering. The parameter Active group indicates the
setting group valid for the recorded data.
3.3.3.6 Priority
1 Tripping of Ib>
2 Starting of Ib>
3 Alarming of Ia>
4 Starting of Ia>
5 Tripping of I<
6 Starting of I<
7 External triggering,
which means that if the function block has started, an external triggering request will
be neglected.
Duration Imin V205 0.0...100.0 % 0.0 R/M Duration of start situation of I<
18
Substation Automation OL3Cap
Duration Imin V305 0.0...100.0 % 0.0 R/M Duration of start situation of I<
Duration Imin V405 0.0...100.0 % 0.0 R/M Duration of start situation of I<
19
OL3Cap Substation Automation
3.3.4 Events
20
Substation Automation OL3Cap
Reset time 40...1000 ms (depends on the minimum pulse width set for the
TRIP output)
Undercurrent stage:
Typ. 1.05 (range 1.02...1.05)
21
1MRS100092 (Stage 1) RE_5_ _
1MRS100093 (Stage 2) Three-Phase Directional
1MRS100094 (Stage 3)
Issued: 10/1998 Overpower Protection
Version: C
Stage 1 (OPOW6St1)
Data subject to change without notice
Stage 2 (OPOW6St2)
Stage 3 (OPOW6St3)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 3
2. Description of Operation.......................................................................... 4
2.1 Configuration....................................................................................... 4
2.1.1 Analogue input selection for configuration.................................. 4
2.2 Measuring mode ................................................................................. 5
2.3 Operation criteria................................................................................. 5
2.4 Delayed reset facility and drop-off time in DT Mode ............................ 6
2.5 Setting groups ..................................................................................... 7
2.6 Test mode ........................................................................................... 7
2.7 START, TRIP and CBFP outputs ........................................................ 7
2.8 Resetting............................................................................................. 8
3. Parameters and Events ............................................................................ 9
3.1 General ............................................................................................... 9
3.2 Setting values.................................................................................... 10
3.2.1 Actual settings.......................................................................... 10
3.2.2 Setting group 1......................................................................... 10
3.2.3 Setting group 2......................................................................... 10
3.2.4 Control settings ........................................................................ 11
3.3 Measurement values ......................................................................... 12
3.3.1 Input data ................................................................................. 12
3.3.2 Output data .............................................................................. 12
3.3.3 Recorded data.......................................................................... 12
3.3.4 Events ...................................................................................... 15
1. Introduction
1.1 Features
1.2 Application
This document specifies the functions of the directional overpower function blocks
OPOW6St1, OPOW6St2 and OPOW6St3 used in products based on the RED 500
Platform. The three stages are identical in operation.
S>
)LJXUH 3URWHFWLRQGLDJUDPV\PERORI232:6WB)RU,(&V\PEROVXVHGLQ
VLQJOHOLQHGLDJUDPVUHIHUWRWKHPDQXDO7HFKQLFDO'HVFULSWLRQVRI
)XQFWLRQV,QWURGXFWLRQ056080
)LJXUH )XQFWLRQEORFNV\PEROVRI232:6W232:6WDQG232:6W
2
ABB Automation OPOW6St1OPOW6St3 RE_5_ _
3
RE_5_ _ OPOW6St1OPOW6St3 ABB Automation
2.1 Configuration
The analogue input combinations listed below are available in the dialogue box of the
configuration tool. When all the phase currents and phase voltages are known, P and
Q are calculated from positive-sequence components. The correct input combination
is selected via the configuration tool.
4
ABB Automation OPOW6St1OPOW6St3 RE_5_ _
With the rated frequency of 50 Hz, the active and reactive power values are updated
twice each fundamental frequency cycle, i.e. every 10 ms.
Power direction can be changed via the control parameter Power direction.
The directional overpower function block OPOW6St_ starts if the power reaches the
operating area. The direction is set with the parameter Angle. The setting parameter
Power Setting is the shortest distance between the origo and the operating line.
Hysteresis
Operates
3R ZH U
6H WW LQ J
P
.
)LJXUH 2SHUDWLQJFKDUDVWHULVWLFRI232:6WBZKHQWKHSDUDPHWHU$QJOHLV
DQGWKHSDUDPHWHU3RZHUGLUHFWLRQLV)RUZDUG
Hysteresis
Operates
3 RZ HU
6 H W WL QJ
$QJOH
P
)LJXUH 2SHUDWLQJFKDUDVWHULVWLFRI232:6WBZKHQWKHSDUDPHWHU$QJOHLV
DQGWKHSDUDPHWHU3RZHUGLUHFWLRQLV)RUZDUG
5
RE_5_ _ OPOW6St1OPOW6St3 ABB Automation
At reciprocating load conditions the power measuring element may pick up briefly
and periodically. The purpose of the delayed reset function is to ensure that the
function block operates within its predetermined operating time even in such power
swing conditions. Without the delayed reset function the DT timer would reset as
soon as the measuring element drops off.
When the DT timer has started, it goes on running normally even if the measuring
element drops off, provided the drop-off period is shorter than the set drop-off time. If
the drop-off period is longer than the set drop-off time, the DT timer will reset when
the drop-off time elapses (Figure 5).
In Figures 5 and 6 the input signal IN of the DT timer is TRUE when the measured
power is above the set start value and FALSE when the measured power is below the
set start value.
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff1.fh7
Operate time
Operate
timer
)LJXUH 7KHGURSRIISHULRGLVORQJHUWKDQWKHVHWGURSRIIWLPH
If the drop-off period is shorter than the set drop-off time and the DT timer has
elapsed during the drop-off period, the function block will trip once the measured
power exceeds the set start value again (Figure 6).
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff2.fh7
Operate time
Operate
timer
)LJXUH 7KHGURSRIISHULRGLVVKRUWHUWKDQWKHVHWGURSRIIWLPH
6
ABB Automation OPOW6St1OPOW6St3 RE_5_ _
Two different groups of setting values, group 1 and group 2, are available for
OPOW6St_. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The output signal START is always pulse-shaped. The minimum pulse width of the
corresponding output signal is set with a separate parameter on the MMI or on serial
communication. If the start situation is longer than the set pulse width, the START
signal remains active until the start situation is over. The output signal TRIP may
have a non-latching or latching feature. When the latching mode has been selected,
the TRIP signal remains active until the output is reset even if the operation criteria
have reset.
The function block provides a delayed trip signal CBFP after the TRIP signal unless
the fault has disappeared during the set CBFP time delay. In circuit-breaker failure
protection, the CBFP output can be used to operate a circuit breaker in front of the
circuit breaker of the machine. The control parameter Trip pulse also sets the width
of the CBFP output signal.
7
RE_5_ _ OPOW6St1OPOW6St3 ABB Automation
2.8 Resetting
The TRIP output signal and the registers can be reset via the RESET input, or over the
serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
8
ABB Automation OPOW6St1OPOW6St3 RE_5_ _
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for OPOW6St1 is 92, that for OPOW6St2 93
and that for OPOW6St3 94.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
9
RE_5_ _ OPOW6St1OPOW6St3 ABB Automation
10
ABB Automation OPOW6St1OPOW6St3 RE_5_ _
Drop-off time V2 0.00...60.00 s 1.00 R/W Resetting time of the operate time
counter
Trip pulse V9 40...1000 ms 40 R/W Min pulse width of TRIP and CBFP
Event mask 1 V101 0...1023 - 63 R/W Event mask 1 for event transmission
(E0 ... E9)
Event mask 2 V103 0...1023 - 63 R/W Event mask 2 for event transmission
(E0 ... E9)
Event mask 3 V105 0...1023 - 63 R/W Event mask 3 for event transmission
(E0 ... E9)
Event mask 4 V107 0...1023 - 63 R/W Event mask 4 for event transmission
(E0 ... E9)
1)
Parameter # denotes the stage number of the function block (1, 2 or 3)
2)
Status 0 = Not in use; 1 = In use
3)
Measuring mode 0 = Not in use; 1 = U1,U2,U3 & I1,I2,I3; 2=U12,U23,U0 & I1,I2,I3
3 = U23,U31,U0 & I1,I2,I3; 4 = U12,U31,U0 & I1,I2,I3; 5 = U12,U23 & I1,I2,I3;
6 = U23,U31 & I1,I2,I3; 7 = U12,U31 & I1,I2,I3; 8 = U1 & I1; 9 = U2 & I2;
10 = U3 & I3; 11 = U12 & I3; 12 = U23 & I1; 13 = U31 & I2
4)
Power direction 0 = Forward; 1 = Reverse
5)
Group selection 0 = Group 1; 1 = Group 2; 2 = GROUP input
6)
Active group 0 = Group 1; 1 = Group 2
7)
Trip signal 0 = Non-latching; 1 = Latching
8)
Test 0 = Do not activate; 1 = Activate
11
RE_5_ _ OPOW6St1OPOW6St3 ABB Automation
3.3.3.1 General
The information required for later fault analysis is recorded when the function block
starts or trips.
The data of three last operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
The time stamp indicates the rising edge of the START or TRIP signal.
12
ABB Automation OPOW6St1OPOW6St3 RE_5_ _
3.3.3.3 Duration
The duration of the start situation is recorded as a percentage of the set operate time.
If the function block trips, the power values are updated at the moment of tripping i.e.
on the rising edge of the TRIP signal. If the function block starts but does not trip, the
power values captured one fundamental cycle (20 ms at rated frequency 50 Hz) after
the beginning of the start situation are recorded. Consequently, the active and reactive
power values P and Q always originate from the same moment and are recorded as
multiples of the rated power Sn.
The status data of the input signal BLOCK (Active or Not active) and the Active
group parameter are recorded at the moment of triggering. The Active group
parameter indicates the setting group valid for the recorded data.
3.3.3.6 Priority
1 Tripping
2 Starting
13
RE_5_ _ OPOW6St1OPOW6St3 ABB Automation
14
ABB Automation OPOW6St1OPOW6St3 RE_5_ _
3.3.4 Events
15
RE_5_ _ OPOW6St1OPOW6St3 ABB Automation
Reset time 70...1030 ms (depends on the minimum pulse width set for the TRIP
output)
Retardation time Total retardation time when the measured power drops
below the value set for the Power setting parameter 2) < 45 ms
Operate time accuracy Depends on the frequency of the current and voltage measured:
16
1MRS752321-MUM OPOW6St _
Issued: 10/1998
Version: D/24.1.2002
Three-Phase Directional
Overpower Protection
Stage 1 (OPOW6St1)
Stage 2 (OPOW6St2)
Data subject to change without notice Stage 3 (OPOW6St3)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 3
2. Description of Operation.......................................................................... 4
2.1 Configuration....................................................................................... 4
2.1.1 Analogue input selection for configuration.................................. 4
2.2 Measuring mode ................................................................................. 5
2.3 Operation criteria................................................................................. 5
2.4 Delayed reset facility and drop-off time in DT Mode ............................ 6
2.5 Setting groups ..................................................................................... 7
2.6 Test mode ........................................................................................... 7
2.7 START, TRIP and CBFP outputs ........................................................ 7
2.8 Resetting............................................................................................. 8
3. Parameters and Events ............................................................................ 9
3.1 General ............................................................................................... 9
3.2 Setting values.................................................................................... 10
3.2.1 Actual settings.......................................................................... 10
3.2.2 Setting group 1......................................................................... 10
3.2.3 Setting group 2......................................................................... 10
3.2.4 Control settings ........................................................................ 11
3.3 Measurement values ......................................................................... 12
3.3.1 Input data ................................................................................. 12
3.3.2 Output data .............................................................................. 12
3.3.3 Recorded data.......................................................................... 12
3.3.4 Events ...................................................................................... 15
1. Introduction
1.1 Features
1.2 Application
This document specifies the functions of the directional overpower function blocks
OPOW6St1, OPOW6St2 and OPOW6St3 used in products based on the RED 500
Platform. The three stages are identical in operation.
S>
)LJXUH 3URWHFWLRQGLDJUDPV\PERORI232:6WB)RU,(&V\PEROVXVHGLQ
VLQJOHOLQHGLDJUDPVUHIHUWRWKHPDQXDO7HFKQLFDO'HVFULSWLRQVRI
)XQFWLRQV,QWURGXFWLRQ056080
)LJXUH )XQFWLRQEORFNV\PEROVRI232:6W232:6WDQG232:6W
2
Substation Automation OPOW6St _
3
OPOW6St _ Substation Automation
2.1 Configuration
The analogue input combinations listed below are available in the dialogue box of the
configuration tool. When all the phase currents and phase voltages are known, P and
Q are calculated from positive-sequence components. The correct input combination
is selected via the configuration tool.
4
Substation Automation OPOW6St _
With the rated frequency of 50 Hz, the active and reactive power values are updated
twice each fundamental frequency cycle, i.e. every 10 ms.
Power direction can be changed via the control parameter Power direction.
The directional overpower function block OPOW6St_ starts if the power reaches the
operating area. The direction is set with the parameter Angle. The setting parameter
Power Setting is the shortest distance between the origo and the operating line.
Hysteresis
Operates
3R ZH U
6H WW LQ J
P
.
)LJXUH 2SHUDWLQJFKDUDVWHULVWLFRI232:6WBZKHQWKHSDUDPHWHU$QJOHLV
DQGWKHSDUDPHWHU3RZHUGLUHFWLRQLV)RUZDUG
Hysteresis
Operates
3 RZ HU
6 H W WL QJ
$QJOH
P
)LJXUH 2SHUDWLQJFKDUDVWHULVWLFRI232:6WBZKHQWKHSDUDPHWHU$QJOHLV
DQGWKHSDUDPHWHU3RZHUGLUHFWLRQLV)RUZDUG
5
OPOW6St _ Substation Automation
At reciprocating load conditions the power measuring element may pick up briefly
and periodically. The purpose of the delayed reset function is to ensure that the
function block operates within its predetermined operating time even in such power
swing conditions. Without the delayed reset function the DT timer would reset as
soon as the measuring element drops off.
When the DT timer has started, it goes on running normally even if the measuring
element drops off, provided the drop-off period is shorter than the set drop-off time. If
the drop-off period is longer than the set drop-off time, the DT timer will reset when
the drop-off time elapses (Figure 5).
In Figures 5 and 6 the input signal IN of the DT timer is TRUE when the measured
power is above the set start value and FALSE when the measured power is below the
set start value.
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff1.fh7
Operate time
Operate
timer
)LJXUH 7KHGURSRIISHULRGLVORQJHUWKDQWKHVHWGURSRIIWLPH
If the drop-off period is shorter than the set drop-off time and the DT timer has
elapsed during the drop-off period, the function block will trip once the measured
power exceeds the set start value again (Figure 6).
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff2.fh7
Operate time
Operate
timer
)LJXUH 7KHGURSRIISHULRGLVVKRUWHUWKDQWKHVHWGURSRIIWLPH
6
Substation Automation OPOW6St _
Two different groups of setting values, group 1 and group 2, are available for
OPOW6St_. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The output signal START is always pulse-shaped. The minimum pulse width of the
corresponding output signal is set with a separate parameter on the MMI or on serial
communication. If the start situation is longer than the set pulse width, the START
signal remains active until the start situation is over. The output signal TRIP may
have a non-latching or latching feature. When the latching mode has been selected,
the TRIP signal remains active until the output is reset even if the operation criteria
have reset.
The function block provides a delayed trip signal CBFP after the TRIP signal unless
the fault has disappeared during the set CBFP time delay. In circuit-breaker failure
protection, the CBFP output can be used to operate a circuit breaker in front of the
circuit breaker of the machine. The control parameter Trip pulse also sets the width
of the CBFP output signal.
7
OPOW6St _ Substation Automation
2.8 Resetting
The TRIP output signal and the registers can be reset via the RESET input, or over the
serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
8
Substation Automation OPOW6St _
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for OPOW6St1 is 92, that for OPOW6St2 93
and that for OPOW6St3 94.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
9
OPOW6St _ Substation Automation
10
Substation Automation OPOW6St _
Drop-off time V2 0.00...60.00 s 1.00 R/W Resetting time of the operate time
counter
Trip pulse V9 40...1000 ms 40 R/W Min pulse width of TRIP and CBFP
Event mask 1 V101 0...1023 - 63 R/W Event mask 1 for event transmission
(E0 ... E9)
Event mask 2 V103 0...1023 - 63 R/W Event mask 2 for event transmission
(E0 ... E9)
Event mask 3 V105 0...1023 - 63 R/W Event mask 3 for event transmission
(E0 ... E9)
Event mask 4 V107 0...1023 - 63 R/W Event mask 4 for event transmission
(E0 ... E9)
1)
Parameter # denotes the stage number of the function block (1, 2 or 3)
2)
Status 0 = Not in use; 1 = In use
3)
Measuring mode 0 = Not in use; 1 = U1,U2,U3 & I1,I2,I3; 2=U12,U23,U0 & I1,I2,I3
3 = U23,U31,U0 & I1,I2,I3; 4 = U12,U31,U0 & I1,I2,I3; 5 = U12,U23 & I1,I2,I3;
6 = U23,U31 & I1,I2,I3; 7 = U12,U31 & I1,I2,I3; 8 = U1 & I1; 9 = U2 & I2;
10 = U3 & I3; 11 = U12 & I3; 12 = U23 & I1; 13 = U31 & I2
4)
Power direction 0 = Forward; 1 = Reverse
5)
Group selection 0 = Group 1; 1 = Group 2; 2 = GROUP input
6)
Active group 0 = Group 1; 1 = Group 2
7)
Trip signal 0 = Non-latching; 1 = Latching
8)
Test 0 = Do not activate; 1 = Activate
11
OPOW6St _ Substation Automation
3.3.3.1 General
The information required for later fault analysis is recorded when the function block
starts or trips.
The data of three last operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
12
Substation Automation OPOW6St _
The time stamp indicates the rising edge of the START or TRIP signal.
3.3.3.3 Duration
The duration of the start situation is recorded as a percentage of the set operate time.
If the function block trips, the power values are updated at the moment of tripping i.e.
on the rising edge of the TRIP signal. If the function block starts but does not trip, the
power values captured one fundamental cycle (20 ms at rated frequency 50 Hz) after
the beginning of the start situation are recorded. Consequently, the active and reactive
power values P and Q always originate from the same moment and are recorded as
multiples of the rated power Sn.
The status data of the input signal BLOCK (Active or Not active) and the Active
group parameter are recorded at the moment of triggering. The Active group
parameter indicates the setting group valid for the recorded data.
3.3.3.6 Priority
1 Tripping
2 Starting
13
OPOW6St _ Substation Automation
14
Substation Automation OPOW6St _
3.3.4 Events
15
OPOW6St _ Substation Automation
Reset time 70...1030 ms (depends on the minimum pulse width set for the TRIP
output)
Retardation time Total retardation time when the measured power drops
below the value set for the Power setting parameter 2) < 45 ms
Operate time accuracy Depends on the frequency of the current and voltage measured:
D -
16
1MRS100062 (OV3Low) RE_5_ _
1MRS100063 (OV3High) Three-Phase
Issued: 10/1997
Version: E Overvoltage Protection
Data subject to change without notice Low-Set Stage (OV3Low)
High-Set Stage (OV3High)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 4
1.4 Output description ............................................................................... 4
2. Description of Operation.......................................................................... 5
2.1 Configuration....................................................................................... 5
2.2 Measuring mode ................................................................................. 6
2.3 Operation criteria................................................................................. 6
2.3.1 Operation hysteresis and reset ratio........................................... 7
2.4 IDMT type operation of OV3Low ......................................................... 8
2.5 Setting groups ..................................................................................... 9
2.6 Test mode ........................................................................................... 9
2.7 START and TRIP outputs.................................................................... 9
2.8 Resetting........................................................................................... 10
3. Parameters and Events .......................................................................... 11
3.1 General ............................................................................................. 11
3.2 Setting values.................................................................................... 12
3.2.1 Actual settings.......................................................................... 12
3.2.2 Setting group 1......................................................................... 13
3.2.3 Setting group 2......................................................................... 13
3.2.4 Control settings ........................................................................ 14
3.3 Measurement values ......................................................................... 15
3.3.1 Input data ................................................................................. 15
3.3.2 Output data .............................................................................. 15
3.3.3 Recorded data.......................................................................... 15
3.3.4 Events ...................................................................................... 18
1. Introduction
1.1 Features
1.2 Application
This document specifies the functions of the three-phase overvoltage function blocks
OV3Low and OV3High used in products based on the RED 500 Platform. The
inverse-time operation is only included in the OV3Low function block.
3U> 3U>>
2
ABB Automation OV3Low RE_5_ _
OV3High
)LJXUH )XQFWLRQEORFNV\PEROVRI29/RZDQG29+LJK
3
RE_5_ _ OV3Low ABB Automation
OV3High
4
ABB Automation OV3Low RE_5_ _
OV3High
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The phase-to-phase voltages U12, U23 and
U31 are connected to the corresponding UL1_U12, UL2_U23 and UL3_U31 inputs of
the function block. Digital inputs are connected to the boolean inputs of the function
block and in the same way, the outputs of the function block are connected to the
output signals.
1RWHIf phase voltages are measured, the phase voltage UL1 is connected to the
input U12, the phase voltage UL2 to the input U23 and the phase voltage UL3 to the
input U31. The control parameter Measuring mode has to be in position Mode 3.
Phase-to-phase voltages are derived from phase voltages within the function block as
follows:
1RWHWhen phase-to-phase voltages are derived numerically in the relay, only the
fundamental frequency measurement can be used: peak-to-peak measurement is not
available (see section Measuring mode).
5
RE_5_ _ OV3Low ABB Automation
OV3High
When phase-to-phase voltages are measured, the function block operates on two
alternative measuring principles: the average value of consecutive instantaneous peak-
to-peak values of voltages or the numerically calculated fundamental frequency
voltage. The measuring mode is selected with either an MMI parameter or a serial
communication parameter as follows:
With both the measuring principles, the operation is insensitive to the DC component
and the operation accuracy is defined in the frequency range f/fn=0.95...1.05. In peak-
to-peak measurement, the harmonics of the voltages are not suppressed, whereas in
fundamental frequency measurement the harmonics suppression is about
-50 dB at f = n x fn, where n = 2, 3, 4, 5,...
If at least one phase-to-phase voltage measured by the function block exceeds the set
start voltage, the module delivers the START signal. When the function block starts,
the START signal and the STATUS_ output signal of the specific phase-to-earth or
phase-to-phase voltage are set to TRUE. Should the overvoltage situation exceed the
preset definite operate time or, at the inverse-time operation of OV3Low, the time
determined by the level of the measured voltage, the function block operates. At the
inverse-time operation, two different sets of voltage/time curves, A and B, are
available. The delay of the heavy-duty output relay is included in the total operate
time. In operation, the TRIP signal is set to TRUE.
The DT or IDMT timer is allowed to run only if the blocking signal BS1 is inactive,
i.e. its value is FALSE. When the signal becomes active, i.e. its value turns to TRUE,
the timer will be stopped (frozen).
When the blocking signal BS2 is active, the TRIP signal cannot be activated. The
TRIP signal can be blocked by activating the BS2 signal until the function block
drops off.
6
ABB Automation OV3Low RE_5_ _
OV3High
The Oper. hysteresis control parameter can be set to adjust the level of a
comparator. The operation hysteresis affects the reset ratio. If the hysteresis is set to
3%, for example, the reset ratio of an overvoltage function block (OV3_) will be 0.97.
On the other hand, the same setting for an undervoltage function block (UV3_) will
lead to the reset ratio of 1.03. Furthermore, an absolute operation hysteresis of 0.005
per unit is included. The absolute hysteresis affects the reset ratio when a low start
voltage setting is used. For example, if the start voltage setting is 0.2 x Un and the
operation hysteresis is set to 2%, the reset ratio would normally be 0.996 (OV_) or
1.004 (UV_). Due to the absolute hysteresis, however, the reset ratio will be 0.995
(OV_) or 1.005 (UV_).
Figure 3 below clarifies the effect of the Oper. hysteresis parameter. The start
voltage of overvoltage protection is set to 1.1 x Un and that of undervoltage
protection to 0.9 x Un. Both protection functions have the same setting of 4% for the
Oper. hysteresis parameter.
U/Un
hysteresis zones
1
1.1
4%
2
4
0.9 4%
3
7
RE_5_ _ OV3Low ABB Automation
OV3High
At the inverse-time characteristic, the operate time will the shorter, the more the
voltage deviates from the set start voltage. The relationship between time and voltage
can be expressed as follows:
ka
t= +c
U-U > p
(b U > -0.5)
,where
t operate time in seconds
k adjustable time multiplier
U measured voltage
U> set start voltage
a constant 480
b constant 32
c constant 0.035
p constant (see the table below)
At the IDMT mode of operation, the integration of the operate time of the overvoltage
function block does not start until the voltage exceeds the set start value by 6%. The
operate time accuracy stated in the technical data applies when the voltage exceeds
the set value by 10%.
Characteristic p (constant)
A 2
B 3
The parameter Operation mode is used for selecting the desired operate time
characteristic.
8
ABB Automation OV3Low RE_5_ _
OV3High
Two different groups of setting values, group 1 and group 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The output signal START is always pulse-shaped. The minimum pulse width of the
corresponding output signal is set via a separate parameter on the MMI or on serial
communication. If the start situation is longer than the set pulse width, the START
signal remains active until the start situation is over. The output signal TRIP may be
non-latching or latching. When the latching mode has been selected, the TRIP signal
remains active until the output is reset even if the operation criteria have reset.
9
RE_5_ _ OV3Low ABB Automation
OV3High
2.8 Resetting
The TRIP output signal and the registers can be reset either with the RESET input or
over the serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
10
ABB Automation OV3Low RE_5_ _
OV3High
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for OV3Low is 62 and that for OV3High 63.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
11
RE_5_ _ OV3Low ABB Automation
OV3High
OV3Low
OV3High
12
ABB Automation OV3Low RE_5_ _
OV3High
OV3Low
Time multiplier S44 0.05...1.00 - 0.05 R/W Time multiplier at IDMT mode
1)
Operation mode 0 = Not in use; 1 = Definite time; 2 = A curve; 3 = B curve
OV3High
OV3Low
Time multiplier S74 0.05...1.00 - 0.05 R/W Time multiplier at IDMT mode
1)
Operation mode 0 = Not in use; 1 = Definite time; 2 = A curve; 3 = B curve
OV3High
13
RE_5_ _ OV3Low ABB Automation
OV3High
14
ABB Automation OV3Low RE_5_ _
OV3High
3.3.3.1 General
The information required for later fault analysis is recorded when the function block
starts or trips, or when the recording function is triggered via the external TRIGG
input.
The data of three last operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
15
RE_5_ _ OV3Low ABB Automation
OV3High
The time stamp indicates the rising edge of the START, TRIP or TRIGG signal.
3.3.3.3 Duration
3.3.3.4 Voltages
If the function block trips, the voltage values are updated at the moment of tripping,
i.e. on the rising edge of the TRIP signal. At external triggering, the voltage values are
updated at the moment of triggering i.e. on the rising edge of the input signal TRIGG.
If the function block starts but does not trip, the voltage values captured one
fundamental cycle (20 ms at rated frequency 50 Hz) after the beginning of the start
situation will be recorded. So, the values of the phase-to-phase voltages U12, U23 and
U31 are always recorded at the same moment, as multiples of the rated voltage Un.
The status data of the input signals BS1 and BS2 as well as the Active group
parameter are recorded at the moment of triggering. The Active group parameter
indicates the setting group valid for the recorded data.
3.3.3.6 Priority
1 Tripping
2 Starting
3 External triggering,
which means that if the function block has started, it will neglect an external
triggering request.
16
ABB Automation OV3Low RE_5_ _
OV3High
Voltage UL1_U12 V204 0.00...2.00 x Un 0.00 R/M Filtered value of U12 or UL1
Voltage UL2_U23 V205 0.00...2.00 x Un 0.00 R/M Filtered value of U23 or UL2
Voltage UL3_U31 V206 0.00...2.00 x Un 0.00 R/M Filtered value of U31 or UL3
1)
BS1 V207 0 or 1 - 0 R/M Status of BS1 input
Voltage UL1_U12 V304 0.00...2.00 x Un 0.00 R/M Filtered value of U12 or UL1
Voltage UL2_U23 V305 0.00...2.00 x Un 0.00 R/M Filtered value of U23 or UL2
Voltage UL3_U31 V306 0.00...2.00 x Un 0.00 R/M Filtered value of U31 or UL3
1)
BS1 V307 0 or 1 - 0 R/M Status of BS1 input
17
RE_5_ _ OV3Low ABB Automation
OV3High
Voltage UL1_U12 V404 0.00...2.00 x Un 0.00 R/M Filtered value of U12 or UL1
Voltage UL2_U23 V405 0.00...2.00 x Un 0.00 R/M Filtered value of U23 or UL2
Voltage UL3_U31 V406 0.00...2.00 x Un 0.00 R/M Filtered value of U31 or UL3
1)
BS1 V407 0 or 1 - 0 R/M Status of BS1 input
3.3.4 Events
18
ABB Automation OV3Low RE_5_ _
OV3High
Reset time 40...1000 ms (depends on the minimum pulse width set for the TRIP
output)
19
RE_5_ _ OV3Low ABB Automation
OV3High
OV3High B -
20
1MRS752322-MUM OV3_
Issued: 10/1997
Version: F/25.1.2002
Three-Phase
Overvoltage Protection
Low-Set Stage (OV3Low)
Data subject to change without notice High-Set Stage (OV3High)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 4
1.4 Output description ............................................................................... 4
2. Description of Operation.......................................................................... 5
2.1 Configuration....................................................................................... 5
2.2 Measuring mode ................................................................................. 6
2.3 Operation criteria................................................................................. 6
2.3.1 Operation hysteresis and reset ratio........................................... 7
2.4 IDMT type operation of OV3Low ......................................................... 8
2.5 Setting groups ..................................................................................... 9
2.6 Test mode ........................................................................................... 9
2.7 START and TRIP outputs.................................................................... 9
2.8 Resetting........................................................................................... 10
3. Parameters and Events .......................................................................... 11
3.1 General ............................................................................................. 11
3.2 Setting values.................................................................................... 12
3.2.1 Actual settings.......................................................................... 12
3.2.2 Setting group 1......................................................................... 13
3.2.3 Setting group 2......................................................................... 13
3.2.4 Control settings ........................................................................ 14
3.3 Measurement values ......................................................................... 15
3.3.1 Input data ................................................................................. 15
3.3.2 Output data .............................................................................. 15
3.3.3 Recorded data.......................................................................... 15
3.3.4 Events ...................................................................................... 18
1. Introduction
1.1 Features
1.2 Application
This document specifies the functions of the three-phase overvoltage function blocks
OV3Low and OV3High used in products based on the RED 500 Platform. The
inverse-time operation is only included in the OV3Low function block.
3U> 3U>>
2
Substation Automation OV3 _
)LJXUH )XQFWLRQEORFNV\PEROVRI29/RZDQG29+LJK
3
OV3_ Substation Automation
4
Substation Automation OV3 _
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The phase-to-phase voltages U12, U23 and
U31 are connected to the corresponding UL1_U12, UL2_U23 and UL3_U31 inputs of
the function block. Digital inputs are connected to the boolean inputs of the function
block and in the same way, the outputs of the function block are connected to the
output signals.
1RWHIf phase voltages are measured, the phase voltage UL1 is connected to the
input U12, the phase voltage UL2 to the input U23 and the phase voltage UL3 to the
input U31. The control parameter Measuring mode has to be in position Mode 3.
Phase-to-phase voltages are derived from phase voltages within the function block as
follows:
1RWHWhen phase-to-phase voltages are derived numerically in the relay, only the
fundamental frequency measurement can be used: peak-to-peak measurement is not
available (see section Measuring mode).
5
OV3_ Substation Automation
When phase-to-phase voltages are measured, the function block operates on two
alternative measuring principles: the average value of consecutive instantaneous peak-
to-peak values of voltages or the numerically calculated fundamental frequency
voltage. The measuring mode is selected with either an MMI parameter or a serial
communication parameter as follows:
With both the measuring principles, the operation is insensitive to the DC component
and the operation accuracy is defined in the frequency range f/fn=0.95...1.05. In peak-
to-peak measurement, the harmonics of the voltages are not suppressed, whereas in
fundamental frequency measurement the harmonics suppression is about
-50 dB at f = n x fn, where n = 2, 3, 4, 5,...
If at least one phase-to-phase voltage measured by the function block exceeds the set
start voltage, the module delivers the START signal. When the function block starts,
the START signal and the STATUS_ output signal of the specific phase-to-earth or
phase-to-phase voltage are set to TRUE. Should the overvoltage situation exceed the
preset definite operate time or, at the inverse-time operation of OV3Low, the time
determined by the level of the measured voltage, the function block operates. At the
inverse-time operation, two different sets of voltage/time curves, A and B, are
available. The delay of the heavy-duty output relay is included in the total operate
time. In operation, the TRIP signal is set to TRUE.
The DT or IDMT timer is allowed to run only if the blocking signal BS1 is inactive,
i.e. its value is FALSE. When the signal becomes active, i.e. its value turns to TRUE,
the timer will be stopped (frozen).
When the blocking signal BS2 is active, the TRIP signal cannot be activated. The
TRIP signal can be blocked by activating the BS2 signal until the function block
drops off.
6
Substation Automation OV3 _
The Oper. hysteresis control parameter can be set to adjust the level of a
comparator. The operation hysteresis affects the reset ratio. If the hysteresis is set to
3%, for example, the reset ratio of an overvoltage function block (OV3_) will be 0.97.
On the other hand, the same setting for an undervoltage function block (UV3_) will
lead to the reset ratio of 1.03. Furthermore, an absolute operation hysteresis of 0.005
per unit is included. The absolute hysteresis affects the reset ratio when a low start
voltage setting is used. For example, if the start voltage setting is 0.2 x Un and the
operation hysteresis is set to 2%, the reset ratio would normally be 0.996 (OV_) or
1.004 (UV_). Due to the absolute hysteresis, however, the reset ratio will be 0.995
(OV_) or 1.005 (UV_).
Figure 3 below clarifies the effect of the Oper. hysteresis parameter. The start
voltage of overvoltage protection is set to 1.1 x Un and that of undervoltage
protection to 0.9 x Un. Both protection functions have the same setting of 4% for the
Oper. hysteresis parameter.
U/Un
hysteresis zones
1
1.1
4%
2
4
0.9 4%
3
7
OV3_ Substation Automation
At the inverse-time characteristic, the operate time will the shorter, the more the
voltage deviates from the set start voltage. The relationship between time and voltage
can be expressed as follows:
ka
t= +c
U-U > p
(b U > -0.5)
,where
t operate time in seconds
k adjustable time multiplier
U measured voltage
U> set start voltage
a constant 480
b constant 32
c constant 0.035
p constant (see the table below)
In the IDMT mode of operation, the integration of the operate time of the overvoltage
function block does not start until the voltage exceeds the set start value by 6%. The
operate time accuracy stated in the technical data applies when the voltage exceeds
the set value by 10%.
Characteristic p (constant)
A 2
B 3
The parameter Operation mode is used for selecting the desired operate time
characteristic.
8
Substation Automation OV3 _
Two different groups of setting values, group 1 and group 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The output signal START is always pulse-shaped. The minimum pulse width of the
corresponding output signal is set via a separate parameter on the MMI or on serial
communication. If the start situation is longer than the set pulse width, the START
signal remains active until the start situation is over. The output signal TRIP may be
non-latching or latching. When the latching mode has been selected, the TRIP signal
remains active until the output is reset even if the operation criteria have reset.
9
OV3_ Substation Automation
2.8 Resetting
The TRIP output signal and the registers can be reset either with the RESET input or
over the serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
10
Substation Automation OV3 _
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for OV3Low is 62 and that for OV3High 63.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
11
OV3_ Substation Automation
OV3Low
OV3High
12
Substation Automation OV3 _
OV3Low
Time multiplier S44 0.05...1.00 - 0.05 R/W Time multiplier in IDMT mode
1)
Operation mode 0 = Not in use; 1 = Definite time; 2 = A curve; 3 = B curve
OV3High
OV3Low
Time multiplier S74 0.05...1.00 - 0.05 R/W Time multiplier in IDMT mode
1)
Operation mode 0 = Not in use; 1 = Definite time; 2 = A curve; 3 = B curve
OV3High
13
OV3_ Substation Automation
14
Substation Automation OV3 _
3.3.3.1 General
The information required for later fault analysis is recorded when the function block
starts or trips, or when the recording function is triggered via the external TRIGG
input.
The data of three last operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
15
OV3_ Substation Automation
The time stamp indicates the rising edge of the START, TRIP or TRIGG signal.
3.3.3.3 Duration
3.3.3.4 Voltages
If the function block trips, the voltage values are updated at the moment of tripping,
i.e. on the rising edge of the TRIP signal. At external triggering, the voltage values are
updated at the moment of triggering i.e. on the rising edge of the input signal TRIGG.
If the function block starts but does not trip, the voltage values captured one
fundamental cycle (20 ms at rated frequency 50 Hz) after the beginning of the start
situation will be recorded. So, the values of the phase-to-phase voltages U12, U23 and
U31 are always recorded at the same moment, as multiples of the rated voltage Un.
The status data of the input signals BS1 and BS2 as well as the Active group
parameter are recorded at the moment of triggering. The Active group parameter
indicates the setting group valid for the recorded data.
3.3.3.6 Priority
1 Tripping
2 Starting
3 External triggering,
which means that if the function block has started, it will neglect an external
triggering request.
16
Substation Automation OV3 _
Voltage UL1_U12 V204 0.00...2.00 x Un 0.00 R/M Filtered value of U12 or UL1
Voltage UL2_U23 V205 0.00...2.00 x Un 0.00 R/M Filtered value of U23 or UL2
Voltage UL3_U31 V206 0.00...2.00 x Un 0.00 R/M Filtered value of U31 or UL3
1)
BS1 V207 0 or 1 - 0 R/M Status of BS1 input
Voltage UL1_U12 V304 0.00...2.00 x Un 0.00 R/M Filtered value of U12 or UL1
Voltage UL2_U23 V305 0.00...2.00 x Un 0.00 R/M Filtered value of U23 or UL2
Voltage UL3_U31 V306 0.00...2.00 x Un 0.00 R/M Filtered value of U31 or UL3
1)
BS1 V307 0 or 1 - 0 R/M Status of BS1 input
17
OV3_ Substation Automation
Voltage UL1_U12 V404 0.00...2.00 x Un 0.00 R/M Filtered value of U12 or UL1
Voltage UL2_U23 V405 0.00...2.00 x Un 0.00 R/M Filtered value of U23 or UL2
Voltage UL3_U31 V406 0.00...2.00 x Un 0.00 R/M Filtered value of U31 or UL3
1)
BS1 V407 0 or 1 - 0 R/M Status of BS1 input
3.3.4 Events
18
Substation Automation OV3 _
Reset time 40...1000 ms (depends on the minimum pulse width set for the TRIP
output)
19
OV3_ Substation Automation
OV3High B -
20
1MRS752335-MUM PQCU3H
Issued: 3/2000
Version: A/30.1.2002
Current Waveform Distortion
Data subject to change without notice
Measurement
Contents
1 Introduction .............................................................................................. 3
1.1 Features.............................................................................................. 3
1.2 Harmonic distortion ............................................................................. 3
1.3 Application........................................................................................... 4
1.4 Input description.................................................................................. 5
1.5 Output description ............................................................................... 5
2 Description of Operation.......................................................................... 6
2.1 Configuration....................................................................................... 6
2.1.1 Analogue channels..................................................................... 6
2.1.2 Digital inputs............................................................................... 6
2.1.3 Configuration error ..................................................................... 6
2.1.4 Configuration examples.............................................................. 7
2.2 Measuring mode ................................................................................. 8
2.3 Operation criteria................................................................................. 8
2.4 Observation times ............................................................................... 9
2.5 Real time monitoring ........................................................................... 9
2.6 Harmonic limit supervision................................................................. 11
2.7 Statistics............................................................................................ 11
2.7.1 Background.............................................................................. 11
2.7.2 Measurement settings.............................................................. 12
2.7.3 Input values.............................................................................. 13
2.7.4 Calculated results..................................................................... 14
2.7.4.1 Recording banks ........................................................... 14
2.7.4.2 Maximum values ........................................................... 14
2.7.4.3 Percentiles .................................................................... 15
2.7.4.4 Fixed percentiles for selected harmonic ........................ 17
2.7.5 Output CUM_HIGH .................................................................. 17
2.7.6 Indications and events.............................................................. 17
2.7.7 Exceptions ............................................................................... 17
2.8 Setting examples............................................................................... 18
2.9 Step-by-step guide for settings.......................................................... 20
2.10 Measurement accuracy ..................................................................... 23
PQCU3H Substation Automation
3.1 General..............................................................................................25
3.2 Control settings..................................................................................26
3.2.1 Statistic limits............................................................................26
3.2.2 Settings ....................................................................................26
3.3 Measurement values .........................................................................27
3.3.1 Inputs/ Outputs .........................................................................27
3.3.2 3 sec. values.............................................................................28
3.3.3 10 min. values ..........................................................................29
3.3.4 Recorded data ..........................................................................30
3.3.4.1 General..........................................................................30
3.3.4.2 A:Period info ..................................................................30
3.3.4.3 A:Maxim. values ............................................................31
3.3.4.4 A:Cumulat. prob.............................................................32
3.3.4.5 A:Selected harm. ...........................................................32
3.3.4.6 B:Period info ..................................................................33
3.3.4.7 B:Maxim. values ............................................................33
3.3.4.8 B:Cumulat. prob.............................................................34
3.3.4.9 B:Selected harm. ...........................................................34
3.3.4.10 Last exceeding...............................................................35
3.3.5 Events ......................................................................................35
4 Technical Data.........................................................................................36
2
Substation Automation PQCU3H
1 Introduction
1.1 Features
Harmonic distortion
Total Harmonic Distortion measurement (THD) or
Total Demand Distortion measurement (TDD)
Individual harmonics up to 13th:
short time average values for monitoring
statistics according to EN 50160 and IEC 61000-4-7 (standards for voltage
distortion measurements are applied to current distortion measurements)
Measurement activation via:
MMI
preset time
serial communication line or a parameter
Measurement frequency:
once (single measurement, e.g. one day)
continuously
periodically (e.g. every Tuesday)
Measurement with:
conventional current transformers
Rogowski coils
The harmonic voltage distortion in a power system depends on the current distortion
produced by nonlinear loads and on the impedance characteristics visible to each load.
The most sensitive equipment to voltage harmonics is usually data processing and
communication equipment; at the same time these devices are considerable current
harmonic sources. These devices are susceptible to misoperation caused by harmonic
distortion. For example, in computers and medical instruments considerably low
harmonic levels can result in malfunctions that can have serious consequences. In
3
PQCU3H Substation Automation
Power quality monitoring is an essential service utilities can provide for their
industrial and key customers. Not only can a monitoring system provide information
about system disturbances and their possible causes, it can also detect problem
conditions throughout the system before they cause customer complaints, equipment
malfunctions, and even equipment damage or failure. Power quality problems are not
limited to the utility side of the system. In fact, the majority of power quality
problems are localized within customer facilities. Thus, power quality monitoring is
not only an effective customer service strategy, but also a way to protect a utilitys
reputation for quality power and service.
At present, power utilities obtain power quality information via measurements done
with portable measuring devices. Enhanced energy meters can also produce some
power quality information. The function block PQCU3H provides a convenient
method for monitoring power quality by means of current waveform distortion:
monitoring can be done together with feeder protection and control using products
based on the RED 500 Platform. Function block PQCU3H produces statistical data
about harmonic distortion for long term evaluation. In addition, the function block
provides short time average and maximum values for THD and individual harmonics.
1.3 Application
This document specifies the functions of the function block PQCU3H for current
waveform distortion measurement used in products based on the RED 500 Platform.
The function block PQCU3H is used for measuring the harmonics and monitoring the
power quality in distribution networks. Although the European Standard EN 50160
concerns voltage distortion, the same standard is applied to current distortion
measurements in PQCU3H. Data collection and analysis is done according to EN
50160. Measuring principles for individual harmonics and THD are adapted from the
International standard IEC 61000-4-7. The American standard IEEE Std 1159 is also
partly supported.
)LJXUH )XQFWLRQEORFNV\PERORI34&8+
4
Substation Automation PQCU3H
5
PQCU3H Substation Automation
2 Description of Operation
2.1 Configuration
Note: It is necessary that currents are connected to the inputs of the function block in
the correct order, cf. Input description above and Configuration examples below.
At the rated frequency of 50 Hz, the function block can only be configured to the task
interval of 10 ms (at 60 Hz 8.33 ms). If any other task interval than that of 10 ms is
used, only the Not in use mode is available.
6
Substation Automation PQCU3H
Note: Check the detailed description of the measuring modes below in the
corresponding section.
Harmonics can be measured from phase currents IL1, IL2 and IL3. With the analogue
channel configuration given in Figure 2 all phase currents and the worst case can be
measured.
)LJXUH $OOSKDVHFXUUHQWVFRQQHFWHG
It is not necessary to connect all inputs to the corresponding analogue channels. For
example, only IL2 can be connected to the input IL2 as shown in Figure 3, but in this
case harmonics can be measured only from IL2.
)LJXUH 2QO\SKDVHFXUUHQW,/FRQQHFWHG
7
PQCU3H Substation Automation
When the measuring mode is set to Worst phase, a current with the highest THD (or
TDD) is measured. Because the worst case can vary during the observation time (first
IL1, then IL2 and then again IL1), the statistics can originate from different currents. The
monitored value Measured input indicates the actual phase all the time (phase
current with the highest THD).
1. Fundamental frequency:
I1 = 0.9 I 1 ...1.1 I 1
where I1 is the measured fundamental frequency and IN the network frequency.
2. Deviation of the fundamental frequency:
GI1 0.5 +] , GI1 = I1, max I1, min
where GI1 is the difference between the measured maximum and minimum values
of the fundamental frequency within one second.
3. Amplitude of the fundamental wave:
$1 1% , 1
Further, if the amplitude of the fundamental wave deviates rapidly, results will be
blocked out (possible transient).
If any of the criteria above is not fulfilled, PQCU3H will not show the values of the
harmonic amplitudes. In addition, these values are not included in statistics. These
operation criteria have been set in order to guarantee sufficient measurement
accuracy. Also the European Standard EN 50160 gives the maximum values for the
harmonic amplitudes in normal operation conditions.
8
Substation Automation PQCU3H
PQCU3H monitors sliding average values from the time intervals of TVs (= 3 s) and
TSh (= 10 min), see the next section Real time monitoring. Other intervals are used
as observation times in PQCU3H. In addition to the standards recommendation,
intervals of 12 h and 2-6 days are also provided. T Vs and TSh values used for
monitoring are used in statistical analysis according to the IEC standard (see section
Statistics). Observation time can be selected via the parameter Observation time.
Available observation times are: 1 hour, 12 hours, 1 day, 2 days, 3 days, 4 days, 5
days, 6 days and 1 week.
There are two sets of harmonic and THD values that can be monitored, namely T Vs
values (very short time, 3 s) and TSh values (short time, 10 min). Both TVs and TSh
values are sliding average values. The observation time corresponding to the time
interval TVs = 3 s consists of windows, within which the real time values are
calculated (effective measuring time), and gaps between those windows. Effective
measuring time windows are equally spaced within the observation time as the IEC
61000-4-7 standard recommends, see Figure 4.
TVs = 3 s M values
time
EffMeas
)LJXUH (IIHFWLYHPHDVXULQJWLPHZLQGRZVGXULQJWKHREVHUYDWLRQWLPH
FRUUHVSRQGLQJWR79V V0 QXPEHURIVDPSOHV
TVs value of an individual harmonic n is calculated in RMS sense using the real time
RMS values (Cn,k) of the nth harmonic:
9
PQCU3H Substation Automation
0
FQ N
2
,
& Q9V = N=1
In TVs sliding average calculation the length of the slide is the length of the effective
measuring time. That is, when a new set of real time values is ready, the oldest set is
rejected from the TVs window and the new set is included (Figure 5).
TVs = 3 s
time
SlidAver
Real time values
)LJXUH 9HU\VKRUWWLPHYDOXHVDUHFDOFXODWHGXVLQJVOLGLQJZLQGRZV
Short time values (TSh = 10 min) are calculated from very short time values in RMS
sense. The length of the slide for short time average values is equal to T Vs = 3s.
13
N
,N
=2
2
7+' =
,1
where I1 is the RMS value of the fundamental component and Ik is the RMS value of
the kth harmonic. If the Settings parameter Distort. factor is set to TDD, Total
Demand Distortion is used instead of THD:
13
N
,N
=2
2
7'' =
,1
The real time values can be read via the directories 3 sec. values and 10 min.
values.
10
Substation Automation PQCU3H
The limits for harmonics and THD (or TDD) set by the user (refer to sections Setting
examples and Last exceeding) are continuously compared to the TVs sliding
average values. If a TVs value for any harmonic should exceed the corresponding
limit, the HAR_HIGH output will be activated (TRUE). Furthermore, an event will be
sent and an MMI indication given. HAR_HIGH will remain active until every
harmonic has dropped under the set limit. An example is given in Figure 6.
TVs value for 3rd
Max THD
THD:
HAR_HIGH:
time:
LimitSuperv
Time stamp + harmonic set Actual recording
)LJXUH ([FHHGLQJRIDKDUPRQLFOLPLW2WKHUKDUPRQLFVDUHXQGHUWKHVHWOLPLWV
EXWWKHUGDQGWKKDUPRQLFVH[FHHGWKHLUOLPLWV7KH+$5B+,*+RXWSXW
UHPDLQVDFWLYHXQWLOERWKKDUPRQLFVKDYHGURSSHGXQGHUWKHLUOLPLWV
During every exceeding of a limit the THD will be observed and the whole harmonic
set (TVs values) will be stored (with a time stamp) at the instant the THD has its
highest value. The actual recording (i.e. the recorded data is readable) is done and a
reset event will be sent when HAR_HIGH is deactivated.
2.7 Statistics
2.7.1 Background
Because there is no standard concerning the harmonic measurement for currents at the
moment, the European Standard for voltages EN 50160 is applied here.
Statistical calculations carried out by PQCU3H fulfil the requirements for statistical
analysis of harmonics declared in EN 50160. The recommendations for harmonics
measurement over the time intervals TL (1 h), TD (1 d) and TWk (1 week) declared in
IEC 61000-4-7 are also fulfilled.
In the following text statistics recorder refers to the part of PQCU3H that carries out
the statistical calculations.
11
PQCU3H Substation Automation
The function block PQCU3H calculates the statistics only if it has been triggered. A
triggering signal always starts a new observation time.
There are several possible ways for triggering, i.e. activating, the statistics. The
statistics can be triggered via a local MMI by activating the Settings parameter
Remote trigger. The same parameter can be used for remote triggering, e.g. for
activating the statistics via MicroSCADA in Network Control Center. The function
block can also be activated by an external digital input connected to the function
block input TRIGG. Setting this digital input from FALSE to TRUE activates the
statistics. Statistics can also be activated at some preset time and date. The user can
set the time of the activation via the Settings parameters Trigger year, Trigger
month, Trigger day and Trigger hour. Refer to section Setting examples for
further information.
Statistics are calculated over the elapsing observation time. This time period is set via
the Settings parameter Observation time. There are several possibilities from one
hour to one week.
The user can also select a preferable way of continuous statistics recordings over a
longer period of time (months, years). With the Settings parameter Trigger mode
the user can select how the next observation time will be activated after the former
one has finished. There are three possibilities: Single, Continuous and Periodic.
Active state of statistics recorder, i.e. calculation and storage of data, in each mode is
shown in Figure 7. In the trigger mode Single, data for one observation time is
calculated and stored. If another observation time is wanted, the statistics recorder
must be triggered again. In the trigger mode Continuous, the next observation time
starts automatically right after the former observation time has finished. In the
Periodic mode, there is a fixed time gap of one week between the beginning of the
former observation time and the beginning of the next observation time.
12
Substation Automation PQCU3H
Start of Statistics
Trigger mode: Single
recordings,
Observation time: 1 week
Trigger: Activated
Time
1 week
Time
Time
ObsTimes
Time
)LJXUH 3HULRGVIRUVWDWLVWLFVUHFRUGHUZLWKGLIIHUHQWWULJJHUPRGHVDQG
REVHUYDWLRQWLPHV
The statistics recorder uses the TVs (3 s) and TSh (10 min) values in calculations
depending on the length of the observation time. If the observation time is shorter
than one day, statistics recorder uses the TVs values. If the observation time is one day
or longer, the TSh values are used.
13
PQCU3H Substation Automation
Calculated results are stored in two recording banks. One bank includes data from the
previous observation time. The other bank includes data from the elapsing observation
time. Data in the active bank is updated continuously as long as the active observation
time is elapsing. When the active observation time ends, data is moved from the
active bank to the other bank.
Calculated data are stored in different directories. The directory Period info
includes general information about the observation time (start and end times of the
period, measuring mode); Maxim. values includes measured maximum values for
THD and individual harmonics, Cumulat. prob. (Cumulative probability) includes
percentiles (can be selected by the user) for THD and individual harmonics, and
Selected harm. (Selected harmonic) includes five fixed percentiles for one
selectable harmonic (or THD). Data from the active observation time are in
directories:
A:Period info
A:Maxim. values
A:Cumulat. prob.
A:Selected harm.
and data from the previous observation time:
B:Period info
B:Maxim. values
B:Cumulat. prob.
B:Selected harm.
The Time to end parameter in the A: Period info directory informs how long it is
to the end of the observation time. This parameter is useful when checking that the
triggering has succeeded. If Time to end is 0 min, the statistics are not calculated. If
Time to end is other than 0 min, it indicates that statistics are calculated just then.
Maximum values for THD and individual harmonics are real maximum TVs (3 s) or
TSh (10 min) values during the observation time. These are picked from continuously
updated sliding average values. This enables recording of the true worst values. There
is no time dependency between recorded maximum values for THD and individual
harmonics. Hence, maximum values can be from several different time instants.
14
Substation Automation PQCU3H
2.7.4.3 Percentiles
Percentiles are values in a given set of observations that divide the data into 100 equal
parts. These values can be denoted by P1, P2,..., P99, where
1 % of the data falls below (is less than or equal to) P1; 2 % of the data falls
below P2; ... ; 99 % of the data falls below P99.
The purpose of percentiles is to find the harmonic amplitude so that, during the
observation time, 95 % of all the measured harmonic amplitudes are less than or equal
to the calculated percentile. As a default, 95th percentiles are calculated for each
harmonic, but also other percentiles can be calculated (parameter Cum. probability
in Statistic limits directory). The percentiles are found in the Selected harm.
directories.
Non-sliding and non-overlapping TVs (3 s) or TSh (10 min) average values are used in
percentile calculation depending on the length of the observation time. For example,
when the 10 min average values are used and the measurement is activated at
12:00:000, the first average used in the percentile calculation is measured during the
time interval 12:00:000 ... 12:10:000, the next one during the time interval 12:10:000
... 12:20:000 and so on.
All average values are divided into classifiers. The categorisation resolution, i.e. the
width of the classifiers, is dependent on the Limit p (set with Limit parameters in the
Statistic limits directory). Categorisation for each harmonic includes 16 classifiers
between values 0 and 2p. Hence, the classifier width a is
2 S
D=
1XP2I&ODVVLILHUV
For example, if the limit for the second harmonic is 10 %In, the classifier width a is
1.25 %In. If the average value I2,ave is
D < , 2,DYH 2D
the average value is put into classifier 2. Calculation of percentiles is shown in Figure
8.
15
PQCU3H Substation Automation
Classifier 2
Limit p
2*p
10 30 30 ... 25 4 ... 1 0 0 0
0 a 2*a 3*a p-a p+a 2*p-3a 2*p-2a 2*p-a
Over
category
PQCUPercentileCalc1
a = 2*p/NumOfCategories
Value/%In
)LJXUH &DWHJRULVDWLRQRIPHDVXUHGYDOXHVDQGFDOFXODWLRQRIDSHUFHQWLOH
Classifier 2
Limit p
2*p
10 30 30 ... 24 4 ... 2 0 0 0
0 a 2*a 3*a p-a p+a 2*p-3a 2*p-2a 2*p-a
Over cat-
egory
PQCUPercentileCalc2
a = 2*p/NumOfCategories
Value/%In
)LJXUH &DWHJRULVDWLRQRIPHDVXUHGYDOXHVDQGFDOFXODWLRQRIDSHUFHQWLOH
Figure 9 presentsa situation where 6 values are in classifiers above the limit p. Hence,
the 95th percentile is greater than the set limit p, which means that the
recommendation of the European Standard EN 50160 would not be met.
16
Substation Automation PQCU3H
With five percentiles more detailed information can be obtained from the cumulative
distribution of the selected harmonic, see Figure 10.
% In
14
12
10
8
6
4
PQCUFixed perc
2
Time
1% 5% 50 % 95 % 99 %
)LJXUH VWWKWKWKDQGWKSHUFHQWLOHVIRUVHOHFWHGKDUPRQLF
If the calculated percentile is greater than the preset limit (i.e. more than 5 % of all
harmonic values are smaller than the preset limit), an indication will be given: the
output CUM_HIGH will be activated, an event sent and an MMI indication given.
The indication declares which harmonic exceeded the limit.
During the elapsing observation time there will be indications about the ending of the
observation time. The first warning event will be given 5 minutes before the end of
the elapsing observation time; the second event at the end of the observation time.
2.7.7 Exceptions
Exceptional usage of the function block is taken into account. There are two major
exceptions: changing the settings during an elapsing observation time and changing
the system clock to a new time. The latter is valid e.g. with daylight saving time.
17
PQCU3H Substation Automation
Changes to the setting parameters during an elapsing observation time are taken into
account when the elapsing observation time has ended. If the new settings must be
activated at once, the function block has to be reset. This means that all data from the
elapsing observation time in the statistics recorder will be cleared and the statistics
recorder starts to wait for a new observation time (a new measurement activation).
Resetting can be done via the local MMI (parameter Reset registers) or by
activating the digital input RESET.
Changing the system clock back during an active observation time lengthens the
active observation time by the amount of the time change. On the contrary, changing
the system clock forward shortens the active observation time. With this functionality,
the end date and time of the active observation time remain as set.
There are several parameters that can be set by the user. Setting parameters are
explained in detail in the corresponding sections, for example the use of harmonic
limits (percentiles) is explained in the section Statistics. In the following, two
examples on the use of the setting parameters:
The recommendation gives values for each individual harmonic current in medium
voltage supply. THD shall be less than or equal to 14 %.
Let us say that phase current IL1 is under this survey and we want to verify its quality.
The survey should start at 8:00 am on Monday the 3rd of May, 1999 and last until
further notice. Let us also assume that we want to know the cumulative distribution of
the third harmonic values more precisely. The setting values would be:
Settings:
Measuring mode L1
Distort. factor THD
Observation time 1 week
Trigger mode Continuous
Trigger year 1999
Trigger month 5
Trigger day 3
Trigger hour 8
rd
Selected harm. 3 harmonic
18
Substation Automation PQCU3H
Statistic limits:
Cum. probability 95 %
Limit THD 14.0 %
Limit 2nd harm. 4.0 % In
Limit 3rd harm. 10.0 % In
Limit 4th harm. 2.0 % In
Limit 5th harm. 12.0 % In
Limit 6th harm. 1.0 % In
Limit 7th harm. 10.0 % In
Limit 8th harm. 1.0 % In
Limit 9th harm. 3.0 % In
Limit 10th harm. 1.0 % In
Limit 11th harm. 7.0 % In
Limit 12th harm. 0.4 % In
Limit 13th harm. 6.0 % In
Note: Check the sections Statistics and Real time monitoring for the effects of the
harmonic limits (% In).
The same recommended reference values are used as in example 1, but now we want
to survey the harmonics only on Mondays, starting at 0:00 am on Monday the 12th of
April, 1999.Let us also assume that we want to check the overall worst case of phase
currents (statistics are collected using the values from the phase current with the
highest THD at each moment). The third harmonic is once again observed more
closely than the others. Instead of THD, TDD is used, so the Distort. factor
parameter should be set to TDD.
Settings:
19
PQCU3H Substation Automation
Statistic limits:
Cum. probability 95 %
Limit THD 14.0 % (<-- TDD)
Limit 2nd harm. 4.0 % In
Limit 3rd harm. 10.0 % In
Limit 4th harm. 2.0 % In
Limit 5th harm. 12.0 % In
Limit 6th harm. 1.0 % In
Limit 7th harm. 10.0 % In
Limit 8th harm. 1.0 % In
Limit 9th harm. 3.0 % In
Limit 10th harm. 1.0 % In
Limit 11th harm. 7.0 % In
Limit 12th harm. 0.4 % In
Limit 13th harm. 6.0 % In
Harmonic limits shall be chosen carefully. The lower the limit, the higher resolution is
used in percentile calculation and vice versa: if the limit is high, the resolution
becomes lower. However, if too low a limit is chosen, harmonic values may exceed
the limit too easily.
The difference between real time monitoring and statistics should be noticed. Once
triggered, the 3 sec and 10 min values are monitored continuously even if the statistics
are not calculated (observation time has ended). The statistics, on the other hand, are
calculated over the selected observation time (from 1 hour to 1 week). The Time to
end parameter gives an indication of the elapsing observation time. If the Time to
end parameter has a value other than 0 min, the statistics are calculated just then.
5HVHWWLQJ
If the statistics calculation is on and new settings are going to be made, PQCU3H
must be reset (RESET input or Reset registers parameter). Resetting the registers
stops the statistics calculations. If the statistics calculation has ended, reset is not
necessary. Alternatively, in case of the continuous or the periodic triggering mode,
new settings can be made without resetting the registers. Yet, the new settings become
valid after the elapsing observation time has ended and a new one has begun.
7ULJJHULQJ
New settings are not valid until they have been activated by triggering. The triggering
signal can be given via the Remote trigger parameter, the TRIGG input or the
trigger date (Trigger year, Trigger month, Trigger day and Trigger hour). In the single
mode, the settings are activated immediately after triggering. In the continuous and
the period triggering mode, the settings are activated at the preset triggering date
(year, month, day and hour); thus triggering via the Remote trigger parameter or the
TRIGG input is not possible.
20
Substation Automation PQCU3H
Next, four setting examples are given for activation of PQCU3H. In addition to the
settings given here, statistical limits and a harmonic for closer percentile calculation
can be set before activating the settings
([DPSOH
([DPSOH
21
PQCU3H Substation Automation
([DPSOH
([DPSOH
Objective: Continue the statistic calculations with the current settings, but change the
monitored signal to IL3 for the next observation time.
Check: When the elapsing observation time Monitoring phase current IL3
ends (Time to end is 0 min), the active
measuring mode should change to L3
Right after reaching 0 min, the Time to Statistics calculation
end parameter should change to show
the selected observation time in
minutes
Data from the previous observation Previous data stored in bank B
time should be in the recording bank B
(using IL1)
22
Substation Automation PQCU3H
)XQGDPHQWDOIUHTXHQF\
I1 = I 1
+DUPRQLFDPSOLWXGHVLQWKHIUHTXHQF\UDQJHDERYH)V
30% $1
where AN is the highest harmonic amplitude within the frequency range from 0 Hz to
Fs/2, where Fs is the used sampling frequency (if fN = 50 Hz, Fs = 2000 Hz and if fN =
60 Hz, Fs = 2400 Hz).
$PSOLWXGHRIWKHIXQGDPHQWZDYH
0.01, 1 , 60 , 1
5% , P , if , P 10% , 1
10% , P , if , P 10% , 1 .
When Rogowski coils are used for current measurement, the measurement accuracy of
IEC 61000-4-7 is not guaranteed.
23
PQCU3H Substation Automation
2.11 Resetting
The registers can be reset either via the RESET input, or over the serial bus or the
local MMI.
24
Substation Automation PQCU3H
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for PQCU3H is 512.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the relay
terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask 1
parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
25
PQCU3H Substation Automation
3.2.2 Settings
Parameter Code Values Unit Default Data Explanation
direction
Measuring mode V15 0...4 1) - 0 R/W Measuring mode
2)
Distort. factor V16 0 or 1 - 1 R/W Selection of distortion
factor (THD or TDD)
Observation time V17 0...9 3) - 9 R/W Selection of
observation time
Trigger mode V18 0...2 4) - 0 R/W Selection of trigger
mode
Trigger year V19 1980...2400 y 1980 R/W Triggering year
Trigger month V20 1...12 m 1 R/W Triggering month
Trigger day V21 1...31 d 1 R/W Triggering day
Trigger hour V22 0...23 h 1 R/W Triggering hour
Remote trigger V23 1=Trigger - 0 W Remote or local
triggering
Selected harm. V24 0...13 5) - 3 R/W Selected harmonic for
recordings
Act. meas.mode V26 0...4 1) - 0 R Active measuring
mode
Event mask 1 V101 0...31 - 31 R/W Event mask 1 for
event transmission
Event mask 2 V103 0...31 - 31 R/W Event mask 2 for
event transmission
Event mask 3 V105 0...31 - 31 R/W Event mask 3 for
event transmission
Event mask 4 V107 0...31 - 31 R/W Event mask 4 for
event transmission
26
Substation Automation PQCU3H
1)
Measuring mode 0=Not in use; 1=L1; 2=L2; 3=L3; 4=Worst phase
2)
Distortion factor 0=THD, 1=TDD
3)
Observation time 0=1 hour; 1=12 hours; 2=1 day; 3=2 days; 4=3 days; 5=4 days;
6=5 days; 7=6 days; 8=1 week
4)
Triggering mode 0=Single; 1=Continuous; 2=Periodic
5)
Selected harmonic 0=THD; 1=2nd harmonic; 2=3rd harmonic; 3=4th harmonic;
4=5th harmonic; 5=6th harmonic; 6=7th harmonic; 7=8th harmonic; 8=9th harmonic;
9=10th harmonic; 10=11th harmonic; 11=12th harmonic; 12=13th harmonic
27
PQCU3H Substation Automation
28
Substation Automation PQCU3H
29
PQCU3H Substation Automation
3.3.4.1 General
Recorded data includes two recording banks for statistics calculations and one bank
for recording individual harmonics at the time of the latest exceeding of a harmonic
limit. One statistics bank includes the data from the elapsing observation period and
the other bank similar information from the previous observation period.
5HFRUGHGGDWDIURPWKHODWHVWH[FHHGLQJ
Time stamp: indicates the start date and time for the last exceeding in THD or a
harmonic
Very short time (3 s) values of THD and harmonics when the exceeding of the
preset limit occurs
6WDWLVWLFVUHFRUGLQJV (x2, one set for the current observation period and one for the
previous period):
Period info: Start and end time stamps which indicate the start/end date and time
for the Observation period
Maximum values of THD and harmonics: the highest average period (e.g. 10 min)
harmonic value during the observation period is recorded
Xth percentiles for THD and harmonics
For one selected harmonic: the 1st, 5th, 50th, 95th and 99th percentiles
30
Substation Automation PQCU3H
31
PQCU3H Substation Automation
32
Substation Automation PQCU3H
33
PQCU3H Substation Automation
34
Substation Automation PQCU3H
3.3.5 Events
Code Weighting Default Event reason Event state
coefficient mask
E0 1 1 PQCU3H:Harmonic limit Reset
E1 2 1 PQCU3H:Harmonic limit Exceeded
E2 4 1 PQCU3H:Cumulative limit Exceeded
E3 8 1 PQCU3H:Obs. period near end On
E4 16 1 PQCU3H:Obs. period ended On
35
PQCU3H Substation Automation
4 Technical Data
Configuration data Task execution interval (Relay Configuration Tool):
10 ms, at the rated frequency fn = 50 Hz
36
1MRS752335-MUM PQCU3H
Issued: 3/2000
Version: B/12.3.2002
Current Waveform Distortion
Data subject to change without notice
Measurement
Contents
1 Introduction .............................................................................................. 3
1.1 Features.............................................................................................. 3
1.2 Harmonic distortion ............................................................................. 3
1.3 Application........................................................................................... 4
1.4 Input description.................................................................................. 5
1.5 Output description ............................................................................... 5
2 Description of Operation.......................................................................... 6
2.1 Configuration....................................................................................... 6
2.1.1 Analogue channels..................................................................... 6
2.1.2 Digital inputs............................................................................... 6
2.1.3 Configuration error ..................................................................... 6
2.1.4 Configuration examples.............................................................. 7
2.2 Measuring mode ................................................................................. 8
2.3 Operation criteria................................................................................. 8
2.4 Observation times ............................................................................... 9
2.5 Real time monitoring ........................................................................... 9
2.6 Harmonic limit supervision................................................................. 11
2.7 Statistics............................................................................................ 11
2.7.1 Background.............................................................................. 11
2.7.2 Measurement settings.............................................................. 12
2.7.3 Input values.............................................................................. 13
2.7.4 Calculated results..................................................................... 14
2.7.4.1 Recording banks ........................................................... 14
2.7.4.2 Maximum values ........................................................... 14
2.7.4.3 Percentiles .................................................................... 15
2.7.4.4 Fixed percentiles for selected harmonic ........................ 17
2.7.5 Output CUM_HIGH .................................................................. 17
2.7.6 Indications and events.............................................................. 17
2.7.7 Exceptions ............................................................................... 17
2.8 Setting examples............................................................................... 18
2.9 Step-by-step guide for settings.......................................................... 20
2.10 Measurement accuracy ..................................................................... 23
PQCU3H Substation Automation
3.1 General..............................................................................................25
3.2 Control settings..................................................................................26
3.2.1 Statistic limits............................................................................26
3.2.2 Settings ....................................................................................26
3.3 Measurement values .........................................................................27
3.3.1 Inputs/ Outputs .........................................................................27
3.3.2 3 sec. values.............................................................................28
3.3.3 10 min. values ..........................................................................29
3.3.4 Recorded data ..........................................................................30
3.3.4.1 General..........................................................................30
3.3.4.2 A:Period info ..................................................................30
3.3.4.3 A:Maxim. values ............................................................31
3.3.4.4 A:Cumulat. prob.............................................................32
3.3.4.5 A:Selected harm. ...........................................................32
3.3.4.6 B:Period info ..................................................................33
3.3.4.7 B:Maxim. values ............................................................33
3.3.4.8 B:Cumulat. prob.............................................................34
3.3.4.9 B:Selected harm. ...........................................................34
3.3.4.10 Last exceeding...............................................................35
3.3.5 Events ......................................................................................35
4 Technical Data.........................................................................................36
2
Substation Automation PQCU3H
1 Introduction
1.1 Features
Harmonic distortion
Total Harmonic Distortion measurement (THD) or
Total Demand Distortion measurement (TDD)
Individual harmonics up to 13th:
short time average values for monitoring
statistics according to EN 50160 and IEC 61000-4-7 (standards for voltage
distortion measurements are applied to current distortion measurements)
Measurement activation via:
MMI
preset time
serial communication line or a parameter
Measurement frequency:
once (single measurement, e.g. one day)
continuously
periodically (e.g. every Tuesday)
Measurement with:
conventional current transformers
Rogowski coils
The harmonic voltage distortion in a power system depends on the current distortion
produced by nonlinear loads and on the impedance characteristics visible to each load.
The most sensitive equipment to voltage harmonics is usually data processing and
communication equipment; at the same time these devices are considerable current
harmonic sources. These devices are susceptible to misoperation caused by harmonic
distortion. For example, in computers and medical instruments considerably low
harmonic levels can result in malfunctions that can have serious consequences. In
3
PQCU3H Substation Automation
Power quality monitoring is an essential service utilities can provide for their
industrial and key customers. Not only can a monitoring system provide information
about system disturbances and their possible causes, it can also detect problem
conditions throughout the system before they cause customer complaints, equipment
malfunctions, and even equipment damage or failure. Power quality problems are not
limited to the utility side of the system. In fact, the majority of power quality
problems are localized within customer facilities. Thus, power quality monitoring is
not only an effective customer service strategy, but also a way to protect a utilitys
reputation for quality power and service.
At present, power utilities obtain power quality information via measurements done
with portable measuring devices. Enhanced energy meters can also produce some
power quality information. The function block PQCU3H provides a convenient
method for monitoring power quality by means of current waveform distortion:
monitoring can be done together with feeder protection and control using products
based on the RED 500 Platform. Function block PQCU3H produces statistical data
about harmonic distortion for long term evaluation. In addition, the function block
provides short time average and maximum values for THD and individual harmonics.
1.3 Application
This document specifies the functions of the function block PQCU3H for current
waveform distortion measurement used in products based on the RED 500 Platform.
The function block PQCU3H is used for measuring the harmonics and monitoring the
power quality in distribution networks. Although the European Standard EN 50160
concerns voltage distortion, the same standard is applied to current distortion
measurements in PQCU3H. Data collection and analysis is done according to EN
50160. Measuring principles for individual harmonics and THD are adapted from the
International standard IEC 61000-4-7. The American standard IEEE Std 1159 is also
partly supported.
)LJXUH )XQFWLRQEORFNV\PERORI34&8+
4
Substation Automation PQCU3H
5
PQCU3H Substation Automation
2 Description of Operation
2.1 Configuration
Note: It is necessary that currents are connected to the inputs of the function block in
the correct order, cf. Input description above and Configuration examples below.
At the rated frequency of 50 Hz, the function block can only be configured to the task
interval of 10 ms (at 60 Hz 8.33 ms). If any other task interval than that of 10 ms is
used, only the Not in use mode is available.
6
Substation Automation PQCU3H
Note: Check the detailed description of the measuring modes below in the
corresponding section.
Harmonics can be measured from phase currents IL1, IL2 and IL3. With the analogue
channel configuration given in Figure 2 all phase currents and the worst case can be
measured.
)LJXUH $OOSKDVHFXUUHQWVFRQQHFWHG
It is not necessary to connect all inputs to the corresponding analogue channels. For
example, only IL2 can be connected to the input IL2 as shown in Figure 3, but in this
case harmonics can be measured only from IL2.
)LJXUH 2QO\SKDVHFXUUHQW,/FRQQHFWHG
7
PQCU3H Substation Automation
When the measuring mode is set to Worst phase, a current with the highest THD (or
TDD) is measured. Because the worst case can vary during the observation time (first
IL1, then IL2 and then again IL1), the statistics can originate from different currents. The
monitored value Measured input indicates the actual phase all the time (phase
current with the highest THD).
1. Fundamental frequency:
I1 = 0.9 I 1 ...1.1 I 1
where I1 is the measured fundamental frequency and IN the network frequency.
2. Deviation of the fundamental frequency:
GI1 0.5 +] , GI1 = I1, max I1, min
where GI1 is the difference between the measured maximum and minimum values
of the fundamental frequency within one second.
3. Amplitude of the fundamental wave:
$1 1% , 1
Further, if the amplitude of the fundamental wave deviates rapidly, results will be
blocked out (possible transient).
If any of the criteria above is not fulfilled, PQCU3H will not show the values of the
harmonic amplitudes. In addition, these values are not included in statistics. These
operation criteria have been set in order to guarantee sufficient measurement
accuracy. Also the European Standard EN 50160 gives the maximum values for the
harmonic amplitudes in normal operation conditions.
8
Substation Automation PQCU3H
PQCU3H monitors sliding average values from the time intervals of TVs (= 3 s) and
TSh (= 10 min), see the next section Real time monitoring. Other intervals are used
as observation times in PQCU3H. In addition to the standards recommendation,
intervals of 12 h and 2-6 days are also provided. T Vs and TSh values used for
monitoring are used in statistical analysis according to the IEC standard (see section
Statistics). Observation time can be selected via the parameter Observation time.
Available observation times are: 1 hour, 12 hours, 1 day, 2 days, 3 days, 4 days, 5
days, 6 days and 1 week.
There are two sets of harmonic and THD values that can be monitored, namely T Vs
values (very short time, 3 s) and TSh values (short time, 10 min). Both TVs and TSh
values are sliding average values. The observation time corresponding to the time
interval TVs = 3 s consists of windows, within which the real time values are
calculated (effective measuring time), and gaps between those windows. Effective
measuring time windows are equally spaced within the observation time as the IEC
61000-4-7 standard recommends, see Figure 4.
TVs = 3 s M values
time
EffMeas
)LJXUH (IIHFWLYHPHDVXULQJWLPHZLQGRZVGXULQJWKHREVHUYDWLRQWLPH
FRUUHVSRQGLQJWR79V V0 QXPEHURIVDPSOHV
TVs value of an individual harmonic n is calculated in RMS sense using the real time
RMS values (Cn,k) of the nth harmonic:
9
PQCU3H Substation Automation
0
FQ N
2
,
& Q9V = N=1
In TVs sliding average calculation the length of the slide is the length of the effective
measuring time. That is, when a new set of real time values is ready, the oldest set is
rejected from the TVs window and the new set is included (Figure 5).
TVs = 3 s
time
SlidAver
Real time values
)LJXUH 9HU\VKRUWWLPHYDOXHVDUHFDOFXODWHGXVLQJVOLGLQJZLQGRZV
Short time values (TSh = 10 min) are calculated from very short time values in RMS
sense. The length of the slide for short time average values is equal to T Vs = 3s.
13
N
,N
=2
2
7+' =
,1
where I1 is the RMS value of the fundamental component and Ik is the RMS value of
the kth harmonic. If the Settings parameter Distort. factor is set to TDD, Total
Demand Distortion is used instead of THD:
13
N
,N
=2
2
7'' =
,1
The real time values can be read via the directories 3 sec. values and 10 min.
values.
10
Substation Automation PQCU3H
The limits for harmonics and THD (or TDD) set by the user (refer to sections Setting
examples and Last exceeding) are continuously compared to the TVs sliding
average values. If a TVs value for any harmonic should exceed the corresponding
limit, the HAR_HIGH output will be activated (TRUE). Furthermore, an event will be
sent and an MMI indication given. HAR_HIGH will remain active until every
harmonic has dropped under the set limit. An example is given in Figure 6.
TVs value for 3rd
Max THD
THD:
HAR_HIGH:
time:
LimitSuperv
Time stamp + harmonic set Actual recording
)LJXUH ([FHHGLQJRIDKDUPRQLFOLPLW2WKHUKDUPRQLFVDUHXQGHUWKHVHWOLPLWV
EXWWKHUGDQGWKKDUPRQLFVH[FHHGWKHLUOLPLWV7KH+$5B+,*+RXWSXW
UHPDLQVDFWLYHXQWLOERWKKDUPRQLFVKDYHGURSSHGXQGHUWKHLUOLPLWV
During every exceeding of a limit the THD will be observed and the whole harmonic
set (TVs values) will be stored (with a time stamp) at the instant the THD has its
highest value. The actual recording (i.e. the recorded data is readable) is done and a
reset event will be sent when HAR_HIGH is deactivated.
2.7 Statistics
2.7.1 Background
Because there is no standard concerning the harmonic measurement for currents at the
moment, the European Standard for voltages EN 50160 is applied here.
Statistical calculations carried out by PQCU3H fulfil the requirements for statistical
analysis of harmonics declared in EN 50160. The recommendations for harmonics
measurement over the time intervals TL (1 h), TD (1 d) and TWk (1 week) declared in
IEC 61000-4-7 are also fulfilled.
In the following text statistics recorder refers to the part of PQCU3H that carries out
the statistical calculations.
11
PQCU3H Substation Automation
The function block PQCU3H calculates the statistics only if it has been triggered. A
triggering signal always starts a new observation time.
There are several possible ways for triggering, i.e. activating, the statistics. The
statistics can be triggered via a local MMI by activating the Settings parameter
Remote trigger. The same parameter can be used for remote triggering, e.g. for
activating the statistics via MicroSCADA in Network Control Center. The function
block can also be activated by an external digital input connected to the function
block input TRIGG. Setting this digital input from FALSE to TRUE activates the
statistics. Statistics can also be activated at some preset time and date. The user can
set the time of the activation via the Settings parameters Trigger year, Trigger
month, Trigger day and Trigger hour. Refer to section Setting examples for
further information.
Statistics are calculated over the elapsing observation time. This time period is set via
the Settings parameter Observation time. There are several possibilities from one
hour to one week.
The user can also select a preferable way of continuous statistics recordings over a
longer period of time (months, years). With the Settings parameter Trigger mode
the user can select how the next observation time will be activated after the former
one has finished. There are three possibilities: Single, Continuous and Periodic.
Active state of statistics recorder, i.e. calculation and storage of data, in each mode is
shown in Figure 7. In the trigger mode Single, data for one observation time is
calculated and stored. If another observation time is wanted, the statistics recorder
must be triggered again. In the trigger mode Continuous, the next observation time
starts automatically right after the former observation time has finished. In the
Periodic mode, there is a fixed time gap of one week between the beginning of the
former observation time and the beginning of the next observation time.
12
Substation Automation PQCU3H
Start of Statistics
Trigger mode: Single
recordings,
Observation time: 1 week
Trigger: Activated
Time
1 week
Time
Time
ObsTimes
Time
)LJXUH 3HULRGVIRUVWDWLVWLFVUHFRUGHUZLWKGLIIHUHQWWULJJHUPRGHVDQG
REVHUYDWLRQWLPHV
The statistics recorder uses the TVs (3 s) and TSh (10 min) values in calculations
depending on the length of the observation time. If the observation time is shorter
than one day, statistics recorder uses the TVs values. If the observation time is one day
or longer, the TSh values are used.
13
PQCU3H Substation Automation
Calculated results are stored in two recording banks. One bank includes data from the
previous observation time. The other bank includes data from the elapsing observation
time. Data in the active bank is updated continuously as long as the active observation
time is elapsing. When the active observation time ends, data is moved from the
active bank to the other bank.
Calculated data are stored in different directories. The directory Period info
includes general information about the observation time (start and end times of the
period, measuring mode); Maxim. values includes measured maximum values for
THD and individual harmonics, Cumulat. prob. (Cumulative probability) includes
percentiles (can be selected by the user) for THD and individual harmonics, and
Selected harm. (Selected harmonic) includes five fixed percentiles for one
selectable harmonic (or THD). Data from the active observation time are in
directories:
A:Period info
A:Maxim. values
A:Cumulat. prob.
A:Selected harm.
and data from the previous observation time:
B:Period info
B:Maxim. values
B:Cumulat. prob.
B:Selected harm.
The Time to end parameter in the A: Period info directory informs how long it is
to the end of the observation time. This parameter is useful when checking that the
triggering has succeeded. If Time to end is 0 min, the statistics are not calculated. If
Time to end is other than 0 min, it indicates that statistics are calculated just then.
Maximum values for THD and individual harmonics are real maximum TVs (3 s) or
TSh (10 min) values during the observation time. These are picked from continuously
updated sliding average values. This enables recording of the true worst values. There
is no time dependency between recorded maximum values for THD and individual
harmonics. Hence, maximum values can be from several different time instants.
14
Substation Automation PQCU3H
2.7.4.3 Percentiles
Percentiles are values in a given set of observations that divide the data into 100 equal
parts. These values can be denoted by P1, P2,..., P99, where
1 % of the data falls below (is less than or equal to) P1; 2 % of the data falls
below P2; ... ; 99 % of the data falls below P99.
The purpose of percentiles is to find the harmonic amplitude so that, during the
observation time, 95 % of all the measured harmonic amplitudes are less than or equal
to the calculated percentile. As a default, 95th percentiles are calculated for each
harmonic, but also other percentiles can be calculated (parameter Cum. probability
in Statistic limits directory). The percentiles are found in the Selected harm.
directories.
Non-sliding and non-overlapping TVs (3 s) or TSh (10 min) average values are used in
percentile calculation depending on the length of the observation time. For example,
when the 10 min average values are used and the measurement is activated at
12:00:000, the first average used in the percentile calculation is measured during the
time interval 12:00:000 ... 12:10:000, the next one during the time interval 12:10:000
... 12:20:000 and so on.
All average values are divided into classifiers. The categorisation resolution, i.e. the
width of the classifiers, is dependent on the Limit p (set with Limit parameters in the
Statistic limits directory). Categorisation for each harmonic includes 16 classifiers
between values 0 and 2p. Hence, the classifier width a is
2 S
D=
1XP2I&ODVVLILHUV
For example, if the limit for the second harmonic is 10 %In, the classifier width a is
1.25 %In. If the average value I2,ave is
D < , 2,DYH 2D
the average value is put into classifier 2. Calculation of percentiles is shown in Figure
8.
15
PQCU3H Substation Automation
Classifier 2
Limit p
2*p
10 30 30 ... 25 4 ... 1 0 0 0
0 a 2*a 3*a p-a p+a 2*p-3a 2*p-2a 2*p-a
Over
category
PQCUPercentileCalc1
a = 2*p/NumOfCategories
Value/%In
)LJXUH &DWHJRULVDWLRQRIPHDVXUHGYDOXHVDQGFDOFXODWLRQRIDSHUFHQWLOH
Classifier 2
Limit p
2*p
10 30 30 ... 24 4 ... 2 0 0 0
0 a 2*a 3*a p-a p+a 2*p-3a 2*p-2a 2*p-a
Over cat-
egory
PQCUPercentileCalc2
a = 2*p/NumOfCategories
Value/%In
)LJXUH &DWHJRULVDWLRQRIPHDVXUHGYDOXHVDQGFDOFXODWLRQRIDSHUFHQWLOH
Figure 9 presentsa situation where 6 values are in classifiers above the limit p. Hence,
the 95th percentile is greater than the set limit p, which means that the
recommendation of the European Standard EN 50160 would not be met.
16
Substation Automation PQCU3H
With five percentiles more detailed information can be obtained from the cumulative
distribution of the selected harmonic, see Figure 10.
% In
14
12
10
8
6
4
PQCUFixed perc
2
Time
1% 5% 50 % 95 % 99 %
)LJXUH VWWKWKWKDQGWKSHUFHQWLOHVIRUVHOHFWHGKDUPRQLF
If the calculated percentile is greater than the preset limit (i.e. more than 5 % of all
harmonic values are higher than the preset limit), an indication will be given: the
output CUM_HIGH will be activated, an event sent and an MMI indication given.
The indication declares which harmonic exceeded the limit.
During the elapsing observation time there will be indications about the ending of the
observation time. The first warning event will be given 5 minutes before the end of
the elapsing observation time; the second event at the end of the observation time.
2.7.7 Exceptions
Exceptional usage of the function block is taken into account. There are two major
exceptions: changing the settings during an elapsing observation time and changing
the system clock to a new time. The latter is valid e.g. with daylight saving time.
17
PQCU3H Substation Automation
Changes to the setting parameters during an elapsing observation time are taken into
account when the elapsing observation time has ended. If the new settings must be
activated at once, the function block has to be reset. This means that all data from the
elapsing observation time in the statistics recorder will be cleared and the statistics
recorder starts to wait for a new observation time (a new measurement activation).
Resetting can be done via the local MMI (parameter Reset registers) or by
activating the digital input RESET.
Changing the system clock back during an active observation time lengthens the
active observation time by the amount of the time change. On the contrary, changing
the system clock forward shortens the active observation time. With this functionality,
the end date and time of the active observation time remain as set.
There are several parameters that can be set by the user. Setting parameters are
explained in detail in the corresponding sections, for example the use of harmonic
limits (percentiles) is explained in the section Statistics. In the following, two
examples on the use of the setting parameters:
The recommendation gives values for each individual harmonic current in medium
voltage supply. THD shall be less than or equal to 14 %.
Let us say that phase current IL1 is under this survey and we want to verify its quality.
The survey should start at 8:00 am on Monday the 3rd of May, 1999 and last until
further notice. Let us also assume that we want to know the cumulative distribution of
the third harmonic values more precisely. The setting values would be:
Settings:
Measuring mode L1
Distort. factor THD
Observation time 1 week
Trigger mode Continuous
Trigger year 1999
Trigger month 5
Trigger day 3
Trigger hour 8
rd
Selected harm. 3 harmonic
18
Substation Automation PQCU3H
Statistic limits:
Cum. probability 95 %
Limit THD 14.0 %
Limit 2nd harm. 4.0 % In
Limit 3rd harm. 10.0 % In
Limit 4th harm. 2.0 % In
Limit 5th harm. 12.0 % In
Limit 6th harm. 1.0 % In
Limit 7th harm. 10.0 % In
Limit 8th harm. 1.0 % In
Limit 9th harm. 3.0 % In
Limit 10th harm. 1.0 % In
Limit 11th harm. 7.0 % In
Limit 12th harm. 0.4 % In
Limit 13th harm. 6.0 % In
Note: Check the sections Statistics and Real time monitoring for the effects of the
harmonic limits (% In).
The same recommended reference values are used as in example 1, but now we want
to survey the harmonics only on Mondays, starting at 0:00 am on Monday the 12th of
April, 1999.Let us also assume that we want to check the overall worst case of phase
currents (statistics are collected using the values from the phase current with the
highest THD at each moment). The third harmonic is once again observed more
closely than the others. Instead of THD, TDD is used, so the Distort. factor
parameter should be set to TDD.
Settings:
19
PQCU3H Substation Automation
Statistic limits:
Cum. probability 95 %
Limit THD 14.0 % (<-- TDD)
Limit 2nd harm. 4.0 % In
Limit 3rd harm. 10.0 % In
Limit 4th harm. 2.0 % In
Limit 5th harm. 12.0 % In
Limit 6th harm. 1.0 % In
Limit 7th harm. 10.0 % In
Limit 8th harm. 1.0 % In
Limit 9th harm. 3.0 % In
Limit 10th harm. 1.0 % In
Limit 11th harm. 7.0 % In
Limit 12th harm. 0.4 % In
Limit 13th harm. 6.0 % In
Harmonic limits shall be chosen carefully. The lower the limit, the higher resolution is
used in percentile calculation and vice versa: if the limit is high, the resolution
becomes lower. However, if too low a limit is chosen, harmonic values may exceed
the limit too easily.
The difference between real time monitoring and statistics should be noticed. Once
triggered, the 3 sec and 10 min values are monitored continuously even if the statistics
are not calculated (observation time has ended). The statistics, on the other hand, are
calculated over the selected observation time (from 1 hour to 1 week). The Time to
end parameter gives an indication of the elapsing observation time. If the Time to
end parameter has a value other than 0 min, the statistics are calculated just then.
5HVHWWLQJ
If the statistics calculation is on and new settings are going to be made, PQCU3H
must be reset (RESET input or Reset registers parameter). Resetting the registers
stops the statistics calculations. If the statistics calculation has ended, reset is not
necessary. Alternatively, in case of the continuous or the periodic triggering mode,
new settings can be made without resetting the registers. Yet, the new settings become
valid after the elapsing observation time has ended and a new one has begun.
7ULJJHULQJ
New settings are not valid until they have been activated by triggering. The triggering
signal can be given via the Remote trigger parameter, the TRIGG input or the
trigger date (Trigger year, Trigger month, Trigger day and Trigger hour). In the single
mode, the settings are activated immediately after triggering. In the continuous and
the period triggering mode, the settings are activated at the preset triggering date
(year, month, day and hour); thus triggering via the Remote trigger parameter or the
TRIGG input is not possible.
20
Substation Automation PQCU3H
Next, four setting examples are given for activation of PQCU3H. In addition to the
settings given here, statistical limits and a harmonic for closer percentile calculation
can be set before activating the settings
([DPSOH
([DPSOH
21
PQCU3H Substation Automation
([DPSOH
([DPSOH
Objective: Continue the statistic calculations with the current settings, but change the
monitored signal to IL3 for the next observation time.
Check: When the elapsing observation time Monitoring phase current IL3
ends (Time to end is 0 min), the active
measuring mode should change to L3
Right after reaching 0 min, the Time to Statistics calculation
end parameter should change to show
the selected observation time in
minutes
Data from the previous observation Previous data stored in bank B
time should be in the recording bank B
(using IL1)
22
Substation Automation PQCU3H
)XQGDPHQWDOIUHTXHQF\
I1 = I 1
+DUPRQLFDPSOLWXGHVLQWKHIUHTXHQF\UDQJHDERYH)V
30% $1
where AN is the highest harmonic amplitude within the frequency range from 0 Hz to
Fs/2, where Fs is the used sampling frequency (if fN = 50 Hz, Fs = 2000 Hz and if fN =
60 Hz, Fs = 2400 Hz).
$PSOLWXGHRIWKHIXQGDPHQWZDYH
0.01, 1 , 60 , 1
5% , P , if , P 10% , 1
10% , P , if , P 10% , 1 .
When Rogowski coils are used for current measurement, the measurement accuracy of
IEC 61000-4-7 is not guaranteed.
23
PQCU3H Substation Automation
2.11 Resetting
The registers can be reset either via the RESET input, or over the serial bus or the
local MMI.
24
Substation Automation PQCU3H
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for PQCU3H is 512.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the relay
terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask 1
parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
25
PQCU3H Substation Automation
3.2.2 Settings
Parameter Code Values Unit Default Data Explanation
direction
Measuring mode V15 0...4 1) - 0 R/W Measuring mode
2)
Distort. factor V16 0 or 1 - 1 R/W Selection of distortion
factor (THD or TDD)
Observation time V17 0...9 3) - 9 R/W Selection of
observation time
Trigger mode V18 0...2 4) - 0 R/W Selection of trigger
mode
Trigger year V19 1980...2400 y 1980 R/W Triggering year
Trigger month V20 1...12 m 1 R/W Triggering month
Trigger day V21 1...31 d 1 R/W Triggering day
Trigger hour V22 0...23 h 1 R/W Triggering hour
Remote trigger V23 1=Trigger - 0 W Remote or local
triggering
Selected harm. V24 0...13 5) - 3 R/W Selected harmonic for
recordings
Act. meas.mode V26 0...4 1) - 0 R Active measuring
mode
Event mask 1 V101 0...31 - 31 R/W Event mask 1 for
event transmission
Event mask 2 V103 0...31 - 31 R/W Event mask 2 for
event transmission
Event mask 3 V105 0...31 - 31 R/W Event mask 3 for
event transmission
Event mask 4 V107 0...31 - 31 R/W Event mask 4 for
event transmission
26
Substation Automation PQCU3H
1)
Measuring mode 0=Not in use; 1=L1; 2=L2; 3=L3; 4=Worst phase
2)
Distortion factor 0=THD, 1=TDD
3)
Observation time 0=1 hour; 1=12 hours; 2=1 day; 3=2 days; 4=3 days; 5=4 days;
6=5 days; 7=6 days; 8=1 week
4)
Triggering mode 0=Single; 1=Continuous; 2=Periodic
5)
Selected harmonic 0=THD; 1=2nd harmonic; 2=3rd harmonic; 3=4th harmonic;
4=5th harmonic; 5=6th harmonic; 6=7th harmonic; 7=8th harmonic; 8=9th harmonic;
9=10th harmonic; 10=11th harmonic; 11=12th harmonic; 12=13th harmonic
27
PQCU3H Substation Automation
28
Substation Automation PQCU3H
29
PQCU3H Substation Automation
3.3.4.1 General
Recorded data includes two recording banks for statistics calculations and one bank
for recording individual harmonics at the time of the latest exceeding of a harmonic
limit. One statistics bank includes the data from the elapsing observation period and
the other bank similar information from the previous observation period.
5HFRUGHGGDWDIURPWKHODWHVWH[FHHGLQJ
Time stamp: indicates the start date and time for the last exceeding in THD or a
harmonic
Very short time (3 s) values of THD and harmonics when the exceeding of the
preset limit occurs
6WDWLVWLFVUHFRUGLQJV (x2, one set for the current observation period and one for the
previous period):
Period info: Start and end time stamps which indicate the start/end date and time
for the Observation period
Maximum values of THD and harmonics: the highest average period (e.g. 10 min)
harmonic value during the observation period is recorded
Xth percentiles for THD and harmonics
For one selected harmonic: the 1st, 5th, 50th, 95th and 99th percentiles
30
Substation Automation PQCU3H
31
PQCU3H Substation Automation
32
Substation Automation PQCU3H
33
PQCU3H Substation Automation
34
Substation Automation PQCU3H
3.3.5 Events
Code Weighting Default Event reason Event state
coefficient mask
E0 1 1 PQCU3H:Harmonic limit Reset
E1 2 1 PQCU3H:Harmonic limit Exceeded
E2 4 1 PQCU3H:Cumulative limit Exceeded
E3 8 1 PQCU3H:Obs. period near end On
E4 16 1 PQCU3H:Obs. period ended On
35
PQCU3H Substation Automation
4 Technical Data
Configuration data Task execution interval (Relay Configuration Tool):
10 ms, at the rated frequency fn = 50 Hz
36
1MRS752336-MUM PQVO3H
Issued: 3/2000
Version: A/30.1.2002
Voltage Waveform Distortion
Data subject to change without notice
Measurement
Contents
1 Introduction .............................................................................................. 3
1.1 Features.............................................................................................. 3
1.2 Harmonic distortion ............................................................................. 3
1.3 Application........................................................................................... 4
1.4 Input description.................................................................................. 5
1.5 Output description ............................................................................... 5
2 Description of Operation.......................................................................... 6
2.1 Configuration....................................................................................... 6
2.1.1 Analogue channels..................................................................... 6
2.1.2 Digital inputs............................................................................... 7
2.1.3 Configuration error ..................................................................... 7
2.1.4 Configuration examples.............................................................. 7
2.2 Measuring mode ................................................................................. 8
2.3 Operation criteria................................................................................. 9
2.4 Observation times ............................................................................... 9
2.5 Real time monitoring ......................................................................... 10
2.6 Harmonic limit supervision................................................................. 11
2.7 Statistics............................................................................................ 12
2.7.1 Background.............................................................................. 12
2.7.2 Measurement settings.............................................................. 12
2.7.3 Input values.............................................................................. 13
2.7.4 Calculated results..................................................................... 14
2.7.4.1 Recording banks ........................................................... 14
2.7.4.2 Maximum values ........................................................... 14
2.7.4.3 Percentiles .................................................................... 15
2.7.4.4 Fixed percentiles for selected harmonic ........................ 17
2.7.5 Output CUM_HIGH .................................................................. 17
2.7.6 Indications and events.............................................................. 17
2.7.7 Exceptions ............................................................................... 17
2.8 Setting examples............................................................................... 18
2.9 Step-by-step guide for settings.......................................................... 20
2.10 Measurement accuracy ..................................................................... 23
PQVO3H Substation Automation
3.1 General..............................................................................................25
3.2 Control settings..................................................................................26
3.2.1 Statistic limits............................................................................26
3.2.2 Settings ....................................................................................26
3.3 Measurement values .........................................................................27
3.3.1 Inputs/ Outputs .........................................................................27
3.3.2 3 sec. values.............................................................................28
3.3.3 10 min. values ..........................................................................29
3.3.4 Recorded data ..........................................................................30
3.3.4.1 General..........................................................................30
3.3.4.2 A:Period info ..................................................................30
3.3.4.3 A:Maxim. values ............................................................31
3.3.4.4 A:Cumulat. prob.............................................................32
3.3.4.5 A:Selected harm. ...........................................................32
3.3.4.6 B:Period info ..................................................................33
3.3.4.7 B:Maxim. values ............................................................33
3.3.4.8 B:Cumulat. prob.............................................................34
3.3.4.9 B:Selected harm. ...........................................................34
3.3.4.10 Last exceeding...............................................................35
3.3.5 Events ......................................................................................35
4 Technical Data.........................................................................................36
2
Substation Automation PQVO3H
1 Introduction
1.1 Features
Total Harmonic Distortion measurement (THD)
Individual harmonics up to 13th:
short time average values for monitoring
statistics according to EN 50160 and IEC 61000-4-7
Measurement activation via:
MMI
preset time
serial communication line or a parameter
Measurement frequency:
once (single measurement, e.g. one day)
continuously
periodically (e.g. every Tuesday)
Measurement with:
conventional voltage transformers
voltage dividers
The harmonic voltage distortion in a power system depends on the current distortion
produced by nonlinear loads and on the impedance characteristics visible to each load.
The most sensitive equipment to voltage harmonics is usually data processing and
communication equipment; at the same time these devices are considerable current
harmonic sources. These devices are susceptible to misoperation caused by harmonic
distortion. For example, in computers and medical instruments considerably low
harmonic levels can result in malfunctions that can have serious consequences. In
rotating machinery, a major effect of harmonic voltages and currents is an increased
heating due to iron and copper losses at the harmonic frequencies.
3
PQVO3H Substation Automation
Power quality monitoring is an essential service utilities can provide for their
industrial and key customers. Not only can a monitoring system provide information
about system disturbances and their possible causes, it can also detect problem
conditions throughout the system before they cause customer complaints, equipment
malfunctions, and even equipment damage or failure. Power quality problems are not
limited to the utility side of the system. In fact, the majority of power quality
problems are localized within customer facilities. Thus, power quality monitoring is
not only an effective customer service strategy, but also a way to protect a utilitys
reputation for quality power and service.
At present, power utilities obtain power quality information via measurements done
with portable measuring devices. Enhanced energy meters can also produce some
power quality information. The function block PQVO3H provides a convenient
method for monitoring power quality by means of voltage waveform distortion:
monitoring can be done together with feeder protection and control using products
based on the RED 500 Platform. Function block PQVO3H produces statistical data
about harmonic distortion that is immediately comparable to standard definitions
about power of good quality. In addition, the function block provides short time
average and maximum values for THD and individual harmonics.
1.3 Application
This document specifies the functions of the function block PQVO3H for voltage
waveform distortion measurement used in products based on the RED 500 Platform.
The function block PQVO3H is used for measuring the harmonics and monitoring the
power quality in distribution networks. Power quality measurements carried out by
the function block PQVO3H follow the European Standard EN 50160. Data collection
and analysis is done according to EN 50160. Measuring principles for individual
harmonics and THD are adapted from the International standard IEC 61000-4-7. The
American standard IEEE Std 1159 is also partly supported.
)LJXUH )XQFWLRQEORFNV\PERORI3492+
4
Substation Automation PQVO3H
5
PQVO3H Substation Automation
2 Description of Operation
2.1 Configuration
Then again, if at least two of the phase-to-phase voltages and residual voltage are
connected, it is possible to carry out the distortion measurement for phase-to-earth
voltages. For example, if U0, U12 and U23 are connected, phase-to-earth voltages are
calculated as follows:
UL1 = 3 (U0 + 2*U12 + U23) /3
UL2 = 3 (U0 - U12 + U23) /3
UL3 = 3 (U0 - U12 - 2*U23) /3
Note: It is necessary that the voltages are connected to the inputs of the function block
in the correct order, cf. Input Description above and Configuration examples
below.
At the rated frequency of 50 Hz, the function block can only be configured to the task
interval of 10 ms (at 60 Hz 8.33 ms). If any other task interval than that of 10 ms is
used, only the Not in use mode is available.
6
Substation Automation PQVO3H
Note: Check the detailed description of the measuring modes below in the
corresponding section.
1. 2.
3. 4.
7
PQVO3H Substation Automation
Configurations in the figures above are all valid. In figure (1), phase-to-phase voltages
U12 and U23 and residual voltage U0 are connected in correct order. U12 is also
connected to the frequency reference input. This configuration allows all measuring
modes to be used except L3-L1 (cf. Measuring mode below). In figure (2), phase-
to-earth voltages UL2 and UL3 are connected in correct order. UL2 is also connected to
the frequency reference input. This configuration allows measuring modes L2, L3
and Worst phase. In figure (3), phase-to-earth voltages UL1 and UL3 are connected in
correct order. UL1 is used as frequency reference. This configuration allows measuring
modes L1, L3 and Worst phase. A basic configuration where all phase-to-phase
voltages and residual voltage are connected is presented in figure (4). This
configuration allows all measuring modes.
The measuring devices and signal types for analogue channels are selected and
configured in a special dialogue box of the Relay Configuration Tool. Digital inputs
are configured in the same programming environment (the number of selectable
analogue inputs, digital inputs and digital outputs depends on the hardware used).
When the measuring mode is set to Worst phase, the phase-to-earth voltage with the
highest THD is measured. Because the worst case can vary during the observation
time (first UL1, then UL2 and then again UL1), the statistics can originate from different
phases. The monitored value Measured input indicates the actual phase all the time
(phase-to-earth voltage with the highest THD).
Operation with the measuring mode Worst main is the same as with Worst phase.
Now the highest THD is tracked from the phase-to-phase voltages.
8
Substation Automation PQVO3H
1. Fundamental frequency:
I1 = 0.9 I 1 ...1.1 I 1
where I1 is the measured fundamental frequency and IN the network frequency.
2. Deviation of the fundamental frequency:
where GI1 is the difference between the measured maximum and minimum values of
the fundamental frequency within one second.
$1 70%8 1
Further, if the amplitude of the fundamental wave deviates rapidly, results will be
blocked out (possible transient).
If any of the criteria above is not fulfilled, PQVO3H will not show the values of the
harmonic amplitudes. In addition, these values are not included in statistics. These
operation criteria have been set in order to guarantee sufficient measurement
accuracy. Also the European Standard EN 50160 gives the maximum values for the
harmonic amplitudes in normal operation conditions.
PQVO3H monitors sliding average values from the time intervals of TVs (= 3 s) and
TSh (= 10 min), see the next section Real time monitoring. Other intervals are used
as observation times in PQVO3H. In addition to the standards recommendation,
intervals of 12 h and 2-6 days are also provided. T Vs and TSh values used for
monitoring are used in statistical analysis according to the IEC standard (see section
Statistics). Observation time can be selected via the parameter Observation time.
Available observation times are: 1 hour, 12 hours, 1 day, 2 days, 3 days, 4 days, 5
days, 6 days and 1 week.
9
PQVO3H Substation Automation
There are two sets of harmonic and THD values that can be monitored, namely T Vs
values (very short time, 3 s) and TSh values (short time, 10 min). Both TVs and TSh
values are sliding average values. The observation time corresponding to the time
interval TVs = 3 s consists of windows, within which the real time values are
calculated (effective measuring time), and gaps between those windows. Effective
measuring time windows are equally spaced within the observation time as the IEC
61000-4-7 standard recommends, see Figure 3.
TVs = 3 s M values
time
EffMeas
Real time values
)LJXUH (IIHFWLYHPHDVXULQJWLPHZLQGRZVGXULQJWKHREVHUYDWLRQWLPH
FRUUHVSRQGLQJWR79V V0 QXPEHURIVDPSOHV
TVs value of individual harmonic n is calculated in RMS sense using the real time
RMS values (Cn,k) of the nth harmonic:
0
FQ N
2
,
&Q9V = N=1
0
In TVs sliding average calculation the length of the slide is the length of the effective
measuring time. That is, when a new set of real time values is ready, the oldest set is
rejected from the TVs window and the new set is included (figure 4).
TVs = 3 s
time
SlidAver
)LJXUH 9HU\VKRUWWLPHYDOXHVDUHFDOFXODWHGXVLQJVOLGLQJZLQGRZV
Short time values (TSh = 10 min) are calculated from very short time values in RMS
sense. The length of the slide for short time average values is equal to T Vs = 3s.
10
Substation Automation PQVO3H
13
8
N =2
2
N
7+' =
81
where U1 is the RMS value of the fundamental component and Uk is the RMS value of
the kth harmonic.
The real time values can be read via the directories 3 sec. values and 10 min.
values.
The limits for harmonics and THD set by the user (refer to sections Setting
examples and Last exceeding) are compared continuously to the TVs sliding
average values. If the TVs value for any harmonic should exceed the corresponding
limit, the HAR_HIGH output will be activated (TRUE). Furthermore, an event will be
sent and an MMI indication given. HAR_HIGH will remain active until every
harmonic has dropped under the set limit. An example is given in Figure 5.
TVs value for 3rd
Max THD
THD:
HAR_HIGH:
time:
LimitSuperv
)LJXUH ([FHHGLQJRIDKDUPRQLFOLPLW2WKHUKDUPRQLFVDUHXQGHUWKHVHWOLPLWV
EXWWKHUGDQGWKKDUPRQLFVH[FHHGWKHLUOLPLWV7KH+$5B+,*+RXWSXW
UHPDLQVDFWLYHXQWLOERWKKDUPRQLFVKDYHGURSSHGXQGHUWKHLUOLPLWV
During every exceeding of a limit the THD will be observed and the whole harmonic
set (TVs values) will be stored (with a time stamp) at the instant the THD has its
highest value. The actual recording (i.e. the recorded data is readable) is done and a
reset event will be sent when HAR_HIGH is deactivated.
11
PQVO3H Substation Automation
2.7 Statistics
2.7.1 Background
Statistical calculations carried out by PQVO3H fulfil the requirements for statistical
analysis of harmonics declared in EN 50160. The recommendations for harmonics
measurement over the time intervals TL (1 h), TD (1 d) and TWk (1 week) declared in
IEC 61000-4-7 are also fulfilled. EN 50160 states the requirements for power quality
(concerning harmonics) as follows:
In the following text statistics recorder refers to the part of PQVO3H that carries out
the statistical calculations.
PQVO3H calculates the statistics only if it has been triggered. A triggering signal
always starts a new observation time.
There are several possibilities for triggering, i.e. activating, the statistics. The
statistics can be triggered via a local MMI by activating the Settings parameter
Remote trigger. The same parameter can be used for remote triggering, e.g.
activating the statistics via MicroSCADA in Network Control Center. The function
block can also be activated by an external digital input connected to the function
block input TRIGG. Setting this digital input from FALSE to TRUE activates the
statistics. Statistics can also be activated at some preset time and date. The user can
set the time of the activation via the Settings parameters Trigger year, Trigger
month, Trigger day and Trigger hour. Refer to section Setting examples for
further information.
Statistics are calculated over the elapsing observation time. This time period is set via
the Settings parameter Observation time. There are several possibilities from one
hour to one week.
The user can also select a preferable way of continuous statistics recordings over a
longer period of time (months, years). With the Settings parameter Trigger mode
the user can select how the next observation time will be activated after the former
one has finished. There are three possibilities: Single, Continuous and Periodic.
Active state of statistics recorder, i.e. calculation and storage of data, in each mode is
shown in Figure 6. In the trigger mode Single, data for one observation time is
calculated and stored. If another observation time is wanted, the statistics recorder
must be triggered again. In the trigger mode Continuous, the next observation time
starts automatically right after the former observation time has finished. In the
Periodic mode, there is a fixed time gap of one week between the beginning of the
former observation time and the beginning of the next observation time.
12
Substation Automation PQVO3H
Start of Statistics
Trigger mode: Single
recordings,
Observation time: 1 week
Trigger: Activated
Time
1 week
Time
Time
ObsTimes
Time
)LJXUH 3HULRGVIRUVWDWLVWLFVUHFRUGHUZLWKGLIIHUHQWWULJJHUPRGHVDQG
REVHUYDWLRQWLPHV
The statistics recorder uses the TVs (3 s) and TSh (10 min) values in calculations
depending on the length of the observation time. If the observation time is shorter
than one day, statistics recorder uses the TVs values. If the observation time is one day
or longer, the TSh values are used.
13
PQVO3H Substation Automation
Calculated results are stored in two recording banks. One bank includes data from the
previous observation time. The other bank includes data from the elapsing observation
time. Data in the active bank is updated continuously as long as the active observation
time is elapsing. When the active observation time ends, data is moved from the
active bank to the other bank.
Calculated data are stored in different directories. The directory Period info
includes general information about the observation time (start and end times of the
period, measuring mode); Maxim. values includes measured maximum values for
THD and individual harmonics, Cumulat. prob. (Cumulative probability) includes
percentiles (can be selected by the user) for THD and individual harmonics, and
Selected harm. (Selected harmonic) includes five fixed percentiles for one
selectable harmonic (or THD). Data from the active observation time are in
directories:
A:Period info
A:Maxim. values
A:Cumulat. prob.
A:Selected harm.
and data from the previous observation time:
B:Period info
B:Maxim. values
B:Cumulat. prob.
B:Selected harm.
The Time to end parameter in the A: Period info directory informs how long it is
to the end of the observation time. This parameter is useful when checking that
triggering has succeeded. If Time to end is 0 min, the statistics are not calculated. If
Time to end is other than 0 min, it indicates that statistics are calculated just then.
Maximum values for THD and individual harmonics are real maximum TVs (3 s) or
TSh (10 min) values during the observation time. These are picked from continuously
updated sliding average values. This enables recording of the true worst values. There
is no time dependency between recorded maximum values for THD and individual
harmonics. Hence, maximum values can be from several different time instants.
14
Substation Automation PQVO3H
2.7.4.3 Percentiles
Percentiles are values in a given set of observations that divide the data into 100 equal
parts. These values can be denoted by P1, P2,..., P99, where
1 % of the data falls below (is less than or equal to) P1; 2 % of the data falls
below P2; ... ; 99 % of the data falls below P99.
The purpose of percentiles is to find the harmonic amplitude so that during the
observation time 95 % of all the measured harmonic amplitudes are less than or equal
to the calculated percentile. As a default, 95th percentiles are calculated for each
harmonic, but also other percentiles can be calculated (parameter Cum. probability
in Statistic limits directory). The percentiles are found in the Selected harm.
directories.
Non-sliding and non-overlapping TVs (3 s) or TSh (10 min) average values are used in
percentile calculation depending on the length of the observation time. For example,
when the 10 min average values are used and the measurement is activated at
12:00:000, the first average used in the percentile calculation is measured during the
time interval 12:00:000 ... 12:10:000, the next one during the time interval 12:10:000
... 12:20:000 and so on.
All average values are divided into classifiers. The categorisation resolution, i.e. the
width of the classifiers, is dependent on the Limit p (set with Limit parameters in the
Statistic limits directory). Categorisation for each harmonic includes 16 classifiers
between values 0 and 2p. Hence, the classifier width a is
2 S
D=
1XP2I&ODVVLILHUV
For example, if the limit for the second harmonic is 10 %Un, the classifier width a is
1.25 %Un. If the average value U2,ave is
D < 8 2,DYH 2D ,
15
PQVO3H Substation Automation
Classifier 2
Limit p
2*p
10 30 30 ... 25 4 ... 1 0 0 0
0 a 2*a 3*a p-a p+a 2*p-3a 2*p-2a 2*p-a
Over
category
PQVOPercentileCalc1
a = 2*p/NumOfCategories
Value/%Un
)LJXUH &DWHJRULVDWLRQRIPHDVXUHGYDOXHVDQGFDOFXODWLRQRIDSHUFHQWLOH
Classifier 2
Limit p
2*p
10 30 30 ... 24 4 ... 2 0 0 0
0 a 2*a 3*a p-a p+a 2*p-3a 2*p-2a 2*p-a
Over
category
PQVOPercentileCalc2
a = 2*p/NumOfCategories
Value/%Un
)LJXUH &DWHJRULVDWLRQRIPHDVXUHGYDOXHVDQGFDOFXODWLRQRIDSHUFHQWLOH
Figure 8 presents a situation where 6 values are in classifiers above the limit p. Hence,
the 95th percentile is greater than the set limit p, which means that the
recommendation of the European Standard EN 50160 would not be met.
16
Substation Automation PQVO3H
For one harmonic or THD (selected by Selected harm. parameter in the Settings
directory) a more accurate cumulative distribution is gained by calculating five fixed
percentiles (1st, 5th, 50th, 95th and 99th). Calculation is carried out in a similar way
as for the one percentile with the exception that now 32 classifiers are used.
With five percentiles, more detailed information can be obtained from the cumulative
distribution of the selected harmonic, see Figure 9.
% Un
14
12
10
8
6
4
PQVOFixed perc
2 Time
1% 5% 50 % 95 % 99 %
)LJXUH VWWKWKWKDQGWKSHUFHQWLOHVIRUVHOHFWHGKDUPRQLF
If the calculated percentile is greater than the preset limit (i.e. more than 5 % of all
harmonic values are smaller than the preset limit), an indication will be given: the
output CUM_HIGH will be activated, an event sent and an MMI indication given.
The indication declares which harmonic exceeded the limit.
During the elapsing observation time there will be indications about the ending of the
observation time. The first warning event will be given 5 minutes before the end of
the elapsing observation time; the second event at the end of the observation time.
2.7.7 Exceptions
Exceptional usage of the function block is taken into account. There are two major
exceptions: changing the settings during an elapsing observation time and changing
the system clock to a new time. The latter is valid e.g. with daylight saving time.
Changes to the setting parameters during an elapsing observation time are taken into
account when the elapsing observation time has ended. If the new settings must be
activated at once, the function block has to be reset. This means that all data from the
elapsing observation time in the statistics recorder will be cleared and the statistics
recorder starts to wait for a new observation time (a new measurement activation).
17
PQVO3H Substation Automation
Resetting can be done via the local MMI (parameter Reset registers) or by
activating the digital input RESET.
Changing the system clock back during an active observation time lengthens the
active observation time by the amount of the time change. On the contrary, changing
the system clock forward shortens the active observation time. With this functionality,
the end date and time of the active observation time remain as set.
There are several parameters that can be set by the user. Setting parameters are
explained in detail in the corresponding sections, for example the use of harmonic
limits (percentiles) is explained in the section Statistics. In the following, two
examples on the use of the setting parameters:
The standard gives values for each individual harmonic voltage so that during each
period of one week, 95 % of the 10 minutes mean RMS values of each individual
harmonic voltage shall be less than or equal to those values. Also the THD shall be
less than or equal to 8 %.
Let us say that phase-to-earth voltage UL1 is under this survey and we want to verify
its quality according to EN 50160. The survey should start at 8:00 am on Monday the
3rd of May, 1999 and last until further notice. Let us also assume that we want to
know the cumulative distribution of the third harmonic values more precisely. The
setting values would be:
Settings:
18
Substation Automation PQVO3H
Statistic limits:
Cum. probability 95 %
Limit THD 8.0 %
Limit 2nd harm. 2.0 % Un
Limit 3rd harm. 5.0 % Un
Limit 4th harm. 1.0 % Un
Limit 5th harm. 6.0 % Un
Limit 6th harm. 0.5 % Un
Limit 7th harm. 5.0 % Un
Limit 8th harm. 0.5 % Un
Limit 9th harm. 1.5 % Un
Limit 10th harm. 0.5 % Un
Limit 11th harm. 3.5 % Un
Limit 12th harm. 0.5 % Un
Limit 13th harm. 3.0 % Un
Note: Check the sections Statistics recorder and Real time monitoring for the
effects of the harmonic limits (% Un).
Again the used reference values are those given by EN 50160 but now we want to
survey the harmonics only on Mondays, starting at 0:00 am on Monday the 12th of
April, 1999. Let us also assume that we want to check the overall worst case of phase-
to-earth voltages (statistics are collected using the values from the phase-to-earth
voltage with the highest THD at each moment). The third harmonic is once again
observed more closely than the others.
Settings:
19
PQVO3H Substation Automation
Statistic limits:
Cum. probability 95 %
Limit THD 8.0 %
Limit 2nd harm. 2.0 % Un
Limit 3rd harm. 5.0 % Un
Limit 4th harm. 1.0 % Un
Limit 5th harm. 6.0 % Un
Limit 6th harm. 0.5 % Un
Limit 7th harm. 5.0 % Un
Limit 8th harm. 0.5 % Un
Limit 9th harm. 1.5 % Un
Limit 10th harm. 0.5 % Un
Limit 11th harm. 3.5 % Un
Limit 12th harm. 0.5 % Un
Limit 13th harm. 3.0 % Un
Harmonic limits shall be chosen carefully. The lower the limit, the higher resolution is
used in percentile calculation and vice versa: if the limit is high, the resolution
becomes lower. However, if too low a limit is chosen, harmonic values may exceed
the limit too easily.
The difference between real time monitoring and statistics should be noticed. Once
triggered, the 3 sec and 10 min values are monitored continuously even if the statistics
are not calculated (observation time has ended). The statistics, on the other hand, are
calculated over the selected observation time (from 1 hour to 1 week). The Time to
end parameter gives an indication of the elapsing observation time. If the Time to
end parameter has a value other than 0 min, the statistics are calculated just then.
5HVHWWLQJ
If the statistics calculation is on and new settings are going to be made, PQVO3H
must be reset (RESET input or Reset registers parameter). Resetting the registers
stops the statistics calculations. If the statistics calculation has ended, reset is not
necessary. Alternatively, in case of the continuous or the periodic triggering mode,
new settings can be made without resetting the registers. Yet, the new settings become
valid after the elapsing observation time has ended and a new one has begun.
7ULJJHULQJ
New settings are not valid until they have been activated by triggering. The triggering
signal can be given via the Remote trigger parameter, the TRIGG input or the
trigger date (Trigger year, Trigger month, Trigger day and Trigger hour). In the single
mode, the settings are activated immediately after triggering. In the continuous and
the periodic triggering mode, the settings are activated at the preset triggering date
(year, month, day and hour); thus triggering via the Remote trigger parameter or the
TRIGG input is not possible.
20
Substation Automation PQVO3H
Next, four setting examples are given for activation of PQVO3H. In addition to the
settings given here, statistical limits and a harmonic for closer percentile calculation
can be set before activating the settings.
([DPSOH
([DPSOH
21
PQVO3H Substation Automation
([DPSOH
([DPSOH
Objective: Continue the statistic calculations with the current settings, but change the
monitored signal to UL3 for the next observation time.
Check: When elapsing observation time ends Monitoring phase voltage UL3
(Time to end is 0 min), the active
measuring mode should change to L3
Right after reaching 0 min, the Time to Statistics calculation
end parameter should change to show
the selected observation time in
minutes
Data from the previous observation Previous data stored in bank B
time should be in the recording bank B
(using UL1)
22
Substation Automation PQVO3H
)XQGDPHQWDOIUHTXHQF\
I1 = I 1
+DUPRQLFDPSOLWXGHVLQWKHIUHTXHQF\UDQJHDERYH)V
30% $1
where AN is the highest harmonic amplitude within the frequency range from 0 Hz to
Fs/2, where Fs is the used sampling frequency (if fN = 50 Hz, Fs = 2000 Hz and if
fN = 60 Hz, Fs = 2400 Hz).
$PSOLWXGHRIWKHIXQGDPHQWZDYH
0.98 1 8 1.18 1
5%8 P , if 8 P 3%8 1
10%8 P , if 8 P 3%8 1 .
23
PQVO3H Substation Automation
2.11 Resetting
The registers can be reset either via the RESET input, or over the serial bus or the
local MMI.
24
Substation Automation PQVO3H
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for PQVO3H is 513.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the relay
terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask 1
parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
25
PQVO3H Substation Automation
3.2.2 Settings
Parameter Code Values Unit Default Data Explanation
direction
Measuring mode V15 0...8 1) - 0 R/W Measuring mode
2)
Observation V16 0...9 - 9 R/W Selection of observation
time time
Trigger mode V17 0...2 3) - 0 R/W Selection of trigger mode
Trigger year V18 1980...2400 y 1980 R/W Triggering year
Trigger month V19 1...12 m 1 R/W Triggering month
Trigger day V20 1...31 d 1 R/W Triggering day
Trigger hour V21 0...23 h 1 R/W Triggering hour
Remote trigger V22 1=Trigger - 0 W Remote or local triggering
4)
Selected harm. V23 0...13 - 3 R/W Selected harmonic for
recordings
Act. meas.mode V25 0...8 1) - 0 R Active measuring mode
Event mask 1 V101 0...31 - 31 R/W Event mask 1 for event
transmission
Event mask 2 V103 0...31 - 31 R/W Event mask 2 for event
transmission
Event mask 3 V105 0...31 - 31 R/W Event mask 3 for event
transmission
Event mask 4 V107 0...31 - 31 R/W Event mask 4 for event
transmission
1)
Measuring mode 0=Not in use; 1=L1; 2=L2; 3=L3; 4=Worst phase; 5=L1-L2; 6=L2-L3; 7=L3-L1;
8=Worst main
26
Substation Automation PQVO3H
2)
Observation time 0=1 hour; 1=12 hours; 2=1 day; 3=2 days; 4=3 days; 5=4 days;
6=5 days; 7=6 days; 8=1 week
3)
Triggering mode 0=Single; 1=Continuous; 2=Periodic
4)
Selected harmonic 0=THD; 1=2nd harmonic; 2=3rd harmonic; 3=4th harmonic;
4=5th harmonic; 5=6th harmonic; 6=7th harmonic; 7=8th harmonic; 8=9th
harmonic; 9=10th harmonic; 10=11th harmonic; 11=12th harmonic; 12=13th
harmonic
27
PQVO3H Substation Automation
28
Substation Automation PQVO3H
29
PQVO3H Substation Automation
3.3.4.1 General
Recorded data includes two recording banks for statistics calculations and one bank
for recording individual harmonics at the time of the latest exceeding of a harmonic
limit. One statistics bank includes the data from the elapsing observation period and
the other bank similar information from the previous observation period.
5HFRUGHGGDWDIURPWKHODWHVWH[FHHGLQJ
Time stamp: indicates the start date and time for the last exceeding in THD or a
harmonic
Very short time (3 s) values of THD and harmonics when the exceeding of the
preset limit occurs
6WDWLVWLFVUHFRUGLQJV (x2, one set for the current observation period and one for the
previous period):
Period info: Start and end time stamps which indicate the start/end date and time
for the observation period
Maximum values of THD and harmonics: the highest average period (e.g. 10 min)
harmonic value during the observation period is recorded
Xth percentiles for THD and harmonics
For one selected harmonic: the 1st, 5th, 50th, 95th and 99th percentiles
30
Substation Automation PQVO3H
31
PQVO3H Substation Automation
32
Substation Automation PQVO3H
33
PQVO3H Substation Automation
34
Substation Automation PQVO3H
3.3.5 Events
Code Weighting Default Event reason Event state
coefficient mask
E0 1 1 PQVO3H:Harmonic limit Reset
E1 2 1 PQVO3H:Harmonic limit Exceeded
E2 4 1 PQVO3H:Cumulative limit Exceeded
E3 8 1 PQVO3H:Obs. period near end On
E4 16 1 PQVO3H:Obs. period ended On
35
PQVO3H Substation Automation
4 Technical Data
Configuration data Task execution interval (Relay Configuration Tool):
10 ms, at the rated frequency fn = 50 Hz
36
1MRS752336-MUM PQVO3H
Issued: 3/2000
Version: B/20.2.2002
Voltage Waveform Distortion
Data subject to change without notice
Measurement
Contents
1 Introduction .............................................................................................. 3
1.1 Features.............................................................................................. 3
1.2 Harmonic distortion ............................................................................. 3
1.3 Application........................................................................................... 4
1.4 Input description.................................................................................. 5
1.5 Output description ............................................................................... 5
2 Description of Operation.......................................................................... 6
2.1 Configuration....................................................................................... 6
2.1.1 Analogue channels..................................................................... 6
2.1.2 Digital inputs............................................................................... 7
2.1.3 Configuration error ..................................................................... 7
2.1.4 Configuration examples.............................................................. 7
2.2 Measuring mode ................................................................................. 8
2.3 Operation criteria................................................................................. 9
2.4 Observation times ............................................................................... 9
2.5 Real time monitoring ......................................................................... 10
2.6 Harmonic limit supervision................................................................. 11
2.7 Statistics............................................................................................ 12
2.7.1 Background.............................................................................. 12
2.7.2 Measurement settings.............................................................. 12
2.7.3 Input values.............................................................................. 13
2.7.4 Calculated results..................................................................... 14
2.7.4.1 Recording banks ........................................................... 14
2.7.4.2 Maximum values ........................................................... 14
2.7.4.3 Percentiles .................................................................... 15
2.7.4.4 Fixed percentiles for selected harmonic ........................ 17
2.7.5 Output CUM_HIGH .................................................................. 17
2.7.6 Indications and events.............................................................. 17
2.7.7 Exceptions ............................................................................... 17
2.8 Setting examples............................................................................... 18
2.9 Step-by-step guide for settings.......................................................... 20
2.10 Measurement accuracy ..................................................................... 23
PQVO3H Substation Automation
3.1 General..............................................................................................25
3.2 Control settings..................................................................................26
3.2.1 Statistic limits............................................................................26
3.2.2 Settings ....................................................................................26
3.3 Measurement values .........................................................................27
3.3.1 Inputs/ Outputs .........................................................................27
3.3.2 3 sec. values.............................................................................28
3.3.3 10 min. values ..........................................................................29
3.3.4 Recorded data ..........................................................................30
3.3.4.1 General..........................................................................30
3.3.4.2 A:Period info ..................................................................30
3.3.4.3 A:Maxim. values ............................................................31
3.3.4.4 A:Cumulat. prob.............................................................32
3.3.4.5 A:Selected harm. ...........................................................32
3.3.4.6 B:Period info ..................................................................33
3.3.4.7 B:Maxim. values ............................................................33
3.3.4.8 B:Cumulat. prob.............................................................34
3.3.4.9 B:Selected harm. ...........................................................34
3.3.4.10 Last exceeding...............................................................35
3.3.5 Events ......................................................................................35
4 Technical Data.........................................................................................36
2
Substation Automation PQVO3H
1 Introduction
1.1 Features
Total Harmonic Distortion measurement (THD)
Individual harmonics up to 13th:
short time average values for monitoring
statistics according to EN 50160 and IEC 61000-4-7
Measurement activation via:
MMI
preset time
serial communication line or a parameter
Measurement frequency:
once (single measurement, e.g. one day)
continuously
periodically (e.g. every Tuesday)
Measurement with:
conventional voltage transformers
voltage dividers
The harmonic voltage distortion in a power system depends on the current distortion
produced by nonlinear loads and on the impedance characteristics visible to each load.
The most sensitive equipment to voltage harmonics is usually data processing and
communication equipment; at the same time these devices are considerable current
harmonic sources. These devices are susceptible to misoperation caused by harmonic
distortion. For example, in computers and medical instruments considerably low
harmonic levels can result in malfunctions that can have serious consequences. In
rotating machinery, a major effect of harmonic voltages and currents is an increased
heating due to iron and copper losses at the harmonic frequencies.
3
PQVO3H Substation Automation
Power quality monitoring is an essential service utilities can provide for their
industrial and key customers. Not only can a monitoring system provide information
about system disturbances and their possible causes, it can also detect problem
conditions throughout the system before they cause customer complaints, equipment
malfunctions, and even equipment damage or failure. Power quality problems are not
limited to the utility side of the system. In fact, the majority of power quality
problems are localized within customer facilities. Thus, power quality monitoring is
not only an effective customer service strategy, but also a way to protect a utilitys
reputation for quality power and service.
At present, power utilities obtain power quality information via measurements done
with portable measuring devices. Enhanced energy meters can also produce some
power quality information. The function block PQVO3H provides a convenient
method for monitoring power quality by means of voltage waveform distortion:
monitoring can be done together with feeder protection and control using products
based on the RED 500 Platform. Function block PQVO3H produces statistical data
about harmonic distortion that is immediately comparable to standard definitions
about power of good quality. In addition, the function block provides short time
average and maximum values for THD and individual harmonics.
1.3 Application
This document specifies the functions of the function block PQVO3H for voltage
waveform distortion measurement used in products based on the RED 500 Platform.
The function block PQVO3H is used for measuring the harmonics and monitoring the
power quality in distribution networks. Power quality measurements carried out by
the function block PQVO3H follow the European Standard EN 50160. Data collection
and analysis is done according to EN 50160. Measuring principles for individual
harmonics and THD are adapted from the International standard IEC 61000-4-7. The
American standard IEEE Std 1159 is also partly supported.
)LJXUH )XQFWLRQEORFNV\PERORI3492+
4
Substation Automation PQVO3H
5
PQVO3H Substation Automation
2 Description of Operation
2.1 Configuration
Then again, if at least two of the phase-to-phase voltages and residual voltage are
connected, it is possible to carry out the distortion measurement for phase-to-earth
voltages. For example, if U0, U12 and U23 are connected, phase-to-earth voltages are
calculated as follows:
UL1 = 3 (U0 + 2*U12 + U23) /3
UL2 = 3 (U0 - U12 + U23) /3
UL3 = 3 (U0 - U12 - 2*U23) /3
Note: It is necessary that the voltages are connected to the inputs of the function block
in the correct order, cf. Input Description above and Configuration examples
below.
At the rated frequency of 50 Hz, the function block can only be configured to the task
interval of 10 ms (at 60 Hz 8.33 ms). If any other task interval than that of 10 ms is
used, only the Not in use mode is available.
6
Substation Automation PQVO3H
Note: Check the detailed description of the measuring modes below in the
corresponding section.
1. 2.
3. 4.
7
PQVO3H Substation Automation
Configurations in the figures above are all valid. In figure (1), phase-to-phase voltages
U12 and U23 and residual voltage U0 are connected in correct order. U12 is also
connected to the frequency reference input. This configuration allows all measuring
modes to be used except L3-L1 (cf. Measuring mode below). In figure (2), phase-
to-earth voltages UL2 and UL3 are connected in correct order. UL2 is also connected to
the frequency reference input. This configuration allows measuring modes L2, L3
and Worst phase. In figure (3), phase-to-earth voltages UL1 and UL3 are connected in
correct order. UL1 is used as frequency reference. This configuration allows measuring
modes L1, L3 and Worst phase. A basic configuration where all phase-to-phase
voltages and residual voltage are connected is presented in figure (4). This
configuration allows all measuring modes.
The measuring devices and signal types for analogue channels are selected and
configured in a special dialogue box of the Relay Configuration Tool. Digital inputs
are configured in the same programming environment (the number of selectable
analogue inputs, digital inputs and digital outputs depends on the hardware used).
When the measuring mode is set to Worst phase, the phase-to-earth voltage with the
highest THD is measured. Because the worst case can vary during the observation
time (first UL1, then UL2 and then again UL1), the statistics can originate from different
phases. The monitored value Measured input indicates the actual phase all the time
(phase-to-earth voltage with the highest THD).
Operation with the measuring mode Worst main is the same as with Worst phase.
Now the highest THD is tracked from the phase-to-phase voltages.
8
Substation Automation PQVO3H
1. Fundamental frequency:
I1 = 0.9 I 1 ...1.1 I 1
where I1 is the measured fundamental frequency and IN the network frequency.
2. Deviation of the fundamental frequency:
where GI1 is the difference between the measured maximum and minimum values of
the fundamental frequency within one second.
$1 70%8 1
Further, if the amplitude of the fundamental wave deviates rapidly, results will be
blocked out (possible transient).
If any of the criteria above is not fulfilled, PQVO3H will not show the values of the
harmonic amplitudes. In addition, these values are not included in statistics. These
operation criteria have been set in order to guarantee sufficient measurement
accuracy. Also the European Standard EN 50160 gives the maximum values for the
harmonic amplitudes in normal operation conditions.
PQVO3H monitors sliding average values from the time intervals of TVs (= 3 s) and
TSh (= 10 min), see the next section Real time monitoring. Other intervals are used
as observation times in PQVO3H. In addition to the standards recommendation,
intervals of 12 h and 2-6 days are also provided. T Vs and TSh values used for
monitoring are used in statistical analysis according to the IEC standard (see section
Statistics). Observation time can be selected via the parameter Observation time.
Available observation times are: 1 hour, 12 hours, 1 day, 2 days, 3 days, 4 days, 5
days, 6 days and 1 week.
9
PQVO3H Substation Automation
There are two sets of harmonic and THD values that can be monitored, namely T Vs
values (very short time, 3 s) and TSh values (short time, 10 min). Both TVs and TSh
values are sliding average values. The observation time corresponding to the time
interval TVs = 3 s consists of windows, within which the real time values are
calculated (effective measuring time), and gaps between those windows. Effective
measuring time windows are equally spaced within the observation time as the IEC
61000-4-7 standard recommends, see Figure 3.
TVs = 3 s M values
time
EffMeas
Real time values
)LJXUH (IIHFWLYHPHDVXULQJWLPHZLQGRZVGXULQJWKHREVHUYDWLRQWLPH
FRUUHVSRQGLQJWR79V V0 QXPEHURIVDPSOHV
TVs value of individual harmonic n is calculated in RMS sense using the real time
RMS values (Cn,k) of the nth harmonic:
0
FQ N
2
,
&Q9V = N=1
0
In TVs sliding average calculation the length of the slide is the length of the effective
measuring time. That is, when a new set of real time values is ready, the oldest set is
rejected from the TVs window and the new set is included (figure 4).
TVs = 3 s
time
SlidAver
)LJXUH 9HU\VKRUWWLPHYDOXHVDUHFDOFXODWHGXVLQJVOLGLQJZLQGRZV
Short time values (TSh = 10 min) are calculated from very short time values in RMS
sense. The length of the slide for short time average values is equal to T Vs = 3s.
10
Substation Automation PQVO3H
13
8
N =2
2
N
7+' =
81
where U1 is the RMS value of the fundamental component and Uk is the RMS value of
the kth harmonic.
The real time values can be read via the directories 3 sec. values and 10 min.
values.
The limits for harmonics and THD set by the user (refer to sections Setting
examples and Last exceeding) are compared continuously to the TVs sliding
average values. If the TVs value for any harmonic should exceed the corresponding
limit, the HAR_HIGH output will be activated (TRUE). Furthermore, an event will be
sent and an MMI indication given. HAR_HIGH will remain active until every
harmonic has dropped under the set limit. An example is given in Figure 5.
TVs value for 3rd
Max THD
THD:
HAR_HIGH:
time:
LimitSuperv
)LJXUH ([FHHGLQJRIDKDUPRQLFOLPLW2WKHUKDUPRQLFVDUHXQGHUWKHVHWOLPLWV
EXWWKHUGDQGWKKDUPRQLFVH[FHHGWKHLUOLPLWV7KH+$5B+,*+RXWSXW
UHPDLQVDFWLYHXQWLOERWKKDUPRQLFVKDYHGURSSHGXQGHUWKHLUOLPLWV
During every exceeding of a limit the THD will be observed and the whole harmonic
set (TVs values) will be stored (with a time stamp) at the instant the THD has its
highest value. The actual recording (i.e. the recorded data is readable) is done and a
reset event will be sent when HAR_HIGH is deactivated.
11
PQVO3H Substation Automation
2.7 Statistics
2.7.1 Background
Statistical calculations carried out by PQVO3H fulfil the requirements for statistical
analysis of harmonics declared in EN 50160. The recommendations for harmonics
measurement over the time intervals TL (1 h), TD (1 d) and TWk (1 week) declared in
IEC 61000-4-7 are also fulfilled. EN 50160 states the requirements for power quality
(concerning harmonics) as follows:
In the following text statistics recorder refers to the part of PQVO3H that carries out
the statistical calculations.
PQVO3H calculates the statistics only if it has been triggered. A triggering signal
always starts a new observation time.
There are several possibilities for triggering, i.e. activating, the statistics. The
statistics can be triggered via a local MMI by activating the Settings parameter
Remote trigger. The same parameter can be used for remote triggering, e.g.
activating the statistics via MicroSCADA in Network Control Center. The function
block can also be activated by an external digital input connected to the function
block input TRIGG. Setting this digital input from FALSE to TRUE activates the
statistics. Statistics can also be activated at some preset time and date. The user can
set the time of the activation via the Settings parameters Trigger year, Trigger
month, Trigger day and Trigger hour. Refer to section Setting examples for
further information.
Statistics are calculated over the elapsing observation time. This time period is set via
the Settings parameter Observation time. There are several possibilities from one
hour to one week.
The user can also select a preferable way of continuous statistics recordings over a
longer period of time (months, years). With the Settings parameter Trigger mode
the user can select how the next observation time will be activated after the former
one has finished. There are three possibilities: Single, Continuous and Periodic.
Active state of statistics recorder, i.e. calculation and storage of data, in each mode is
shown in Figure 6. In the trigger mode Single, data for one observation time is
calculated and stored. If another observation time is wanted, the statistics recorder
must be triggered again. In the trigger mode Continuous, the next observation time
starts automatically right after the former observation time has finished. In the
Periodic mode, there is a fixed time gap of one week between the beginning of the
former observation time and the beginning of the next observation time.
12
Substation Automation PQVO3H
Start of Statistics
Trigger mode: Single
recordings,
Observation time: 1 week
Trigger: Activated
Time
1 week
Time
Time
ObsTimes
Time
)LJXUH 3HULRGVIRUVWDWLVWLFVUHFRUGHUZLWKGLIIHUHQWWULJJHUPRGHVDQG
REVHUYDWLRQWLPHV
The statistics recorder uses the TVs (3 s) and TSh (10 min) values in calculations
depending on the length of the observation time. If the observation time is shorter
than one day, statistics recorder uses the TVs values. If the observation time is one day
or longer, the TSh values are used.
13
PQVO3H Substation Automation
Calculated results are stored in two recording banks. One bank includes data from the
previous observation time. The other bank includes data from the elapsing observation
time. Data in the active bank is updated continuously as long as the active observation
time is elapsing. When the active observation time ends, data is moved from the
active bank to the other bank.
Calculated data are stored in different directories. The directory Period info
includes general information about the observation time (start and end times of the
period, measuring mode); Maxim. values includes measured maximum values for
THD and individual harmonics, Cumulat. prob. (Cumulative probability) includes
percentiles (can be selected by the user) for THD and individual harmonics, and
Selected harm. (Selected harmonic) includes five fixed percentiles for one
selectable harmonic (or THD). Data from the active observation time are in
directories:
A:Period info
A:Maxim. values
A:Cumulat. prob.
A:Selected harm.
and data from the previous observation time:
B:Period info
B:Maxim. values
B:Cumulat. prob.
B:Selected harm.
The Time to end parameter in the A: Period info directory informs how long it is
to the end of the observation time. This parameter is useful when checking that
triggering has succeeded. If Time to end is 0 min, the statistics are not calculated. If
Time to end is other than 0 min, it indicates that statistics are calculated just then.
Maximum values for THD and individual harmonics are real maximum TVs (3 s) or
TSh (10 min) values during the observation time. These are picked from continuously
updated sliding average values. This enables recording of the true worst values. There
is no time dependency between recorded maximum values for THD and individual
harmonics. Hence, maximum values can be from several different time instants.
14
Substation Automation PQVO3H
2.7.4.3 Percentiles
Percentiles are values in a given set of observations that divide the data into 100 equal
parts. These values can be denoted by P1, P2,..., P99, where
1 % of the data falls below (is less than or equal to) P1; 2 % of the data falls
below P2; ... ; 99 % of the data falls below P99.
The purpose of percentiles is to find the harmonic amplitude so that during the
observation time 95 % of all the measured harmonic amplitudes are less than or equal
to the calculated percentile. As a default, 95th percentiles are calculated for each
harmonic, but also other percentiles can be calculated (parameter Cum. probability
in Statistic limits directory). The percentiles are found in the Selected harm.
directories.
Non-sliding and non-overlapping TVs (3 s) or TSh (10 min) average values are used in
percentile calculation depending on the length of the observation time. For example,
when the 10 min average values are used and the measurement is activated at
12:00:000, the first average used in the percentile calculation is measured during the
time interval 12:00:000 ... 12:10:000, the next one during the time interval 12:10:000
... 12:20:000 and so on.
All average values are divided into classifiers. The categorisation resolution, i.e. the
width of the classifiers, is dependent on the Limit p (set with Limit parameters in the
Statistic limits directory). Categorisation for each harmonic includes 16 classifiers
between values 0 and 2p. Hence, the classifier width a is
2 S
D=
1XP2I&ODVVLILHUV
For example, if the limit for the second harmonic is 10 %Un, the classifier width a is
1.25 %Un. If the average value U2,ave is
D < 8 2,DYH 2D ,
15
PQVO3H Substation Automation
Classifier 2
Limit p
2*p
10 30 30 ... 25 4 ... 1 0 0 0
0 a 2*a 3*a p-a p+a 2*p-3a 2*p-2a 2*p-a
Over
category
PQVOPercentileCalc1
a = 2*p/NumOfCategories
Value/%Un
)LJXUH &DWHJRULVDWLRQRIPHDVXUHGYDOXHVDQGFDOFXODWLRQRIDSHUFHQWLOH
Classifier 2
Limit p
2*p
10 30 30 ... 24 4 ... 2 0 0 0
0 a 2*a 3*a p-a p+a 2*p-3a 2*p-2a 2*p-a
Over
category
PQVOPercentileCalc2
a = 2*p/NumOfCategories
Value/%Un
)LJXUH &DWHJRULVDWLRQRIPHDVXUHGYDOXHVDQGFDOFXODWLRQRIDSHUFHQWLOH
Figure 8 presents a situation where 6 values are in classifiers above the limit p. Hence,
the 95th percentile is greater than the set limit p, which means that the
recommendation of the European Standard EN 50160 would not be met.
16
Substation Automation PQVO3H
For one harmonic or THD (selected by Selected harm. parameter in the Settings
directory) a more accurate cumulative distribution is gained by calculating five fixed
percentiles (1st, 5th, 50th, 95th and 99th). Calculation is carried out in a similar way
as for the one percentile with the exception that now 32 classifiers are used.
With five percentiles, more detailed information can be obtained from the cumulative
distribution of the selected harmonic, see Figure 9.
% Un
14
12
10
8
6
4
PQVOFixed perc
2 Time
1% 5% 50 % 95 % 99 %
)LJXUH VWWKWKWKDQGWKSHUFHQWLOHVIRUVHOHFWHGKDUPRQLF
If the calculated percentile is greater than the preset limit (i.e. more than 5 % of all
harmonic values are higher than the preset limit), an indication will be given: the
output CUM_HIGH will be activated, an event sent and an MMI indication given.
The indication declares which harmonic exceeded the limit.
During the elapsing observation time there will be indications about the ending of the
observation time. The first warning event will be given 5 minutes before the end of
the elapsing observation time; the second event at the end of the observation time.
2.7.7 Exceptions
Exceptional usage of the function block is taken into account. There are two major
exceptions: changing the settings during an elapsing observation time and changing
the system clock to a new time. The latter is valid e.g. with daylight saving time.
Changes to the setting parameters during an elapsing observation time are taken into
account when the elapsing observation time has ended. If the new settings must be
activated at once, the function block has to be reset. This means that all data from the
elapsing observation time in the statistics recorder will be cleared and the statistics
recorder starts to wait for a new observation time (a new measurement activation).
17
PQVO3H Substation Automation
Resetting can be done via the local MMI (parameter Reset registers) or by
activating the digital input RESET.
Changing the system clock back during an active observation time lengthens the
active observation time by the amount of the time change. On the contrary, changing
the system clock forward shortens the active observation time. With this functionality,
the end date and time of the active observation time remain as set.
There are several parameters that can be set by the user. Setting parameters are
explained in detail in the corresponding sections, for example the use of harmonic
limits (percentiles) is explained in the section Statistics. In the following, two
examples on the use of the setting parameters:
The standard gives values for each individual harmonic voltage so that during each
period of one week, 95 % of the 10 minutes mean RMS values of each individual
harmonic voltage shall be less than or equal to those values. Also the THD shall be
less than or equal to 8 %.
Let us say that phase-to-earth voltage UL1 is under this survey and we want to verify
its quality according to EN 50160. The survey should start at 8:00 am on Monday the
3rd of May, 1999 and last until further notice. Let us also assume that we want to
know the cumulative distribution of the third harmonic values more precisely. The
setting values would be:
Settings:
18
Substation Automation PQVO3H
Statistic limits:
Cum. probability 95 %
Limit THD 8.0 %
Limit 2nd harm. 2.0 % Un
Limit 3rd harm. 5.0 % Un
Limit 4th harm. 1.0 % Un
Limit 5th harm. 6.0 % Un
Limit 6th harm. 0.5 % Un
Limit 7th harm. 5.0 % Un
Limit 8th harm. 0.5 % Un
Limit 9th harm. 1.5 % Un
Limit 10th harm. 0.5 % Un
Limit 11th harm. 3.5 % Un
Limit 12th harm. 0.5 % Un
Limit 13th harm. 3.0 % Un
Note: Check the sections Statistics recorder and Real time monitoring for the
effects of the harmonic limits (% Un).
Again the used reference values are those given by EN 50160 but now we want to
survey the harmonics only on Mondays, starting at 0:00 am on Monday the 12th of
April, 1999. Let us also assume that we want to check the overall worst case of phase-
to-earth voltages (statistics are collected using the values from the phase-to-earth
voltage with the highest THD at each moment). The third harmonic is once again
observed more closely than the others.
Settings:
19
PQVO3H Substation Automation
Statistic limits:
Cum. probability 95 %
Limit THD 8.0 %
Limit 2nd harm. 2.0 % Un
Limit 3rd harm. 5.0 % Un
Limit 4th harm. 1.0 % Un
Limit 5th harm. 6.0 % Un
Limit 6th harm. 0.5 % Un
Limit 7th harm. 5.0 % Un
Limit 8th harm. 0.5 % Un
Limit 9th harm. 1.5 % Un
Limit 10th harm. 0.5 % Un
Limit 11th harm. 3.5 % Un
Limit 12th harm. 0.5 % Un
Limit 13th harm. 3.0 % Un
Harmonic limits shall be chosen carefully. The lower the limit, the higher resolution is
used in percentile calculation and vice versa: if the limit is high, the resolution
becomes lower. However, if too low a limit is chosen, harmonic values may exceed
the limit too easily.
The difference between real time monitoring and statistics should be noticed. Once
triggered, the 3 sec and 10 min values are monitored continuously even if the statistics
are not calculated (observation time has ended). The statistics, on the other hand, are
calculated over the selected observation time (from 1 hour to 1 week). The Time to
end parameter gives an indication of the elapsing observation time. If the Time to
end parameter has a value other than 0 min, the statistics are calculated just then.
5HVHWWLQJ
If the statistics calculation is on and new settings are going to be made, PQVO3H
must be reset (RESET input or Reset registers parameter). Resetting the registers
stops the statistics calculations. If the statistics calculation has ended, reset is not
necessary. Alternatively, in case of the continuous or the periodic triggering mode,
new settings can be made without resetting the registers. Yet, the new settings become
valid after the elapsing observation time has ended and a new one has begun.
7ULJJHULQJ
New settings are not valid until they have been activated by triggering. The triggering
signal can be given via the Remote trigger parameter, the TRIGG input or the
trigger date (Trigger year, Trigger month, Trigger day and Trigger hour). In the single
mode, the settings are activated immediately after triggering. In the continuous and
the periodic triggering mode, the settings are activated at the preset triggering date
(year, month, day and hour); thus triggering via the Remote trigger parameter or the
TRIGG input is not possible.
20
Substation Automation PQVO3H
Next, four setting examples are given for activation of PQVO3H. In addition to the
settings given here, statistical limits and a harmonic for closer percentile calculation
can be set before activating the settings.
([DPSOH
([DPSOH
21
PQVO3H Substation Automation
([DPSOH
([DPSOH
Objective: Continue the statistic calculations with the current settings, but change the
monitored signal to UL3 for the next observation time.
Check: When elapsing observation time ends Monitoring phase voltage UL3
(Time to end is 0 min), the active
measuring mode should change to L3
Right after reaching 0 min, the Time to Statistics calculation
end parameter should change to show
the selected observation time in
minutes
Data from the previous observation Previous data stored in bank B
time should be in the recording bank B
(using UL1)
22
Substation Automation PQVO3H
)XQGDPHQWDOIUHTXHQF\
I1 = I 1
+DUPRQLFDPSOLWXGHVLQWKHIUHTXHQF\UDQJHDERYH)V
30% $1
where AN is the highest harmonic amplitude within the frequency range from 0 Hz to
Fs/2, where Fs is the used sampling frequency (if fN = 50 Hz, Fs = 2000 Hz and if
fN = 60 Hz, Fs = 2400 Hz).
$PSOLWXGHRIWKHIXQGDPHQWZDYH
0.98 1 8 1.18 1
5%8 P , if 8 P 3%8 1
10%8 P , if 8 P 3%8 1 .
23
PQVO3H Substation Automation
2.11 Resetting
The registers can be reset either via the RESET input, or over the serial bus or the
local MMI.
24
Substation Automation PQVO3H
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for PQVO3H is 513.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the relay
terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask 1
parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
25
PQVO3H Substation Automation
3.2.2 Settings
Parameter Code Values Unit Default Data Explanation
direction
Measuring mode V15 0...8 1) - 0 R/W Measuring mode
2)
Observation V16 0...9 - 9 R/W Selection of observation
time time
Trigger mode V17 0...2 3) - 0 R/W Selection of trigger mode
Trigger year V18 1980...2400 y 1980 R/W Triggering year
Trigger month V19 1...12 m 1 R/W Triggering month
Trigger day V20 1...31 d 1 R/W Triggering day
Trigger hour V21 0...23 h 1 R/W Triggering hour
Remote trigger V22 1=Trigger - 0 W Remote or local triggering
4)
Selected harm. V23 0...13 - 3 R/W Selected harmonic for
recordings
Act. meas.mode V25 0...8 1) - 0 R Active measuring mode
Event mask 1 V101 0...31 - 31 R/W Event mask 1 for event
transmission
Event mask 2 V103 0...31 - 31 R/W Event mask 2 for event
transmission
Event mask 3 V105 0...31 - 31 R/W Event mask 3 for event
transmission
Event mask 4 V107 0...31 - 31 R/W Event mask 4 for event
transmission
1)
Measuring mode 0=Not in use; 1=L1; 2=L2; 3=L3; 4=Worst phase; 5=L1-L2; 6=L2-L3; 7=L3-L1;
8=Worst main
26
Substation Automation PQVO3H
2)
Observation time 0=1 hour; 1=12 hours; 2=1 day; 3=2 days; 4=3 days; 5=4 days;
6=5 days; 7=6 days; 8=1 week
3)
Triggering mode 0=Single; 1=Continuous; 2=Periodic
4)
Selected harmonic 0=THD; 1=2nd harmonic; 2=3rd harmonic; 3=4th harmonic;
4=5th harmonic; 5=6th harmonic; 6=7th harmonic; 7=8th harmonic; 8=9th
harmonic; 9=10th harmonic; 10=11th harmonic; 11=12th harmonic; 12=13th
harmonic
27
PQVO3H Substation Automation
28
Substation Automation PQVO3H
29
PQVO3H Substation Automation
3.3.4.1 General
Recorded data includes two recording banks for statistics calculations and one bank
for recording individual harmonics at the time of the latest exceeding of a harmonic
limit. One statistics bank includes the data from the elapsing observation period and
the other bank similar information from the previous observation period.
5HFRUGHGGDWDIURPWKHODWHVWH[FHHGLQJ
Time stamp: indicates the start date and time for the last exceeding in THD or a
harmonic
Very short time (3 s) values of THD and harmonics when the exceeding of the
preset limit occurs
6WDWLVWLFVUHFRUGLQJV (x2, one set for the current observation period and one for the
previous period):
Period info: Start and end time stamps which indicate the start/end date and time
for the observation period
Maximum values of THD and harmonics: the highest average period (e.g. 10 min)
harmonic value during the observation period is recorded
Xth percentiles for THD and harmonics
For one selected harmonic: the 1st, 5th, 50th, 95th and 99th percentiles
30
Substation Automation PQVO3H
31
PQVO3H Substation Automation
32
Substation Automation PQVO3H
33
PQVO3H Substation Automation
34
Substation Automation PQVO3H
3.3.5 Events
Code Weighting Default Event reason Event state
coefficient mask
E0 1 1 PQVO3H:Harmonic limit Reset
E1 2 1 PQVO3H:Harmonic limit Exceeded
E2 4 1 PQVO3H:Cumulative limit Exceeded
E3 8 1 PQVO3H:Obs. period near end On
E4 16 1 PQVO3H:Obs. period ended On
35
PQVO3H Substation Automation
4 Technical Data
Configuration data Task execution interval (Relay Configuration Tool):
10 ms, at the rated frequency fn = 50 Hz
36
1MRS100055 RE_ 5_ _
Issued: 3/2000
Version: A
Phase Reversal Protection
Data subject to change without notice (PREV3)
Contents
1 Introduction ....................................................................................2
1.1 Features.......................................................................................... 2
1.2 Application ...................................................................................... 2
1.3 Input description.............................................................................. 3
1.4 Output description ........................................................................... 3
2 Description of Operation...............................................................4
2.1 Configuration................................................................................... 4
2.1.1 Input and output configuration ............................................. 4
2.1.2 Setting the rated current of the protected unit ...................... 5
2.2 Measuring mode ............................................................................. 5
2.3 Operation criteria............................................................................. 5
2.4 Setting groups................................................................................. 8
2.5 Test mode ....................................................................................... 8
2.6 Resetting......................................................................................... 9
4 Technical Data..............................................................................17
RE_ 5_ _ PREV3 ABB Automation
1 Introduction
1.1 Features
Phase reversal protection for motors
Definite-time (DT) operation based on phase angle difference
Current measurement with conventional current transformers or Rogowski coils
1.2 Application
This document specifies the functions of the phase reversal protection function block
PREV3 used in products based on the RED 500 Platform.
The function block PREV3 is designed for the phase reversal protection of motors.
3I 3I
)LJXUH 3URWHFWLRQGLDJUDPV\PERORI35(9)RU,(&V\PEROVXVHGLQVLQJOH
OLQHGLDJUDPVUHIHUWRWKHPDQXDO7HFKQLFDO'HVFULSWLRQVRI)XQFWLRQV
,QWURGXFWLRQ056080
)LJXUH )XQFWLRQEORFNV\PERORI35(9
2
ABB Automation PREV3 RE_ 5_ _
3
RE_ 5_ _ PREV3 ABB Automation
2 Description of Operation
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The phase currents IL1, IL2 and IL3 are
connected to the corresponding IL1, IL2 and IL3 inputs of the function block. If the
operation mode 2-phase is selected, the configuration possibilities are those shown
in Figure 3. In case of the operation mode 3-phase, the configuration is as presented
in Figure 4.
Digital inputs are connected to the boolean inputs of the function block and in the
same way, the outputs of the function block are connected to the output signals.
)LJXUH 3RVVLEOHDQDORJXHFKDQQHOFRQQHFWLRQVLQFDVHRIWZRSKDVHRSHUDWLRQ
ZKHUHQHXWUDOFXUUHQWLVDVVXPHGWREHLH,/,/,/
)LJXUH $QDORJXHFKDQQHOFRQQHFWLRQLQFDVHRIWKUHHSKDVHRSHUDWLRQ
Note! Using the signals IL1b, IL2b and IL3b instead of IL1, IL2 and IL3 is also
possible, but mixing these two signal sets is not allowed.
4
ABB Automation PREV3 RE_ 5_ _
A separate scaling factor can be set for each analogue channel. The factors enable
differences between the ratings of protected unit (generator, transformer, motor, etc.)
and those of the measuring device (CTs, VTs, etc.). The setting value 1.00 means that
the rated value of the protected unit is exactly the same as that of the measuring
device. For more information refer to the Technical Reference Manual for REM 54_.
The operation of PREV3 is based on phase angle differences between the currents IL1,
IL2 and IL3. Measured phase angle difference between two phase is set to 0 if current is
below 0.05 x In at least in other phase. Moreover, that forced value of phase angle
difference cant cause phase reversal operation even if it is in operating range when 3-
phase operation mode is used. The setting parameters with their features are described
below.
Operation mode:
Not in use:
PREV3 is switched off.
2-phase:
Operation is based on definite time and the value of the neutral current is assumed to
be 0 i.e. IL1+IL2+IL3=0. The function block operates if the phase difference between
two phases is -90...-150 and the expected rotation direction is forward. If the reverse
rotation direction is selected, the operating range is 90...150.
5
RE_ 5_ _ PREV3 ABB Automation
([DPSOH
Phases L1 and L2 are used for protection. The rotation direction selected with the
parameter Rotation dir. is forward and thus the operating range is -90...-150. In
Figure 5 (a), the actual rotation direction is forward and the phase difference between
currents IL1 and IL2 is 120. In figure 5 (b), the function block operates because the
actual direction is reverse and the phase difference is -120.
L1 L1
(a) (b)
(L1-L2) -120.0
-150.0
-90.0
120.0 (L1-L2)
L3 L2 L2 L3
Operating range
)LJXUH ([DPSOHRIWZRSKDVHRSHUDWLRQ
3-phase:
Operation is based on definite time. The function block operates if the phase
difference between two phases is 2...-122 and the expected rotation direction is
forward. If the reverse rotation direction is selected, the operating range is -2...122.
If only two currents are above the blocking current value 0.05 x In, operation of the 3-
phase mode is similar to the 2-phase mode.
([DPSOH
All three phases are used for protection. The selected rotation direction is forward and
thus the operating range is 2...-122. In Figure 6 (a), the actual rotation direction is
forward and the phase differences are 120. In Figure 6 (b), the CT polarity of the
phase L3 has reversed. The function block operates because two phase difference
values are -60.
L1 L1
(a) (b)
-60.0 (L3-L1)
L3
(L1-L2)
(L3-L1) 120.0 120.0 (L1-L2) 120.0
-60.0 (L2-L3)
120.0
L2 Operating range L2
L3 (L2-L3)
)LJXUH ([DPSOHIRUWKUHHSKDVHRSHUDWLRQ
6
ABB Automation PREV3 RE_ 5_ _
Operate time:
When the function block starts, the START signal is set to TRUE. Should the phase
reversal situation exceed the set definite operate time, the function block operates.
The delay of the heavy-duty output relay is included in the total operate time. When
the function block operates, the TRIP signal is set to TRUE. In Figure , the input
signal IN of the DT timer is TRUE when the selected operation criterion is true and
FALSE when the criterion is false.
The DT timer is allowed to run only if the blocking signal BLOCK is inactive i.e. its
value is FALSE. When the blocking signal becomes active i.e. its value turns to
TRUE, the timer will be stopped (frozen).
Rotation dir. :
Forward:
Expected phase order is L1,L2,L3 and motor rotation direction forward.
L1 L1 L2 L3 L1 L2 L3
120.0
L3 (L2-L3) L2
)LJXUH 3KDVHDQJOHGLIIHUHQFHVZKHQWKHVLWXDWLRQLVV\PPHWULFDQGWKHURWDWLRQ
GLUHFWLRQLVIRUZDUG
7
RE_ 5_ _ PREV3 ABB Automation
Reverse:
Expected phase order is L1,L3,L2 and motor rotation direction reverse.
L1 L1 L3 L2 L1 L3 L2
-120.0
L2 (L2-L3) L3
)LJXUH 3KDVHDQJOHGLIIHUHQFHVZKHQWKHVLWXDWLRQLVV\PPHWULFDQGWKHURWDWLRQ
GLUHFWLRQLVUHYHUVH
If expected rotation direction is wanted to change during motor operation sequency, it
is recommended to select different rotation direction for setting parameter Rotation
dir. in Setting group1 and Setting group 2. Active setting group and likewise
active setting for Expected rot.can now be selected via GROUP input (see also
section Setting groups).
Two different groups of setting values, group1 and group 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
8
ABB Automation PREV3 RE_ 5_ _
2.6 Resetting
The TRIP output signal and the registers can be reset either via the RESET input, or
over the serial bus or the local MMI.
The operation indicators, latched alarm or trip signal and recorded data can be reset as
follows:
Operation Latched Recorded
indicators alarm or data
trip signal
1)
RESET input of the function block X X
1)
Parameter F055V013 for PREV3 X X
2)
General parameter F001V011 X
2)
General parameter F001V012 X X
2)
General parameter F001V013 X X X
2)
Push-button C X
2)
Push-buttons C + E (2 s) X X
2)
Push-buttons C + E (5 s) X X X
1)
Resets the latched alarm or trip signal and recorded data of the particular function block.
2)
Affects all function blocks.
9
RE_ 5_ _ PREV3 ABB Automation
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for PREV3 is 55.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
10
ABB Automation PREV3 RE_ 5_ _
11
RE_ 5_ _ PREV3 ABB Automation
12
ABB Automation PREV3 RE_ 5_ _
3.3.3.1 General
The information required for later fault analysis is recorded when the function block
starts or trips, or when the recording function is triggered via an external triggering
input.
The data of three last operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
The time stamp indicates the rising edge of the START, TRIP or TRIGG signal.
13
RE_ 5_ _ PREV3 ABB Automation
The status data of the BLOCK input (Active or Not active) and the Active group
parameter are recorded at the moment of triggering. The Active group parameter
indicates the setting group valid for the recorded data.
3.3.3.4 Duration
If the function block alarms or trips, the current values and phase difference values
are updated at the moment of tripping, i.e. on the rising edge of the TRIP signal. For
external triggering, the current values and phase difference values are updated at the
moment of triggering, i.e. on the rising edge of the input signal TRIGG. If the
function block starts but does not trip, the current and phase difference values
captured one fundamental cycle (20 ms at rated frequency 50 Hz) after the beginning
of the start situation are recorded. So the values of the phase currents IL1, IL2 and IL3
and phase angle difference values always originate from the same moment. The
current values are recorded as multiples of the rated current In and the phase
difference values are recorded in degrees.
3.3.3.6 Priority
14
ABB Automation PREV3 RE_ 5_ _
15
RE_ 5_ _ PREV3 ABB Automation
3.3.4 Events
Code Weighting Default mask Event reason Event state
coefficient
E0 1 1 START signal from PREV3 Reset
E1 2 1 START signal from PREV3 Activated
E2 4 1 TRIP signal from PREV3 Reset
E3 8 1 TRIP signal from PREV3 Activated
E4 16 0 BLOCK signal of PREV3 Reset
E5 32 0 BLOCK signal of PREV3 Activated
E6 64 0 Test mode of PREV3 Off
E7 128 0 Test mode of PREV3 On
16
ABB Automation PREV3 RE_ 5_ _
4 Technical Data
Operation accuracies Depends on the frequency of the current measured:
f/fn = 0.951.05: phase angle difference 2
current 0.01 x In
Start time Start time when the phase order is wrong
and the injected currents = 1.0 x In:
f/fn = 0.951.05: internal time < 72 ms
total time < 80 ms 1)
Reset time2) 401000 ms
(depends on the minimum pulse width set for the TRIP output)
Reset ratio Reset value for the phase angle difference: 3
Retardation time Total retardation time when the correct phase order is
restored < 60 ms 2)
Operate time accuracy Depends on the frequency of the current measured:
f/fn = 0.951.05: 2% of set value or 20 ms 2)
Frequency dependence of Suppression of harmonics:
the settings and operate -50 dB at f = n x fn, where n = 2, 3, 4, 5,
times (see above)
Configuration data Task execution interval (Relay Configuration Tool): 10 ms
at the rated frequency fn = 50 Hz
1)
Includes the delay of the signal relay
2)
Includes the delay of the heavy-duty output relay
17
1MRS 752323-MUM PREV3
Issued: 3/2000
Version: B/25.1.2002
Phase Reversal Protection
Data subject to change without notice
Contents
1 Introduction ....................................................................................2
1.1 Features.......................................................................................... 2
1.2 Application ...................................................................................... 2
1.3 Input description.............................................................................. 3
1.4 Output description ........................................................................... 3
2 Description of Operation...............................................................4
2.1 Configuration................................................................................... 4
2.1.1 Input and output configuration ............................................. 4
2.1.2 Setting the rated current of the protected unit ...................... 5
2.2 Measuring mode ............................................................................. 5
2.3 Operation criteria............................................................................. 5
2.4 Setting groups................................................................................. 8
2.5 Test mode ....................................................................................... 8
2.6 Resetting......................................................................................... 9
4 Technical Data..............................................................................17
PREV3 Substation Automation
1 Introduction
1.1 Features
Phase reversal protection for motors
Definite-time (DT) operation based on phase angle difference
Current measurement with conventional current transformers or Rogowski coils
1.2 Application
This document specifies the functions of the phase reversal protection function block
PREV3 used in products based on the RED 500 Platform.
The function block PREV3 is designed for the phase reversal protection of motors.
3I 3I
)LJXUH 3URWHFWLRQGLDJUDPV\PERORI35(9)RU,(&V\PEROVXVHGLQVLQJOH
OLQHGLDJUDPVUHIHUWRWKHPDQXDO7HFKQLFDO'HVFULSWLRQVRI)XQFWLRQV
,QWURGXFWLRQ056080
)LJXUH )XQFWLRQEORFNV\PERORI35(9
2
Substation Automation PREV3
3
PREV3 Substation Automation
2 Description of Operation
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The phase currents IL1, IL2 and IL3 are
connected to the corresponding IL1, IL2 and IL3 inputs of the function block. If the
operation mode 2-phase is selected, the configuration possibilities are those shown
in Figure 3. In case of the operation mode 3-phase, the configuration is as presented
in Figure 4.
Digital inputs are connected to the boolean inputs of the function block and in the
same way, the outputs of the function block are connected to the output signals.
)LJXUH 3RVVLEOHDQDORJXHFKDQQHOFRQQHFWLRQVLQFDVHRIWZRSKDVHRSHUDWLRQ
ZKHUHQHXWUDOFXUUHQWLVDVVXPHGWREHLH,/,/,/
)LJXUH $QDORJXHFKDQQHOFRQQHFWLRQLQFDVHRIWKUHHSKDVHRSHUDWLRQ
Note! Using the signals IL1b, IL2b and IL3b instead of IL1, IL2 and IL3 is also
possible, but mixing these two signal sets is not allowed.
4
Substation Automation PREV3
A separate scaling factor can be set for each analogue channel. The factors enable
differences between the ratings of protected unit (generator, transformer, motor, etc.)
and those of the measuring device (CTs, VTs, etc.). The setting value 1.00 means that
the rated value of the protected unit is exactly the same as that of the measuring
device. For more information refer to the Technical Reference Manual for REM 54_.
The operation of PREV3 is based on phase angle differences between the currents IL1,
IL2 and IL3. Measured phase angle difference between two phase is set to 0 if current is
below 0.05 x In at least in other phase. Moreover, that forced value of phase angle
difference cant cause phase reversal operation even if it is in operating range when 3-
phase operation mode is used. The setting parameters with their features are described
below.
Operation mode:
Not in use:
PREV3 is switched off.
2-phase:
Operation is based on definite time and the value of the neutral current is assumed to
be 0 i.e. IL1+IL2+IL3=0. The function block operates if the phase difference between
two phases is -90...-150 and the expected rotation direction is forward. If the reverse
rotation direction is selected, the operating range is 90...150.
5
PREV3 Substation Automation
([DPSOH
Phases L1 and L2 are used for protection. The rotation direction selected with the
parameter Rotation dir. is forward and thus the operating range is -90...-150. In
Figure 5 (a), the actual rotation direction is forward and the phase difference between
currents IL1 and IL2 is 120. In figure 5 (b), the function block operates because the
actual direction is reverse and the phase difference is -120.
L1 L1
(a) (b)
(L1-L2) -120.0
-150.0
-90.0
120.0 (L1-L2)
L3 L2 L2 L3
Operating range
)LJXUH ([DPSOHRIWZRSKDVHRSHUDWLRQ
3-phase:
Operation is based on definite time. The function block operates if the phase
difference between two phases is 2...-122 and the expected rotation direction is
forward. If the reverse rotation direction is selected, the operating range is -2...122.
If only two currents are above the blocking current value 0.05 x In, operation of the 3-
phase mode is similar to the 2-phase mode.
([DPSOH
All three phases are used for protection. The selected rotation direction is forward and
thus the operating range is 2...-122. In Figure 6 (a), the actual rotation direction is
forward and the phase differences are 120. In Figure 6 (b), the CT polarity of the
phase L3 has reversed. The function block operates because two phase difference
values are -60.
L1 L1
(a) (b)
-60.0 (L3-L1)
L3
(L1-L2)
(L3-L1) 120.0 120.0 (L1-L2) 120.0
-60.0 (L2-L3)
120.0
L2 Operating range L2
L3 (L2-L3)
)LJXUH ([DPSOHIRUWKUHHSKDVHRSHUDWLRQ
6
Substation Automation PREV3
Operate time:
When the function block starts, the START signal is set to TRUE. Should the phase
reversal situation exceed the set definite operate time, the function block operates.
The delay of the heavy-duty output relay is included in the total operate time. When
the function block operates, the TRIP signal is set to TRUE. In Figure , the input
signal IN of the DT timer is TRUE when the selected operation criterion is true and
FALSE when the criterion is false.
The DT timer is allowed to run only if the blocking signal BLOCK is inactive i.e. its
value is FALSE. When the blocking signal becomes active i.e. its value turns to
TRUE, the timer will be stopped (frozen).
Rotation dir. :
Forward:
Expected phase order is L1,L2,L3 and motor rotation direction forward.
L1 L1 L2 L3 L1 L2 L3
120.0
L3 (L2-L3) L2
)LJXUH 3KDVHDQJOHGLIIHUHQFHVZKHQWKHVLWXDWLRQLVV\PPHWULFDQGWKHURWDWLRQ
GLUHFWLRQLVIRUZDUG
7
PREV3 Substation Automation
Reverse:
Expected phase order is L1,L3,L2 and motor rotation direction reverse.
L1 L1 L3 L2 L1 L3 L2
-120.0
L2 (L2-L3) L3
)LJXUH 3KDVHDQJOHGLIIHUHQFHVZKHQWKHVLWXDWLRQLVV\PPHWULFDQGWKHURWDWLRQ
GLUHFWLRQLVUHYHUVH
If expected rotation direction is wanted to change during motor operation sequency, it
is recommended to select different rotation direction for setting parameter Rotation
dir. in Setting group1 and Setting group 2. Active setting group and likewise
active setting for Expected rot.can now be selected via GROUP input (see also
section Setting groups).
Two different groups of setting values, group1 and group 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
8
Substation Automation PREV3
2.6 Resetting
The TRIP output signal and the registers can be reset either via the RESET input, or
over the serial bus or the local MMI.
The operation indicators, latched alarm or trip signal and recorded data can be reset as
follows:
Operation Latched Recorded
indicators alarm or data
trip signal
1)
RESET input of the function block X X
1)
Parameter F055V013 for PREV3 X X
2)
General parameter F001V011 X
2)
General parameter F001V012 X X
2)
General parameter F001V013 X X X
2)
Push-button C X
2)
Push-buttons C + E (2 s) X X
2)
Push-buttons C + E (5 s) X X X
1)
Resets the latched alarm or trip signal and recorded data of the particular function block.
2)
Affects all function blocks.
9
PREV3 Substation Automation
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for PREV3 is 55.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
10
Substation Automation PREV3
11
PREV3 Substation Automation
12
Substation Automation PREV3
3.3.3.1 General
The information required for later fault analysis is recorded when the function block
starts or trips, or when the recording function is triggered via an external triggering
input.
The data of three last operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
The time stamp indicates the rising edge of the START, TRIP or TRIGG signal.
13
PREV3 Substation Automation
The status data of the BLOCK input (Active or Not active) and the Active group
parameter are recorded at the moment of triggering. The Active group parameter
indicates the setting group valid for the recorded data.
3.3.3.4 Duration
If the function block alarms or trips, the current values and phase difference values
are updated at the moment of tripping, i.e. on the rising edge of the TRIP signal. For
external triggering, the current values and phase difference values are updated at the
moment of triggering, i.e. on the rising edge of the input signal TRIGG. If the
function block starts but does not trip, the current and phase difference values
captured one fundamental cycle (20 ms at rated frequency 50 Hz) after the beginning
of the start situation are recorded. So the values of the phase currents IL1, IL2 and IL3
and phase angle difference values always originate from the same moment. The
current values are recorded as multiples of the rated current In and the phase
difference values are recorded in degrees.
3.3.3.6 Priority
14
Substation Automation PREV3
15
PREV3 Substation Automation
3.3.4 Events
Code Weighting Default mask Event reason Event state
coefficient
E0 1 1 START signal from PREV3 Reset
E1 2 1 START signal from PREV3 Activated
E2 4 1 TRIP signal from PREV3 Reset
E3 8 1 TRIP signal from PREV3 Activated
E4 16 0 BLOCK signal of PREV3 Reset
E5 32 0 BLOCK signal of PREV3 Activated
E6 64 0 Test mode of PREV3 Off
E7 128 0 Test mode of PREV3 On
16
Substation Automation PREV3
4 Technical Data
Operation accuracies Depends on the frequency of the current measured:
f/fn = 0.951.05: phase angle difference 2
current 0.01 x In
Start time Start time when the phase order is wrong
and the injected currents = 1.0 x In:
f/fn = 0.951.05: internal time < 72 ms
total time < 80 ms 1)
Reset time2) 401000 ms
(depends on the minimum pulse width set for the TRIP output)
Reset ratio Reset value for the phase angle difference: 3
Retardation time Total retardation time when the correct phase order is
restored < 60 ms 2)
Operate time accuracy Depends on the frequency of the current measured:
f/fn = 0.951.05: 2% of set value or 20 ms 2)
Frequency dependence of Suppression of harmonics:
the settings and operate -50 dB at f = n x fn, where n = 2, 3, 4, 5,
times (see above)
Configuration data Task execution interval (Relay Configuration Tool): 10 ms
at the rated frequency fn = 50 Hz
1)
Includes the delay of the signal relay
2)
Includes the delay of the heavy-duty output relay
17
1MRS100112 (Stage 1) RE_5_ _
1MRS100113 (Stage 2) Phase-Sequence Voltage
Issued: 3/2000
Version: A Protection
Data subject to change without notice Stage1 (PSV3St1)
Stage2 (PSV3St2)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 4
1.4 Output description ............................................................................... 4
2. Description of Operation.......................................................................... 5
2.1 Configuration....................................................................................... 5
2.2 Configuration error checking ............................................................... 6
2.3 Measuring mode ................................................................................. 7
2.4 Operation criteria................................................................................. 7
2.5 Setting groups ..................................................................................... 9
2.6 Test mode ........................................................................................... 9
2.7 START and TRIP outputs.................................................................... 9
2.8 Resetting........................................................................................... 10
3. Application of U1< Operation ................................................................ 11
3.1 Setting the U1< operation.................................................................. 12
3.2 Setting examples for U1< operation .................................................. 13
4. Application of U2> Operation ................................................................ 19
1. Introduction
1.1 Features
1.2 Application
This document specifies the functions of the phase-sequence voltage function blocks
PSV3St1 and PSV3St2 used in products based on the RED 500 Platform. The two
function blocks are identical in operation.
against reversal of phase sequence, both with forward and reverse rotation
direction.
2
ABB Automation PSV3St1 RE_5_ _
PSV3St2
U1<
U2>
U1>
)LJXUH 3URWHFWLRQGLDJUDPV\PERORI3696WB)RU,(&V\PEROVXVHGLQVLQJOH
OLQHGLDJUDPVUHIHUWRWKHPDQXDO7HFKQLFDO'HVFULSWLRQVRI)XQFWLRQV
,QWURGXFWLRQ056080
)LJXUH )XQFWLRQEORFNV\PEROVRI3696WDQG3696W
3
RE_5_ _ PSV3St1 ABB Automation
PSV3St2
4
ABB Automation PSV3St1 RE_5_ _
PSV3St2
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. In case of phase-to-earth voltages, the
voltages UL1, UL2, and UL3 are connected to the corresponding UL1_U12, UL2_U23
and UL3_U31 inputs of the function block. In the same way, if the phase-to-phase
voltages are used, they are connected to the corresponding inputs of the function
block. Already two phase-to-phase voltages allow a correct calculation of positive-
and negative-sequence components. So, if all three phase-to-phase voltages are
connected, the two with the lowest amplitude are used in calculation to assure the best
possible accuracy. Examples of the connections are shown in Figure 3 below.
)LJXUH &RQQHFWLRQSRVVLELOLWLHVZKHQRQO\WZRSKDVHWRSKDVHYROWDJHVDUHXVHG
It is also possible to use only two phase-to-earth voltages. In this case the residual
voltage U0 is assumed to be zero and the analogue channels are connected to the first
two voltage inputs and the third input is left unconnected. Examples of the
connections are shown in Figure 4 below. All possible input combinations are
presented in Table 1 below.
5
RE_5_ _ PSV3St1 ABB Automation
PSV3St2
)LJXUH &RQQHFWLRQSRVVLELOLWLHVZKHQRQO\WZRSKDVHWRHDUWKYROWDJHVDUHXVHG
Digital inputs are connected to the boolean inputs of the function block and, in the
same way, the outputs of the function block are connected to the output signals.
The ROT_DIR input can be used to protect machines that can be driven both in
forward and in reverse directions. If the status information about the machine rotation
direction is available, it can be connected to the ROT_DIR input of the function
block. In this case the control setting parameter Dir. Selection must be set to value
Input ROT_DIR, which means that the measured negative- and positive-sequence
voltages and the operation of the function block are automatically adapted to the
machine rotation direction.
When the relay is started, the function block checks that at least two voltages are
connected to the first two analogue inputs. If two voltages are not connected, the ERR
output is activated and an event is generated. Activation of the ERR output also
automatically sets the function block to the Not in use mode, which means that it
cannot operate.
6
ABB Automation PSV3St1 RE_5_ _
PSV3St2
When three phase-to-earth voltages are used, the sequence voltages are calculated as
follows:
positive-sequence voltage
1
U1 = U + aU S + a 2 U T (1)
3 R
negative-sequence voltage
1
U2 = U R + a 2 U S + aU T (2)
3
where UR, US and UT are phase-to-earth voltages and a is a phase-shifting operator
(a = 1120 and a2 = 1240).
positive-sequence voltage
1
U1 = U RS a 2 U ST (3)
3
negative-sequence voltage
1
U2 = U aU ST (4)
3 RS
where URS and UST are phase-to-phase voltages and a is a phase-shifting operator
(a = 1120 and a2 = 1240).
The function block includes three independent operations: one for negative-sequence
overvoltage, one for positive-sequence undervoltage and one for positive-sequence
overvoltage. The operation mode can be selected via the setting parameter Operation
mode that allows selecting just one operation to be active at a time, all three
operations to be active simultaneously, or any combination of two operations to be
active at a time. All the possible operation modes are presented in Table 2 below.
7
RE_5_ _ PSV3St1 ABB Automation
PSV3St2
If the U2> operation is in use, the function block starts when the measured negative-
sequence voltage exceeds the set start voltage value. Should the overvoltage situation
last the preset operate time, the function block trips.
If the U1< operation is in use, the function block starts when the measured positive-
sequence voltage falls below the set start voltage value. Should the undervoltage
situation last the preset operate time, the function block trips.
If the U1> operation is in use, the function block starts when the measured positive-
sequence voltage exceeds the set start voltage value. Should the overvoltage situation
last the preset operate time, the function block trips.
The delay of the heavy-duty output relay is included in preset operate times.
If any of the operations starts or trips, an event indicating the situation is generated.
An indication is also seen on the MMI of the relay. All the operations have their own
start and trip events and also the indication on the MMI includes the information of
the operation which has started or tripped.
The DT timer is allowed to run only if the input signal BLOCK is inactive. If the
BLOCK signal is activated, the timer will be frozen. Moreover, the TRIP signal
cannot be activated when the BLOCK signal is active.
8
ABB Automation PSV3St1 RE_5_ _
PSV3St2
Two different groups of setting values, group 1 and group 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
The START and TRIP digital outputs of the function block can be activated with
separate control parameters for each output either locally via the MMI or externally
via the serial communication. When an output is activated with the test parameter, an
event indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The output signal START is always pulse-shaped. The minimum pulse width of the
corresponding output signal is set via a separate parameter on the MMI or on serial
communication. If the start situation is longer than the set pulse width, the START
signal remains active until the start situation is over. The output signal TRIP may be
non-latching or latching. When the latching mode has been selected, the TRIP signal
remains active until the output is reset even if the operation criteria have reset. When
the non-latching mode has been selected, the TRIP signal remains active until the
operation criteria have reset and the time determined by the control parameter Trip
pulse has elapsed.
9
RE_5_ _ PSV3St1 ABB Automation
PSV3St2
2.8 Resetting
The TRIP output signal and the registers can be reset via the RESET input, or over the
serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
10
ABB Automation PSV3St1 RE_5_ _
PSV3St2
The lower the three-phase symmetrical voltage of the network is, the higher is the
probability that the generator will lose synchronism. The positive phase-sequence
voltage gives the three-phase symmetrical component of voltage even during
unsymmetrical faults. It is therefore a more appropriate criterion for detecting the risk
of loss of synchronism than, for instance, the lowest phase-to-phase voltage.
The loss of synchronism of a generator means that the generator is not able to operate
as a generator with the network frequency but enters an unstable condition, in which it
operates by turns as a generator and a motor. Such a condition stresses the generator
thermally and mechanically. This kind of loss of synchronism should not be mixed
with the one between an island and the utility network. In the islanding situation, the
condition of the generator itself is normal, but the phase angle and the frequency of a
phase-to-phase voltage may be different from the corresponding voltage in the rest of
the network. The island may get a frequency of its own relatively fast when fed by a
small power station with a low inertia.
11
RE_5_ _ PSV3St1 ABB Automation
PSV3St2
The magnitude of U1 in the fault point, U1f , can be calculated for different types of
faults by the following formulas.
=
81 = 0
I
= +=
I
N 1 I
= +=
81 = 0 .5
I N 2
= += +=
I
I N 2 N 1
= 2 (= + 3= )
81 = 0.33
N N 0 I
(= + = 2 )( = + 3= ) + = 1 =
I
N 1 N N 0 I N N 2
= += + 3=
81 = 0.67
N 2 N 0 I
= += += + 3=
I
N 1 N 2 N 0 I
were Zk1 , Zk2 and Zk0 are respectively positive-, negative- and zero-sequence
impedances of the faulted circuit and Zf is the fault impedance.
The approximations above are based on the assumption that the sequence impedances
consist mainly of sequence reactances (Xk1 , Xk2 , Xk0) and that Xk1 = Xk2 = Xk0 and
Zf = 0.
When the function block is to trip in an islanding situation, it will have to be set
according to the highest magnitude of U1 during the fault when the fault is in such an
area of the network that an island will be formed. The highest U1-value at the
measuring point of the relay appears when the fault occurs near the farthest circuit
breaker within the potential island.
Which type of fault the setting should be based on depends on the operating principle
of protection at single phase-to-earth faults. If a single phase-to-earth fault results in
the one-phase operation of circuit breakers, the fault must involve at least two phases
before an island is formed. The highest U1-value indicating a fault leading to a loss-
of-grid condition appears at a two-phase short circuit.
If, however, a three-phase circuit breaker operation will take place at all faults,
including a single phase-to-earth fault, the setting has to be calculated based on a
single phase-to-earth fault to get the highest during-the-fault value of U1.
12
ABB Automation PSV3St1 RE_5_ _
PSV3St2
The U1< operation is naturally able to detect the islanding condition only when it has
been caused by a fault on the line between the power station and the transmission
network. However, the island may also be formed by the switchings related to
locating an earth fault in a medium voltage network or, for example, by the trip of a
Buchholz relay of a transformer. In these cases, no high-speed autoreclosures are
performed, and there is thus time to trip the utility circuit breaker of the power station
by a frequency protection function or manually by remote control.
The task of a U1< operation is to detect such fault situations in the network that will
OHDGWR a loss-of-grid condition. It is not able to identify the condition after it has been
created. The operate time of the U1< operation therefore has to be made so short, that
it will not drop off after the line protection of the network has cleared the fault and an
island has come about. The fast operate time (for instance 50 ms) also brings another
advantage: the high-speed autoreclosure is more likely to be a successful one, since
the U1< operation will de-energize the faulty line even in case the fault current fed by
the power station is too low to start the overcurrent protection between the power
station and the fault, but high enough to maintain the arc.
The disadvantage of the fast operation of the U1< operation is that it will issue a trip
even if the fault is on one of the medium voltage lines fed by the power station. This
is an undue trip, since such a fault would not lead to an islanding condition. This
drawback is, however, smaller than the benefit of having a reliable loss-of-grid
protection. Sometimes it is possible to improve the selectivity: if the U1< operation is
located in the same substation as the overcurrent protection functions protecting the
medium voltage lines, it is possible to block the U1< operation by the start signals of
the overcurrent function blocks.
The purpose of the following examples is to illustrate the setting principle. The
calculations may be more complicated in practice, especially if there are other
generators having an impact on the voltages at the generator in question. Fault
calculation tools or network simulators are recommended to be used in complicated
studies.
If there are several generators in the network, the during-the-fault voltages at the
measuring point of the relay depend on the number of generators actually connected
to the network when the fault occurs. One option is to use a fixed setting based on the
case that leads to the highest U1-value during the fault. In this case, the function block
will always trip when it is required to, but there may also appear unnecessary
operations. When maximum selectivity is pursued, the distribution management
system can be utilized for updating the settings as the switching state of the generators
or of the network changes. The two setting groups of the function block can also be
utilized for the same purpose.
([DPSOH
In Figure 5, a radial line leads from the substation A to the substation B. Tripping this
line will create an island fed by the power station. Let us assume that one-phase
autoreclosures are applied in single-phase earth faults. Only two- or three-phase short-
circuits will then lead to a loss-of-grid situation. The setting value for the parameter
13
RE_5_ _ PSV3St1 ABB Automation
PSV3St2
The equivalent circuit presented in Figure 6 will be applied in the calculation. The U1-
value of the faulty point at a two-phase short circuit is U1f = 0.5 p.u. The transient U1-
value of the generator source voltage can be approximated as 1.1 p.u. The U1-voltage
appearing at the generator terminals during the fault is calculated as follows:
; N* ; N*
8 1* = 8 1 I + (1.1 8 1 I ) = 0.5 + (1.1 0.5)
; N* + ; G
; N* + ; G
where XkG is the short-circuit reactance between the power station and the fault
reduced to the voltage level of the power station. Xd is the transient reactance of
the generator of the power station.
xd = 0.15
Sn = 5 MVA
Un = 10 kV
XkG = 2
8 Q2 (100009 ) 2
; =[
G
G= 015
. = 3
6Q 50000009$
; N* 2
8 1* = 0.5 + 0.6 = 0.5 + 0.6 = 0.74
; N* + ; G
2+3
The actual setting should be slightly (for instance 10 %) higher than the value
calculated above to allow some marginal for the fault resistance and other factors that
may make the U1-value higher:
14
ABB Automation PSV3St1 RE_5_ _
PSV3St2
)LJXUH $IDXOWRQDUDGLDOOLQHUHVXOWLQJLQDORVVRIJULGFRQGLWLRQ
)LJXUH 7KHHTXLYDOHQWFLUFXLWXVHGLQWKHFDOFXODWLRQ8ILVWKHSRVLWLYHVHTXHQFH
FRPSRQHQWRIWKHYROWDJHGXULQJDIDXOWDWWKHIDUWKHVWSRLQWRIDSRWHQWLDO
LVODQGQHDUWKHVXEVWDWLRQ$VHH)LJXUH;N*LVWKHVKRUWFLUFXLW
UHDFWDQFHEHWZHHQWKHPHDVXULQJSRLQWRIWKHUHOD\DQGWKHIDXOWUHGXFHG
WRWKHYROWDJHOHYHORIWKHODWWHU;GLVWKHWUDQVLHQWUHDFWDQFHRIWKH
JHQHUDWRURIWKHSRZHUVWDWLRQ7KHSRVLWLYHSKDVHVHTXHQFHFRPSRQHQWRI
WKHWUDQVLHQWVRXUFHYROWDJHRIWKHJHQHUDWRUFDQEHDSSUR[LPDWHGE\
SX
([DPSOH
The lines between the substations A, B and C in Figure 7 are protected by distance
relays without communication schemes. Fast protection is obtained for the whole line
by making the first zone overreaching (covering for instance 120 % of the length of
the line) for the first trip. The possible second trip after the high-speed autoreclosure
15
RE_5_ _ PSV3St1 ABB Automation
PSV3St2
will take place according to the normal 1. zone (covering for instance 80-90 % of the
length of the line). The healthy line will thus be tripped only once. In the case
presented in Figure 7, the fault occurs in the beginning of the line BC, and both the
line AB and the line BC will be tripped at first, which results in a loss-of-grid
situation.
Let us assume that in this example, all circuit breaker operations are three-phase ones
for all faults. Then also a single phase-to-earth fault will result in an islanding
condition and the setting has to be calculated according to a one-phase fault.
)LJXUH 2YHUUHDFKLQJGLVWDQFHUHOD\VPD\JLYHULVHWRDORVVRIJULGVLWXDWLRQDWD
OLQHIDXOW
)LJXUH 7KHHTXLYDOHQWFLUFXLWXVHGLQWKHFDOFXODWLRQ
16
ABB Automation PSV3St1 RE_5_ _
PSV3St2
The equivalent circuit in Figure 8 is now used in the calculation. The U1-value of the
fault-point voltage at a single phase-to-earth fault is U1f = 0.67 p.u. The positive-
phase-sequence component of the transient source voltage of a generator can be
approximated by 1.1 p.u. The U1-voltage appearing at the measuring point of the relay
is calculated using the following approximation formula:
;\ ; N* ;\
8 1* = 8 1 I + (1 8 1 I ) + ((1.1 8 1 I ) (1 8 1 I ) )
; N% + ; \ ; N* + ; G
; N% + ; \
where
XkG is the short circuit reactance between the farthest point of the created island
(the substation B in this case) and the measuring point of the relay reduced to the
voltage level of the latter.
Xd is the transient reactance of the generator of the power station.
XkB is the short circuit reactance of the network as seen from the substation B
towards either the substation A or the substation C. The smaller of these values
will be used in the calculation. The XkB is reduced to the voltage level of the
measuring point of the relay.
Xy is the higher of the overreachings of the distance relays of the substations A and
C. The value used in the calculation is reduced to the voltage level of the
measuring point of the relay.
xd = 0.2
Sn = 6 MVA
Un = 10 kV
8 Q2 (100009 ) 2
; G = [ G = 0.2 = 3.33
6Q 60000009$
XkG = 1 (reduced to the 10 kV voltage level)
The short-circuit reactance of the network seen from the substation B towards the
substation A is 1 and towards the substation C 1.2 => XkB = 1 .
The overreaching first zone of the distance relay of the substation A covers a length of
0.3 of the line BC. The overreaching first zone of the distance relay of the
substation C covers a length of 0.25 of the line BA => Xy = 0.3 .
17
RE_5_ _ PSV3St1 ABB Automation
PSV3St2
; \ ; N* ; \
8 1* = 0.67 + (1 0.67) + ((1.1 0.67) (1 0.67) )=
; N%
+ ; \ ; N* + ; G ; N% + ; \
0.0013 1 0.0013
0.67 + 0.33 + (0.43 0.33 ) = 0.83
0.0044 + 0.0013 1 + 3.33 0.0044 + 0.0013
The actual setting should be slightly (for instance 10 %) higher that the value
calculated above to allow some marginal for the fault resistance and other factors that
may make the U1-value higher:
Start value U1< 1.1 0.83 = 0.91
1RWH In the examples above, it has been assumed that the generator is connected to
the 10 kV network without a power transformer in between. If there is such a
transformer, the same setting principles are still followed. The short-circuit reactance
of the transformer has to be added to the transient reactance of the generator if the
voltage is measured at the network-side of the transformer, or to the network short
circuit reactance if the voltage is measured at the generator-side of the transformer.
18
ABB Automation PSV3St1 RE_5_ _
PSV3St2
If the machines have unbalance protection of their own, the U2> operation can be
applied as backup protection or it can be used only to give an alarm. The latter can be
applied when it is desired not to trip loads tolerating voltage unbalance better than
rotating machines.
An appropriate value for the setting parameter Start value U2> is approximately 3%
Un. A suitable value for the setting parameter Operate time U2> depends on the
application. If the U2> operation is used as backup protection, the operate time should
be set in accordance with the operate time of NPS3Low/High used as main protection.
If the U2> operation is used as main protection, the operate time should be
approximately one second.
19
RE_5_ _ PSV3St1 ABB Automation
PSV3St2
5.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for PSV3St1 is 112 and that for PSV3St2 113.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the
Event mask 1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
20
ABB Automation PSV3St1 RE_5_ _
PSV3St2
Start value U2> S42 0.011.00 x Un 0.03 R/W Start voltage of the negative-phase-
sequence overvoltage operation
Start value U1< S43 0.011.20 x Un 0.90 R/W Start voltage of the positive-phase-
sequence undervoltage operation
Start value U1> S44 0.801.60 x Un 1.10 R/W Start voltage of the positive-phase-
sequence overvoltage operation
Operate time U2> S45 0.0460.00 s 0.04 R/W Operate time of the negative-phase-
sequence overvoltage operation
Operate time U1< S46 0.0460.00 s 0.04 R/W Operate time of the positive-phase-
sequence undervoltage operation
Operate time U1> S47 0.0460.00 s 0.04 R/W Operate time of the positive-phase-
sequence overvoltage operation
1)
Operation mode 0 = Not in use; 1 = U1< & U2> & U1>; 2 = U1< & U2>; 3 = U2> & U1>;
4 = U1< & U1>; 5 =U2>; 6 = U1<; 7 = U1>
21
RE_5_ _ PSV3St1 ABB Automation
PSV3St2
Start value U2> S72 0.011.00 x Un 0.03 R/W Start voltage of the negative-phase-
sequence overvoltage operation
Start value U1< S73 0.011.20 x Un 0.90 R/W Start voltage of the positive-phase-
sequence undervoltage operation
Start value U1> S74 0.801.60 x Un 1.10 R/W Start voltage of the positive-phase-
sequence overvoltage operation
Operate time U2> S75 0.0460.00 s 0.04 R/W Operate time of the negative-phase-
sequence overvoltage operation
Operate time U1< S76 0.0460.00 s 0.04 R/W Operate time of the positive-phase-
sequence undervoltage operation
Operate time U1> S77 0.0460.00 s 0.04 R/W Operate time of the positive-phase-
sequence overvoltage operation
1)
Operation mode 0 = Not in use; 1 = U1< & U2> & U1>; 2 = U1< & U2>; 3 = U2> & U1>;
4 = U1< & U1>; 5 =U2>; 6 = U1<; 7 = U1>
22
ABB Automation PSV3St1 RE_5_ _
PSV3St2
Event mask 1 V101 0262143 - 135167 R/W Event mask 1 for event
transmission (E0E15, E17)
Event mask 2 V103 0262143 - 135167 R/W Event mask 2 for event
transmission (E0E15, E17)
Event mask 3 V105 0262143 - 135167 R/W Event mask 3 for event
transmission (E0E15, E17)
Event mask 4 V107 0262143 - 135167 R/W Event mask 4 for event
transmission (E0E15, E17)
1)
Group selection 0 = Group 1; 1 = Group 2; 2 = GROUP input
2)
Active group 0 = Group 1; 1 = Group 2
3)
Dir. Selection 0 = Forward; 1 = Reverse; 2 = Input ROT_DIR
4)
Rotation dir. 0 = Forward; 1 = Reverse
5)
Trip signal 0 = Non-latching; 1 = Latching
6)
Intern. blocking 0 = Disabled; 1 = Enabled
7)
Test 0 = Do not activate; 1 = Activate
23
RE_5_ _ PSV3St1 ABB Automation
PSV3St2
5.3.3.1 General
The data of three last operations (operation 1...3) are stored, and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
The time stamp indicates the rising edge of the START or TRIP signal.
24
ABB Automation PSV3St1 RE_5_ _
PSV3St2
5.3.3.3 Duration
The duration of start situation is recorded separately for all the operations (U2>, U1<
and U1>) included in the function block, which makes it it possible to conclude which
operation has started or tripped. The durations are recorded as percentages of the set
operate time. If more than one durations differ from zero per cent, more than one
operations can be concluded to have started at the same time.
5.3.3.4 Voltages
If the function block trips, the voltage values are updated at the moment of tripping
i.e. on the rising edge of the TRIP signal. If the function block starts but does not trip,
the voltage values captured one fundamental cycle (20 ms at rated frequency 50 Hz)
after the beginning of the start situation will be recorded.
The status of the Active group parameter, which indicates the setting group valid
for the recorded data, is recorded at the moment of tripping.
The recorded status of the input signal BLOCK will be Active if the BLOCK signal
was activated during the start situation. In all other situations, the recorded status of
the input signal BLOCK will be Not active.
5.3.3.6 Priority
1) Tripping
2) Starting
25
RE_5_ _ PSV3St1 ABB Automation
PSV3St2
Duration U2> V203 0.0100.0 % 0.0 R/M Duration of start situation of the
U2> operation
Duration U1< V204 0.0100.0 % 0.0 R/M Duration of start situation of the
U1< operation
Duration U1> V205 0.0100.0 % 0.0 R/M Duration of start situation of the
U1> operation
Duration U2> V303 0.0100.0 % 0.0 R/M Duration of start situation of the
U2> operation
Duration U1< V304 0.0100.0 % 0.0 R/M Duration of start situation of the
U1< operation
Duration U1> V305 0.0100.0 % 0.0 R/M Duration of start situation of the
U1> operation
26
ABB Automation PSV3St1 RE_5_ _
PSV3St2
Duration U2> V403 0.0100.0 % 0.0 R/M Duration of start situation of the
U2> operation
Duration U1< V404 0.0100.0 % 0.0 R/M Duration of start situation of the
U1< operation
Duration U1> V405 0.0100.0 % 0.0 R/M Duration of start situation of the
U1> operation
27
RE_5_ _ PSV3St1 ABB Automation
PSV3St2
5.3.4 Events
E16 0 0 - -
28
ABB Automation PSV3St1 RE_5_ _
PSV3St2
U1< operation:
Injected positive-seq. voltage = 0.50 x start value:
U1> operation:
Injected positive-seq. voltage = 1.1 x start value:
Reset time 70...1030 ms (depends on the minimum pulse width set for the
TRIP output)
U1< operation:
Typ. 1.04 (range 1.021.10)
U1> operation:
Typ. 0.99
29
1MRS752324-MUM PSV3St _
Phase-Sequence Voltage
Issued: 3/2000
Protection
Version: B/25.1.2002 Stage1 (PSV3St1)
Data subject to change without notice Stage2 (PSV3St2)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 4
1.4 Output description ............................................................................... 4
2. Description of Operation.......................................................................... 5
2.1 Configuration....................................................................................... 5
2.2 Configuration error checking ............................................................... 6
2.3 Measuring mode ................................................................................. 7
2.4 Operation criteria................................................................................. 7
2.5 Setting groups ..................................................................................... 9
2.6 Test mode ........................................................................................... 9
2.7 START and TRIP outputs.................................................................... 9
2.8 Resetting........................................................................................... 10
3. Application of U1< Operation ................................................................ 11
3.1 Setting the U1< operation.................................................................. 12
3.2 Setting examples for U1< operation .................................................. 13
4. Application of U2> Operation ................................................................ 19
1. Introduction
1.1 Features
1.2 Application
This document specifies the functions of the phase-sequence voltage function blocks
PSV3St1 and PSV3St2 used in products based on the RED 500 Platform. The two
function blocks are identical in operation.
against reversal of phase sequence, both with forward and reverse rotation
direction.
2
Substation Automation PSV3St _
U1<
U2>
U1>
)LJXUH 3URWHFWLRQGLDJUDPV\PERORI3696WB)RU,(&V\PEROVXVHGLQVLQJOH
OLQHGLDJUDPVUHIHUWRWKHPDQXDO7HFKQLFDO'HVFULSWLRQVRI)XQFWLRQV
,QWURGXFWLRQ056080
)LJXUH )XQFWLRQEORFNV\PEROVRI3696WDQG3696W
3
PSV3St _ Substation Automation
4
Substation Automation PSV3St _
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. In case of phase-to-earth voltages, the
voltages UL1, UL2, and UL3 are connected to the corresponding UL1_U12, UL2_U23
and UL3_U31 inputs of the function block. In the same way, if the phase-to-phase
voltages are used, they are connected to the corresponding inputs of the function
block. Already two phase-to-phase voltages allow a correct calculation of positive-
and negative-sequence components. So, if all three phase-to-phase voltages are
connected, the two with the lowest amplitude are used in calculation to assure the best
possible accuracy. Examples of the connections are shown in Figure 3 below.
)LJXUH &RQQHFWLRQSRVVLELOLWLHVZKHQRQO\WZRSKDVHWRSKDVHYROWDJHVDUHXVHG
It is also possible to use only two phase-to-earth voltages. In this case the residual
voltage U0 is assumed to be zero and the analogue channels are connected to the first
two voltage inputs and the third input is left unconnected. Examples of the
connections are shown in Figure 4 below. All possible input combinations are
presented in Table 1 below.
5
PSV3St _ Substation Automation
)LJXUH &RQQHFWLRQSRVVLELOLWLHVZKHQRQO\WZRSKDVHWRHDUWKYROWDJHVDUHXVHG
Digital inputs are connected to the boolean inputs of the function block and, in the
same way, the outputs of the function block are connected to the output signals.
The ROT_DIR input can be used to protect machines that can be driven both in
forward and in reverse directions. If the status information about the machine rotation
direction is available, it can be connected to the ROT_DIR input of the function
block. In this case the control setting parameter Dir. Selection must be set to value
Input ROT_DIR, which means that the measured negative- and positive-sequence
voltages and the operation of the function block are automatically adapted to the
machine rotation direction.
When the relay is started, the function block checks that at least two voltages are
connected to the first two analogue inputs. If two voltages are not connected, the ERR
output is activated and an event is generated. Activation of the ERR output also
automatically sets the function block to the Not in use mode, which means that it
cannot operate.
6
Substation Automation PSV3St _
When three phase-to-earth voltages are used, the sequence voltages are calculated as
follows:
positive-sequence voltage
1
U1 = U + aU S + a 2 U T (1)
3 R
negative-sequence voltage
1
U2 = U + a 2 U S + aU T (2)
3 R
where UR, US and UT are phase-to-earth voltages and a is a phase-shifting operator
(a = 1120 and a2 = 1240).
positive-sequence voltage
1
U1 = U RS a 2 U ST (3)
3
negative-sequence voltage
1
U2 = U aU ST (4)
3 RS
where URS and UST are phase-to-phase voltages and a is a phase-shifting operator
(a = 1120 and a2 = 1240).
The function block includes three independent operations: one for negative-sequence
overvoltage, one for positive-sequence undervoltage and one for positive-sequence
overvoltage. The operation mode can be selected via the setting parameter Operation
mode that allows selecting just one operation to be active at a time, all three
operations to be active simultaneously, or any combination of two operations to be
active at a time. All the possible operation modes are presented in Table 2 below.
7
PSV3St _ Substation Automation
If the U2> operation is in use, the function block starts when the measured negative-
sequence voltage exceeds the set start voltage value. Should the overvoltage situation
last the preset operate time, the function block trips.
If the U1< operation is in use, the function block starts when the measured positive-
sequence voltage falls below the set start voltage value. Should the undervoltage
situation last the preset operate time, the function block trips.
If the U1> operation is in use, the function block starts when the measured positive-
sequence voltage exceeds the set start voltage value. Should the overvoltage situation
last the preset operate time, the function block trips.
The delay of the heavy-duty output relay is included in preset operate times.
If any of the operations starts or trips, an event indicating the situation is generated.
An indication is also seen on the MMI of the relay. All the operations have their own
start and trip events and also the indication on the MMI includes the information of
the operation which has started or tripped.
The DT timer is allowed to run only if the input signal BLOCK is inactive. If the
BLOCK signal is activated, the timer will be frozen. Moreover, the TRIP signal
cannot be activated when the BLOCK signal is active.
8
Substation Automation PSV3St _
Two different groups of setting values, group 1 and group 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
The START and TRIP digital outputs of the function block can be activated with
separate control parameters for each output either locally via the MMI or externally
via the serial communication. When an output is activated with the test parameter, an
event indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The output signal START is always pulse-shaped. The minimum pulse width of the
corresponding output signal is set via a separate parameter on the MMI or on serial
communication. If the start situation is longer than the set pulse width, the START
signal remains active until the start situation is over. The output signal TRIP may be
non-latching or latching. When the latching mode has been selected, the TRIP signal
remains active until the output is reset even if the operation criteria have reset. When
the non-latching mode has been selected, the TRIP signal remains active until the
operation criteria have reset and the time determined by the control parameter Trip
pulse has elapsed.
9
PSV3St _ Substation Automation
2.8 Resetting
The TRIP output signal and the registers can be reset via the RESET input, or over the
serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
10
Substation Automation PSV3St _
The lower the three-phase symmetrical voltage of the network is, the higher is the
probability that the generator will lose synchronism. The positive phase-sequence
voltage gives the three-phase symmetrical component of voltage even during
unsymmetrical faults. It is therefore a more appropriate criterion for detecting the risk
of loss of synchronism than, for instance, the lowest phase-to-phase voltage.
The loss of synchronism of a generator means that the generator is not able to operate
as a generator with the network frequency but enters an unstable condition, in which it
operates by turns as a generator and a motor. Such a condition stresses the generator
thermally and mechanically. This kind of loss of synchronism should not be mixed
with the one between an island and the utility network. In the islanding situation, the
condition of the generator itself is normal, but the phase angle and the frequency of a
phase-to-phase voltage may be different from the corresponding voltage in the rest of
the network. The island may get a frequency of its own relatively fast when fed by a
small power station with a low inertia.
11
PSV3St _ Substation Automation
The magnitude of U1 in the fault point, U1f , can be calculated for different types of
faults by the following formulas.
=
81 = 0
I
= +=
I
N 1 I
= +=
81 = 0 .5
I N 2
= += +=
I
I N 2 N 1
= 2 (= + 3= )
81 = 0.33
N N 0 I
(= + = 2 )( = + 3= ) + = 1 =
I
N 1 N N 0 I N N 2
= += + 3=
81 = 0.67
N 2 N 0 I
= 1 += += + 3=
I
N N 2 N 0 I
were Zk1 , Zk2 and Zk0 are respectively positive-, negative- and zero-sequence
impedances of the faulted circuit and Zf is the fault impedance.
The approximations above are based on the assumption that the sequence impedances
consist mainly of sequence reactances (Xk1 , Xk2 , Xk0) and that Xk1 = Xk2 = Xk0 and
Zf = 0.
When the function block is to trip in an islanding situation, it will have to be set
according to the highest magnitude of U1 during the fault when the fault is in such an
area of the network that an island will be formed. The highest U1-value at the
measuring point of the relay appears when the fault occurs near the farthest circuit
breaker within the potential island.
Which type of fault the setting should be based on depends on the operating principle
of protection at single phase-to-earth faults. If a single phase-to-earth fault results in
the one-phase operation of circuit breakers, the fault must involve at least two phases
before an island is formed. The highest U1-value indicating a fault leading to a loss-
of-grid condition appears at a two-phase short circuit.
If, however, a three-phase circuit breaker operation will take place at all faults,
including a single phase-to-earth fault, the setting has to be calculated based on a
single phase-to-earth fault to get the highest during-the-fault value of U1.
12
Substation Automation PSV3St _
The U1< operation is naturally able to detect the islanding condition only when it has
been caused by a fault on the line between the power station and the transmission
network. However, the island may also be formed by the switchings related to
locating an earth fault in a medium voltage network or, for example, by the trip of a
Buchholz relay of a transformer. In these cases, no high-speed autoreclosures are
performed, and there is thus time to trip the utility circuit breaker of the power station
by a frequency protection function or manually by remote control.
The task of a U1< operation is to detect such fault situations in the network that will
OHDGWR a loss-of-grid condition. It is not able to identify the condition after it has been
created. The operate time of the U1< operation therefore has to be made so short, that
it will not drop off after the line protection of the network has cleared the fault and an
island has come about. The fast operate time (for instance 50 ms) also brings another
advantage: the high-speed autoreclosure is more likely to be a successful one, since
the U1< operation will de-energize the faulty line even in case the fault current fed by
the power station is too low to start the overcurrent protection between the power
station and the fault, but high enough to maintain the arc.
The disadvantage of the fast operation of the U1< operation is that it will issue a trip
even if the fault is on one of the medium voltage lines fed by the power station. This
is an undue trip, since such a fault would not lead to an islanding condition. This
drawback is, however, smaller than the benefit of having a reliable loss-of-grid
protection. Sometimes it is possible to improve the selectivity: if the U1< operation is
located in the same substation as the overcurrent protection functions protecting the
medium voltage lines, it is possible to block the U1< operation by the start signals of
the overcurrent function blocks.
The purpose of the following examples is to illustrate the setting principle. The
calculations may be more complicated in practice, especially if there are other
generators having an impact on the voltages at the generator in question. Fault
calculation tools or network simulators are recommended to be used in complicated
studies.
If there are several generators in the network, the during-the-fault voltages at the
measuring point of the relay depend on the number of generators actually connected
to the network when the fault occurs. One option is to use a fixed setting based on the
case that leads to the highest U1-value during the fault. In this case, the function block
will always trip when it is required to, but there may also appear unnecessary
operations. When maximum selectivity is pursued, the distribution management
system can be utilized for updating the settings as the switching state of the generators
or of the network changes. The two setting groups of the function block can also be
utilized for the same purpose.
([DPSOH
In Figure 5, a radial line leads from the substation A to the substation B. Tripping this
line will create an island fed by the power station. Let us assume that one-phase
autoreclosures are applied in single-phase earth faults. Only two- or three-phase short-
circuits will then lead to a loss-of-grid situation. The setting value for the parameter
13
PSV3St _ Substation Automation
The equivalent circuit presented in Figure 6 will be applied in the calculation. The U1-
value of the faulty point at a two-phase short circuit is U1f = 0.5 p.u. The transient U1-
value of the generator source voltage can be approximated as 1.1 p.u. The U1-voltage
appearing at the generator terminals during the fault is calculated as follows:
; N* ; N*
8 1* = 8 1 I + (1.1 8 1 I ) = 0.5 + (1.1 0.5)
; N* + ; G
; N* + ; G
where XkG is the short-circuit reactance between the power station and the fault
reduced to the voltage level of the power station. Xd is the transient reactance of
the generator of the power station.
xd = 0.15
Sn = 5 MVA
Un = 10 kV
XkG = 2
8 Q2 (100009 ) 2
; =[
G
G= 015
. = 3
6Q 50000009$
; N* 2
8 1* = 0.5 + 0.6 = 0.5 + 0.6 = 0.74
; N* + ; G
2+3
The actual setting should be slightly (for instance 10 %) higher than the value
calculated above to allow some marginal for the fault resistance and other factors that
may make the U1-value higher:
14
Substation Automation PSV3St _
)LJXUH $IDXOWRQDUDGLDOOLQHUHVXOWLQJLQDORVVRIJULGFRQGLWLRQ
)LJXUH 7KHHTXLYDOHQWFLUFXLWXVHGLQWKHFDOFXODWLRQ8ILVWKHSRVLWLYHVHTXHQFH
FRPSRQHQWRIWKHYROWDJHGXULQJDIDXOWDWWKHIDUWKHVWSRLQWRIDSRWHQWLDO
LVODQGQHDUWKHVXEVWDWLRQ$VHH)LJXUH;N*LVWKHVKRUWFLUFXLW
UHDFWDQFHEHWZHHQWKHPHDVXULQJSRLQWRIWKHUHOD\DQGWKHIDXOWUHGXFHG
WRWKHYROWDJHOHYHORIWKHODWWHU;GLVWKHWUDQVLHQWUHDFWDQFHRIWKH
JHQHUDWRURIWKHSRZHUVWDWLRQ7KHSRVLWLYHSKDVHVHTXHQFHFRPSRQHQWRI
WKHWUDQVLHQWVRXUFHYROWDJHRIWKHJHQHUDWRUFDQEHDSSUR[LPDWHGE\
SX
([DPSOH
The lines between the substations A, B and C in Figure 7 are protected by distance
relays without communication schemes. Fast protection is obtained for the whole line
by making the first zone overreaching (covering for instance 120 % of the length of
the line) for the first trip. The possible second trip after the high-speed autoreclosure
will take place according to the normal 1. zone (covering for instance 80-90 % of the
15
PSV3St _ Substation Automation
length of the line). The healthy line will thus be tripped only once. In the case
presented in Figure 7, the fault occurs in the beginning of the line BC, and both the
line AB and the line BC will be tripped at first, which results in a loss-of-grid
situation.
Let us assume that in this example, all circuit breaker operations are three-phase ones
for all faults. Then also a single phase-to-earth fault will result in an islanding
condition and the setting has to be calculated according to a one-phase fault.
)LJXUH 2YHUUHDFKLQJGLVWDQFHUHOD\VPD\JLYHULVHWRDORVVRIJULGVLWXDWLRQDWD
OLQHIDXOW
)LJXUH 7KHHTXLYDOHQWFLUFXLWXVHGLQWKHFDOFXODWLRQ
16
Substation Automation PSV3St _
The equivalent circuit in Figure 8 is now used in the calculation. The U1-value of the
fault-point voltage at a single phase-to-earth fault is U1f = 0.67 p.u. The positive-
phase-sequence component of the transient source voltage of a generator can be
approximated by 1.1 p.u. The U1-voltage appearing at the measuring point of the relay
is calculated using the following approximation formula:
;\ ; N* ;\
8 1* = 8 1 I + (1 8 1 I ) + ((1.1 8 1 I ) (1 8 1 I ) )
; N% + ; \ ; N* + ; G
; N% + ; \
where
XkG is the short circuit reactance between the farthest point of the created island
(the substation B in this case) and the measuring point of the relay reduced to the
voltage level of the latter.
Xd is the transient reactance of the generator of the power station.
XkB is the short circuit reactance of the network as seen from the substation B
towards either the substation A or the substation C. The smaller of these values
will be used in the calculation. The XkB is reduced to the voltage level of the
measuring point of the relay.
Xy is the higher of the overreachings of the distance relays of the substations A and
C. The value used in the calculation is reduced to the voltage level of the
measuring point of the relay.
xd = 0.2
Sn = 6 MVA
Un = 10 kV
8 Q2 (100009 ) 2
; =[
G = 0.2
G = 3.33
6Q 60000009$
XkG = 1 (reduced to the 10 kV voltage level)
The short-circuit reactance of the network seen from the substation B towards the
substation A is 1 and towards the substation C 1.2 => XkB = 1 .
The overreaching first zone of the distance relay of the substation A covers a length of
0.3 of the line BC. The overreaching first zone of the distance relay of the
substation C covers a length of 0.25 of the line BA => Xy = 0.3 .
17
PSV3St _ Substation Automation
; \ ; N* ; \
8 1* = 0.67 + (1 0.67) + ((1.1 0.67) (1 0.67) )=
; N%
+ ; \ ; N* + ; G ; N% + ; \
0.0013 1 0.0013
0.67 + 0.33 + (0.43 0.33 ) = 0.83
0.0044 + 0.0013 1 + 3.33 0.0044 + 0.0013
The actual setting should be slightly (for instance 10 %) higher that the value
calculated above to allow some marginal for the fault resistance and other factors that
may make the U1-value higher:
Start value U1< 1.1 0.83 = 0.91
1RWH In the examples above, it has been assumed that the generator is connected to
the 10 kV network without a power transformer in between. If there is such a
transformer, the same setting principles are still followed. The short-circuit reactance
of the transformer has to be added to the transient reactance of the generator if the
voltage is measured at the network-side of the transformer, or to the network short
circuit reactance if the voltage is measured at the generator-side of the transformer.
18
Substation Automation PSV3St _
If the machines have unbalance protection of their own, the U2> operation can be
applied as backup protection or it can be used only to give an alarm. The latter can be
applied when it is desired not to trip loads tolerating voltage unbalance better than
rotating machines.
An appropriate value for the setting parameter Start value U2> is approximately 3%
Un. A suitable value for the setting parameter Operate time U2> depends on the
application. If the U2> operation is used as backup protection, the operate time should
be set in accordance with the operate time of NPS3Low/High used as main protection.
If the U2> operation is used as main protection, the operate time should be
approximately one second.
19
PSV3St _ Substation Automation
5.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for PSV3St1 is 112 and that for PSV3St2 113.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the
Event mask 1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
20
Substation Automation PSV3St _
Start value U2> S42 0.011.00 x Un 0.03 R/W Start voltage of the negative-phase-
sequence overvoltage operation
Start value U1< S43 0.011.20 x Un 0.90 R/W Start voltage of the positive-phase-
sequence undervoltage operation
Start value U1> S44 0.801.60 x Un 1.10 R/W Start voltage of the positive-phase-
sequence overvoltage operation
Operate time U2> S45 0.0460.00 s 0.04 R/W Operate time of the negative-phase-
sequence overvoltage operation
Operate time U1< S46 0.0460.00 s 0.04 R/W Operate time of the positive-phase-
sequence undervoltage operation
Operate time U1> S47 0.0460.00 s 0.04 R/W Operate time of the positive-phase-
sequence overvoltage operation
1)
Operation mode 0 = Not in use; 1 = U1< & U2> & U1>; 2 = U1< & U2>; 3 = U2> & U1>;
4 = U1< & U1>; 5 =U2>; 6 = U1<; 7 = U1>
21
PSV3St _ Substation Automation
Start value U2> S72 0.011.00 x Un 0.03 R/W Start voltage of the negative-phase-
sequence overvoltage operation
Start value U1< S73 0.011.20 x Un 0.90 R/W Start voltage of the positive-phase-
sequence undervoltage operation
Start value U1> S74 0.801.60 x Un 1.10 R/W Start voltage of the positive-phase-
sequence overvoltage operation
Operate time U2> S75 0.0460.00 s 0.04 R/W Operate time of the negative-phase-
sequence overvoltage operation
Operate time U1< S76 0.0460.00 s 0.04 R/W Operate time of the positive-phase-
sequence undervoltage operation
Operate time U1> S77 0.0460.00 s 0.04 R/W Operate time of the positive-phase-
sequence overvoltage operation
1)
Operation mode 0 = Not in use; 1 = U1< & U2> & U1>; 2 = U1< & U2>; 3 = U2> & U1>;
4 = U1< & U1>; 5 =U2>; 6 = U1<; 7 = U1>
22
Substation Automation PSV3St _
Event mask 1 V101 0196607 - 135167 R/W Event mask 1 for event
transmission (E0E15, E17)
Event mask 2 V103 0196607 - 135167 R/W Event mask 2 for event
transmission (E0E15, E17)
Event mask 3 V105 0196607 - 135167 R/W Event mask 3 for event
transmission (E0E15, E17)
Event mask 4 V107 0196607 - 135167 R/W Event mask 4 for event
transmission (E0E15, E17)
1)
Group selection 0 = Group 1; 1 = Group 2; 2 = GROUP input
2)
Active group 0 = Group 1; 1 = Group 2
3)
Dir. Selection 0 = Forward; 1 = Reverse; 2 = Input ROT_DIR
4)
Rotation dir. 0 = Forward; 1 = Reverse
5)
Trip signal 0 = Non-latching; 1 = Latching
6)
Intern. blocking 0 = Disabled; 1 = Enabled
7)
Test 0 = Do not activate; 1 = Activate
23
PSV3St _ Substation Automation
5.3.3.1 General
The data of three last operations (operation 1...3) are stored, and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
The time stamp indicates the rising edge of the START or TRIP signal.
24
Substation Automation PSV3St _
5.3.3.3 Duration
The duration of start situation is recorded separately for all the operations (U2>, U1<
and U1>) included in the function block, which makes it it possible to conclude which
operation has started or tripped. The durations are recorded as percentages of the set
operate time. If more than one durations differ from zero per cent, more than one
operations can be concluded to have started at the same time.
5.3.3.4 Voltages
If the function block trips, the voltage values are updated at the moment of tripping
i.e. on the rising edge of the TRIP signal. If the function block starts but does not trip,
the voltage values captured one fundamental cycle (20 ms at rated frequency 50 Hz)
after the beginning of the start situation will be recorded.
The status of the Active group parameter, which indicates the setting group valid
for the recorded data, is recorded at the moment of tripping.
The recorded status of the input signal BLOCK will be Active if the BLOCK signal
was activated during the start situation. In all other situations, the recorded status of
the input signal BLOCK will be Not active.
5.3.3.6 Priority
1) Tripping
2) Starting
25
PSV3St _ Substation Automation
Duration U2> V203 0.0100.0 % 0.0 R/M Duration of start situation of the
U2> operation
Duration U1< V204 0.0100.0 % 0.0 R/M Duration of start situation of the
U1< operation
Duration U1> V205 0.0100.0 % 0.0 R/M Duration of start situation of the
U1> operation
Duration U2> V303 0.0100.0 % 0.0 R/M Duration of start situation of the
U2> operation
Duration U1< V304 0.0100.0 % 0.0 R/M Duration of start situation of the
U1< operation
Duration U1> V305 0.0100.0 % 0.0 R/M Duration of start situation of the
U1> operation
26
Substation Automation PSV3St _
Duration U2> V403 0.0100.0 % 0.0 R/M Duration of start situation of the
U2> operation
Duration U1< V404 0.0100.0 % 0.0 R/M Duration of start situation of the
U1< operation
Duration U1> V405 0.0100.0 % 0.0 R/M Duration of start situation of the
U1> operation
27
PSV3St _ Substation Automation
5.3.4 Events
E16 0 0 - -
28
Substation Automation PSV3St _
U1< operation:
Injected positive-seq. voltage = 0.50 x start value:
U1> operation:
Injected positive-seq. voltage = 1.1 x start value:
Reset time 70...1030 ms (depends on the minimum pulse width set for the
TRIP output)
U1< operation:
Typ. 1.04 (range 1.021.10)
U1> operation:
Typ. 0.99
C -
29
1MRS 752325-MUM REF1A
Issued: 10/1998
Version: C/25.1.2002
High-Impedance Based
Restricted Earth-Fault Protection
Data subject to change without notice
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 3
2. Description of Operation.......................................................................... 4
2.1 Configuration....................................................................................... 4
2.2 The measuring configuration ............................................................... 5
2.3 Operation criteria................................................................................. 5
2.4 Recommendations for current transformers ........................................ 6
2.5 Setting groups ................................................................................... 11
2.6 Test mode ......................................................................................... 11
2.7 TRIP and CBFP outputs.................................................................... 11
2.8 Resetting........................................................................................... 12
3. Parameters and Events .......................................................................... 13
1. Introduction
1.1 Features
1.2 Application
This document specifies the function of REF1A, the high-impedance based restricted
earth-fault protection for generators and transformers, used in products based on the
RED 500 Platform.
dIo>
)LJXUH 3URWHFWLRQGLDJUDPV\PERO)RU,(&V\PEROVXVHGLQVLQJOHOLQH
GLDJUDPVUHIHUWRWKHPDQXDO7HFKQLFDO'HVFULSWLRQVRI)XQFWLRQV
,QWURGXFWLRQ056080
)LJXUH )XQFWLRQEORFNV\PERORI5()$WKHVWDELOL]HGUHVWULFWHGHDUWKIDXOW
SURWHFWLRQ
2
Substation Automation REF1A
3
REF1A Substation Automation
2.1 Configuration
P2 P1
IL1
S2 S1
P1 P2
IL2
S1 S2
IL3
Variable resistor
Stabilizing
resistor
87N High-impedance relay
)LJXUH 5HVWULFWHGHDUWKIDXOWSURWHFWLRQIRUJHQHUDWRUVDQGWUDQVIRUPHUVEDVHG
RQKLJKLPSHGDQFHSULQFLSOH
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The differential neutral current Ido
composed by the external measuring configuration is connected to the corresponding
Ido input of the function block. Digital inputs are connected to the boolean inputs of
the function block and in the same way, the outputs of the function block are
connected to the output signals.
4
Substation Automation REF1A
Us
Rs = , (1)
Ir
where
I kmax
Us = ( R in + R m ) (2)
n
where
Additionally it is required that the knee-point voltages (Uk) of the current transformers
are at least twice the value of the stabilizing voltage (U s).
For more information about calculating the value of the stabilizing resistor and
choosing the current transformers refer to section Recommendations for current
transformers.
5
REF1A Substation Automation
The value of the stabilizing resistor, which has to be calculated before installation and
commissioning, mainly determines the stability of the relay. The Basic setting
parameter allows for fine tuning the sensitivity of the protection.
To make the operation of the relay fast and reliable for in-zone faults, the knee-point
voltage has to be twice the stabilizing voltage. The stabilizing voltage Us of the
function block is given by equation (2) in section The measuring configuration. The
required knee-point voltage Uk of the current transformer is calculated as follows:
Uk = 2 Us (3)
The factor 2 is used when no operate delay is permitted for the protection.
The sensitivity requirements for the protection are jeopardized if the magnetizing
current of the current transformers at the knee-point voltage is too high. The Iprim value
of the primary current at which the function block operates at certain settings can be
calculated as follows:
where
1. Firstly, the nominal current In of the protected winding has to be known. It also
affects how high Ikmax is. Normally the Ikmax values are the following:
- for small transformers Ikmax = 16 In
- for big transformers Ikmax = 12 In
- for generators Ikmax = 6 In
2. The nominal primary current I1n of the CT must be higher than the nominal
current of the protected winding. The choice of the CT also specifies Rin.
6
Substation Automation REF1A
3. The required Uk is calculated using the formula (3). If the Uk of the CT is not
high enough, another CT has to be chosen. The value of the Uk is given by the
manufacturer or in the case of class X current transformer it can be estimated using
the equation (5) below.
4. The sensitivity Iprim is calculated with the formula (4). If the achieved sensitivity
is sufficient, the present CT is chosen. If better sensitivity is needed, a CT with a
bigger core is chosen
If other than class X current transformers are used, an estimate for Uk can be
calculated as follows:
where
If the rated accuracy limit factor Fn is used in equation (5) instead of Fa, also Rm has to
be replaced with the rated burden of the current transformer.
Examples of the required knee-point voltages and achieved sensitivity are given
below (Examples 1 and 2). For transformer the value 12 In is given to Ikmax, In being
the nominal current of the protected winding of the power transformer. For generator
the value 6 In is used as Ikmax. When calculating Iprim, the value Ir = m Ie has been
given for the setting of the relay and the value Iu = 0 A for the current of the varistor.
Ir depends on the application. However, it is recommended that Ir m Ie. The
number of CTs connected in parallel is here m = 4.
1RWHThe formulae are based on worst-case analysis, i.e. choosing the CTs
according to the criteria above (equation 3) results in an absolutely stable scheme. In
some cases it is possible to achieve stability by knee-point voltages lower than stated
by the formulae. The conditions of the network, however, have to be known well
enough to ensure the stability. The following rule could be used.
1RWHThe analysis of stability is based on the assumption that the ampere turns are
the same for individual CTs. If that is not the case, the selectivity may be endangered.
It is thus recommended that all the CTs used in the scheme are of the same type and
preferably from the the same batch.
7
REF1A Substation Automation
Example 1
)LJXUH 5HVWULFWHGHDUWKIDXOWSURWHFWLRQRIDWUDQVIRUPHU
The data for the protected power transformer is as follows:
Sn = 20 MVA
U2n= 11 kV
The longest distance of the secondary circuit is 50 m (the whole loop being thus 100
m) and the area of the cross-section is 10 mm2.
In = Sn / (3 Un) = 1050 A
Ikmax = 12 In = 12600 A
Let us choose the CT-type IHBF 12 and the core size of 35 %. Let us choose 1200 A
for the primary current and 5 A for the secondary current.
8
Substation Automation REF1A
Rs = Us / Ir = 34 V / 0.11 A 309
However, the sensitivity can be calculated more accurately when the actual values of
Iu and Ir are known.
In the example above it has been assumed that the stabilizing resistor of the relay is
not fixed but can be chosen freely.
Example 2
)LJXUH 5HVWULFWHGHDUWKIDXOWSURWHFWLRQRIDJHQHUDWRU
9
REF1A Substation Automation
Sn = 8 MVA
Un = 6 kV
In = 770 A
Ikmax = 6 In = 6 770 A = 4620 A
As mentioned earlier, writing Ie = 0.5 Io gives a realistic value for Iprim in equation
(4). By writing Iu = 0 and Ir = m 0.5 Io the following value for the sensitivity can
be calculated:
Rs = Us / Ir = 78 V / 48 mA 1630
In this example the relay has been supposed to be of such a type that the stabilizing
resistor can be chosen freely.
10
Substation Automation REF1A
Two different groups of setting values, group 1 and group 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
The TRIP and CBFP digital outputs of the function block can be activated with
separate control parameters for each output either locally via the MMI or externally
via the serial communication. When an output is activated with the test parameter, an
event indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The output signal TRIP may have a non-latching or latching feature. When the
latching mode has been selected, the TRIP signal remains active until the output is
reset even if the operation criteria have reset.
The function block provides a delayed trip signal CBFP after the TRIP signal unless
the fault has disappeared during the set CBFP time delay. In circuit-breaker failure
protection the CBFP output can be used to operate a circuit breaker in front of the
circuit breaker of the machine. The control parameter Trip pulse also sets the width
of the CBFP output signal.
11
REF1A Substation Automation
2.8 Resetting
The TRIP output signal and the registers can be reset via the RESET input, or over the
serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
12
Substation Automation REF1A
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for REF1A is 102.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
13
REF1A Substation Automation
14
Substation Automation REF1A
CBFP time V6 100...1000 ms 100 R/W Operate time of the delayed trip
CBFP
15
REF1A Substation Automation
3.3.3.1 General
The data of three last operations (operation 1...3) are recorded, and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
The time stamp indicates the moment of the highest fault current during 50 ms after
the tripping.
16
Substation Automation REF1A
3.3.3.3 Current
If the function block trips, the neutral differential current value is updated during 50
ms after the tripping, and the highest value during that time is recorded. The value of
the differential neutral current Ido is recorded as a multiple of the rated current In.
The status of the Active group parameter, which indicates the setting group valid
for the recorded data, is recorded at the moment of tripping.
17
REF1A Substation Automation
3.3.4 Events
18
Substation Automation REF1A
Retardation time This function block cannot retard. The function block trips if the current
even once exceeds the operate value.
B -
19
1MRS100044 (ROV1Low) RE_5_ _
1MRS100045 (ROV1High) Residual Overvoltage Protection
1MRS100046 (ROV1Inst)
Issued: 10/1997 Low-Set Stage (ROV1Low)
Version: E
High-Set Stage (ROV1High)
Data subject to change without notice
Instantaneous Stage (ROV1Inst)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 3
2. Description of Operation.......................................................................... 4
2.1 Configuration....................................................................................... 4
2.2 Measuring mode ................................................................................. 4
2.3 Operation criteria................................................................................. 4
2.4 Setting groups ..................................................................................... 5
2.5 Test mode ........................................................................................... 5
2.6 START and TRIP outputs.................................................................... 5
2.7 Resetting............................................................................................. 6
1. Introduction
1.1 Features
1.2 Application
This document specifies the functions of the residual overvoltage protection function
blocks ROV1Low, ROV1High and ROV1Inst used in products based on the RED 500
Platform. The setting values of the low-set stage (ROV1Low) differ from those of the
high-set and instantaneous stages. Otherwise the three stages are identical in
operation.
The residual overvoltage protection function blocks are designed for sensitive earth-
fault protection. Suppression of harmonics is possible.
)LJXUH )XQFWLRQEORFNV\PEROVRI529/RZ529+LJKDQG529,QVW
2
ABB Automation ROV1Low, ROV1High, ROV1Inst RE_5_ _
3
RE_5_ _ ROV1Low, ROV1High, ROV1Inst ABB Automation
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The residual voltage Uo can be connected
to the Uo input of the function block. Furthermore, digital inputs are connected to the
boolean inputs of the function block and the outputs of the function block are
connected to the output signals.
The function block operates on two alternative measuring principles: the average
value of consecutive instantaneous peak-to-peak values or the numerically calculated
fundamental frequency component of the residual voltage. An MMI parameter or a
serial communication parameter can be used for selecting the measuring mode.
With both the measuring principles, the operation is insensitive to the DC component
and the operation accuracy is defined in the frequency range f/fn=0.95...1.05. In peak-
to-peak measurement, the harmonics of the residual voltage are not suppressed,
whereas in fundamental frequency measurement the harmonics suppression is about
-50 dB at f = n x fn, where n = 2, 3, 4, 5,...
The function block starts when the residual voltage of the busbar system exceeds the
set start voltage. When the function block starts, the signal START is set to TRUE.
Should the duration of the earth-fault exceed the set definite operate time, the function
block operates. The delay of the heavy-duty output relay is included in the total
operate time. When the function block operates, the signal TRIP is set to TRUE.
The DT timer will be allowed to run only if the signal BS1 is inactive, i.e. its value is
FALSE. When the blocking signal BS1 becomes active, i.e. its value turns to TRUE,
the timer will be stopped (frozen).
4
ABB Automation ROV1Low, ROV1High, ROV1Inst RE_5_ _
When the blocking signal BS2 is active, the TRIP signal cannot be activated. The
TRIP signal can be blocked by activating the signal BS2 until the function block
drops off.
Two different groups of setting values, group 1 and group 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The output signal START is always pulse-shaped. The minimum pulse width of the
corresponding output signal is set via a separate parameter on the MMI or the serial
communication. If the start situation is longer than the set pulse width, the START
signal remains active until the start situation is over. The output signal TRIP may be
non-latching or latching. When the latching mode has been selected, the TRIP signal
remains active until the output is reset even if the operation criteria have reset.
5
RE_5_ _ ROV1Low, ROV1High, ROV1Inst ABB Automation
2.7 Resetting
The TRIP output signal and the registers can be reset either via the RESET input, or
over the serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
6
ABB Automation ROV1Low, ROV1High, ROV1Inst RE_5_ _
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for ROV1Low is 44, that for ROV1High 45
and that for ROV1Inst 46.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
7
RE_5_ _ ROV1Low, ROV1High, ROV1Inst ABB Automation
ROV1Low
ROV1Low
8
ABB Automation ROV1Low, ROV1High, ROV1Inst RE_5_ _
ROV1Low
9
RE_5_ _ ROV1Low, ROV1High, ROV1Inst ABB Automation
10
ABB Automation ROV1Low, ROV1High, ROV1Inst RE_5_ _
The information required for later fault analysis is recorded when the function block
starts, trips, or when the recording function is triggered via the external TRIGG input.
The data of three last operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
The time stamp indicates the rising edge of the START, TRIP or TRIGG signal.
11
RE_5_ _ ROV1Low, ROV1High, ROV1Inst ABB Automation
3.3.3.2 Duration
The duration of the start situation is recorded as a percentage of the set operate time.
If the function block trips, the voltage value is updated at the moment of tripping i.e.
on the rising edge of the TRIP signal. At external triggering, the voltage value is
updated at the moment of triggering i.e. on the rising edge of the input signal TRIGG.
If the function block starts but does not trip, the residual voltage value captured one
fundamental cycle (20 ms at rated frequency 50 Hz) after the beginning of the start
situation will be recorded. The value of the residual voltage Uo is recorded as a
percentage value of the rated voltage Un.
The status data of the input signals BS1 and BS2 as well as the Active group
parameter are recorded at the moment of triggering. The Active group parameter
indicates the setting group valid for the recorded data.
3.3.3.5 Priority
1 Tripping
2 Starting
3 External triggering,
which means that if the function block has started, it will neglect an external
triggering request.
12
ABB Automation ROV1Low, ROV1High, ROV1Inst RE_5_ _
13
RE_5_ _ ROV1Low, ROV1High, ROV1Inst ABB Automation
3.3.4 Events
14
ABB Automation ROV1Low, ROV1High, ROV1Inst RE_5_ _
Reset time 40...1000 ms (depends on the minimum pulse width set for the
TRIP output)
15
1MRS 752326-MUM ROV1_
Issued: 10/1997
Version: F/11.3.2002
Residual Overvoltage Protection
Low-Set Stage (ROV1Low)
High-Set Stage (ROV1High)
Data subject to change without notice Instantaneous Stage (ROV1Inst)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 3
2. Description of Operation.......................................................................... 4
2.1 Configuration....................................................................................... 4
2.2 Measuring mode ................................................................................. 4
2.3 Operation criteria................................................................................. 4
2.4 Setting groups ..................................................................................... 5
2.5 Test mode ........................................................................................... 5
2.6 START and TRIP outputs.................................................................... 5
2.7 Resetting............................................................................................. 6
1. Introduction
1.1 Features
1.2 Application
This document specifies the functions of the residual overvoltage protection function
blocks ROV1Low, ROV1High and ROV1Inst used in products based on the RED 500
Platform. The three stages are identical in operation.
The residual overvoltage protection function blocks are designed for sensitive earth-
fault protection. Suppression of harmonics is possible.
)LJXUH )XQFWLRQEORFNV\PEROVRI529/RZ529+LJKDQG529,QVW
2
Substation Automation ROV1 _
3
ROV1_ Substation Automation
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The residual voltage Uo can be connected
to the Uo input of the function block. Furthermore, digital inputs are connected to the
boolean inputs of the function block and the outputs of the function block are
connected to the output signals.
The function block operates on two alternative measuring principles: the average
value of consecutive instantaneous peak-to-peak values or the numerically calculated
fundamental frequency component of the residual voltage. An MMI parameter or a
serial communication parameter can be used for selecting the measuring mode.
With both the measuring principles, the operation is insensitive to the DC component
and the operation accuracy is defined in the frequency range f/fn=0.95...1.05. In peak-
to-peak measurement, the harmonics of the residual voltage are not suppressed,
whereas in fundamental frequency measurement the harmonics suppression is at least
-50 dB at f = n x fn, where n = 2, 3, 4, 5,...
The function block starts when the residual voltage of the busbar system exceeds the
set start voltage. When the function block starts, the signal START is set to TRUE.
Should the duration of the earth-fault exceed the set definite operate time, the function
block operates. The delay of the heavy-duty output relay is included in the total
operate time. When the function block operates, the signal TRIP is set to TRUE.
The DT timer will be allowed to run only if the signal BS1 is inactive, i.e. its value is
FALSE. When the blocking signal BS1 becomes active, i.e. its value turns to TRUE,
the timer will be stopped (frozen).
4
Substation Automation ROV1 _
When the blocking signal BS2 is active, the TRIP signal cannot be activated. The
TRIP signal can be blocked by activating the signal BS2 until the function block
drops off.
Two different groups of setting values, group 1 and group 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The output signal START is always pulse-shaped. The minimum pulse width of the
corresponding output signal is set via a separate parameter on the MMI or the serial
communication. If the start situation is longer than the set pulse width, the START
signal remains active until the start situation is over. The output signal TRIP may be
non-latching or latching. When the latching mode has been selected, the TRIP signal
remains active until the output is reset even if the operation criteria have reset.
5
ROV1_ Substation Automation
2.7 Resetting
The TRIP output signal and the registers can be reset either via the RESET input, or
over the serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
6
Substation Automation ROV1 _
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for ROV1Low is 44, that for ROV1High 45
and that for ROV1Inst 46.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
7
ROV1_ Substation Automation
8
Substation Automation ROV1 _
9
ROV1_ Substation Automation
The information required for later fault analysis is recorded when the function block
starts, trips, or when the recording function is triggered via the external TRIGG input.
The data of three last operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
The time stamp indicates the rising edge of the START, TRIP or TRIGG signal.
10
Substation Automation ROV1 _
3.3.3.2 Duration
The duration of the start situation is recorded as a percentage of the set operate time.
If the function block trips, the voltage value is updated at the moment of tripping i.e.
on the rising edge of the TRIP signal. At external triggering, the voltage value is
updated at the moment of triggering i.e. on the rising edge of the input signal TRIGG.
If the function block starts but does not trip, the residual voltage value captured one
fundamental cycle (20 ms at rated frequency 50 Hz) after the beginning of the start
situation will be recorded. The value of the residual voltage Uo is recorded as a
percentage value of the rated voltage Un.
The status data of the input signals BS1 and BS2 as well as the Active group
parameter are recorded at the moment of triggering. The Active group parameter
indicates the setting group valid for the recorded data.
3.3.3.5 Priority
1 Tripping
2 Starting
3 External triggering,
which means that if the function block has started, it will neglect an external
triggering request.
11
ROV1_ Substation Automation
12
Substation Automation ROV1 _
3.3.4 Events
13
ROV1_ Substation Automation
Reset time 40...1000 ms (depends on the minimum pulse width set for the
TRIP output)
C -
14
1MRS100070 (Stage 1) RE_5_ _
1MRS100071 (Stage 2) Synchro-Check/
Issued: 10/1998
Version: C Voltage-Check Function
Data subject to change without notice Stage 1 (SCVCSt1)
Stage 2 (SCVCSt2)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 3
2. Description of Operation.......................................................................... 4
2.1 Configuration....................................................................................... 4
2.2 Operation criteria................................................................................. 4
2.3 Operation ............................................................................................ 5
2.3.1 Synchro-check ........................................................................... 5
2.3.2 Voltage-check ............................................................................ 7
2.3.3 Bypass mode ............................................................................. 8
2.3.4 Operation mode ......................................................................... 8
2.3.5 Voltage combine function ......................................................... 12
2.4 Setting groups ................................................................................... 13
2.5 Resetting........................................................................................... 14
1. Introduction
1.1 Features
1.2 Application
This document specifies the functions of the synchro-check function blocks SCVCSt1
and SCVCSt2 used in products based on the RED 500 Platform.
The function block SCVCSt_ is designed to be used for checking the conditions for
circuit-breaker closing. The function can be used for closing ring mains,
interconnecting busbars and connecting generators to the network. The harmonics are
suppressed.
)LJXUH 3URWHFWLRQGLDJUDPV\PERORI6&9&6WB)RU,(&V\PEROVXVHGLQVLQJOH
OLQHGLDJUDPVUHIHUWRWKHPDQXDO7HFKQLFDO'HVFULSWLRQVRI)XQFWLRQV
,QWURGXFWLRQ056080
2
ABB Automation SCVCSt1 RE_5_ _
SCVCSt2
)LJXUH )XQFWLRQEORFNV\PEROVRI6&9&6WDQG6&9&6W
3
RE_5_ _ SCVCSt1 ABB Automation
SCVCSt2
2.1 Configuration
The measuring devices and signal types for analogue channels are selected and
configured in a special dialogue box of the Relay Configuration Tool included in the
CAP 505 Tool Box. Digital inputs are configured in the same programming
environment (the number of selectable analogue inputs, digital inputs and digital
outputs depends on the hardware variant used).
The special measurements dialogue box in the configuration tool is used for selecting
frequency protection for the voltage inputs.
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The phase-to-phase voltage U12 is
connected to the U1 input and correspondingly U12b is connected to the U2 input.
Furthermore, digital inputs are connected to the boolean inputs of the function block,
and in the same way the outputs of the function block are connected to the output
signals.
Note! Frequency measurement must be selected for the voltage inputs used in
SCVCSt_ from the special measurements dialogue box of the configuration tool. Note
that when the voltage combine function is used, frequency measurement must also be
selected for U2.
4
ABB Automation SCVCSt1 RE_5_ _
SCVCSt2
2.3 Operation
The function tacts of the circuit-breaker close. This duration is determined on the
basis of the frequency of the voltages on opposite sides of the CB. The synchro-check
function block has two parallel functions: a synchro-check function and a voltage-
check function.
2.3.1 Synchro-check
The synchro-check function can be used for two different operating conditions. The
most typical case is one where both sides of the circuit breaker to be closed are live
and thus the synchronism is always checked before the circuit breaker is given the
permission to close. In the other situation one or both sides of the circuit breaker to be
closed are dead and, consequently, the frequency and phase differences cannot be
measured, in which case the relay checks the energizing direction.
The purpose of the synchro-check function is to find the instant when the voltages on
both sides of the circuit breaker are synchronized, i.e. they have the same frequency,
are in phase and are of such a magnitude that the concerned busbars or lines can be
regarded as live. When the frequency, phase angle and voltage conditions are
fulfilled, the duration of the synchronized state is checked on the basis of the
frequency and phase differences measured so as to ensure that the conditions will still
be met when the CB closes. Depending on the circuit breaker and the closing system,
the delay from the moment the closing signal is given until the circuit breaker finally
closes is about 50 - 250 ms. The CB operate time selected tells the relay for how long
the conditions at least have to persist.
)LJXUH +\VWHUHVLVRIRI8QLVDSSOLHGZKHQWKHDPSOLWXGHVRIYROWDJHVDUH
FKHFNHG
5
RE_5_ _ SCVCSt1 ABB Automation
SCVCSt2
The network sections on both sides of the CB must be energized. The voltage
magnitudes of the energized networks are determined by the set value for the upper
threshold voltage Umax.
The voltage difference over the CB must be small enough. The voltage difference
allowed is determined by the set voltage difference value dU.
The frequencies of the network sections (voltages) to be connected shall not differ
too much from each other. The frequency conditions are fulfilled when the allowed
frequency difference of the networks to be connected is smaller than the set
frequency difference value df.
The network sections to be connected (voltages) have the same phase angle. The
phase angle conditions are fulfilled when the allowed phase angle difference
between the network voltages is smaller than the set phase angle difference dphi.
The validity time for CB closing conditions, achieved from frequency and phase-
angle differencies, must have a duration of at least the time needed for the closing
of the circuit breaker to be operated (operate time of CB).
When the closing conditions mentioned above are fulfilled simultaneously, the
network voltages are considered to be synchronized and a closing command signal
SC_OK is delivered to the CB.
The threshold voltage Umax, above which the measured bus/line network voltage
must be before the network is considered to be energized.
Voltage difference allowed, absolute value dU. The set value determines the
maximum allowed voltage difference for the synchro-check function.
Frequency difference allowed, absolute value df. The set value determines the
maximum allowed frequency difference for the synchro-check function.
The phase-angle difference allowed, dphi, is an absolute value which means that
there are no demands concerning the phase-angle direction. The set value
determines the maximum allowed phase-angle difference for the synchro-check
function.
The operate time of a circuit breaker is set via the parameter Oper. time of CB.
In asynchronous mode the synchro-check function checks that the voltage, frequency
and phase differences are within the set limits. From the frequency slip (f) the
function predicts the time remaining to the moment when the phase difference
6
ABB Automation SCVCSt1 RE_5_ _
SCVCSt2
exceeds the setting. CB closing is only allowed if the time required for CB closing is
shorter than the predicted time.
In synchronous mode the aim is that the phase difference at the moment of CB closing
is zero. The mode is only possible when the frequency slip on the network is below
0,04% of fn and all the other conditions are fulfilled. If the time required for reaching
a synchronized state exceeds the maximum check time, the function will fail.
2.3.2 Voltage-check
The energizing direction in the voltage-check function is chosen via the parameter
Energizing mode. When the value of the parameter is 0, the voltage-check function
is not in use.
When the energizing direction corresponds to the settings, the situation has to remain
constant for a certain period of time before the close signal is permitted. The purpose
of the operate time (dead time) is to ensure that the dead side remains de-energized
and that the situation is not due to a temporary interference. Should the conditions not
persist for the specified time, the operate time is reset and the procedure is started
over when the conditions are fulfilled again. Circuit-breaker closing is thus not
permitted until the energizing situation has remained constant throughout the set
operate time.
7
RE_5_ _ SCVCSt1 ABB Automation
SCVCSt2
The threshold voltage Umax, above which the measured bus/line network voltage
must be before the network is considered to be energized. The set threshold value
applies to the synchro-check function as well.
The threshold value Umin, below which the measured bus/line network voltage
must be before the network is considered to be non-energized.
Note!
Because the setting ranges of the threshold voltages Umax and Umin partly overlap
each other, the setting conditions may be such that the setting of the non-energized
threshold value Umin is higher than that of the energized threshold value Umax. The
parameters should be set carefully by the user to avoid the setting conditions
mentioned above.
If the parameters SynchroMode and Energizing mode are both set to Not in use,
the SCVCSt_ function block is in bypass mode. This means that in command mode,
the command input is wired straight through to the SC_OK output, and in continuous
mode, the SC_OK output is continuously FALSE. The bypass mode does not affect
the events that are sent.
The closing command conditions for the circuit breaker are checked by the synchro-
check and voltage-check functions. In addition to the closing command conditions,
the delivering of the final closing signal depends on the operation mode selected for
the synchro-check function. Selection of the operation mode depends on whether the
synchro-check function itself directly uses the output signal to close the circuit
breaker (command mode operation) or if another function block (for example a
control function block) performs the closing operation after having received a
command signal from the synchro-check function (continuous mode operation).
The operation mode is selected via the parameter Operate mode. In continuous
mode, the synchro-check function is running continuously checking the synchronism.
When synchronism is detected i.e. the conditions are fulfilled according to the
settings, the output SC_OK is set to TRUE and will remain so as long as the
conditions remain fulfilled.
8
ABB Automation SCVCSt1 RE_5_ _
SCVCSt2
A distinctive difference between the two operation modes is that in the command
mode operation the synchro-check function is controlled by an external command
signal but in the continuous mode operation no external signal is needed. In the
command mode operation the synchro-check function delivers the closing signal
directly to the object to be controlled (a circuit breaker) whereas in the continuous
mode operation the closing signal is delivered via another function block that delivers
the final closing signal.
In the continuous mode operation the closing signal output of the synchro-check
function stays active as long as the closing conditions remain fulfilled and the signal
disappears when the conditions cease. The operation of the synchro-check function
can be blocked by applying a blocking signal to the function.
The continuous mode can be used to provide extra information on synchronism for an
external operating device.
)LJXUH ([DPSOHIRUDFRQILJXUDWLRQZKHUH6&9&6WBLVXVHGLQFRQWLQXRXVPRGH
LHWKHIXQFWLRQEORFNFKHFNVWKHV\QFKURQLVPFRQWLQXRXVO\7KH
LQIRUPDWLRQLVWUDQVIHUUHGWRDQH[WHUQDORSHUDWLQJGHYLFHYLDWKHVLJQDO
RXWSXW%,2BB621RWHWKDWLQWKHFRQWLQXRXVPRGHWKH&RPPDQG
LQSXWLVQRWFRQQHFWHGWKH6&B'8(RXWSXWLVQRWDFWLYHDQGWKHDODUP
RXWSXWVDUHQRWLQXVH
In command mode operation, an external command signal, besides the normal closing
conditions, is needed for delivering the closing signal. The command signal shall
remain active for the set checking time. The closing signal from the synchro-check
function can be blocked by applying the blocking signal to the function.
In the command mode operation the synchro-check function itself controls the
selected object directly via its own output signal. In this case the control function
block delivers the command signal for closing to the synchro-check function for
releasing of a closing signal pulse to the circuit breaker. If, after the delivered
9
RE_5_ _ SCVCSt1 ABB Automation
SCVCSt2
command signal for closing, the closing conditions are fulfilled during a permitted
check time, the synchro-check function delivers a closing signal to the circuit breaker.
)LJXUH ([DPSOHRIDFRQILJXUDWLRQRI&2&%DQG6&9&6WIXQFWLRQVZKHQWKH
FRPPDQGPRGHLVVHOHFWHG6&YHULILHVWKHV\QFKURQLVPZKHQDFORVH
FRPPDQGLVJLYHQDQGFORVHVWKHFLUFXLWEUHDNHUGLUHFWO\YLDLWVRZQ
FRQWURORXWSXWZKHQDOOFRQGLWLRQVDUHIXOILOOHG
The closing signal is delivered only once per activated external closing command
signal. The duration of the delivered closing signal is the set parameter value. If the
delivered command signal disappears or the closing conditions cease before the
maximum length of the command signal is reached, the closing signal will be the set
parameter value. If the external closing command signal and the closing conditions
persist longer than for the length of the set closing signal, the closing signal will have
the length of the set parameter value.
If the command signal delivered to the synchro-check function is too long, the alarm
ALARM_CO is given and the alarm state will persist until the closing command
signal is removed. A failed closing attempt produces the alarm signal ALARM_NC of
about 500 ms, after which the synchro-check function is ready for a new operation
sequence.
The most essential features of the command mode operation are shown in Figures 6, 7
and 8.
10
ABB Automation SCVCSt1 RE_5_ _
SCVCSt2
The length of the closing signal is determined via the parameter Closing signal
length. If the external command signal disappears during the closing operation, the
function block delivers the closing signal as a set value.
Conditions OK
Command
SC_DUE
)LJXUH &ORVLQJVLJQDOOHQJWKLQFRPPDQGPRGH
The setting of the Check time parameter determines also the alarm limit for a
command signal that has remained active. If the command signal is still active after
the pre-set checking time + 5 seconds, the ALARM_CO signal is activated. The alarm
indicates that the control function block has not removed the command signal after
the performed checking operation. To avoid unnecessary alarms, the duration of the
command signal should be set in such a way that the maximum length of the closing
signal under normal conditions is always below checking time + 5 seconds.
Conditions OK
SC_DUE
5s
ALARM_CO
commsign
)LJXUH 'HWHUPLQDWLRQRIWKHDODUPOLPLWIRUDQDFWLYHFRPPDQGVLJQDO
Closing is permitted during the check time starting from the moment when the
external command signal is activated. The command signal has to be active during the
whole pre-set checking time, which means that the value of the set check time must
also be considered when the length of the external command signal to be delivered to
the function block is determined. If the closing conditions get fulfilled during the
check time, a closing signal is delivered to the circuit breaker. If the closing
conditions are not met, ALARM_NC will be activated for 500 ms after the check time
ceases.
11
RE_5_ _ SCVCSt1 ABB Automation
SCVCSt2
Conditions OK
SC_DUE
SC_OK
)LJXUH 'HWHUPLQDWLRQRIWKHFKHFNLQJWLPHIRUFORVLQJ
When the voltage combine function is in use, the function block calculates phase-to-
phase voltage U12 internally from phase-to-earth voltages U1 and U2.
U1
U12
U3 U2
VoltComb
)LJXUH 'HILQLWLRQRI8
The signals that are connected to the inputs of SCVCSt_ are U1 and U12. Note that
phase-to-earth voltage U2 has to be available and measureable in one of the analogue
channels of the protection relay, otherwise a configuration error is generated.
When using the voltage combine function the voltage connected to the U2 pin should
always be U12.
)LJXUH &RQQHFWLRQRIYROWDJHVLJQDOVWR6&9&6WIXQFWLRQZKHQWKHYROWDJH
FRPELQHIXQFWLRQLVXVHG,QDGGLWLRQ8PXVWEHGHILQHGLQRQHRIWKH
DQDORJXHFKDQQHOV
12
ABB Automation SCVCSt1 RE_5_ _
SCVCSt2
REF54x
U12 SCVCSt1
U1 U1
U2
U3 U2
U12
U1
U2
U3
)LJXUH ([DPSOHRIDFRQILJXUDWLRQZKHUHWKHYROWDJHFRPELQHIXQFWLRQFDQEH
XVHG
The voltage combine function can be taken into use by setting the control parameter
VoltCombine to 1. VoltCombine is a special parameter that affects the analogue
measurements of the feeder terminal. Thus, for the parameter to take effect, the new
parameter value has to be stored via the parameter Store and the relay has to be
reset via the parameter Software reset in the MMI menu Configuration/General.
Note! Do not reset the relay before storing has been completed successfully.
Two different groups of setting values, group 1 and group 2, are available for
SCVCSt_. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
13
RE_5_ _ SCVCSt1 ABB Automation
SCVCSt2
2.5 Resetting
The recorded data can be reset either via the RESET input, or over the serial bus or
the local MMI.
14
ABB Automation SCVCSt1 RE_5_ _
SCVCSt2
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for SCVCSt1 is 70 and that for SCVCSt2 71.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
15
RE_5_ _ SCVCSt1 ABB Automation
SCVCSt2
16
ABB Automation SCVCSt1 RE_5_ _
SCVCSt2
Event mask 1 V101 0...255 - 255 R/W Event mask 1 for event
transmission (E0 ... E7)
Event mask 2 V103 0...255 - 255 R/W Event mask 2 for event
transmission (E0 ... E7)
Event mask 3 V105 0...255 - 255 R/W Event mask 3 for event
transmission (E0 ... E7)
Event mask 4 V107 0...255 - 255 R/W Event mask 4 for event
transmission (E0 ... E7)
1)
Energizing mode 0=Not in use, 1 = U1->U2 or U1<-U2, 2 = U1->U2, 3= U1<-U2,
4 = U1->U2 or U1<-U2 or both "cold"
2)
Operation mode 0 = Command mode, 1 = Continuous mode
3)
Synchro mode 0 = Not in use,1 = Asynchronous mode, 2 = Synchronous mode
4)
Group selection 0 = Group1, 1 = Group2, 2 = GROUP-input
5)
Active group 0 = Group1, 1 = Group2
6)
Voltage combine 0 = Disabled, 1 = Enabled
17
RE_5_ _ SCVCSt1 ABB Automation
SCVCSt2
3.3.3.1 General
The information required for later analysis is recorded when the function block
activates the SC_OK output.
The data of three last operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
18
ABB Automation SCVCSt1 RE_5_ _
SCVCSt2
The time stamp indicates the rising edge of the SC_OK signal.
If the function block trips, the measured voltage, phase angle and frequency values are
updated at the moment of tripping i.e. on the rising edge of the SC_OK signal. Thus
the values of the voltages, phase angles and frequencies always originate from the
same moment.
The voltages are recorded as multiples of the rated voltage Un. The phase angles are
recorded in degrees. The frequencies are recorded in Hertz.
The status data of the Active group parameter is recorded at the rising edge of the
SC_OK signal.
19
RE_5_ _ SCVCSt1 ABB Automation
SCVCSt2
20
ABB Automation SCVCSt1 RE_5_ _
SCVCSt2
3.3.4 Events
21
RE_5_ _ SCVCSt1 ABB Automation
SCVCSt2
SCVCSt2 D -
22
1MRS752327-MUM SCVCSt _
Synchro-Check/
Issued: 10/1998
Version: D/25.1.2002 Voltage-Check Function
Stage 1 (SCVCSt1)
Data subject to change without notice Stage 2 (SCVCSt2)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 3
2. Description of Operation.......................................................................... 4
2.1 Configuration....................................................................................... 4
2.2 Operation criteria................................................................................. 4
2.3 Operation ............................................................................................ 5
2.3.1 Synchro-check ........................................................................... 5
2.3.2 Voltage-check ............................................................................ 7
2.3.3 Bypass mode ............................................................................. 8
2.3.4 Operation mode ......................................................................... 8
2.3.5 Voltage combine function ......................................................... 12
2.4 Setting groups ................................................................................... 13
2.5 Resetting........................................................................................... 14
1. Introduction
1.1 Features
1.2 Application
This document specifies the functions of the synchro-check function blocks SCVCSt1
and SCVCSt2 used in products based on the RED 500 Platform.
The function block SCVCSt_ is designed to be used for checking the conditions for
circuit-breaker closing. The function can be used for closing ring mains,
interconnecting busbars and connecting generators to the network. The harmonics are
suppressed.
)LJXUH 3URWHFWLRQGLDJUDPV\PERORI6&9&6WB)RU,(&V\PEROVXVHGLQVLQJOH
OLQHGLDJUDPVUHIHUWRWKHPDQXDO7HFKQLFDO'HVFULSWLRQVRI)XQFWLRQV
,QWURGXFWLRQ056080
2
Substation Automation SCVCSt_
)LJXUH )XQFWLRQEORFNV\PEROVRI6&9&6WDQG6&9&6W
3
SCVCSt_ Substation Automation
2.1 Configuration
The measuring devices and signal types for analogue channels are selected and
configured in a special dialogue box of the Relay Configuration Tool included in the
CAP 505 Tool Box. Digital inputs are configured in the same programming
environment (the number of selectable analogue inputs, digital inputs and digital
outputs depends on the hardware variant used).
The special measurements dialogue box in the configuration tool is used for selecting
frequency protection for the voltage inputs.
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The phase-to-phase voltage U12 is
connected to the U1 input and correspondingly U12b is connected to the U2 input.
Furthermore, digital inputs are connected to the boolean inputs of the function block,
and in the same way the outputs of the function block are connected to the output
signals.
Note! Frequency measurement must be selected for the voltage inputs used in
SCVCSt_ from the special measurements dialogue box of the configuration tool. Note
that when the voltage combine function is used, frequency measurement must also be
selected for U2.
4
Substation Automation SCVCSt_
2.3 Operation
The function tacts of the circuit-breaker close. This duration is determined on the
basis of the frequency of the voltages on opposite sides of the CB. The synchro-check
function block has two parallel functions: a synchro-check function and a voltage-
check function.
2.3.1 Synchro-check
The synchro-check function can be used for two different operating conditions. The
most typical case is one where both sides of the circuit breaker to be closed are live
and thus the synchronism is always checked before the circuit breaker is given the
permission to close. In the other situation one or both sides of the circuit breaker to be
closed are dead and, consequently, the frequency and phase differences cannot be
measured, in which case the relay checks the energizing direction.
The purpose of the synchro-check function is to find the instant when the voltages on
both sides of the circuit breaker are synchronized, i.e. they have the same frequency,
are in phase and are of such a magnitude that the concerned busbars or lines can be
regarded as live. When the frequency, phase angle and voltage conditions are
fulfilled, the duration of the synchronized state is checked on the basis of the
frequency and phase differences measured so as to ensure that the conditions will still
be met when the CB closes. Depending on the circuit breaker and the closing system,
the delay from the moment the closing signal is given until the circuit breaker finally
closes is about 50 - 250 ms. The CB operate time selected tells the relay for how long
the conditions at least have to persist.
)LJXUH +\VWHUHVLVRIRI8QLVDSSOLHGZKHQWKHDPSOLWXGHVRIYROWDJHVDUH
FKHFNHG
5
SCVCSt_ Substation Automation
The network sections on both sides of the CB must be energized. The voltage
magnitudes of the energized networks are determined by the set value for the upper
threshold voltage Umax.
The voltage difference over the CB must be small enough. The voltage difference
allowed is determined by the set voltage difference value dU.
The frequencies of the network sections (voltages) to be connected shall not differ
too much from each other. The frequency conditions are fulfilled when the allowed
frequency difference of the networks to be connected is smaller than the set
frequency difference value df.
The network sections to be connected (voltages) have the same phase angle. The
phase angle conditions are fulfilled when the allowed phase angle difference
between the network voltages is smaller than the set phase angle difference dphi.
The validity time for CB closing conditions, achieved from frequency and phase-
angle differencies, must have a duration of at least the time needed for the closing
of the circuit breaker to be operated (operate time of CB).
When the closing conditions mentioned above are fulfilled simultaneously, the
network voltages are considered to be synchronized and a closing command signal
SC_OK is delivered to the CB.
The threshold voltage Umax, above which the measured bus/line network voltage
must be before the network is considered to be energized.
Voltage difference allowed, absolute value dU. The set value determines the
maximum allowed voltage difference for the synchro-check function.
Frequency difference allowed, absolute value df. The set value determines the
maximum allowed frequency difference for the synchro-check function.
The phase-angle difference allowed, dphi, is an absolute value which means that
there are no demands concerning the phase-angle direction. The set value
determines the maximum allowed phase-angle difference for the synchro-check
function.
The operate time of a circuit breaker is set via the parameter Oper. time of CB.
In asynchronous mode the synchro-check function checks that the voltage, frequency
and phase differences are within the set limits. From the frequency slip (f) the
function predicts the time remaining to the moment when the phase difference
6
Substation Automation SCVCSt_
exceeds the setting. CB closing is only allowed if the time required for CB closing is
shorter than the predicted time.
In synchronous mode the aim is that the phase difference at the moment of CB closing
is zero. The mode is only possible when the frequency slip on the network is below
0,04% of fn and all the other conditions are fulfilled. If the time required for reaching
a synchronized state exceeds the maximum check time, the function will fail.
2.3.2 Voltage-check
The energizing direction in the voltage-check function is chosen via the parameter
Energizing mode. When the value of the parameter is 0, the voltage-check function
is not in use.
When the energizing direction corresponds to the settings, the situation has to remain
constant for a certain period of time before the close signal is permitted. The purpose
of the operate time (dead time) is to ensure that the dead side remains de-energized
and that the situation is not due to a temporary interference. Should the conditions not
persist for the specified time, the operate time is reset and the procedure is started
over when the conditions are fulfilled again. Circuit-breaker closing is thus not
permitted until the energizing situation has remained constant throughout the set
operate time.
7
SCVCSt_ Substation Automation
The threshold voltage Umax, above which the measured bus/line network voltage
must be before the network is considered to be energized. The set threshold value
applies to the synchro-check function as well.
The threshold value Umin, below which the measured bus/line network voltage
must be before the network is considered to be non-energized.
Note!
Because the setting ranges of the threshold voltages Umax and Umin partly overlap
each other, the setting conditions may be such that the setting of the non-energized
threshold value Umin is higher than that of the energized threshold value Umax. The
parameters should be set carefully by the user to avoid the setting conditions
mentioned above.
If the parameters SynchroMode and Energizing mode are both set to Not in use,
the SCVCSt_ function block is in bypass mode. This means that in command mode,
the command input is wired straight through to the SC_OK output and in continuous
mode, the SC_OK output is continuously FALSE.
Note!
In bypass mode events are sent as in normal operation (ie. when output changes
accure).
The closing command conditions for the circuit breaker are checked by the synchro-
check and voltage-check functions. In addition to the closing command conditions,
the delivering of the final closing signal depends on the operation mode selected for
the synchro-check function. Selection of the operation mode depends on whether the
synchro-check function itself directly uses the output signal to close the circuit
breaker (command mode operation) or if another function block (for example a
control function block) performs the closing operation after having received a
command signal from the synchro-check function (continuous mode operation).
The operation mode is selected via the parameter Operate mode. In continuous
mode, the synchro-check function is running continuously checking the synchronism.
8
Substation Automation SCVCSt_
When synchronism is detected i.e. the conditions are fulfilled according to the
settings, the output SC_OK is set to TRUE and will remain so as long as the
conditions remain fulfilled.
A distinctive difference between the two operation modes is that in the command
mode operation the synchro-check function is controlled by an external command
signal but in the continuous mode operation no external signal is needed. In the
command mode operation the synchro-check function delivers the closing signal
directly to the object to be controlled (a circuit breaker) whereas in the continuous
mode operation the closing signal is delivered via another function block that delivers
the final closing signal.
In the continuous mode operation the closing signal output of the synchro-check
function stays active as long as the closing conditions remain fulfilled and the signal
disappears when the conditions cease. The operation of the synchro-check function
can be blocked by applying a blocking signal to the function.
The continuous mode can be used to provide extra information on synchronism for an
external operating device.
)LJXUH ([DPSOHIRUDFRQILJXUDWLRQZKHUH6&9&6WBLVXVHGLQFRQWLQXRXVPRGH
LHWKHIXQFWLRQEORFNFKHFNVWKHV\QFKURQLVPFRQWLQXRXVO\7KH
LQIRUPDWLRQLVWUDQVIHUUHGWRDQH[WHUQDORSHUDWLQJGHYLFHYLDWKHVLJQDO
RXWSXW%,2BB621RWHWKDWLQWKHFRQWLQXRXVPRGHWKH&RPPDQG
LQSXWLVQRWFRQQHFWHGWKH6&B'8(RXWSXWLVQRWDFWLYHDQGWKHDODUP
RXWSXWVDUHQRWLQXVH
In command mode operation, an external command signal, besides the normal closing
conditions, is needed for delivering the closing signal. The command signal shall
remain active for the set checking time. The closing signal from the synchro-check
function can be blocked by applying the blocking signal to the function.
9
SCVCSt_ Substation Automation
In command mode operation, the synchro-check function itself controls the selected
object directly via its own output signal. In this case the control function block
delivers the command signal for closing to the synchro-check function for releasing of
a closing signal pulse to the circuit breaker. If, after the delivered command signal for
closing, the closing conditions are fulfilled during a permitted check time, the
synchro-check function delivers a closing signal to the circuit breaker.
)LJXUH ([DPSOHRIDFRQILJXUDWLRQRI&2&%DQG6&9&6WIXQFWLRQVZKHQWKH
FRPPDQGPRGHLVVHOHFWHG6&YHULILHVWKHV\QFKURQLVPZKHQDFORVH
FRPPDQGLVJLYHQDQGFORVHVWKHFLUFXLWEUHDNHUGLUHFWO\YLDLWVRZQ
FRQWURORXWSXWZKHQDOOFRQGLWLRQVDUHIXOILOOHG
The closing signal is delivered only once per activated external closing command
signal. The duration of the delivered closing signal is the set parameter value. If the
delivered command signal disappears or the closing conditions cease before the
maximum length of the command signal is reached, the closing signal will be the set
parameter value. If the external closing command signal and the closing conditions
persist longer than for the length of the set closing signal, the closing signal will have
the length of the set parameter value.
If the command signal delivered to the synchro-check function is too long, the alarm
ALARM_CO is given and the alarm state will persist until the closing command
signal is removed. A failed closing attempt produces the alarm signal ALARM_NC of
about 500 ms, after which the synchro-check function is ready for a new operation
sequence.
The most essential features of the command mode operation are shown in Figures 6, 7
and 8.
10
Substation Automation SCVCSt_
The length of the closing signal is determined via the parameter Closing signal
length. If the external command signal disappears during the closing operation, the
function block delivers the closing signal as a set value.
Conditions OK
Command
SC_DUE
)LJXUH &ORVLQJVLJQDOOHQJWKLQFRPPDQGPRGH
The setting of the Check time parameter determines also the alarm limit for a
command signal that has remained active. If the command signal is still active after
the pre-set checking time + 5 seconds, the ALARM_CO signal is activated. The alarm
indicates that the control function block has not removed the command signal after
the performed checking operation. To avoid unnecessary alarms, the duration of the
command signal should be set in such a way that the maximum length of the closing
signal under normal conditions is always below checking time + 5 seconds.
Conditions OK
SC_DUE
5s
ALARM_CO
commsign
)LJXUH 'HWHUPLQDWLRQRIWKHDODUPOLPLWIRUDQDFWLYHFRPPDQGVLJQDO
Closing is permitted during the check time starting from the moment when the
external command signal is activated. The command signal has to be active during the
whole pre-set checking time, which means that the value of the set check time must
also be considered when the length of the external command signal to be delivered to
the function block is determined. If the closing conditions get fulfilled during the
check time, a closing signal is delivered to the circuit breaker. If the closing
conditions are not met, ALARM_NC will be activated for 500 ms after the check time
ceases.
11
SCVCSt_ Substation Automation
Conditions OK
SC_DUE
SC_OK
)LJXUH 'HWHUPLQDWLRQRIWKHFKHFNLQJWLPHIRUFORVLQJ
When the voltage combine function is in use, the function block calculates phase-to-
phase voltage U12 internally from phase-to-earth voltages U1 and U2.
U1
U12
U3 U2
VoltComb
)LJXUH 'HILQLWLRQRI8
The signals that are connected to the inputs of SCVCSt_ are U1 and U12. Note that
phase-to-earth voltage U2 has to be available and measureable in one of the analogue
channels of the protection relay, otherwise a configuration error is generated.
When using the voltage combine function the voltage connected to the U2 pin should
always be U12.
)LJXUH &RQQHFWLRQRIYROWDJHVLJQDOVWR6&9&6WIXQFWLRQZKHQWKHYROWDJH
FRPELQHIXQFWLRQLVXVHG,QDGGLWLRQ8PXVWEHGHILQHGLQRQHRIWKH
DQDORJXHFKDQQHOV
12
Substation Automation SCVCSt_
REF54x
U12 SCVCSt1
U1 U1
U2
U3 U2
U12
U1
U2
U3
)LJXUH ([DPSOHRIDFRQILJXUDWLRQZKHUHWKHYROWDJHFRPELQHIXQFWLRQFDQEH
XVHG
The voltage combine function can be taken into use by setting the control parameter
VoltCombine to 1. VoltCombine is a special parameter that affects the analogue
measurements of the feeder terminal. Thus, for the parameter to take effect, the new
parameter value has to be stored via the parameter Store and the relay has to be
reset via the parameter Software reset in the MMI menu Configuration/General.
Note! Do not reset the relay before storing has been completed successfully.
Two different groups of setting values, group 1 and group 2, are available for
SCVCSt_. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
13
SCVCSt_ Substation Automation
2.5 Resetting
The recorded data can be reset either via the RESET input, or over the serial bus or
the local MMI.
14
Substation Automation SCVCSt_
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for SCVCSt1 is 70 and that for SCVCSt2 71.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
15
SCVCSt_ Substation Automation
16
Substation Automation SCVCSt_
Event mask 1 V101 0...255 - 255 R/W Event mask 1 for event
transmission (E0 ... E7)
Event mask 2 V103 0...255 - 255 R/W Event mask 2 for event
transmission (E0 ... E7)
Event mask 3 V105 0...255 - 255 R/W Event mask 3 for event
transmission (E0 ... E7)
Event mask 4 V107 0...255 - 255 R/W Event mask 4 for event
transmission (E0 ... E7)
1)
Energizing mode 0=Not in use, 1 = U1->U2 or U1<-U2, 2 = U1->U2, 3= U1<-U2,
4 = U1->U2 or U1<-U2 or both "cold"
2)
Operation mode 0 = Command mode, 1 = Continuous mode
3)
Synchro mode 0 = Not in use,1 = Asynchronous mode, 2 = Synchronous mode
4)
Group selection 0 = Group1, 1 = Group2, 2 = GROUP-input
5)
Active group 0 = Group1, 1 = Group2
6)
Voltage combine 0 = Disabled, 1 = Enabled
17
SCVCSt_ Substation Automation
3.3.3.1 General
The information required for later analysis is recorded when the function block
activates the SC_OK output.
The data of three last operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
18
Substation Automation SCVCSt_
The time stamp indicates the rising edge of the SC_OK signal.
If the function block trips, the measured voltage, phase angle and frequency values are
updated at the moment of tripping i.e. on the rising edge of the SC_OK signal. Thus
the values of the voltages, phase angles and frequencies always originate from the
same moment.
The voltages are recorded as multiples of the rated voltage Un. The phase angles are
recorded in degrees. The frequencies are recorded in Hertz.
The status data of the Active group parameter is recorded at the rising edge of the
SC_OK signal.
19
SCVCSt_ Substation Automation
20
Substation Automation SCVCSt_
3.3.4 Events
21
SCVCSt_ Substation Automation
H -
SCVCSt2 D -
G -
22
1MRS100030 RE_5_ _
Issued: 11/1997
Version: D
Switchgroups
Data subject to change without notice
(SWGRP1...SWGRP20)
Contents
1. Description................................................................................................ 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 3
2. Description of Operation.......................................................................... 4
2.1 Configuration....................................................................................... 4
3. Setting Values........................................................................................... 5
1. Description
1.1 Features
The 20 switchgroups SWGRP1 to SWGRP20 are used for changing the functionality
of the configuration via the MMI or via serial communication. Each switchgroup
contains two checksums; checksum 1 and checksum 2. The actual checksum is
selected either with a boolean signal in the logic of the Relay Configuration Tool, or
by presetting the checksum via the local or external MMI.
1.2 Application
The SWGRP function blocks can be used in the Relay Configuration Tool to change
the functionality of configurations via the MMI.
)LJXUH $VDQH[DPSOHWKHIXQFWLRQEORFNV\PERORI6:*53
2
ABB Automation Switchgroups RE_5_ _
SWGRP1...SWGRP20
3
RE_5_ _ Switchgroups ABB Automation
SWGRP1...SWGRP20
2.1 Configuration
The SWGRP functions have their own parameter settings, both on the local MMI and
in the Relay Setting Tool, with which the positions of switches inside the SWGRP
functions can be controlled.
The setting parameter Group selection (F030V01) is used for selecting the
checksum 1 or 2. When the parameter Group selection is set to Checksum1, the
checksum value is used for controlling the switchgroup switches SWGRP**/1....8. In
case the parameter is set to Checksum2, the value is used for switching control. The
group input of SWGRP takes place if the parameter Group selection is set to
Group input. A boolean signal is used to select between the checksum 1 (group
input is low: FALSE) and the checksum 2 (group input is high: TRUE). The group
input can be interconnected in the relay configuration to any boolean type of signal
such as digital inputs, protection/control/condition monitoring etc. function blocks,
boolean functions, flip-flops etc.
4
ABB Automation Switchgroups RE_5_ _
SWGRP1...SWGRP20
5
RE_5_ _ Switchgroups ABB Automation
SWGRP1...SWGRP20
6
1MRS752374-MUM SWGRP_
Issued: 11/1997
Version: E/19.04.2002
Switchgroups
Data subject to change without notice
(SWGRP1...SWGRP20)
Contents
1. Description................................................................................................ 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 3
1. Description
1.1 Features
The 20 function blocks SWGRP1 to SWGRP20 can be used for changing the
functionality of the configuration via the HMI or via serial communication. Each
switchgroup contains two checksums: checksum 1 and checksum 2. The actual
checksum is selected either with a Boolean signal in the logic of the Relay
Configuration Tool, or by presetting the checksum via the local HMI or the Relay
Setting Tool.
1.2 Application
The SWGRP function blocks can be used in the Relay Configuration Tool to change
the functionality of configurations via the HMI.
)LJXUH$VDQH[DPSOHWKHIXQFWLRQEORFNV\PERORI6:*53
2
Substation Automation SWGRP_
3
SWGRP_ Substation Automation
2.1 Configuration
Each of the SWGRP functions have their own parameter settings, accessible both on
the local HMI and in the Relay Setting Tool, with which the positions of switches
inside the SWGRP functions can be controlled.
The setting parameter Group selection is used for selecting the checksum 1 or 2.
Each switchgroup has its own group selection control setting, e.g. SWGRP1 =
F030V001, SWGRP2 = F030V002 etc. When the parameter Group selection is set
to Checksum1, the checksum value is used for controlling the switchgroup switches
SWGRP**/1....8. In case the parameter is set to Checksum2, the value is used for
switching control. The group input of SWGRP takes place if the parameter Group
selection is set to Group input. A Boolean signal is used for selecting between the
checksum 1 (group input is low: FALSE) and the checksum 2 (group input is high:
TRUE). The group input can be connected in the relay configuration to any Boolean
signal such as digital inputs, outputs of application function blocks, generic functions
etc.
When a switch is open, the corresponding output remains FALSE regardless of the
input. Parallel switches can be controlled individually by summing corresponding
weight factors to the checksum setting.
The active checksum is available as a number in the output CHKSUM. This value can
be used in the configuration directly as a general purpose setting value. The data type
of this output is unsigned short integer and the value range is 0...255. This value range
can be adjusted to the application requirements using generic functions.
4
Substation Automation SWGRP_
)LJ$QH[DPSOHRIKRZWRXVHWKHDFWLYHFKHFNVXP
Above an example of how to use the active checksum value as a general purpose
setting value to have an adjustable time delay. The unsigned short integer is first
converted to an unsigned double integer. The preset time duration input PT in generic
timer TON is of data type TIME. The underlying representation of TIME data type in
the RED 500 devices is an unsigned double integer multiple of milliseconds.
Therefore the range of CHKSUM output is multiplied with 1000 to have a setting
value range of 0...255 seconds in steps of 1 second.
5
SWGRP_ Substation Automation
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for SWGRP1...20 is 30.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events in the HMI or in serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / HMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the HMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
6
Substation Automation SWGRP_
7
SWGRP_ Substation Automation
8
Substation Automation SWGRP_
9
1MRS100047 RE_5_ _
Issued: 10/1998
Version: C
Three-Phase Thermal Overload
Data subject to change without notice Protection for Cables
(TOL3Cab)
Contents
1. Introduction .............................................................................................. 3
1.1 Features.............................................................................................. 3
1.2 Application........................................................................................... 3
1.3 Input description.................................................................................. 4
1.4 Output description ............................................................................... 5
2. Description of Operation.......................................................................... 6
2.1 Configuration....................................................................................... 6
2.2 Measuring mode ................................................................................. 6
2.3 Operation criteria................................................................................. 7
2.3.1 Principle of the thermal model applied........................................ 7
2.3.2 TRIP output................................................................................ 8
2.3.3 START output ............................................................................ 8
2.3.4 CU_ALARM output..................................................................... 8
2.3.5 COND_TEMP & TEMP_PERCENT outputs ............................... 9
2.3.6 COOL_TIME output ................................................................. 10
2.3.7 TRIP_TIME output ................................................................... 10
2.3.8 Compensation of ambient temperature .................................... 10
2.3.9 Reclose inhibit.......................................................................... 11
2.3.10 Temperature sensor supervision .............................................. 11
2.3.11 BLOCK input ............................................................................ 11
2.4 Setting groups ................................................................................... 12
2.5 Test mode ......................................................................................... 12
2.6 START, TRIP and CBFP outputs ...................................................... 12
2.7 Resetting........................................................................................... 13
4. Technical Data.........................................................................................23
2
ABB Automation TOL3Cab RE_5_ _
1. Introduction
1.1 Features
1.2 Application
This document specifies the function of the three-phase thermal overload protection
function block TOL3Cab used in products based on the RED 500 Platform.
TOL3Cab is designed for the thermal protection of three-phase power cables and
overhead lines.
3
RE_5_ _ TOL3Cab ABB Automation
)LJXUH )XQFWLRQEORFNV\PERORI72/&DEWKHWKUHHSKDVHWKHUPDORYHUORDG
SURWHFWLRQIRUFDEOHV
4
ABB Automation TOL3Cab RE_5_ _
5
RE_5_ _ TOL3Cab ABB Automation
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The phase currents IL1, IL2 and IL3 are
connected to the corresponding IL1, IL2 and IL3 inputs of the function block. The
measuring principle for the current inputs is defined as TRUE RMS current
measurement. The variables indicating the invalidity of sensor measurement are
connected to the Boolean type of input SENS_IV as presented in Figure 3 below.
)LJXUH ([DPSOHIRUWKHFRQQHFWLRQRIWKH6(16B,9LQSXWWKDWLQGLFDWHVWKH
LQYDOLGLW\RIVHQVRUPHDVXUHPHQW
Provided the sensor measurement is not used to compensate the ambient temperature,
the SENS_IV, SENSOR1 and SENSOR2 inputs can be left unconnected. Digital
inputs are connected to the boolean inputs of the function block and in the same way,
the outputs of the function block are connected to the output signals.
The calculation of the thermal model is based on the TRUE RMS measuring
principle. The thermal load is calculated by means of the highest phase current value.
6
ABB Automation TOL3Cab RE_5_ _
TOL3Cab applies the thermal model of one time constant for temperature
measurement, which means that both the temperature rise and the cooling follow an
exponential curve. The formula applied in calculating the cable temperature is
presented below.
2 t
I -
=[ ( MAX REF )] (1 e ) + AMB
I CABLE
where
REF Reference temp temperature in which the rated current has been
defined; for example, +15 C for underground
cables and +25 C for overhead cables
Time constant time constant for the temperature rise and cooling
of a cable
AMB Ambient temp ambient temperature, which can be either a set
value or a one measured by sensors
7
RE_5_ _ TOL3Cab ABB Automation
In the initializing stage, i.e. when the auxiliary voltage is connected to the relay, the
function block assumes that the cable temperature has risen to 50% of the difference
between the parameter values Maximum temp and Ambient temp. For example, if
the maximum temperature has been set to + 90 C (cable with PEX insulation) and the
ambient temperature is + 20 C, the relay assumes a temperature of + 55 C for the
cable. The same temperature rise of 50% is also assumed for the cable when the
operation mode is set into use i.e. the parameter is set as follows:
1 = ON; no sensors,
2 = ON; Sensor 1 or
3 = ON; Sensors 1&2.
The so-called delayed trip is set into use by giving the Trip temperature parameter a
value higher than 100% and the Trip delay parameter one higher than 0. For
example, the trip temperature can be set to 120% and the trip delay to 60 min, in
which case the function block trips when the cable load remains above 100% for 60
minutes but does not exceed 120%.
If the TRIP output is chosen not to be used, the parameter is set as follows: ...\Control
setting\Trip & Start = Disabled.
The START output becomes active when the calculated conductor temperature
exceeds the setting of the Prior alarm parameter that can be given a value in the
range 40% to 100%. If the START output is chosen not to be used, the parameter is
set as follows: ...\Control setting\Trip & Start = Disabled.
The CU_ALARM output is activated when one of the three phase currents becomes
so high that even if it remains the same, the cable temperature will exceed the
maximum temperature set for the cable. An active CU_ALARM output is indicated
by a blinking start LED (yellow) on the MMI.
8
ABB Automation TOL3Cab RE_5_ _
1 Via the MMI of the relay, in the view MAIN MENU / Protection lib. / TOL3Cab /
Output data
2 Via serial communication provided the event E10 has not been excluded via the
Event mask control parameter of TOL3Cab. Note that only the percentual
temperature rise TEMP_PERCENT is sent with the event.
3 Via the MIMIC view of the relay provided the connection presented in Figure 4
below has been configured with the Relay Configuration Tool
)LJXUH *UDSKLFUHSUHVHQWDWLRQRIWKH&21'B7(03DQG7(03B3(5&(17
RXWSXWVLQWKH0,0,&YLHZRIWKHUHOD\
TOL3Cab sends an event containing the percentual temperature rise of the conductor
to serial communication once a minute at the most frequent. However, if the change in
the conductor temperature is less than 0,5% of the previous value sent, no event is
sent to serial communication even though one minute has passed since the previous
event.
9
RE_5_ _ TOL3Cab ABB Automation
The COOL_TIME output indicates in full minutes the time required for the cable to
cool below the set temperature limit i.e. value of the Reclosure temp. parameter.
The cooling time left (min) can be monitored in the following three ways:
1 Via the MMI of the relay, in the view MAIN MENU / Protection lib. / TOL3Cab /
Output data
2 Via serial communication provided the event E11 has not been excluded via the
Event mask control parameter of TOL3Cab
3 Via the MIMIC view of the relay provided the connection has been configured
with the Relay Configuration Tool. For an exemplary connection, see Figure 4
above.
The TRIP_TIME output indicates the operate time of the function block when the
current remains at the present level. The time estimate can be monitored in the
following three ways:
1 Via the MMI of the relay, in the view MAIN MENU / Protection lib. / TOL3Cab /
Output data
2 Via serial communication provided the event E16 has not been excluded via the
Event mask control parameter of TOL3Cab
3 Via the MIMIC view of the relay provided the connection has been configured
with the Relay Configuration Tool. For an exemplary connection, see Figure 4
above.
In the thermal model (see the formula above in section Principle of the thermal
model applied) the influence of ambient temperature is compensated by the
parameter Ambient temp which can be either a set value or one measured by
temperature sensors. Compensating the ambient temperature is crucial for the correct
function of the thermal model since the environmental conditions of cables to be
protected vary considerably.
The principle of ambient temperature compensation is defined via the control setting
parameter Operation mode. When no external sensors are used to measure the
ambient temperature, the Operation mode parameter is given the value 1 (=ON; no
sensors). In this case the temperature value applied in the thermal model is the one set
for the Ambient temp parameter. On the other hand, when external sensors are used,
the Operation mode parameter is given the value 2 or 3. When the value 2 (=Sensor
1) is set for the parameter, one temperature sensor is used which is connected to the
SENSOR1 input of the function block. The value 3 (=Sensors 1&2) means that two
sensors are used for measuring the ambient temperature, in which case the function
10
ABB Automation TOL3Cab RE_5_ _
applies the higher of the two temperature values in the thermal model for
compensating the ambient temperature.
At any time, the ambient temperature value used for calculating the conductor
temperature can be checked via the MMI or via serial communication in the menu
... / TOL3Cab / Control setting / Ambient temp.
After TOL3Cab has tripped, reclosing is not possible until the conductor temperature
calculated by the formula above (see section Principle of the thermal model
applied) falls below the value set for the Reclosure temp parameter, because the
function block holds the TRIP output active. If the reclosing inhibit is chosen not to
be used, the parameter is set to 100%.
TOL3Cab will wait 10 seconds before starting the sensor measurement of ambient
temperature, after which, provided the average measurement value is not within the
allowable range of -40 to +70 degrees, the function block sends a Sensor error event
(E15) and activates the SENSERR output. Moreover, a fault detected in sensor
measurement always causes the start LED (yellow) to blink on the MMI. If the fault is
detected at start-up, the value set for the Ambient temp parameter is applied as
ambient temperature.
The SENSERR output is also activated if TOL3Cab later detects a rapid change of
more than 5 degrees in the measured temperature. As a result the function block sends
a Sensor error event and blinks the start LED again, after which it applies the set
temperature value for compensating the ambient temperature.
If the BLOCK input is active, the TRIP output cannot be activated, but TOL3Cab still
continues measuring the conductor temperature. Thus, activating the BLOCK signal
prevents neither temperature measurement nor activation of the START or
CU_ALARM outputs.
11
RE_5_ _ TOL3Cab ABB Automation
Two different groups of setting values, group 1 and group 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The START signal remains active until the start situation is over. The output signal
TRIP may have a non-latching or latching feature. When the latching mode has been
selected, the TRIP signal remains active until the output is reset even if the operation
criteria have reset.
The function block provides a delayed trip signal CBFP after the TRIP signal unless
the fault has disappeared during the set CBFP delay. In circuit-breaker failure
protection the CBFP output can be used to operate a circuit breaker in front of the
circuit breaker of the feeder. The control parameter Trip pulse also sets the width of
the CBFP output signal.
The default value for the control parameter CBFP time is 0.00 s which means that
the circuit-breaker failure protection is not in use.
12
ABB Automation TOL3Cab RE_5_ _
2.7 Resetting
The TRIP output signal, the sensor error signal and the registers can be reset either via
the RESET input or over the serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
13
RE_5_ _ TOL3Cab ABB Automation
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for TOL3Cab is 47.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
14
ABB Automation TOL3Cab RE_5_ _
15
RE_5_ _ TOL3Cab ABB Automation
Rated current S42 1.0...5000.0 A 300.0 R/W Maximum load current for the
protected cable
Trip temperature S45 80.0...120.0 % 100.0 R/W Tripping temperature, per cent
value from the Maximum temp
Prior alarm S46 40.0...100.0 % 90.0 R/W Prior alarm temperature, per cent
value
Reclosure temp S47 40.0...100.0 % 80.0 R/W Temperature value which enables
reclosing
Ambient temp S48 -50.0...100.0 C 40.0 R/W Setting value for ambient
temperature
Rated current S72 1.0...5000.0 A 300.0 R/W Maximum load current for the
protected cable
Trip temperature S75 80.0...120.0 % 100.0 R/W Tripping temperature, per cent
value from the Maximum temp
Prior alarm S76 40.0...100.0 % 90.0 R/W Prior alarm temperature, per cent
value
Reclosure temp S77 40.0...100.0 % 80.0 R/W Temperature value which enables
reclosing
Ambient temp S78 -50.0...100.0 C 40.0 R/W Setting value for ambient
temperature
16
ABB Automation TOL3Cab RE_5_ _
Trip delay V8 0...60000 min 0 R/W Operate time of the delayed trip
17
RE_5_ _ TOL3Cab ABB Automation
18
ABB Automation TOL3Cab RE_5_ _
Output TRIP_TIME O7 0...99999 min 0 R/M Predicted time for the trip
in the overload situation
3.3.3.1 General
The information required for later fault analysis is recorded when the function block
starts or trips, or when the recording function is triggered via the external TRIGG
input.
The data of three last operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
'DWHDQGWLPH The time stamp indicates the rising edge of the START, TRIP
or TRIGG signal.
19
RE_5_ _ TOL3Cab ABB Automation
3.3.3.3 Priority
1 Tripping
2 Starting
3 External triggering,
which means that if the function block has started, it will neglect an external
triggering request.
20
ABB Automation TOL3Cab RE_5_ _
21
RE_5_ _ TOL3Cab ABB Automation
3.3.4 Events
22
ABB Automation TOL3Cab RE_5_ _
23
1MRS752328-MUM TOL3Cab
Issued: 10/1998
Version: D/25.1.2002
Three-Phase Thermal Overload
Data subject to change without notice Protection for Cables
Contents
1. Introduction .............................................................................................. 3
1.1 Features.............................................................................................. 3
1.2 Application........................................................................................... 3
1.3 Input description.................................................................................. 4
1.4 Output description ............................................................................... 5
2. Description of Operation.......................................................................... 6
2.1 Configuration....................................................................................... 6
2.2 Measuring mode ................................................................................. 6
2.3 Operation criteria................................................................................. 7
2.3.1 Principle of the thermal model applied........................................ 7
2.3.2 TRIP output................................................................................ 8
2.3.3 START output ............................................................................ 8
2.3.4 CU_ALARM output..................................................................... 8
2.3.5 COND_TEMP & TEMP_PERCENT outputs ............................... 9
2.3.6 COOL_TIME output ................................................................. 10
2.3.7 TRIP_TIME output ................................................................... 10
2.3.8 Compensation of ambient temperature .................................... 10
2.3.9 Reclose inhibit.......................................................................... 11
2.3.10 Temperature sensor supervision .............................................. 11
2.3.11 BLOCK input ............................................................................ 11
2.4 Setting groups ................................................................................... 12
2.5 Test mode ......................................................................................... 12
2.6 START, TRIP and CBFP outputs ...................................................... 12
2.7 Resetting........................................................................................... 13
2
Substation Automation TOL3Cab
1. Introduction
1.1 Features
1.2 Application
This document specifies the function of the three-phase thermal overload protection
function block TOL3Cab used in products based on the RED 500 Platform.
TOL3Cab is designed for the thermal protection of three-phase power cables and
overhead lines.
3
TOL3Cab Substation Automation
)LJXUH )XQFWLRQEORFNV\PERORI72/&DEWKHWKUHHSKDVHWKHUPDORYHUORDG
SURWHFWLRQIRUFDEOHV
4
Substation Automation TOL3Cab
5
TOL3Cab Substation Automation
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The phase currents IL1, IL2 and IL3 are
connected to the corresponding IL1, IL2 and IL3 inputs of the function block. The
measuring principle for the current inputs is defined as TRUE RMS current
measurement. The variables indicating the invalidity of sensor measurement are
connected to the Boolean type of input SENS_IV as presented in Figure 3 below.
)LJXUH ([DPSOHIRUWKHFRQQHFWLRQRIWKH6(16B,9LQSXWWKDWLQGLFDWHVWKH
LQYDOLGLW\RIVHQVRUPHDVXUHPHQW
Provided the sensor measurement is not used to compensate the ambient temperature,
the SENS_IV, SENSOR1 and SENSOR2 inputs can be left unconnected. Digital
inputs are connected to the boolean inputs of the function block and in the same way,
the outputs of the function block are connected to the output signals.
The calculation of the thermal model is based on the TRUE RMS measuring
principle. The thermal load is calculated by means of the highest phase current value.
6
Substation Automation TOL3Cab
TOL3Cab applies the thermal model of one time constant for temperature
measurement, which means that both the temperature rise and the cooling follow an
exponential curve. The formula applied in calculating the cable temperature is
presented below.
2 t
I -
=[ ( MAX REF )] (1 e ) + AMB
I CABLE
where
REF Reference temp temperature in which the rated current has been
defined; for example, +15 C for underground
cables and +25 C for overhead cables
Time constant time constant for the temperature rise and cooling
of a cable
AMB Ambient temp ambient temperature, which can be either a set
value or a one measured by sensors
7
TOL3Cab Substation Automation
In the initializing stage, i.e. when the auxiliary voltage is connected to the relay, the
function block assumes that the cable temperature has risen to 50% of the difference
between the parameter values Maximum temp and Ambient temp. For example, if
the maximum temperature has been set to + 90 C (cable with PEX insulation) and the
ambient temperature is + 20 C, the relay assumes a temperature of + 55 C for the
cable. The same temperature rise of 50% is also assumed for the cable when the
operation mode is set into use i.e. the parameter is set as follows:
1 = ON; no sensors,
2 = ON; Sensor 1 or
3 = ON; Sensors 1&2.
The so-called delayed trip is set into use by giving the Trip temperature parameter a
value higher than 100% and the Trip delay parameter one higher than 0. For
example, the trip temperature can be set to 120% and the trip delay to 60 min, in
which case the function block trips when the cable load remains above 100% for 60
minutes but does not exceed 120%.
If the TRIP output is chosen not to be used, the parameter is set as follows: ...\Control
setting\Trip & Start = Disabled.
The START output becomes active when the calculated conductor temperature
exceeds the setting of the Prior alarm parameter that can be given a value in the
range 40% to 100%. If the START output is chosen not to be used, the parameter is
set as follows: ...\Control setting\Trip & Start = Disabled.
The CU_ALARM output is activated when one of the three phase currents becomes
so high that even if it remains the same, the cable temperature will exceed the
maximum temperature set for the cable. An active CU_ALARM output is indicated
by a blinking start LED (yellow) on the MMI.
8
Substation Automation TOL3Cab
1 Via the MMI of the relay, in the view MAIN MENU / Protection lib. / TOL3Cab /
Output data
2 Via serial communication provided the event E10 has not been excluded via the
Event mask control parameter of TOL3Cab. Note that only the percentual
temperature rise TEMP_PERCENT is sent with the event.
3 Via the MIMIC view of the relay provided the connection presented in Figure 4
below has been configured with the Relay Configuration Tool
)LJXUH *UDSKLFUHSUHVHQWDWLRQRIWKH&21'B7(03DQG7(03B3(5&(17
RXWSXWVLQWKH0,0,&YLHZRIWKHUHOD\
TOL3Cab sends an event containing the percentual temperature rise of the conductor
to serial communication once a minute at the most frequent. However, if the change in
the conductor temperature is less than 0,5% of the previous value sent, no event is
sent to serial communication even though one minute has passed since the previous
event.
9
TOL3Cab Substation Automation
The COOL_TIME output indicates in full minutes the time required for the cable to
cool below the set temperature limit i.e. value of the Reclosure temp. parameter.
The cooling time left (min) can be monitored in the following three ways:
1 Via the MMI of the relay, in the view MAIN MENU / Protection lib. / TOL3Cab /
Output data
2 Via serial communication provided the event E11 has not been excluded via the
Event mask control parameter of TOL3Cab
3 Via the MIMIC view of the relay provided the connection has been configured
with the Relay Configuration Tool. For an exemplary connection, see Figure 4
above.
The TRIP_TIME output indicates the operate time of the function block when the
current remains at the present level. The time estimate can be monitored in the
following three ways:
1 Via the MMI of the relay, in the view MAIN MENU / Protection lib. / TOL3Cab /
Output data
2 Via serial communication provided the event E16 has not been excluded via the
Event mask control parameter of TOL3Cab
3 Via the MIMIC view of the relay provided the connection has been configured
with the Relay Configuration Tool. For an exemplary connection, see Figure 4
above.
In the thermal model (see the formula above in section Principle of the thermal
model applied) the influence of ambient temperature is compensated by the
parameter Ambient temp which can be either a set value or one measured by
temperature sensors. Compensating the ambient temperature is crucial for the correct
function of the thermal model since the environmental conditions of cables to be
protected vary considerably.
The principle of ambient temperature compensation is defined via the control setting
parameter Operation mode. When no external sensors are used to measure the
ambient temperature, the Operation mode parameter is given the value 1 (=ON; no
sensors). In this case the temperature value applied in the thermal model is the one set
for the Ambient temp parameter. On the other hand, when external sensors are used,
the Operation mode parameter is given the value 2 or 3. When the value 2 (=Sensor
1) is set for the parameter, one temperature sensor is used which is connected to the
SENSOR1 input of the function block. The value 3 (=Sensors 1&2) means that two
sensors are used for measuring the ambient temperature, in which case the function
10
Substation Automation TOL3Cab
applies the higher of the two temperature values in the thermal model for
compensating the ambient temperature.
At any time, the ambient temperature value used for calculating the conductor
temperature can be checked via the MMI or via serial communication in the menu
... / TOL3Cab / Control setting / Ambient temp.
After TOL3Cab has tripped, reclosing is not possible until the conductor temperature
calculated by the formula above (see section Principle of the thermal model
applied) falls below the value set for the Reclosure temp parameter, because the
function block holds the TRIP output active. If the reclosing inhibit is chosen not to
be used, the parameter is set to 100%.
TOL3Cab will wait 10 seconds before starting the sensor measurement of ambient
temperature, after which, provided the average measurement value is not within the
allowable range of -40 to +70 degrees, the function block sends a Sensor error event
(E15) and activates the SENSERR output. Moreover, a fault detected in sensor
measurement always causes the start LED (yellow) to blink on the MMI. If the fault is
detected at start-up, the value set for the Ambient temp parameter is applied as
ambient temperature.
The SENSERR output is also activated if TOL3Cab later detects a rapid change of
more than 5 degrees in the measured temperature. As a result the function block sends
a Sensor error event and blinks the start LED again, after which it applies the set
temperature value for compensating the ambient temperature.
If the BLOCK input is active, the TRIP output cannot be activated, but TOL3Cab still
continues measuring the conductor temperature. Thus, activating the BLOCK signal
prevents neither temperature measurement nor activation of the START or
CU_ALARM outputs.
11
TOL3Cab Substation Automation
Two different groups of setting values, group 1 and group 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The START signal remains active until the start situation is over. The output signal
TRIP may have a non-latching or latching feature. When the latching mode has been
selected, the TRIP signal remains active until the output is reset even if the operation
criteria have reset.
The function block provides a delayed trip signal CBFP after the TRIP signal unless
the fault has disappeared during the set CBFP delay. In circuit-breaker failure
protection the CBFP output can be used to operate a circuit breaker in front of the
circuit breaker of the feeder. The control parameter Trip pulse also sets the width of
the CBFP output signal.
The default value for the control parameter CBFP time is 0.00 s which means that
the circuit-breaker failure protection is not in use.
12
Substation Automation TOL3Cab
2.7 Resetting
The TRIP output signal, the sensor error signal and the registers can be reset either via
the RESET input or over the serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
13
TOL3Cab Substation Automation
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for TOL3Cab is 47.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
14
Substation Automation TOL3Cab
15
TOL3Cab Substation Automation
Rated current S42 1.0...5000.0 A 300.0 R/W Maximum load current for the
protected cable
Trip temperature S45 80.0...120.0 % 100.0 R/W Tripping temperature, per cent
value from the Maximum temp
Prior alarm S46 40.0...100.0 % 90.0 R/W Prior alarm temperature, per cent
value
Reclosure temp S47 40.0...100.0 % 80.0 R/W Temperature value which enables
reclosing
Ambient temp S48 -50.0...100.0 C 40.0 R/W Setting value for ambient
temperature
Rated current S72 1.0...5000.0 A 300.0 R/W Maximum load current for the
protected cable
Trip temperature S75 80.0...120.0 % 100.0 R/W Tripping temperature, per cent
value from the Maximum temp
Prior alarm S76 40.0...100.0 % 90.0 R/W Prior alarm temperature, per cent
value
Reclosure temp S77 40.0...100.0 % 80.0 R/W Temperature value which enables
reclosing
Ambient temp S78 -50.0...100.0 C 40.0 R/W Setting value for ambient
temperature
16
Substation Automation TOL3Cab
Trip delay V8 0...60000 min 0 R/W Operate time of the delayed trip
17
TOL3Cab Substation Automation
18
Substation Automation TOL3Cab
Output TRIP_TIME O7 0...99999 min 0 R/M Predicted time for the trip
in the overload situation
3.3.3.1 General
The information required for later fault analysis is recorded when the function block
starts or trips, or when the recording function is triggered via the external TRIGG
input.
The data of three last operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
'DWHDQGWLPH The time stamp indicates the rising edge of the START, TRIP
or TRIGG signal.
19
TOL3Cab Substation Automation
3.3.3.3 Priority
1 Tripping
2 Starting
3 External triggering,
which means that if the function block has started, it will neglect an external
triggering request.
20
Substation Automation TOL3Cab
21
TOL3Cab Substation Automation
3.3.4 Events
22
Substation Automation TOL3Cab
D -
23
1MRS100048 RE_5_ _
Issued: 10/1998
Version: C
Three-Phase Thermal Overload
Data subject to change without notice Protection for Devices
(TOL3Dev)
Contents
1. Introduction .............................................................................................. 3
1.1 Features.............................................................................................. 3
1.2 Application........................................................................................... 3
1.3 Input description.................................................................................. 4
1.4 Output description ............................................................................... 5
2. Description of Operation.......................................................................... 6
2.1 Configuration....................................................................................... 6
2.2 Setting the rated values of the protected unit ...................................... 7
2.3 Measuring mode ................................................................................. 7
2.4 Operation criteria................................................................................. 7
2.4.1 Principle of the thermal model applied........................................ 7
2.4.2 TRIP output................................................................................ 7
2.4.3 START output ............................................................................ 8
2.4.4 TEMP(%), STATOR(%) and ROTOR(%) outputs....................... 8
2.4.5 COOL_TIME output ................................................................... 9
2.4.6 TRIP_TIME output ................................................................... 10
2.4.7 RESTART output ..................................................................... 10
2.4.8 Compensation of ambient temperature .................................... 10
2.4.9 Temperature sensor supervision .............................................. 11
2.4.10 BLOCK input ............................................................................ 11
2.5 Application examples ........................................................................ 11
2.5.1 Motor protection ....................................................................... 11
2.5.2 Generator protection ................................................................ 13
2.5.3 Transformer protection............................................................. 13
2.5.4 Starting temperatures at initialization ....................................... 14
2.5.5 Lowering the calculated temperature during operation ............. 14
2.6 Settings ............................................................................................. 14
2.6.1 Setting groups .......................................................................... 14
2.6.2 Setting the function block via basic settings alone.................... 15
2.6.3 Setting parameters................................................................... 15
2.7 Test mode ......................................................................................... 17
2.8 START, TRIP and CBFP outputs ...................................................... 17
RE_5_ _ TOL3Dev ABB Automation
2
ABB Automation TOL3Dev RE_5_ _
1. Introduction
1.1 Features
1.2 Application
This document specifies the function of the three-phase thermal overload protection
function block TOL3Dev used in products based on the RED 500 Platform, e.g.
motor, generator and transformer protection relays.
3
RE_5_ _ TOL3Dev ABB Automation
)LJXUH )XQFWLRQEORFNV\PERORI72/'HY
4
ABB Automation TOL3Dev RE_5_ _
5
RE_5_ _ TOL3Dev ABB Automation
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The phase currents IL1, IL2 and IL3 are
connected to the corresponding IL1, IL2 and IL3 inputs of the function block. The
measuring principle for the current inputs is defined as TRUE RMS current
measurement. The sensor inputs are connected to the inputs of TOL3Dev by means of
the temperature measurement variables found on the Global Variables sheet of the
configuration tool. The variables indicating the invalidity of sensor measurement are
connected to the Boolean type of input SENS_IV as presented in Figure 3 below.
)LJXUH ([DPSOHIRUWKHFRQQHFWLRQRIWKH6(16B,9LQSXWWKDWLQGLFDWHVWKH
LQYDOLGLW\RIVHQVRUPHDVXUHPHQW
Provided the sensor measurement is not used to compensate the ambient temperature,
the SENS_IV, SENSOR1 and SENSOR2 inputs can be left unconnected.
Digital inputs are connected to the boolean inputs of the function block and in the
same way, the outputs of the function block are connected to the output signals.
6
ABB Automation TOL3Dev RE_5_ _
A separate scaling factor can be set for each analogue channel. The factors enable
differences between the ratings of the protected unit and those of the measuring
device (CTs, VTs, etc.). A setting of 1.00 means that the rated value of the protected
unit is exactly the same as that of the measuring device. For more information refer to
Technical Reference Manual for REM 54_.
The calculation of the thermal model is based on the TRUE RMS measuring
principle. The thermal load is calculated by means of the highest phase current value.
TOL3Dev applies the thermal model of two time constants for temperature
measurement. The basic formula applied in calculating the temperature rise in degrees
Celsius above the ambient temperature is presented below.
where
The TRIP output is activated if TEMP(%), i.e. the temperature-rise calculated in per
cent, exceeds the value of the Trip temperature parameter that can be set in the
range 80% to 120%.
The so-called delayed trip is set into use by giving the Trip temperature parameter a
value higher than 100% and the Trip delay parameter one higher than 0. For
7
RE_5_ _ TOL3Dev ABB Automation
example, the trip temperature can be set to 120% and the trip delay to 60 min, in
which case the function block trips when the calculated temperature remains above
100% for 60 minutes but does not exceed 120%.
If the TRIP output is chosen not to be used, the parameter is set as follows: ...\Control
setting\Trip & Start = Disabled. The temperature-rise is however calculated normally.
If the TRIP output has been activated, it will remain active until the temperature
values calculated for the stator and the rotor have both fallen below the limit value set
for the Restart inhibit parameter.
The START output becomes active when the calculated temperature exceeds the
setting of the Prior alarm parameter that can be given a value in the range 40% to
100%. If the START output is chosen not to be used, the parameter is set as follows:
...\Control setting\Trip & Start = Disabled. The temperature-rise is however calculated
normally.
The START output is useful in situations where the temperature of the protected
object approaches the tripping temperature and the alarm is needed beforehand.
1 Via the MMI of the relay, in the view MAIN MENU / Protection lib. / TOL3Dev /
Output data
2 Via serial communication provided the event E8 has not been excluded via the
Event mask control parameter of TOL3Dev. Note that only the percentual
temperature rise TEMP(%) is sent with the event.
3 Via the MIMIC view of the relay provided the connection presented in Figure 4
below has been configured with the Relay Configuration Tool
8
ABB Automation TOL3Dev RE_5_ _
If the parameter Device type is set to be MOTOR I, II, III, IV, the temperature rises
ROTOR(%) and STATOR(%) are both calculated and the higher of the two values is
shown in the TEMP(%) output. If the protected object is a generator or a transformer,
the temperature rise ROTOR(%) is not calculated.
The COOL_TIME output indicates in seconds the time required for the object to cool
below the set temperature limit, i.e. the value of the Restart inhibit parameter. The
cooling time left (s) can be monitored in the following three ways:
1 Via the MMI of the relay, in the view MAIN MENU / Protection lib. / TOL3Dev /
Output data
2 Via serial communication provided the event E9 has not been excluded via the
Event mask control parameter of TOL3Dev
3 Via the MIMIC view of the relay provided the connection has been configured
with the Relay Configuration Tool. For an exemplary connection, see Figure 4
above.
The COOL_TIME output will show the value 99999 if the TRIP output is not active
or the object is still loaded and can thus not be expected to cool below the set
temperature limit, i.e. the value of the Restart inhibit parameter.
9
RE_5_ _ TOL3Dev ABB Automation
The TRIP_TIME output indicates the operate time of the function block in seconds
when the current remains at the present level. The time estimate can be monitored in
the following three ways:
1 Via the MMI of the relay, in the view MAIN MENU / Protection lib. / TOL3Dev /
Output data
2 Via serial communication provided the event E22 has not been excluded via the
Event mask control parameter of TOL3Dev
3 Via the MIMIC view of the relay provided the connection has been configured
with the Relay Configuration Tool. For an examplary connection, see Figure 4
above.
The TRIP_TIME output will show the value 99999 if the current is so low that the
tripping temperature limit is not expected to be exceeded. The value 99999 is also
shown if the BLOCK input is activated or the parameter Trip & Start is set to
Disabled.
The RESTART output is TRUE when the calculated temperature TEMP(%) is below
the set value Restart inhibit. When the calculated temperature exceeds the set value,
the RESTART output turns to FALSE.
The principle of ambient temperature compensation is defined via the control setting
parameter Operation mode. When no external sensors are used to measure the
ambient temperature, the Operation mode parameter is given the value 1 (=ON; no
sensors). In this case the temperature value applied in the thermal model is the one set
for the Ambient temp parameter. On the other hand, when external sensors are used,
the Operation mode parameter is given the value 2 or 3. When the value 2 (=Sensor
1) is set for the parameter, one temperature sensor is used which is connected to the
SENSOR1 input of the function block. The value 3 (=Sensors 1&2) means that two
sensors are used for measuring the ambient temperature, in which case the function
block applies the higher of the two temperature values in the thermal model for
compensating the ambient temperature.
At any time, the ambient temperature value used in the thermal model can be checked
via the MMI or via serial communication in the menu ... / TOL3Dev / Control setting /
Ambient temp.
10
ABB Automation TOL3Dev RE_5_ _
TOL3Dev will wait 10 seconds before starting the sensor measurement of ambient
temperature, after which, provided the average measurement value is not within the
allowed range of -40 to +70 degrees, the function block sends a Sensor error event
(E13) and activates the SENSERR output. Moreover, a fault detected in sensor
measurement always causes the start LED (yellow) to blink on the MMI. If the fault is
detected at start-up, the value set for the Ambient temp parameter is applied as
ambient temperature.
The SENSERR output is also activated if TOL3Dev later detects a rapid change of
more than 5 degrees in the measured temperature. As a result the function block sends
a Sensor error event and blinks the start LED again, after which it applies the set
temperature value for compensating the ambient temperature.
If the BLOCK input is active, the TRIP output cannot be activated, but TOL3Dev still
continues calculating the temperature of the protected object. Thus, activating the
BLOCK signal prevents neither temperature calculation nor activation of the START
output.
TOL3Dev is well suited for protecting squirrel-cage motors. The function block
protects a motor from both short-duration overloadings and long-time overloadings.
The start situation is a good example of short-duration overloadings since particularly
at start-up the rotor is in danger to be overloaded by the starting current, which can be
in the range of five to seven times the rated current of the motor. The start-ups of the
motor also load the stator windings. The stator may constitute a limitation regarding
thermal protection especially when a warm motor is restarted.
Because the function block calculates the temperature rise for both the stator and the
rotor individually, the motor can be fully protected by means of proper settings.
Furthermore, the thermal model of two time constants (formula 1) enables detecting
both the short-time and long-time overloadings.
The Figure 5 below shows an example of the thermal calculations in the loading
situation of an asynchronous motor.
11
RE_5_ _ TOL3Dev ABB Automation
12
ABB Automation TOL3Dev RE_5_ _
Provided the manufacturer does not state any other value, the cooling time-constant of
the synchronous motor can be set to 3 x the heating time-constant.
By means of the thermal model of two time constants (formula 1), TOL3Dev protects
generators from both short- and long-time overloadings. In generator protection, only
the temperature of the stator is calculated.
The thermal curve GENERATOR I is suitable for hydro generators and for small air-
cooled turbine generators, whereas the thermal curve GENERATOR II is best suited
for large turbine generators.
Provided the manufacturer does not state any other value, the heating time-constant,
i.e. the parameter Gen & Trafo , can be set to 13 min for GENERATOR I and to 7
min for GENERATOR II.
The thermal curve of two time constants is typical for a transformer. Provided the
manufacturer does not state any other value, the heating time-constant, i.e. the
parameter Gen & Trafo , can be set to 50 min for a distribution transformer and to
73 min for a supply transformer.
13
RE_5_ _ TOL3Dev ABB Automation
After a relay reset and an auxiliary power failure, the starting value of the temperature
rise for the stator is 80% and that for the rotor 30%. If the protected unit is not a
motor but a transformer or a generator, the temperature rise calculation is set to 80%
at the reset.
If the push-buttons C+E are pressed simultaneously for 5 s within 90 s from the reset,
the starting values of the temperature rise calculation are reset to zero for both the
stator and the rotor, which may be useful at testing. Note that pressing the push-
buttons later than within 90 s from the reset will have no effect on the temperature
rise calculation.
If the tripping temperature limit has been set below 100%, the calculation of the
temperature rise of the stator is started with the tripping temperature limit - 20%.
If required, the temperature calculated by the relay can be lowered during operation
by setting the maximum temperature allowed for the stator (and the rotor) higher via
the menu Advanced settings of TOL3Dev.
2.6 Settings
The two setting groups available for TOL3Dev are basic settings and advanced
settings. Furthermore, the parameters used by the thermal model are shown under the
heading Actual setting. If the user is only able to set the basic settings, the
suggestions made by the relay for the advanced setting parameters are shown under
actual settings, i.e. the relay is able to internally calculate the advanced setting
parameters. The suggestions made by the relay are also presented in advanced
settings.
Advanced settings include more setting parameters than basic settings, and by means
of the advanced setting parameters the function of the thermal model can be set to be
more accurate. If the user knows e.g. that the short heating time-constant for the rotor
is three minutes, the particular parameter in advanced settings can be set by the user,
after which the relay will show the new set value for the short time-constant under the
heading Actual setting. Therefore, setting a parameter in advanced settings will
always overrule the suggestion the relay has made for the concerned parameter. The
remaining advanced setting parameters, i.e. those unknown by the user, are computed
by the relay.
All the parameters used by the thermal model are shown under the heading Actual
setting. However, these are read-only parameters and can thus not be set by the user.
14
ABB Automation TOL3Dev RE_5_ _
The function block TOL3Dev can be set even if only the basic knowledge of the
motor is available. In other words, the information about the motor starting is
sufficient for setting the protection. These settings are meant to be simple, and
although the extra knowledge from the motor is not known, the basic settings suffice
to confirm the adequate function of overload protection.
For instance, the relay calculates one time constant from the motor start-up
information and then internally converts the result into two time constants separately
for the rotor and the stator, depending on the type of the device to be protected.
Unless the type of the device is MOTOR I, II, III or IV, only the temperature of the
stator is calculated.
'HYLFHW\SHThe parameter specifies the protected object. There are four motor
types, two generator types and one transformer type available. The motor and
generator types are described below.
There is a relation between the cooling process described in detail in the IEC standard
60034-6 and the motor types described above. For example, motors with the cooling
system IC 00, IC 01, IC 03, IC 06, IC 11 or IC 31 should be set to MOTOR I or
MOTOR II. Correspondingly, motors with e.g. the cooling system IC 00 41, IC 01 41,
IC 01 51, IC 01 61, IC W37 A71 or IC W37 A81 belong to the category MOTOR III
or MOTOR IV.
1RRIVWDUWVThe setting parameter defines how many times the motor is allowed to
be cold-started in succession.
&RROLQJ If all the phase currents of the motor fall below 12 % of the rated current,
the motor is presumed to be stopped. Typically, the cooling of the stopped motor is
slower than that of the rotating one since the cooling device installed on the motor
shaft , e.g. an air fan, will be stopped as well. The parameter Cooling is designed
to compensate the difference in cooling properties. The long time-constants of the
stator and the rotor are separately multiplied with the set value.
1: In the thermal model (formula 1) 1 is the short time-constant that describes the
warming of the windings with regard to iron.
15
RE_5_ _ TOL3Dev ABB Automation
SIDFWRUp - factor isthe weighting factor for the short time-constant 1. The figure
below describes the difference in the heating curves between the one time-constant
model and the two time-constant model. Using the two time-constant model, the relay
is able to follow both fast and slow changes in the temperature of the protected object.
As the Figure 6 shows, the higher the p - factor is, the larger is the share of the steep
part of the heating curve. The warming and cooling following the two time-constant
thermal curve is characteristic for motors, generators and transformers. If the p-factor
is set to zero, the thermal image will correspond to the one time-constant model.
)LJXUH (IIHFWRIWKHSIDFWRUDQGWKHGLIIHUHQFHEHWZHHQWKHWZRWLPHFRQVWDQW
DQGWKHRQHWLPHFRQVWDQWPRGHOV
5LVH&, ,QThe parameter defines in degrees Celsius how much the motor,
generator or transformer will warm up above the ambient temperature when loaded by
the rated current. The setting of the rated current is described in chapter
Configuration.
The rated power of ABB motors, for example, is usually based on a temperature rise
of the insulation class B. However, the insulation of the motors is usually made to
withstand class F temperatures. Therefore the default value of the parameter
S: Rise(C), I=In is 90 C, i.e. in accordance with the insulation class B.
When the object to be protected is a transformer, the default value of the parameter
S: Rise(C), I=In is 78 C, i.e. in accordance with the IEC standard 60354.
16
ABB Automation TOL3Dev RE_5_ _
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The START signal remains active until the start situation is over. The output signal
TRIP may have a non-latching or latching feature. If the TRIP output has been set to
function in the latching mode, the TRIP output can only be deactivated by resetting,
which again is possible provided the calculated temperature is below the restart
inhibit level.
The function block provides a delayed trip signal CBFP after the TRIP signal unless
the fault has disappeared during the set CBFP delay. In circuit-breaker failure
protection the CBFP output can be used to operate a circuit breaker in front of the
circuit breaker of the machine. The control parameter Trip pulse also sets the width
of the CBFP output signal.
The default value for the control parameter CBFP time is 0.00 s which means that
the circuit breaker failure protection is not in use.
17
RE_5_ _ TOL3Dev ABB Automation
2.9 Resetting
The TRIP output signal, SENSERR output signal and registers can be reset either via
the RESET input or over the serial bus or the local MMI.
The operation indicators, output signals and recorded data can be reset as follows:
18
ABB Automation TOL3Dev RE_5_ _
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for TOL3Dev is 48.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
19
RE_5_ _ TOL3Dev ABB Automation
20
ABB Automation TOL3Dev RE_5_ _
Starting time S42 0.1...120.0 s 12.0 R/W Maximum starting time permitted for
the motor
Trip temperature S45 80.0...120.0 % 100 R/W Tripping temperature, per cent value
Prior alarm S46 40.0...100.0 % 90 R/W Prior alarm temperature, per cent
value
Restart inhibit S47 40.0...100.0 % 60 R/W Temperature limit for the successful
restarting
Ambient temp S48 -50.0...100.0 C 40.0 R/W Setting value for ambient
temperature
S: 2 V72 0.0...999.0 min 0.0 R/W Long time-constant for the stator
S: Rise(C),I=In V74 0.0...350.0 C 0.0 R/W Temperature rise of the stator when
loaded by the rated current
R: 1 V76 0.0...999.0 min 0.0 R/W Short time-constant for the rotor
R: 2 V77 0.0...999.0 min 0.0 R/W Long time-constant for the rotor
R: Rise(C),I=In V79 0.0...350.0 C 0.0 R/W Temperature rise of the rotor when
loaded by the rated current
21
RE_5_ _ TOL3Dev ABB Automation
Trip delay V8 0...60000 min 0 R/W Operate time of the delayed trip
Event mask 1 V101 0...8388607 - 4177983 R/W Event mask 1 for event
transmission (E0 ... E22)
Event mask 2 V103 0...8388607 - 4177983 R/W Event mask 2 for event
transmission (E0 ... E22)
Event mask 3 V105 0...8388607 - 4177983 R/W Event mask 3 for event
transmission (E0 ... E22)
Event mask 4 V107 0...8388607 - 4177983 R/W Event mask 4 for event
transmission (E0 ... E22)
1)
Operation mode 0 = Not in use; 1=ON: no sensors; 2=Sensor 1; 3=Sensors 1&2
2
Trip signal 0 = Non-latching; 1 = Latching
3
Trip & Start 0 = Disabled; 1 = Enabled
4
Testing 0 = Do not activate; 1 = Activate
22
ABB Automation TOL3Dev RE_5_ _
23
RE_5_ _ TOL3Dev ABB Automation
3.3.3.1 General
The information required for later fault analysis is recorded when the function block
starts or trips, or when the recording function is triggered via the external TRIGG
input.
The data of three last operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
24
ABB Automation TOL3Dev RE_5_ _
'DWHDQGWLPH The time stamp indicates the rising edge of the START, TRIP
or TRIGG signal.
3.3.3.3 Priority
1 Tripping
2 Starting
3 External triggering,
which means that if the function block has started, it will neglect an external
triggering request.
25
RE_5_ _ TOL3Dev ABB Automation
Trip delay V205 0.0...100.0 % 0.0 R/M Elapsed trip delay in per
cent
26
ABB Automation TOL3Dev RE_5_ _
Trip delay V305 0.0...100.0 % 0.0 R/M Elapsed trip delay in per cent
Primary current V306 0.0...20000.0 A 0.0 R/M RMS current value (maximum
of IL1,IL2 & IL3)
Output ROTOR(%) V307 0.0...1000.0 % 0.0 R/M Temperature of the rotor, per
cent value from the maximum
temp of the rotor
Output STATOR(%) V308 0.0...1000.0 % 0.0 R/M Temperature of the stator, per
cent value from the maximum
temp of the stator
Trip delay V405 0.0...100.0 % 0.0 R/M Elapsed trip delay in per cent
Primary current V406 0.0...20000.0 A 0.0 R/M RMS current value (maximum
of IL1,IL2 & IL3)
Output ROTOR(%) V407 0.0...1000.0 % 0.0 R/M Temperature of the rotor, per
cent value from the maximum
temp of the rotor
Output STATOR(%) V408 0.0...1000.0 % 0.0 R/M Temperature of the stator, per
cent value from the maximum
temp of the stator
27
RE_5_ _ TOL3Dev ABB Automation
3.3.4 Events
28
ABB Automation TOL3Dev RE_5_ _
29
RE_5_ _ TOL3Dev ABB Automation
Tripping curves (Figures 734) are based on the following setting values.
30
ABB Automation TOL3Dev RE_5_ _
2
min
120
100
80
60
50
40
30
25
20
15
MOTOR1_1b.CNV
x In
2
min
120
100
80
60
50
40
30
25
20
15
MOTOR1_2b.CNV
x In
31
RE_5_ _ TOL3Dev ABB Automation
2
min
120
100
80
60
50
40
30
25
20
15
MOTOR1_3b.CNV
x In
2
min
120
100
80
60
50
40
30
25
20
15
MOTOR1_4b.CNV
x
In
32
ABB Automation TOL3Dev RE_5_ _
2
min
120
100
80
60
50
40
30
25
20
15
MOTOR2_1b.CNV
x In
2
min
120
100
80
60
50
40
30
25
20
15
MOTOR2_2b.CNV
x In
33
RE_5_ _ TOL3Dev ABB Automation
2
min
120
100
80
60
50
40
30
25
20
15
MOTOR2_3b.CNV
x In
2
min
120
100
80
60
50
40
30
25
20
15
MOTOR2_4b.CNV
x In
34
ABB Automation TOL3Dev RE_5_ _
2
min
120
100
80
60
50
40
30
25
20
15
MOTOR3_1b.CNV
x In
2
min
120
100
80
60
50
40
30
25
20
15
MOTOR3_2b.CNV
x
In
35
RE_5_ _ TOL3Dev ABB Automation
2
min
120
100
80
60
50
40
30
25
20
15
MOTOR3_3b.CNV
x In
2
min
120
100
80
60
50
40
30
25
20
15
MOTOR3_4b.CNV
x In
36
ABB Automation TOL3Dev RE_5_ _
2
min
120
100
80
60
50
40
30
25
20
15
MOTOR4_1b.CNV
x In
2
min
120
100
80
60
50
40
30
25
20
15
MOTOR4_2b.CNV
x In
37
RE_5_ _ TOL3Dev ABB Automation
2
min
120
100
80
60
50
40
30
25
20
15
MOTOR4_3b.CNV
x In
2
min
120
100
80
60
50
40
30
25
20
15
MOTOR4_4b.CNV
x In
38
ABB Automation TOL3Dev RE_5_ _
2
min
120
100
80
60
50
40
30
25
20
15
GEN1_1b.CNV
x In
2
min
120
100
80
60
50
40
30
25
20
15
GEN1_2b.CNV
x In
39
RE_5_ _ TOL3Dev ABB Automation
2
min
120
100
80
60
50
40
30
25
20
15
GEN1_3b.CNV
x In
2
min
120
100
80
60
50
40
30
25
20
15
GEN1_4b.CNV
x In
40
ABB Automation TOL3Dev RE_5_ _
2
min
120
100
80
60
50
40
30
25
20
15
GEN2_1b.CNV
x In
2
min
120
100
80
60
50
40
30
25
20
15
GEN2_2b.CNV
x In
41
RE_5_ _ TOL3Dev ABB Automation
2
min
120
100
80
60
50
40
30
25
20
15
GEN2_3b.CNV
x In
2
min
120
100
80
60
50
40
30
25
20
15
GEN2_4b.CNV
x In
42
ABB Automation TOL3Dev RE_5_ _
2
min
120
100
80
60
50
40
30
25
20
15
TRAFO_1b.CNV
x In
2
min
120
100
80
60
50
40
30
25
20
15
TRAFO_2b.CNV
x In
43
RE_5_ _ TOL3Dev ABB Automation
2
min
120
100
80
60
50
40
30
25
20
15
TRAFP_3b.CNV
x In
2
min
120
100
80
60
50
40
30
25
20
TRAFO_4b.CNV
15
x In
44
1MRS752329-MUM TOL3Dev
Issued: 10/1998
Version: D/16.04.2002
Three-Phase Thermal Overload
Data subject to change without notice Protection for Devices
Contents
1. Introduction .............................................................................................. 3
1.1 Features.............................................................................................. 3
1.2 Application........................................................................................... 3
1.3 Input description.................................................................................. 4
1.4 Output description ............................................................................... 5
2
Substation Automation TOL3Dev
1. Introduction
1.1 Features
1.2 Application
This document specifies the function of the three-phase thermal overload protection
function block TOL3Dev used in products based on the RED 500 Platform, e.g.
motor, generator and transformer protection relays.
3
TOL3Dev Substation Automation
)LJXUH )XQFWLRQEORFNV\PERORI72/'HY
4
Substation Automation TOL3Dev
5
TOL3Dev Substation Automation
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The phase currents IL1, IL2 and IL3 are
connected to the corresponding IL1, IL2 and IL3 inputs of the function block. The
measuring principle for the current inputs is defined as TRUE RMS current
measurement. The sensor inputs are connected to the inputs of TOL3Dev by means of
the temperature measurement variables found on the global variables sheet of the
configuration tool. The variables indicating the invalidity of sensor measurement are
connected to the input SENS_IV as presented in Figure 2.1.-1 below.
)LJXUH ([DPSOHIRUWKHFRQQHFWLRQRIWKH6(16B,9LQSXWWKDWLQGLFDWHVWKH
LQYDOLGLW\RIVHQVRUPHDVXUHPHQW
Provided the sensor measurement is not used for compensating the ambient
temperature, the SENS_IV, SENSOR1 and SENSOR2 inputs can be left unconnected.
Digital inputs are connected to the Boolean inputs of the function block and in the
same way, the outputs of the function block are connected to the output signals.
6
Substation Automation TOL3Dev
A separate scaling factor can be set for each analogue channel. The factors enable
differences between the ratings of the protected unit and those of the measuring
device (CTs, VTs, etc.). A setting of 1.00 means that the rated value of the protected
unit is exactly the same as that of the measuring device. For more information refer to
Technical Reference Manual for REM 54_.
The calculation of the thermal model is based on the TRUE RMS measuring
principle. The thermal load is calculated by means of the highest phase current value.
TOL3Dev applies the thermal model of two time constants for temperature
measurement. The basic formula applied in calculating the temperature rise in degrees
Celsius above the ambient temperature is presented below.
where
The so-called delayed trip is set in use by giving the Trip temperature parameter a
value higher than 100% and the Trip delay parameter a nonzero value. For example,
7
TOL3Dev Substation Automation
the trip temperature can be set to 120% and the trip delay to 60 min, in which case the
function block trips when the calculated temperature remains above 100% for 60
minutes but does not exceed 120%. If the temperature exceeds 120% during trip
delay, the function block trips immediately.
If the TRIP output is chosen not to be used, the parameter is set as follows: ...\Control
setting\Trip & Start = Disabled. The temperature-rise is however calculated normally.
If the TRIP output has been activated, it will remain active until the temperature
values calculated for the stator and the rotor have both fallen below the limit value set
for the Restart inhibit parameter.
The START output becomes active when the calculated temperature exceeds the
setting of the Prior alarm parameter that can be given a value in the range 40% to
100%. If the START output is chosen not to be used, the parameter is set as follows:
...\Control setting\Trip & Start = Disabled. The temperature-rise is however calculated
normally.
The START output is useful in situations where the temperature of the protected
object approaches the tripping temperature and the alarm is needed beforehand.
1 Via the HMI of the relay, in the view MAIN MENU / Protection lib. / TOL3Dev /
Output data
2 Via LON communication provided the event E8 has not been excluded via the
Event mask control parameter of TOL3Dev. Note that only the percentual
temperature rise TEMP(%) is sent with the event.
3 Via the MIMIC view of the relay provided the connection presented in Figure
2.4.4.-1 below has been configured with the Relay Configuration Tool
8
Substation Automation TOL3Dev
If the parameter Device type is set to be MOTOR I, II, III, IV, the temperature rises
ROTOR(%) and STATOR(%) are both calculated and the higher of the two values is
shown in the TEMP(%) output. If the protected object is a generator or a transformer,
the temperature rise ROTOR(%) is not calculated.
The COOL_TIME output indicates in seconds the time required for the object to cool
below the set temperature limit, i.e. the value of the Restart inhibit parameter. The
cooling time left (s) can be monitored in the following three ways:
1 Via the HMI of the relay, in the view MAIN MENU / Protection lib. / TOL3Dev /
Output data
2 Via LON communication provided the event E9 has not been excluded via the
Event mask control parameter of TOL3Dev
3 Via the MIMIC view of the relay provided the connection has been configured
with the Relay Configuration Tool. For an exemplary connection, see Figure
2.4.4.-1 above.
The COOL_TIME output will show the value 0 if the calculated temperature is below
the set "Restart inhibit" level. When temperature is over the restart inhibit level and
the value is still rising, the COOL_TIME output will show the value "99999". If the
calculated temperature is over the Restart inhibit level and the value is decreasing,
9
TOL3Dev Substation Automation
the value of COOL_TIME output will indicate the time when the thermal capacity
value will drop below the Restart inhibit level with actual load (stopped or
running).
The TRIP_TIME output indicates the operate time of the function block in seconds
when the current remains at the present level. The time estimate can be monitored in
the following three ways:
1 Via the HMI of the relay, in the view MAIN MENU / Protection lib. / TOL3Dev /
Output data
2 Via LON communication provided the event E22 has not been excluded via the
Event mask control parameter of TOL3Dev
3 Via the MIMIC view of the relay provided the connection has been configured
with the Relay Configuration Tool. For an examplary connection, see Figure
2.4.4.-1 above.
The TRIP_TIME output will show the value 99999 if the current is so low that the
tripping temperature limit is not expected to be exceeded. The value 99999 is also
shown if the BLOCK input is activated or the parameter Trip & Start is set to
Disabled. After a trip command, the TRIP_TIME will remain zero as long as the
TRIP output is active, or if the trip signal is latched, as long as the EN_RESTART is
active.
The principle of ambient temperature compensation is defined via the control setting
parameter Operation mode. When no external sensors are used for measuring the
ambient temperature, the Operation mode parameter is given the value 1 (=ON; no
sensors). In this case the temperature value applied in the thermal model is the one set
for the Ambient temp parameter. It is important to note that TOL3Dev smoothes
stepwise on-line changes to the "Ambient temp" parameter. This means that the set
changes are taken into use by exponential model having a time constant of 60
10
Substation Automation TOL3Dev
minutes. On the other hand, when external sensors are used, the Operation mode
parameter is given the value 2 or 3. When the value 2 (=Sensor 1) is set for the
parameter, one temperature sensor is used which is connected to the SENSOR1 input
of the function block. The value 3 (=Sensors 1&2) means that two sensors are used
for measuring the ambient temperature, in which case the function block applies the
higher of the two temperature values in the thermal model for compensating the
ambient temperature.
At any time, the ambient temperature value used in the thermal model can be checked
via the HMI or via serial communication in the menu ... / TOL3Dev / Control setting /
Ambient temp.
Provided the temperature measurement value is not within the allowed range of -40 to
+70 degrees, the function block sends a Sensor error event (E13) and activates the
SENSERR output. The same is done also if TOL3Dev detects a rapid change of more
than 5 degrees in the measured temperature. The SENSERR output is always latched
and must be reset as presented in chapter 2.9.
If the BLOCK input is active, the TRIP output cannot be activated, but TOL3Dev still
continues calculating the temperature of the protected object. Thus, activating the
BLOCK signal prevents neither temperature calculation nor activation of the START
output.
TOL3Dev is well suited for protecting squirrel-cage motors. The function block
protects a motor from both short-duration overloadings and long-time overloadings.
The start situation is a good example of short-duration overloadings since particularly
at start-up the rotor is in danger to be overloaded by the starting current, which can be
in the range of five to seven times the rated current of the motor. The start-ups of the
11
TOL3Dev Substation Automation
motor also load the stator windings. The stator may constitute a limitation regarding
thermal protection especially when a warm motor is restarted.
Because the function block calculates the temperature rise for both the stator and the
rotor individually, the motor can be fully protected by means of proper settings.
Furthermore, the thermal model of two time constants (formula 1) enables detecting
both the short-time and long-time overloadings.
The Figure 2.5.1.1.-1 below shows an example of the thermal calculations in the
loading situation of an asynchronous motor.
)LJXUH([DPSOHRIWKHUPDOFDOFXODWLRQVZKHQWKHORDGLQJVHTXHQF\LV
6WDUWVLWXDWLRQVHFRQGV, [,Q/RDGLQJPLQXWHV, [,Q
6WDUWVLWXDWLRQVHFRQGV, [,Q/RDGLQJPLQXWHV, [,Q
The cooling of the motor depends on its structure as well as on the cooling system
applied. In squirrel-cage induction motors the cooling fan is usually installed on the
shaft of the motor, i.e. the motor is self-cooled. Consequently, when the motor stops,
the circulation of cooling air is interrupted as well. As a result the stopped motor
cools down considerably slower than the rotating one. Provided the manufacturer does
not state any other value, the cooling time-constant can be set to3 x the heating time-
constant for fully closed motors with surface cooling and to 4 x the heating time-
constant for through-ventilated motors. For motors with a separate cooling system, the
cooling time-constant is the same as the heating time-constant, and the cooling is set
to 1 x .
12
Substation Automation TOL3Dev
Provided the manufacturer does not state any other value, the cooling time-constant of
the synchronous motor can be set to 3 x the heating time-constant.
By means of the thermal model of two time constants (formula 1), TOL3Dev protects
generators from both short- and long-time overloadings. In generator protection, only
the temperature of the stator is calculated.
The thermal curve GENERATOR I is suitable for hydro generators and for small air-
cooled turbine generators, whereas the thermal curve GENERATOR II is best suited
for large turbine generators.
Provided the manufacturer does not state any other value, the heating time-constant,
i.e. the parameter Gen&Trafo , can be set to 13 min for GENERATOR I and to 7
min for GENERATOR II.
The thermal curve of two time constants is typical for a transformer. Provided the
manufacturer does not state any other value, the heating time-constant, i.e. the
13
TOL3Dev Substation Automation
parameter Gen & Trafo , can be set to 50 min for a distribution transformer and to
73 min for a supply transformer.
After a relay reset and an auxiliary power failure, the starting value of the temperature
rise for the stator is 80% and that for the rotor 30%. If the protected unit is not a
motor but a transformer or a generator, the temperature rise calculation is set to 80%
at the reset.
If the push-buttons C+E are pressed simultaneously for 5 s within 90 s from the reset,
the starting values of the temperature rise calculation are reset to zero for both the
stator and the rotor, which may be useful at testing. Note that pressing the push
buttons later than within 90 s from the reset will have no effect on the temperature
rise calculation.
If the tripping temperature limit has been set below 100%, the calculation of the
temperature rise of the stator is started with the tripping temperature limit - 20%.
If required, the temperature TEMP(%) calculated by the relay can be lowered during
operation by setting the maximum temperature allowed for the stator (and the rotor)
higher via the menu Advanced settings of TOL3Dev.
2.6 Settings
The two setting groups available for TOL3Dev are basic settings and advanced
settings. Furthermore, the parameters used by the thermal model are shown under the
heading Actual setting. If the user is only able to set the basic settings, the
suggestions made by the relay for the advanced setting parameters are shown under
actual settings, i.e. the relay is able to internally calculate the advanced setting
parameters. The suggestions made by the relay are also presented in advanced
settings.
Advanced settings include more setting parameters than basic settings, and by means
of the advanced setting parameters the function of the thermal model can be set to be
more accurate. If the user knows e.g. that the short heating time-constant for the rotor
14
Substation Automation TOL3Dev
is three minutes, the particular parameter in advanced settings can be set by the user,
after which the relay will show the new set value for the short time-constant under the
heading Actual setting. Therefore, setting a parameter in advanced settings will
always overrule the suggestion the relay has made for the concerned parameter. The
remaining advanced setting parameters, i.e. those unknown by the user, are computed
by the relay.
All the parameters used by the thermal model are shown under the heading Actual
setting. However, these are read-only parameters and can thus not be set by the user.
The function block TOL3Dev can be set even if only the basic knowledge of the
motor is available. In other words, the information about the motor starting is
sufficient for setting the protection. These settings are meant to be simple, and
although the extra knowledge from the motor is not known, the basic settings suffice
to confirm the adequate function of overload protection.
For instance, the relay calculates one time constant from the motor start-up
information and then internally converts the result into two time constants separately
for the rotor and the stator, depending on the type of the device to be protected.
Unless the type of the device is MOTOR I, II, III or IV, only the temperature of the
stator is calculated.
'HYLFHW\SHThe parameter specifies the protected object. There are four motor
types, two generator types and one transformer type available. The motor and
generator types are described below.
There is a relation between the cooling process described in detail in the IEC standard
60034-6 and the motor types described above. For example, motors with the cooling
system IC 00, IC 01, IC 03, IC 06, IC 11 or IC 31 should be set to MOTOR I or
MOTOR II. Correspondingly, motors with e.g. the cooling system IC 00 41, IC 01 41,
IC 01 51, IC 01 61, IC W37 A71 or IC W37 A81 belong to the category MOTOR III
or MOTOR IV.
1RRIVWDUWVThe setting parameter defines how many times the motor is allowed to
be started from initial cold condition state.
15
TOL3Dev Substation Automation
&RROLQJ If all the phase currents of the motor fall below 12 % of the rated current,
the motor is presumed to be stopped. Typically, the cooling of the stopped motor is
slower than that of the rotating one since the cooling device installed on the motor
shaft, e.g. an air fan, will be stopped as well. The parameter Cooling is designed
to compensate the difference in cooling properties. The long time-constants of the
stator and the rotor are separately multiplied with the set value.
1: In the thermal model (formula 1) 1 is the short time-constant that describes the
warming of the windings with regard to iron.
SIDFWRUp - factor isthe weighting factor for the short time-constant 1. The figure
below describes the difference in the heating curves between the one time-constant
model and the two time-constant model. Using the two time-constant model, the relay
is able to follow both fast and slow changes in the temperature of the protected object.
As the Figure 2.6.3-1 shows, the higher the p - factor is, the larger is the share of the
steep part of the heating curve. The warming and cooling following the two time-
constant thermal curve is characteristic for motors, generators and transformers. If the
p-factor is set to zero, the thermal image will correspond to the one time-constant
model.
)LJXUH(IIHFWRIWKHSIDFWRUDQGWKHGLIIHUHQFHEHWZHHQWKHWZRWLPH
FRQVWDQWDQGWKHRQHWLPHFRQVWDQWPRGHOV
5LVH&, ,QThe parameter defines in degrees Celsius how much the motor,
generator or transformer will warm up above the ambient temperature when loaded by
the rated current. The setting of the rated current is described in chapter
Configuration.
16
Substation Automation TOL3Dev
The rated power of ABB motors, for example, is usually based on a temperature rise
of the insulation class B. However, the insulation of the motors is usually made to
withstand class F temperatures. Therefore the default value of the parameter
S: Rise(C),I=In is 90 C, i.e. in accordance with the insulation class B.
When the object to be protected is a transformer, the default value of the parameter
S: Rise(C),I=In is 78 C, i.e. in accordance with the IEC standard 60354.
The digital outputs of the function block can be activated with separate control
settings for each output either locally via the HMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The START signal remains active until the start situation is over. The output signal
TRIP may have a non-latching or latching feature. If the TRIP output has been set to
function in the latching mode, the TRIP output can only be deactivated by resetting,
which again is possible provided the calculated temperature is below the restart
inhibit level.
The function block provides a delayed trip signal CBFP for the circuit-breaker failure
protection. The CBFP trip is issued after the trip if the circuit breaker has not been
able to break fault currents during the set CBFP delay. Unsuccessful breaker
operation is detected from phase currents. If any of the phase currents remain above
1% p.u. for the set CBFP operate time, the CBFP trip is activated. In circuit-breaker
failure protection, the CBFP output can be used for operating a circuit breaker in front
of the circuit breaker of the machine. The control parameter "Trip pulse" sets also the
width of the CBFP output signal.
The default value for the control parameter CBFP time is 0.00 s which means that
the circuit breaker failure protection is not in use.
17
TOL3Dev Substation Automation
2.9 Resetting
The TRIP output signal, SENSERR output signal and registers can be reset either via
the RESET input or over the serial bus or the local HMI.
The operation indicators, output signals and recorded data can be reset as follows:
18
Substation Automation TOL3Dev
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for TOL3Dev is 48.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the HMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / HMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the HMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
19
TOL3Dev Substation Automation
20
Substation Automation TOL3Dev
Starting time S42 0.1...120.0 s 12.0 R/W Maximum starting time permitted for
the motor
Trip temperature S45 80.0...120.0 % 100 R/W Tripping temperature, percent value
Restart inhibit S47 40.0...100.0 % 60 R/W Temperature limit for the successful
restarting
Ambient temp S48 -50.0...100.0 C 40.0 R/W Setting value for ambient
temperature
Cooling S49 1.0...10.0 x 4.0 R/W Cooling time multiplier for motor at
standstill
S: 2 V72 0.0...999.0 min 0.0 R/W Long time-constant for the stator
S: Rise(C),I=In V74 0.0...350.0 C 0.0 R/W Temperature rise of the stator when
loaded by the rated current
R: 1 V76 0.0...999.0 min 0.0 R/W Short time-constant for the rotor
R: 2 V77 0.0...999.0 min 0.0 R/W Long time-constant for the rotor
R: Rise(C),I=In V79 0.0...350.0 C 0.0 R/W Temperature rise of the rotor when
loaded by the rated current
21
TOL3Dev Substation Automation
Trip delay V8 0...60000 min 0 R/W Operate time of the delayed trip
Event mask 1 V101 0...8388607 - 4177983 R/W Event mask 1 for event
transmission (E0 ... E22)
Event mask 2 V103 0...8388607 - 4177983 R/W Event mask 2 for event
transmission (E0 ... E22)
Event mask 3 V105 0...8388607 - 4177983 R/W Event mask 3 for event
transmission (E0 ... E22)
Event mask 4 V107 0...8388607 - 4177983 R/W Event mask 4 for event
transmission (E0 ... E22)
1)
Operation mode 0 = Not in use; 1= ON: no sensors; 2= ON: Sensor 1; 3 = ON: Sensors 1&2
2
Trip signal 0 = Non-latching; 1 = Latching
3
Trip & Start 0 = Disabled; 1 = Enabled
4
Testing 0 = Do not activate; 1 = Activate
22
Substation Automation TOL3Dev
23
TOL3Dev Substation Automation
3.3.3.1 General
The information required for later fault analysis is recorded when the function block
starts or trips, or when the recording function is triggered via the external TRIGG
input.
No recordings are done if trip and start outputs are disabled via control setting "Trip
& Start". However, the TRIGG input is functional.
The data of three last operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
24
Substation Automation TOL3Dev
'DWHDQGWLPH The time stamp indicates the rising edge of the START, TRIP
or TRIGG signal.
3.3.3.3 Priority
1 Tripping
2 Starting
3 External triggering,
which means that if the function block has started, it will neglect an external
triggering request.
25
TOL3Dev Substation Automation
26
Substation Automation TOL3Dev
Trip delay V305 0.0...100.0 % 0.0 R/M Elapsed trip delay in percent
Primary current V306 0.0...20000.0 A 0.0 R/M RMS current value (maximum
of IL1,IL2 & IL3)
27
TOL3Dev Substation Automation
Trip delay V405 0.0...100.0 % 0.0 R/M Elapsed trip delay in percent
Primary current V406 0.0...20000.0 A 0.0 R/M RMS current value (maximum
of IL1,IL2 & IL3)
28
Substation Automation TOL3Dev
3.3.4 Events
29
TOL3Dev Substation Automation
30
Substation Automation TOL3Dev
Tripping curves (Figures 5.1.-1 5.1.-28) are based on the following setting values.
31
TOL3Dev Substation Automation
2
min
120
100
80
60
50
40
30
25
20
15
MOTOR1_1b.CNV
x In
2
min
120
100
80
60
50
40
30
25
20
15
MOTOR1_2b.CNV
x In
32
Substation Automation TOL3Dev
2
min
120
100
80
60
50
40
30
25
20
15
MOTOR1_3b.CNV
x In
2
min
120
100
80
60
50
40
30
25
20
15
MOTOR1_4b.CNV
x
In
33
TOL3Dev Substation Automation
2
min
120
100
80
60
50
40
30
25
20
15
MOTOR2_1b.CNV
x In
2
min
120
100
80
60
50
40
30
25
20
15
MOTOR2_2b.CNV
x In
34
Substation Automation TOL3Dev
2
min
120
100
80
60
50
40
30
25
20
15
MOTOR2_3b.CNV
x In
2
min
120
100
80
60
50
40
30
25
20
15
MOTOR2_4b.CNV
x In
35
TOL3Dev Substation Automation
2
min
120
100
80
60
50
40
30
25
20
15
MOTOR3_1b.CNV
x In
2
min
120
100
80
60
50
40
30
25
20
15
MOTOR3_2b.CNV
x
In
)LJXUH0RWRU,,,$PELHQWWHPSHUDWXUH R&,QLWLDOFRQGLWLRQ
:DUPPRWRUORQJWLPHSUHORDGLQJZLWKWKHFXUUHQW[,Q
36
Substation Automation TOL3Dev
2
min
120
100
80
60
50
40
30
25
20
15
MOTOR3_3b.CNV
x In
2
min
120
100
80
60
50
40
30
25
20
15
MOTOR3_4b.CNV
x In
)LJXUH0RWRU,,,$PELHQWWHPSHUDWXUH R&,QLWLDOFRQGLWLRQ
:DUPPRWRUORQJWLPHSUHORDGLQJZLWKWKHFXUUHQW[,Q
37
TOL3Dev Substation Automation
2
min
120
100
80
60
50
40
30
25
20
15
MOTOR4_1b.CNV
x In
)LJXUH0RWRU,9$PELHQWWHPSHUDWXUH R&,QLWLDOFRQGLWLRQ
&ROGPRWRUQRSUHORDGLQJ
2
min
120
100
80
60
50
40
30
25
20
15
MOTOR4_2b.CNV
x In
)LJXUH0RWRU,9$PELHQWWHPSHUDWXUH R&,QLWLDOFRQGLWLRQ
:DUPPRWRUORQJWLPHSUHORDGLQJZLWKWKHFXUUHQW[,Q
38
Substation Automation TOL3Dev
2
min
120
100
80
60
50
40
30
25
20
15
MOTOR4_3b.CNV
x In
)LJXUH0RWRU,9$PELHQWWHPSHUDWXUH R&,QLWLDOFRQGLWLRQ
&ROGPRWRUQRSUHORDGLQJ
2
min
120
100
80
60
50
40
30
25
20
15
MOTOR4_4b.CNV
x In
)LJXUH0RWRU,9$PELHQWWHPSHUDWXUH R&,QLWLDOFRQGLWLRQ
:DUPPRWRUORQJWLPHSUHORDGLQJZLWKWKHFXUUHQW[,Q
39
TOL3Dev Substation Automation
2
min
120
100
80
60
50
40
30
25
20
15
GEN1_1b.CNV
x In
)LJXUH*HQHUDWRU,$PELHQWWHPSHUDWXUH R&,QLWLDOFRQGLWLRQ
&ROGQRSUHORDGLQJ
2
min
120
100
80
60
50
40
30
25
20
15
GEN1_2b.CNV
x In
)LJXUH*HQHUDWRU,$PELHQWWHPSHUDWXUH R&,QLWLDOFRQGLWLRQ
:DUPORQJWLPHSUHORDGLQJZLWKWKHFXUUHQW[,Q
40
Substation Automation TOL3Dev
2
min
120
100
80
60
50
40
30
25
20
15
GEN1_3b.CNV
x In
)LJXUH*HQHUDWRU,$PELHQWWHPSHUDWXUH R&,QLWLDOFRQGLWLRQ
&ROGQRSUHORDGLQJ
2
min
120
100
80
60
50
40
30
25
20
15
GEN1_4b.CNV
x In
)LJXUH*HQHUDWRU,$PELHQWWHPSHUDWXUH R&,QLWLDOFRQGLWLRQ
:DUPORQJWLPHSUHORDGLQJZLWKWKHFXUUHQW[,Q
41
TOL3Dev Substation Automation
2
min
120
100
80
60
50
40
30
25
20
15
GEN2_1b.CNV
x In
)LJXUH*HQHUDWRU,,$PELHQWWHPSHUDWXUH R&,QLWLDOFRQGLWLRQ
&ROGQRSUHORDGLQJ
2
min
120
100
80
60
50
40
30
25
20
15
GEN2_2b.CNV
x In
)LJXUH*HQHUDWRU,,$PELHQWWHPSHUDWXUH R&,QLWLDOFRQGLWLRQ
:DUPORQJWLPHSUHORDGLQJZLWKWKHFXUUHQW[,Q
42
Substation Automation TOL3Dev
2
min
120
100
80
60
50
40
30
25
20
15
GEN2_3b.CNV
x In
)LJXUH*HQHUDWRU,,$PELHQWWHPSHUDWXUH R&,QLWLDOFRQGLWLRQ
&ROGQRSUHORDGLQJ
2
min
120
100
80
60
50
40
30
25
20
15
GEN2_4b.CNV
x In
)LJXUH*HQHUDWRU,,$PELHQWWHPSHUDWXUH R&,QLWLDOFRQGLWLRQ
:DUPORQJWLPHSUHORDGLQJZLWKWKHFXUUHQW[,Q
43
TOL3Dev Substation Automation
2
min
120
100
80
60
50
40
30
25
20
15
TRAFO_1b.CNV
x In
)LJXUH7UDQVIRUPHU$PELHQWWHPSHUDWXUH R&,QLWLDOFRQGLWLRQ
&ROGQRSUHORDGLQJ
2
min
120
100
80
60
50
40
30
25
20
15
TRAFO_2b.CNV
x In
)LJXUH7UDQVIRUPHU$PELHQWWHPSHUDWXUH R&,QLWLDOFRQGLWLRQ
:DUPORQJWLPHSUHORDGLQJZLWKWKHFXUUHQW[,Q
44
Substation Automation TOL3Dev
2
min
120
100
80
60
50
40
30
25
20
15
TRAFP_3b.CNV
x In
)LJXUH7UDQVIRUPHU$PELHQWWHPSHUDWXUH R&,QLWLDOFRQGLWLRQ
&ROGQRSUHORDGLQJ
2
min
120
100
80
60
50
40
30
25
20
TRAFO_4b.CNV
15
x In
)LJXUH7UDQVIRUPHU$PELHQWWHPSHUDWXUH R&,QLWLDOFRQGLWLRQ
:DUPORQJWLPHSUHORDGLQJZLWKWKHFXUUHQW[,Q
45
1MRS100066 (UE6Low) RE_5_ _
1MRS100067 (UE6High) Three-Phase
Issued: 10/1998
Version: C Underexcitation Protection
Data subject to change without notice Low-Set Stage (UE6Low)
High-Set Stage (UE6High)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 4
1.4 Output description ............................................................................... 4
2. Description of Operation.......................................................................... 5
2.1 Configuration....................................................................................... 5
2.2 Measuring mode ................................................................................. 6
2.3 Operation criteria................................................................................. 6
2.3.1 Underexcitation protection.......................................................... 6
2.3.2 Excitation current monitoring...................................................... 8
2.4 Delayed reset facility and drop-off time in DT Mode ............................ 8
2.5 Setting groups ..................................................................................... 9
2.6 Test mode ......................................................................................... 10
2.7 START, TRIP and CBFP outputs ...................................................... 10
2.8 Resetting........................................................................................... 11
1. Introduction
1.1 Features
1.2 Application
The function blocks UE6Low and UE6High are designed for the single-phase or
three-phase underexcitation protection of motors and generators whenever the DT
(Definite Time) characteristic is appropriate.
X<
X<<
)LJXUH 3URWHFWLRQGLDJUDPV\PEROVRI8(/RZDQG8(+LJK)RU,(&V\PEROV
XVHGLQVLQJOHOLQHGLDJUDPVUHIHUWRWKHPDQXDO7HFKQLFDO'HVFULSWLRQV
RI)XQFWLRQV,QWURGXFWLRQ056080
2
ABB Automation UE6Low RE_5_ _
UE6High
)LJXUH )XQFWLRQEORFNV\PEROVRI8(/RZDQG8(+LJK
3
RE_5_ _ UE6Low ABB Automation
UE6High
4
ABB Automation UE6Low RE_5_ _
UE6High
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The phase currents IL1, IL2 and IL3 are
connected to the corresponding IL1, IL2 and IL3 inputs of the function block and
correspondingly, the phase-to-earth voltages U1, U2 and U3 are connected to the inputs
U1, U2 and U3 of the function block. If phase-to-phase voltages are used, they are
connected as follows: U12 to the input U1, U23 to U2 and U31 to U3.
It is also possible to use the function block in a single-phase mode if there is only one
phase-to-earth voltage (U1) available. In this case the phase-to-earth voltage U1 and
current IL1 are connected to the corresponding inputs of the function block. If only one
phase-to-phase voltage (U12) is available, it is connected to the input U1 of the
function block. Note, however, that the two currents IL1 and IL2 are required if the
phase-to-phase voltage U12 is used. The following table explains all the allowed
connection configurations and the measuring modes that may be used with the
corresponding configurations.
5
RE_5_ _ UE6Low ABB Automation
UE6High
Note! The current signals should be connected from the neutral point side of the
generator (symbols IL1, IL2, IL3). The signals IL1b, IL2b and IL3b may be used
instead if, for some reason, the signals need to be connected from the network side.
As a default measuring mode UE6Low and UE6High use either U12&IL1&IL2 (=2)
or U1&IL1 (=1). The default value depends on the signal(s) connected to the voltage
input(s): for phase-to-phase voltage(s) the default value is 2 and for phase-to-earth
voltage(s) 1. If neither of the two measuring modes is possible due to a configuration
error, the measuring mode is set to Not in use (=0), a configuration error event E13
is sent and the ERR output is activated. The measuring mode remains Not in use
until the configuration error is corrected and the correct configuration is downloaded
to the relay.
Digital inputs are connected to the boolean inputs of the function block and in the
same way, the outputs of the function block are connected to the output signals.
The function block operates on two alternative measuring principles: the numerically
calculated fundamental frequency components or the positive-sequence values of the
symmetrical components of currents and voltages. The measuring mode can be
selected with either an MMI parameter or a serial communication parameter. In one-
phase mode, only the fundamental frequency component calculation is possible.
When the function block starts, the START signal is set to TRUE. Should the
duration of the underexcitation exceed the set definite operate time, the function block
operates (=the TRIP signal is set to TRUE). The delay of the heavy-duty output relay
is included in the total operate time.
The DT timer is allowed to run only if the BLOCK signal is inactive, i.e. its value is
FALSE. When the blocking signal becomes active, i.e. its value turns to TRUE, the
timer will be stopped (frozen).
6
ABB Automation UE6Low RE_5_ _
UE6High
the function block allows temporary underexcitation conditions and gives time for
corrective operations.
The operation is based on the offset-mho characteristic. The impedance of the system
in any phase can be represented as a phasor in an impedance plane in which the
horizontal coordinate is resistance (R) and the vertical coordinate reactance (X). The
operating curve is a circle in the impedance plane and the circle is parameterized with
the following three setting values: circle offset, circle diameter and circle
displacement (Figure 3). If the calculated impedance value exceeds the setting limits
i.e. the phasor enters the circle in the impedance plane, the relay starts, and if the
impedance stays within the circle including hysteresis, the relay trips after the set
operate time. In three-phase mode the impedance is calculated in every phase (in
fundamental frequency modes) and the lowest impedance value is taken into account.
)LJXUH 6HWWLQJSDUDPHWHUVIRUWKHRIIVHWPKRFLUFOH1RWHWKDWRIIVHWLVWKH
GLVWDQFHEHWZHHQWKHUHVLVWDQFHD[LVDQGWKHWRSRIWKHFLUFOH
Setting values are calculated as follows:
2IIVHWDistance of the top of the circle from the R-axis. This is usually set equal to -
xd/2 , where xd is the transient reactance of the machine. The sign of the setting value
determines the location of the circle regarding the R-axis. If the sign is negative as
usual, the whole circle lies below the R-axis as in Figure 3.
'LVSODFHPHQWDisplacement of the center of the circle from the reactance axis or, in
other words, the R -coordinate of the center. The setting can be used to adjust the
7
RE_5_ _ UE6Low ABB Automation
UE6High
sensitivity of the underexcitation protection. If the sign of the setting is positive, the
circle is shifted to the right i.e. closer to the normal operating point. Accordingly, if
the sign is negative, the circle is shifted to the left and moves thus away from the
normal operating point.
Note that the settings are given as per unit (p.u.) values. Usually the machine
manufacturers give the xd and xd values in p.u. but in case there are only ohm values
available, it is necessary to convert them to p.u. values. The base impedance (ZN) is
8 12
=1 =
61
where UN is the rated (phase-to-phase) voltage and SN the rated power of the protected
machine.
The p.u. value of the reactance (Xp.u.) is the ratio of the reactance in ohms (Xohm) to
the base impedance (ZN), that is
; RKP
; S.X. =
=1
If the status information of the excitation current is connected to the digital input
EX_CU of the relay and the excitation current monitoring is selected from the control
settings via the parameter Excit.curr.trip, total loss of the excitation current or a
failure in the excitation system will cause DT operation similar to that described
above. Indication of the excitation current can be a boolean input from the AVR
(Automatic Voltage Regulator), for example. The input signal is active high, i.e. the
input must be TRUE when the excitation current is lost. If the input signal is active
low, it can be easily inverted by means of the configuration tool.
When the DT timer has started, it goes on running normally even if the impedance
drops off, provided the drop-off period is shorter than the set drop-off time. If the
drop-off period is longer than the set drop-off time, the DT timer will reset when the
drop-off time elapses (Figure 4).
In Figures 4 and 5 the input signal IN of the DT timer is TRUE when the impedance is
inside the set offset-mho circle and FALSE when the impedance is outside the circle.
8
ABB Automation UE6Low RE_5_ _
UE6High
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff1.fh7
Operate time
Operate
timer
)LJXUH 7KHGURSRIISHULRGLVORQJHUWKDQWKHVHWGURSRIIWLPH
If the drop-off period is shorter than the set drop-off time and the DT timer time has
elapsed during the drop-off period, the function block will trip once the impedance
enters the circle again (Figure 5).
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff2.fh7
Operate time
Operate
timer
)LJXUH 7KHGURSRIISHULRGLVVKRUWHUWKDQWKHVHWGURSRIIWLPH
Two different groups of setting values, group 1 and group 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
9
RE_5_ _ UE6Low ABB Automation
UE6High
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The output signal START is always pulse-shaped. The minimum pulse width of the
corresponding output signal is set with a separate parameter on the MMI or on serial
communication. If the start situation is longer than the set pulse width, the START
signal remains active until the start situation is over. The output signal TRIP may
have a non-latching or latching feature. When the latching mode has been selected,
the TRIP signal remains active until the output is reset even if the operation criteria
have reset.
The function block provides a delayed trip signal CBFP after the TRIP signal unless
the fault has disappeared during the set CBFP time delay. In circuit-breaker failure
protection the CBFP output can be used to operate a circuit breaker in front of the
circuit breaker of the machine. The control parameter Trip pulse also sets the width
of the CBFP output signal.
10
ABB Automation UE6Low RE_5_ _
UE6High
2.8 Resetting
The TRIP output signal and the registers can be reset either via the RESET input, or
over the serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
11
RE_5_ _ UE6Low ABB Automation
UE6High
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for UE6Low is 66 and that for UE6High 67.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
12
ABB Automation UE6Low RE_5_ _
UE6High
UE6High: 1.00
0.06...10.00
Circle diameter S42 0.01...60.00 p.u. 2.00 R/W Diameter of the impedance circle
Cir.displacem. S43 -10.00...10.00 p.u. 0.00 R/W Displacement of the center of the
impedance circle from the X-axis
UE6High: 1.00
0.06...10.00
Circle diameter S72 0.01...60.00 p.u. 2.00 R/W Diameter of the impedance circle
Cir.displacem. S73 -10.00...10.00 p.u. 0.00 R/W Displacement of the center of the
impedance circle from the X-axis
UE6High: 1.00
0.06...10.00
13
RE_5_ _ UE6Low ABB Automation
UE6High
CBFP time V9 100...1000 ms 100 R/W Operate time of the delayed trip
CBFP
Event mask 1 V101 0...16383 - 8255 R/W Event mask 1 for event
transmission (E0 ... E13)
Event mask 2 V103 0...16383 - 8255 R/W Event mask 2 for event
transmission (E0 ... E13)
Event mask 3 V105 0...16383 - 8255 R/W Event mask 3 for event
transmission (E0 ... E13)
Event mask 4 V107 0...16383 - 8255 R/W Event mask 4 for event
transmission (E0 ... E13)
1)
Measuring mode 0 = Not in use, 1 = One phase, phase-earth voltage, fund.freq.,
2 = One phase, phase-phase voltage, fund. freq.,
3= Three phase, phase-earth voltages, fund. freq.,
4 = Three phase, phase-phase voltages, fund. freq.,
5 = Three phase, phase-earth voltages, pos.seq.,
6 = Three phase, phase-phase voltages, pos. seq.
2)
Excit.curr.trip 0 = Disabled, 1 = Enabled
3)
Group selection 0 = Group 1; 1 = Group 2; 2 = GROUP input
4)
Active group 0 = Group 1; 1 = Group 2
5)
Trip signal 0 = Non-latching; 1 = Latching
6)
Oper. direction 0 = Forward; 1 = Reverse; When the reverse direction has been selected, the
angle of the impedance is rotated +180. This can be used e.g. if the polarity
of voltages is opposite to the normal polarity in relay terminals.
7)
Test 0 = Do not activate; 1 = Activate
8)
The default value of the measuring mode depends on the connected signal(s) (refer to section
Configuration)
14
ABB Automation UE6Low RE_5_ _
UE6High
15
RE_5_ _ UE6Low ABB Automation
UE6High
3.3.3.1 General
The information required for later fault analysis is recorded when the function block
starts or trips.
The data of three last operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
The time stamp indicates the rising edge of the START or TRIP signal.
3.3.3.3 Duration
The duration of the start situation is recorded as a percentage of the set operate time.
If the function block trips, the impedance values are updated at the moment of
tripping i.e. on the rising edge of the TRIP signal. If the function block starts but does
not trip, the impedance values captured one fundamental cycle (20 ms at rated
frequency 50 Hz) after the beginning of the start situation are recorded. Thus the
impedance values (magnitudes ZL1, ZL2, ZL3 and phase angles AL1, AL2, AL3 ) always
originate from
2
the same moment and are recorded as multiples of the base impedance
(ZN = | UN / SN | ).
The status data of the EX_CU and BLOCK input signals and the Active group
parameter are recorded at the moment of triggering. The Active group parameter
indicates the setting group valid for the recorded data.
16
ABB Automation UE6Low RE_5_ _
UE6High
3.3.3.6 Priority
1 Tripping
2 Starting
17
RE_5_ _ UE6Low ABB Automation
UE6High
18
ABB Automation UE6Low RE_5_ _
UE6High
3.3.4 Events
E12 0 0 - -
19
RE_5_ _ UE6Low ABB Automation
UE6High
Reset ratio Reset ratio = (distance of the measured impedance from the center
of the circle during drop-off) / (radius of the circle).
Operate time accuracy Depends on the frequency of the current and voltage measured:
20
1MRS752330-MUM UE6_
Three-Phase
Issued: 10/1998
Underexcitation Protection
Version: D/28.1.2002 Low-Set Stage (UE6Low)
Data subject to change without notice High-Set Stage (UE6High)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 4
1.4 Output description ............................................................................... 4
2. Description of Operation.......................................................................... 5
2.1 Configuration....................................................................................... 5
2.2 Measuring mode ................................................................................. 6
2.3 Operation criteria................................................................................. 6
2.3.1 Underexcitation protection.......................................................... 6
2.3.2 Excitation current monitoring...................................................... 8
2.4 Delayed reset facility and drop-off time in DT Mode ............................ 8
2.5 Setting groups ..................................................................................... 9
2.6 Test mode ......................................................................................... 10
2.7 START, TRIP and CBFP outputs ...................................................... 10
2.8 Resetting........................................................................................... 11
1. Introduction
1.1 Features
1.2 Application
The function blocks UE6Low and UE6High are designed for the single-phase or
three-phase underexcitation protection of motors and generators whenever the DT
(Definite Time) characteristic is appropriate.
X<
X<<
)LJXUH 3URWHFWLRQGLDJUDPV\PEROVRI8(/RZDQG8(+LJK)RU,(&V\PEROV
XVHGLQVLQJOHOLQHGLDJUDPVUHIHUWRWKHPDQXDO7HFKQLFDO'HVFULSWLRQV
RI)XQFWLRQV,QWURGXFWLRQ056080
2
Substation Automation UE6 _
)LJXUH )XQFWLRQEORFNV\PEROVRI8(/RZDQG8(+LJK
3
UE6_ Substation Automation
4
Substation Automation UE6 _
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The phase currents IL1, IL2 and IL3 are
connected to the corresponding IL1, IL2 and IL3 inputs of the function block and
correspondingly, the phase-to-earth voltages U1, U2 and U3 are connected to the inputs
U1, U2 and U3 of the function block. If phase-to-phase voltages are used, they are
connected as follows: U12 to the input U1, U23 to U2 and U31 to U3.
It is also possible to use the function block in a single-phase mode if there is only one
phase-to-earth voltage (U1) available. In this case the phase-to-earth voltage U1 and
current IL1 are connected to the corresponding inputs of the function block. If only one
phase-to-phase voltage (U12) is available, it is connected to the input U1 of the
function block. Note, however, that the two currents IL1 and IL2 are required if the
phase-to-phase voltage U12 is used. The following table explains all the allowed
connection configurations and the measuring modes that may be used with the
corresponding configurations.
5
UE6_ Substation Automation
Note! The current signals should be connected from the neutral point side of the
generator (symbols IL1, IL2, IL3). The signals IL1b, IL2b and IL3b may be used
instead if, for some reason, the signals need to be connected from the network side.
As a default measuring mode UE6Low and UE6High use either U12&IL1&IL2 (=2)
or U1&IL1 (=1). The default value depends on the signal(s) connected to the voltage
input(s): for phase-to-phase voltage(s) the default value is 2 and for phase-to-earth
voltage(s) 1. If neither of the two measuring modes is possible due to a configuration
error, the measuring mode is set to Not in use (=0), a configuration error event E13
is sent and the ERR output is activated. The measuring mode remains Not in use
until the configuration error is corrected and the correct configuration is downloaded
to the relay.
Digital inputs are connected to the boolean inputs of the function block and in the
same way, the outputs of the function block are connected to the output signals.
The function block operates on two alternative measuring principles: the numerically
calculated fundamental frequency components or the positive-sequence values of the
symmetrical components of currents and voltages. The measuring mode can be
selected with either an MMI parameter or a serial communication parameter. In one-
phase mode, only the fundamental frequency component calculation is possible.
When the function block starts, the START signal is set to TRUE. Should the
duration of the underexcitation exceed the set definite operate time, the function block
operates (=the TRIP signal is set to TRUE). The delay of the heavy-duty output relay
is included in the total operate time.
The DT timer is allowed to run only if the BLOCK signal is inactive, i.e. its value is
FALSE. When the blocking signal becomes active, i.e. its value turns to TRUE, the
timer will be stopped (frozen).
6
Substation Automation UE6 _
the function block allows temporary underexcitation conditions and gives time for
corrective operations.
The operation is based on the offset-mho characteristic. The impedance of the system
in any phase can be represented as a phasor in an impedance plane in which the
horizontal coordinate is resistance (R) and the vertical coordinate reactance (X). The
operating curve is a circle in the impedance plane and the circle is parameterized with
the following three setting values: circle offset, circle diameter and circle
displacement (Figure 3). If the calculated impedance value exceeds the setting limits
i.e. the phasor enters the circle in the impedance plane, the relay starts, and if the
impedance stays within the circle including hysteresis, the relay trips after the set
operate time. In three-phase mode the impedance is calculated in every phase (in
fundamental frequency modes) and the lowest impedance value is taken into account.
)LJXUH 6HWWLQJSDUDPHWHUVIRUWKHRIIVHWPKRFLUFOH1RWHWKDWRIIVHWLVWKH
GLVWDQFHEHWZHHQWKHUHVLVWDQFHD[LVDQGWKHWRSRIWKHFLUFOH
Setting values are calculated as follows:
2IIVHWDistance of the top of the circle from the R-axis. This is usually set equal to -
xd/2 , where xd is the transient reactance of the machine. The sign of the setting value
determines the location of the circle regarding the R-axis. If the sign is negative as
usual, the whole circle lies below the R-axis as in Figure 3.
'LVSODFHPHQWDisplacement of the center of the circle from the reactance axis or, in
other words, the R -coordinate of the center. The setting can be used to adjust the
7
UE6_ Substation Automation
sensitivity of the underexcitation protection. If the sign of the setting is positive, the
circle is shifted to the right i.e. closer to the normal operating point. Accordingly, if
the sign is negative, the circle is shifted to the left and moves thus away from the
normal operating point.
Note that the settings are given as per unit (p.u.) values. Usually the machine
manufacturers give the xd and xd values in p.u. but in case there are only ohm values
available, it is necessary to convert them to p.u. values. The base impedance (ZN) is
8 12
=1 =
61
where UN is the rated (phase-to-phase) voltage and SN the rated power of the protected
machine.
The p.u. value of the reactance (Xp.u.) is the ratio of the reactance in ohms (Xohm) to
the base impedance (ZN), that is
; RKP
; S.X. =
=1
If the status information of the excitation current is connected to the digital input
EX_CU of the relay and the excitation current monitoring is selected from the control
settings via the parameter Excit.curr.trip, total loss of the excitation current or a
failure in the excitation system will cause DT operation similar to that described
above. Indication of the excitation current can be a boolean input from the AVR
(Automatic Voltage Regulator), for example. The input signal is active high, i.e. the
input must be TRUE when the excitation current is lost. If the input signal is active
low, it can be easily inverted by means of the configuration tool.
When the DT timer has started, it goes on running normally even if the impedance
drops off, provided the drop-off period is shorter than the set drop-off time. If the
drop-off period is longer than the set drop-off time, the DT timer will reset when the
drop-off time elapses (Figure 4).
In Figures 4 and 5 the input signal IN of the DT timer is TRUE when the impedance is
inside the set offset-mho circle and FALSE when the impedance is outside the circle.
8
Substation Automation UE6 _
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff1.fh7
Operate time
Operate
timer
)LJXUH 7KHGURSRIISHULRGLVORQJHUWKDQWKHVHWGURSRIIWLPH
If the drop-off period is shorter than the set drop-off time and the DT timer time has
elapsed during the drop-off period, the function block will trip once the impedance
enters the circle again (Figure 5).
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff2.fh7
Operate time
Operate
timer
)LJXUH 7KHGURSRIISHULRGLVVKRUWHUWKDQWKHVHWGURSRIIWLPH
Two different groups of setting values, group 1 and group 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
9
UE6_ Substation Automation
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The output signal START is always pulse-shaped. The minimum pulse width of the
corresponding output signal is set with a separate parameter on the MMI or on serial
communication. If the start situation is longer than the set pulse width, the START
signal remains active until the start situation is over. The output signal TRIP may
have a non-latching or latching feature. When the latching mode has been selected,
the TRIP signal remains active until the output is reset even if the operation criteria
have reset.
The function block provides a delayed trip signal CBFP after the TRIP signal unless
the fault has disappeared during the set CBFP time delay. In circuit-breaker failure
protection the CBFP output can be used to operate a circuit breaker in front of the
circuit breaker of the machine. The control parameter Trip pulse also sets the width
of the CBFP output signal.
10
Substation Automation UE6 _
2.8 Resetting
The TRIP output signal and the registers can be reset either via the RESET input, or
over the serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
11
UE6_ Substation Automation
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for UE6Low is 66 and that for UE6High 67.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
12
Substation Automation UE6 _
UE6High: 1.00
0.06...10.00
Circle diameter S42 0.01...60.00 p.u. 2.00 R/W Diameter of the impedance circle
Cir.displacem. S43 -10.00...10.00 p.u. 0.00 R/W Displacement of the center of the
impedance circle from the X-axis
UE6High: 1.00
0.06...10.00
Circle diameter S72 0.01...60.00 p.u. 2.00 R/W Diameter of the impedance circle
Cir.displacem. S73 -10.00...10.00 p.u. 0.00 R/W Displacement of the center of the
impedance circle from the X-axis
UE6High: 1.00
0.06...10.00
13
UE6_ Substation Automation
CBFP time V9 100...1000 ms 100 R/W Operate time of the delayed trip
CBFP
Event mask 1 V101 0...12287 - 8255 R/W Event mask 1 for event
transmission (E0 ... E11 and E13)
Event mask 2 V103 0... 12287 - 8255 R/W Event mask 2 for event
transmission (E0 ... E13)
Event mask 3 V105 0... 12287 - 8255 R/W Event mask 3 for event
transmission (E0 ... E13)
Event mask 4 V107 0... 12287 - 8255 R/W Event mask 4 for event
transmission (E0 ... E13)
1)
Measuring mode 0 = Not in use, 1 = One phase, phase-earth voltage, fund.freq.,
2 = One phase, phase-phase voltage, fund. freq.,
3= Three phase, phase-earth voltages, fund. freq.,
4 = Three phase, phase-phase voltages, fund. freq.,
5 = Three phase, phase-earth voltages, pos.seq.,
6 = Three phase, phase-phase voltages, pos. seq.
2)
Excit.curr.trip 0 = Disabled, 1 = Enabled
3)
Group selection 0 = Group 1; 1 = Group 2; 2 = GROUP input
4)
Active group 0 = Group 1; 1 = Group 2
5)
Trip signal 0 = Non-latching; 1 = Latching
6)
Oper. direction 0 = Forward; 1 = Reverse; When the reverse direction has been selected, the
angle of the impedance is rotated +180. This can be used e.g. if the polarity
of voltages is opposite to the normal polarity in relay terminals.
7)
Test 0 = Do not activate; 1 = Activate
8)
The default value of the measuring mode depends on the connected signal(s) (refer to section
Configuration)
14
Substation Automation UE6 _
15
UE6_ Substation Automation
3.3.3.1 General
The information required for later fault analysis is recorded when the function block
starts or trips.
The data of three last operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
The time stamp indicates the rising edge of the START or TRIP signal.
3.3.3.3 Duration
The duration of the start situation is recorded as a percentage of the set operate time.
If the function block trips, the impedance values are updated at the moment of
tripping i.e. on the rising edge of the TRIP signal. If the function block starts but does
not trip, the impedance values captured one fundamental cycle (20 ms at rated
frequency 50 Hz) after the beginning of the start situation are recorded. Thus the
impedance values (magnitudes ZL1, ZL2, ZL3 and phase angles AL1, AL2, AL3 ) always
originate from
2
the same moment and are recorded as multiples of the base impedance
(ZN = | UN / SN | ).
The status data of the EX_CU and BLOCK input signals and the Active group
parameter are recorded at the moment of triggering. The Active group parameter
indicates the setting group valid for the recorded data.
16
Substation Automation UE6 _
3.3.3.6 Priority
1 Tripping
2 Starting
17
UE6_ Substation Automation
18
Substation Automation UE6 _
3.3.4 Events
E12 0 0 - -
19
UE6_ Substation Automation
Reset ratio Reset ratio = (distance of the measured impedance from the center
of the circle during drop-off) / (radius of the circle).
Operate time accuracy Depends on the frequency of the current and voltage measured:
E -
20
1MRS100110 (UI6Low) RE_5_ _
1MRS100111 (UI6High) Three-Phase
Issued: 3/2000
Version: A Underimpedance Protection
Data subject to change without notice Low-Set Stage (UI6Low)
High-Set Stage (UI6High)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 4
1.4 Output description ............................................................................... 4
2. Description of Operation.......................................................................... 5
2.1 Configuration....................................................................................... 5
2.1.1 Signal connection....................................................................... 5
2.1.2 Signal check............................................................................... 6
2.2 Measuring mode ................................................................................. 7
2.3 Operation criteria................................................................................. 7
2.3.1 General ...................................................................................... 7
2.3.2 Underimpedance protection ....................................................... 7
2.4 Comparison between overcurrent and underimpedance protection..... 8
2.5 Delayed reset facility and drop-off time in DT mode .......................... 11
2.6 Setting groups ................................................................................... 12
2.7 Test mode ......................................................................................... 12
2.8 START, TRIP and CBFP outputs ...................................................... 13
2.9 Resetting........................................................................................... 13
3. Parameters and Events .......................................................................... 14
3.1 General ............................................................................................. 14
3.2 Setting values.................................................................................... 15
3.2.1 Actual settings.......................................................................... 15
3.2.2 Setting group 1......................................................................... 15
3.2.3 Setting group 2......................................................................... 15
3.2.4 Control settings ........................................................................ 16
3.3 Measurement values ......................................................................... 17
3.3.1 Input data ................................................................................. 17
3.3.2 Output data .............................................................................. 17
3.3.3 Recorded data.......................................................................... 17
3.3.4 Events ...................................................................................... 20
4. Technical Data ........................................................................................ 21
RE_5_ _ UI6Low ABB Automation
UI6High
1. Introduction
1.1 Features
1.2 Application
Z<
Z<<
)LJXUH 3URWHFWLRQGLDJUDPV\PEROVRI8,/RZDQG8,+LJK)RU,(&V\PEROV
XVHGLQVLQJOHOLQHGLDJUDPVUHIHUWRWKHPDQXDO7HFKQLFDO'HVFULSWLRQV
RI)XQFWLRQV,QWURGXFWLRQ056080
2
ABB Automation UI6Low RE_5_ _
UI6HIgh
)LJXUH )XQFWLRQEORFNV\PEROVRI8,/RZDQG8,+LJK
3
RE_5_ _ UI6Low ABB Automation
UI6High
4
ABB Automation UI6Low RE_5_ _
UI6HIgh
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The phase currents IL1, IL2 and IL3 are
connected to the corresponding IL1, IL2 and IL3 inputs of the function block and
correspondingly, the phase-to-earth voltages U1, U2 and U3 are connected to the inputs
UL1, UL2 and UL3 of the function block. If phase-to-phase voltages are used, they
are connected as follows: U12 to the input UL1, U23 to UL2 and U31 to UL3. The
virtual phase-to-phase voltage signals derived from phase-to-earth voltages may also
be used if available. Furthermore, the digital inputs are connected to the boolean
inputs of the function block and the outputs of the function block are connected to the
output signals. Using the signals IL1b, IL2b and IL3b instead of IL1, IL2 and IL3 is
also possible, but mixing these two signal sets is not allowed.
5
RE_5_ _ UI6Low ABB Automation
UI6High
Table 1. Measuring signal options and the input signals required for each option
2-ph, ph-e 1&2 1 U1, U2; IL1, IL2 (U1 - U2) / (IL1 - IL2)
2-ph, ph-e 2&3 2 U2, U3; IL2, IL3 (U2 - U3) / (IL2 - IL3)
2-ph, ph-e 3&1 3 U3, U1; IL3, IL1 (U3 - U1) / (IL3 - IL1)
3-ph, ph-e 4 U1, U2, U3; IL1, IL2, IL3 (U1 - U2) / (IL1 - IL2); Recommended
(U2 - U3) / (IL2 - IL3);
(U3 - U1) / (IL3 - IL1)
3-ph, U12&U23 8 U12, U23 ; IL1, IL2, IL3 U12 / (IL1 - IL2);
U23 / (IL2 - IL3);
(U12 + U23) / (IL3 - IL1)
3-ph, U23&U31 9 U23, U31 ; IL1, IL2, IL3 U23 / (IL2 - IL3);
U31 / (IL3 - IL1);
(U23 + U31) / (IL1 - IL2)
3-ph, U31&U12 10 U31, U12 ; IL1, IL2, IL3 U31 / (IL3 - IL1);
U12 / (IL1 - IL2);
(U31 + U12) / (IL2 - IL3)
3-ph, ph-ph 11 U12, U23, U31 ; IL1, IL2, IL3 U12 / (IL1 - IL2); Recommended
U23 / (IL2 - IL3);
U31 / (IL3 - IL1)
The default value of the Meas signals parameter depends on the signals connected.
The function block chooses the most covering Meas.signals option (checking order:
11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1, 0).
Note! The current signals should be connected from the neutral point side of the
generator (symbols IL1, IL2, IL3). The signals IL1b, IL2b and IL3b may be used
instead if, for some reason, the signals need to be connected from the network side.
The built-in logic of the UI6_ function block checks the channel configuration, i.e. the
analogue signal connections to the current and voltage inputs, and ensures that at least
the minimum number of signals is properly configured and connected to the inputs.
The function block cannot be activated if there is an insufficient number of correct
input signal connections. Furthermore, the error output of the function block is
activated and a configuration error event (E11) is sent if some of the vital signals are
missing, e.g. there are no currents connected to the function block, or the signal
configuration is incorrect.
6
ABB Automation UI6Low RE_5_ _
UI6HIgh
The current measurement of the function block is based on the average value of
consecutive instantaneous peak-to-peak values or the numerically calculated
fundamental frequency components of currents, whereas the fundamental frequency
components are used for voltages in every case.
The impedance values are calculated from the current and voltage phasors. When
peak-to-peak values are used for currents, the impedance values are calculated using
these peak-to-peak values instead of the magnitude of the current phasor. The phase
angle is derived from the fundamental frequency calculation. Note, however, that
even though the impedance calculation is based on current and voltage phasors, only
the absolute values (or: the magnitudes) of the impedances are taken into account.
An impedance value will not be evaluated, i.e. the default value (100000.00 p.u.) will
be displayed in the monitored input data, if the current is below 0.02 x In.
2.3.1 General
When the function block starts, the START signal is set to TRUE. Should the
duration of the underimpedance exceed the set definite operate time, the function
block operates (=the TRIP signal is set to TRUE). The delay of the heavy-duty output
relay is included in the total operate time.
The DT timer is allowed to run only if the BLOCK signal is inactive, i.e. its value is
FALSE. When the blocking signal becomes active, i.e. its value turns to TRUE, the
timer will be stopped (frozen).
The relay measures the impedance by calculating the impedances of the incoming
voltages and currents. The operating characteristic is an origin-centric circular
characteristic on the impedance plane. The operation of the underimpedance function
block is based on comparing the impedances to the operating characteristic: the
function block operates if the measured impedance falls below the set limit i.e. enters
the circle. The lowest impedance value is taken into account when evaluating the
criterion above. As a result of the origin-centric characteristic, the operation is non-
directional since the angle of the impedance has no effect on the operation but only
the magnitude of the impedance determines the operating point.
The voltage should be measured from the generator terminals and the current from the
neutral point of the generator (Figure 3). The function block is usually set to protect
the zone between the generator windings (although total cover is impossible) and the
generator side windings of the step-up transformer. To prevent maloperation of the
7
RE_5_ _ UI6Low ABB Automation
UI6High
)LJXUH /RFDWLRQRIPHDVXULQJSRLQWVIRUXQGHULPSHGDQFHSURWHFWLRQ
Figure 4 presents a phase current in a three-phase short circuit when a fault occurs at
time 0 s (for simplicity, the offset of the fault current is assumed to be zero). In this
case, with an ordinary overcurrent relay having the current setting 1.2 x In (in the
picture this is presented by dashed lines that are set at 1.2 x 2 1.70 ), the time
setting should be less than 0.2 s since with a higher value, the short-circuit current
would decay below the set value and the relay would drop off. The current setting
may also be reduced to 1.1 x In although this provides no substantial rise in the exceed
time. In some situations, either of the above current settings would be appropriate, but
if longer tripping times are required to maintain the time selectivity, underimpedance
protection is needed.
8
ABB Automation UI6Low RE_5_ _
UI6HIgh
I / In 1
-1
-2
-3
-4
NOTE! Setting limits are multiplied by sqrt of 2
-5
-0.2 -0.1 0 0.1 0.2 0.3 0.4 0.5 0.6
t (s)
)LJXUH 6KRUWFLUFXLWFXUUHQWZDYHIRUP)DXOWRFFXUVDWWLPHVDQGLVQRW
GLVFRQQHFWHG
1
U / Un
-1
-2
-3
-4
-5
-0.2 -0.1 0 0.1 0.2 0.3 0.4 0.5 0.6
t (s)
)LJXUH 6KRUWFLUFXLWYROWDJHZDYHIRUP)DXOWRFFXUVDWWLPHVDQGLVQRW
GLVFRQQHFWHG
The voltage drop caused by a three-phase fault provides more time for determining
the fault by means of an underimpedance relay because the ratio U/I = Z still remains
under the set value (Figure 6).
9
RE_5_ _ UI6Low ABB Automation
UI6High
)LJXUH ,PSHGDQFHWUDMHFWRU\GXULQJDVKRUWFLUFXLW
The operation of the underimpedance function block UI6_ must be restrained if the
voltage in one or more phases suddenly drops close to zero without any significant
change in the current observed at the same time. This situation is considered a fuse
failure or a miniature circuit-breaker operation in the voltage transformer secondary
circuit. The voltage drop could cause an unwanted operation of the function block
since the calculated impedance could fall below the set operating limit even if there
was no actual fault in the primary system. The actual blocking operation is provided
by an external function block, FuseFail, the output of which is connected to the
BLOCK input of the underimpedance function block (Figure 7).
)LJXUH 7KH)XVH)DLOIXQFWLRQEORFNFDQEHXVHGWRJHQHUDWHWKHEORFNLQJVLJQDO
IRUWKH8,/RZDQG8,+LJKIXQFWLRQEORFNVDVZHOODVIRUDQ\RWKHU
YROWDJHGHSHQGHQWIXQFWLRQEORFN1RWHDOVRWKHXVDJHRIWHPSRUDU\
YDULDEOHV
10
ABB Automation UI6Low RE_5_ _
UI6HIgh
The operation of the function block is resumed only after the blocking signal is
restored to zero, i.e. the voltage measurement returns to a normal level. A fuse failure
should be repaired as soon as possible to restore the normal operation of the voltage-
dependent protection functions.
The moment when an underimpedance occurs may contain so-called drop-off periods
during which the impedance is outside the set characteristic. This may happen, for
instance, when a severe fault produces high asymmetrical fault currents that partially
saturate the current transformers. An apparent drop-off period of the secondary
current of the saturated current transformer might reset the DT timer. The adjustable
delayed reset function also enables closer co-ordination with electromechanical
induction disc relays. Without the delayed reset function the DT timer would reset
once the impedance drops off.
When the DT timer has started, it goes on running as normally even if the impedance
drops off, provided the drop-off period is shorter than the set drop-off time. If the
drop-off period is longer than the set drop-off time, the DT timer will reset when the
drop-off time elapses (Figure 8).
In Figure 8 and Figure 9, the input signal IN of the DT timer is TRUE when the
impedance is inside the set offset-mho circle and FALSE when the impedance is
outside the circle.
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff1.fh7
Operate time
Operate
timer
)LJXUH 7KHVHWGURSRIIWLPHLVVKRUWHUWKDQWKHGURSRIISHULRG
11
RE_5_ _ UI6Low ABB Automation
UI6High
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff2.fh7
Operate time
Operate
timer
)LJXUH 7KHVHWGURSRIIWLPHLVORQJHUWKDQWKHGURSRIISHULRG
Two different groups of setting values, group 1 and group 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
The the control parameter Active group indicates the setting group valid at a given
time.
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
12
ABB Automation UI6Low RE_5_ _
UI6HIgh
The output signal START is always pulse-shaped. The minimum pulse width of the
corresponding output signal is set with a separate parameter on the MMI or on serial
communication. If the start situation is longer than the set pulse width, the START
signal remains active until the start situation is over. The output signal TRIP may
have a non-latching or latching feature. When the latching mode has been selected,
the TRIP signal remains active until the output is reset even if the operation criteria
have reset. When the non-latching mode has been selected, the TRIP signal remains
active until the operation criteria have reset and the time determined by the control
parameter Trip pulse has elapsed.
The function block provides a delayed trip signal CBFP after the TRIP signal unless
the fault has disappeared during the set CBFP time delay. In circuit-breaker failure
protection the CBFP output can be used to operate a circuit breaker in front of the
circuit breaker of the machine. The control parameter Trip pulse is used for setting
the width of the CBFP output signal.
2.9 Resetting
The TRIP output signal and the registers can be reset via the RESET input, or over the
serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
13
RE_5_ _ UI6Low ABB Automation
UI6High
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for UI6Low is 110 and that for UI6High 111.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
14
ABB Automation UI6Low RE_5_ _
UI6HIgh
UI6Low
Parameter Code Values Unit Default Data Explanation
direction
Z-setting S1 0.0160.00 p.u. 0.07 R Start impedance
UI6High
Parameter Code Values Unit Default Data Explanation
direction
Z-setting S1 0.0160.00 p.u. 0.04 R Start impedance
UI6Low
Parameter Code Values Unit Default Data Explanation
direction
Z-setting S41 0.0160.00 p.u. 0.07 R/W Start impedance
UI6High
Parameter Code Values Unit Default Data Explanation
direction
Z-setting S41 0.0160.00 p.u. 0.04 R/W Start impedance
UI6Low
Parameter Code Values Unit Default Data Explanation
direction
Z-setting S71 0.0160.00 p.u. 0.07 R/W Start impedance
UI6High
Parameter Code Values Unit Default Data Explanation
direction
Z-setting S71 0.0160.00 p.u. 0.04 R/W Start impedance
15
RE_5_ _ UI6Low ABB Automation
UI6High
CBFP time V10 1001000 ms 200 R/W Operate time of the delayed trip
CBFP
Event mask 1 V101 04095 - 2111 R/W Event mask 1 for event
transmission (E0 ... E9, E11)
Event mask 2 V103 04095 - 2111 R/W Event mask 2 for event
transmission (E0 ... E9, E11)
Event mask 3 V105 04095 - 2111 R/W Event mask 3 for event
transmission (E0 ... E9, E11)
Event mask 4 V107 04095 - 2111 R/W Event mask 4 for event
transmission (E0 ... E9, E11)
1)
UI6_ 0 = Not in use; 1 = In use
2)
Meas. signals 0 = Not selected; 1 = 2-ph, ph-e 1&2; 2 = 2-ph, ph-e 2&3; 3 = 2-ph, ph-e 3&1;
4 = 3-ph, ph-e; 5 = 2-ph, ph-ph 1&2; 6 = 2-ph, ph-ph 2&3; 7 = 2-ph, ph-ph 3&1;
8 = 3-ph, U12&U23; 9 = 3-ph, U23&U31; 10 = 3-ph, U31&U12;
11 = 3-ph, ph-ph
3)
Measuring mode 0 = Peak-to-peak; 1 = Fundam. freq.
4)
Group selection 0 = Group 1; 1 = Group 2; 2 = GROUP input
5)
Active group 0 = Group 1; 1 = Group 2
6)
Trip signal 0 = Non-latching; 1 = Latching
7)
Test 0 = Do not activate; 1 = Activate
8)
The default value of the Meas signals parameter depends on the signals connected. The function
block chooses the most covering Meas.signals option
(checking order: 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1, 0).
16
ABB Automation UI6Low RE_5_ _
UI6HIgh
3.3.3.1 General
The information required for later fault analysis is recorded when the function block
starts or trips.
The data of last three operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,
17
RE_5_ _ UI6Low ABB Automation
UI6High
The time stamp indicates the rising edge of the START or TRIP signal.
3.3.3.3 Duration
The duration of the start situation is recorded as a percentage of the set operate time.
The duration can be 100% only if the function block has tripped. If, for example, the
Drop-off time setting causes the start situation to be active over the set operate time
but a new exceeding of the operate value does not occur during the set drop-off time,
the duration will be 99%.
3.3.3.4 Impedances
If the function block trips, the impedance values are updated at the moment of
tripping i.e. on the rising edge of the TRIP signal. If the function block starts but does
not trip, the impedance values captured one fundamental cycle (20 ms at rated
frequency 50 Hz) after the beginning of the start situation are recorded. So the values
of the impedances (magnitudes ZL1, ZL2, ZL3 ) always originate from the same moment
and are recorded as multiples of the base impedance (ZN = | UN2 / SN | ). Note that the
default value (100000.00 p.u.) remains in the monitored input data and in the recorded
data if the measuring signal selection limits the number of evaluated impedances.
The status data of the input signal BLOCK and the active setting group are recorded
at the moment of triggering.
3.3.3.6 Priority
1) Tripping
2) Starting.
18
ABB Automation UI6Low RE_5_ _
UI6HIgh
19
RE_5_ _ UI6Low ABB Automation
UI6High
3.3.4 Events
E10 0 0 - -
20
ABB Automation UI6Low RE_5_ _
UI6HIgh
Reset time 70...1030 ms (depends on the minimum pulse width set for the TRIP
output)
Reset ratio Reset ratio = (distance of the measured impedance from the center of
the circle during drop-off) / (radius of the circle).
Retardation time Total retardation time when the impedance drops below
the start value < 45 ms 2)
Operate time accuracy Depends on the frequency of the voltage and current measured:
21
1MRS752331-MUM UI6_
Issued: 3/2000
Version: B/28.1.2002
Three-Phase
Underimpedance Protection
Low-Set Stage (UI6Low)
Data subject to change without notice High-Set Stage (UI6High)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 4
1.4 Output description ............................................................................... 4
2. Description of Operation.......................................................................... 5
2.1 Configuration....................................................................................... 5
2.1.1 Signal connection....................................................................... 5
2.1.2 Signal check............................................................................... 6
2.2 Measuring mode ................................................................................. 7
2.3 Operation criteria................................................................................. 7
2.3.1 General ...................................................................................... 7
2.3.2 Underimpedance protection ....................................................... 7
2.4 Comparison between overcurrent and underimpedance protection..... 8
2.5 Delayed reset facility and drop-off time in DT mode .......................... 11
2.6 Setting groups ................................................................................... 12
2.7 Test mode ......................................................................................... 12
2.8 START, TRIP and CBFP outputs ...................................................... 13
2.9 Resetting........................................................................................... 13
3. Parameters and Events .......................................................................... 14
3.1 General ............................................................................................. 14
3.2 Setting values.................................................................................... 15
3.2.1 Actual settings.......................................................................... 15
3.2.2 Setting group 1......................................................................... 15
3.2.3 Setting group 2......................................................................... 15
3.2.4 Control settings ........................................................................ 16
3.3 Measurement values ......................................................................... 17
3.3.1 Input data ................................................................................. 17
3.3.2 Output data .............................................................................. 17
3.3.3 Recorded data.......................................................................... 17
3.3.4 Events ...................................................................................... 20
4. Technical Data ........................................................................................ 21
UI6_ Substation Automation
1. Introduction
1.1 Features
1.2 Application
Z<
Z<<
)LJXUH 3URWHFWLRQGLDJUDPV\PEROVRI8,/RZDQG8,+LJK)RU,(&V\PEROV
XVHGLQVLQJOHOLQHGLDJUDPVUHIHUWRWKHPDQXDO7HFKQLFDO'HVFULSWLRQV
RI)XQFWLRQV,QWURGXFWLRQ056080
2
Substation Automation UI6 _
)LJXUH )XQFWLRQEORFNV\PEROVRI8,/RZDQG8,+LJK
3
UI6_ Substation Automation
4
Substation Automation UI6 _
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The phase currents IL1, IL2 and IL3 are
connected to the corresponding IL1, IL2 and IL3 inputs of the function block and
correspondingly, the phase-to-earth voltages U1, U2 and U3 are connected to the inputs
UL1, UL2 and UL3 of the function block. If phase-to-phase voltages are used, they
are connected as follows: U12 to the input UL1, U23 to UL2 and U31 to UL3. The
virtual phase-to-phase voltage signals derived from phase-to-earth voltages may also
be used if available. Furthermore, the digital inputs are connected to the boolean
inputs of the function block and the outputs of the function block are connected to the
output signals. Using the signals IL1b, IL2b and IL3b instead of IL1, IL2 and IL3 is
also possible, but mixing these two signal sets is not allowed.
5
UI6_ Substation Automation
Table 1. Measuring signal options and the input signals required for each option
2-ph, ph-e 1&2 1 U1, U2; IL1, IL2 (U1 - U2) / (IL1 - IL2)
2-ph, ph-e 2&3 2 U2, U3; IL2, IL3 (U2 - U3) / (IL2 - IL3)
2-ph, ph-e 3&1 3 U3, U1; IL3, IL1 (U3 - U1) / (IL3 - IL1)
3-ph, ph-e 4 U1, U2, U3; IL1, IL2, IL3 (U1 - U2) / (IL1 - IL2); Recommended
(U2 - U3) / (IL2 - IL3);
(U3 - U1) / (IL3 - IL1)
3-ph, U12&U23 8 U12, U23 ; IL1, IL2, IL3 U12 / (IL1 - IL2);
U23 / (IL2 - IL3);
(U12 + U23) / (IL3 - IL1)
3-ph, U23&U31 9 U23, U31 ; IL1, IL2, IL3 U23 / (IL2 - IL3);
U31 / (IL3 - IL1);
(U23 + U31) / (IL1 - IL2)
3-ph, U31&U12 10 U31, U12 ; IL1, IL2, IL3 U31 / (IL3 - IL1);
U12 / (IL1 - IL2);
(U31 + U12) / (IL2 - IL3)
3-ph, ph-ph 11 U12, U23, U31 ; IL1, IL2, IL3 U12 / (IL1 - IL2); Recommended
U23 / (IL2 - IL3);
U31 / (IL3 - IL1)
The default value of the Meas signals parameter depends on the signals connected.
The function block chooses the most covering Meas.signals option (checking order:
11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1, 0).
Note! The current signals should be connected from the neutral point side of the
generator (symbols IL1, IL2, IL3). The signals IL1b, IL2b and IL3b may be used
instead if, for some reason, the signals need to be connected from the network side.
The built-in logic of the UI6_ function block checks the channel configuration, i.e. the
analogue signal connections to the current and voltage inputs, and ensures that at least
the minimum number of signals is properly configured and connected to the inputs.
The function block cannot be activated if there is an insufficient number of correct
input signal connections. Furthermore, the error output of the function block is
activated and a configuration error event (E11) is sent if some of the vital signals are
missing, e.g. there are no currents connected to the function block, or the signal
configuration is incorrect.
6
Substation Automation UI6 _
The current measurement of the function block is based on the average value of
consecutive instantaneous peak-to-peak values or the numerically calculated
fundamental frequency components of currents, whereas the fundamental frequency
components are used for voltages in every case.
The impedance values are calculated from the current and voltage phasors. When
peak-to-peak values are used for currents, the impedance values are calculated using
these peak-to-peak values instead of the magnitude of the current phasor. The phase
angle is derived from the fundamental frequency calculation. Note, however, that
even though the impedance calculation is based on current and voltage phasors, only
the absolute values (or: the magnitudes) of the impedances are taken into account.
An impedance value will not be evaluated, i.e. the default value (100000.00 p.u.) will
be displayed in the monitored input data, if the current is below 0.02 x In.
2.3.1 General
When the function block starts, the START signal is set to TRUE. Should the
duration of the underimpedance exceed the set definite operate time, the function
block operates (=the TRIP signal is set to TRUE). The delay of the heavy-duty output
relay is included in the total operate time.
The DT timer is allowed to run only if the BLOCK signal is inactive, i.e. its value is
FALSE. When the blocking signal becomes active, i.e. its value turns to TRUE, the
timer will be stopped (frozen).
The relay measures the impedance by calculating the impedances of the incoming
voltages and currents. The operating characteristic is an origin-centric circular
characteristic on the impedance plane. The operation of the underimpedance function
block is based on comparing the impedances to the operating characteristic: the
function block operates if the measured impedance falls below the set limit i.e. enters
the circle. The lowest impedance value is taken into account when evaluating the
criterion above. As a result of the origin-centric characteristic, the operation is non-
directional since the angle of the impedance has no effect on the operation but only
the magnitude of the impedance determines the operating point.
The voltage should be measured from the generator terminals and the current from the
neutral point of the generator (Figure 3). The function block is usually set to protect
the zone between the generator windings (although total cover is impossible) and the
generator side windings of the step-up transformer. To prevent maloperation of the
underimpedance protection in case of near-by faults that should not be detected by
7
UI6_ Substation Automation
UI6_, the settings must be reasonably dimensioned. A setting equal to ca. 70% of the
step-up transformer short-circuit impedance is commonly used. Therefore, if used in
directly connected machines where the impedance towards the network is limited only
by the lines/busbars, it must be secured that the UI6_ function block will not cause
any selectivity problems. In general, the voltage-dependent overcurrent protection
VOC6_ is recommended for the protection of directly connected machines.
)LJXUH /RFDWLRQRIPHDVXULQJSRLQWVIRUXQGHULPSHGDQFHSURWHFWLRQ
Figure 4 presents a phase current in a three-phase short circuit when a fault occurs at
time 0 s (for simplicity, the offset of the fault current is assumed to be zero). In this
case, with an ordinary overcurrent relay having the current setting 1.2 x In (in the
picture this is presented by dashed lines that are set at 1.2 x 2 1.70 ), the time
setting should be less than 0.2 s since with a higher value, the short-circuit current
would decay below the set value and the relay would drop off. The current setting
may also be reduced to 1.1 x In although this provides no substantial rise in the exceed
time. In some situations, either of the above current settings would be appropriate, but
if longer tripping times are required to maintain the time selectivity, underimpedance
protection is needed.
8
Substation Automation UI6 _
1
I / In
0
-1
-2
-3
-4
NOTE! Setting limits are multiplied by sqrt of 2
-5
-0.2 -0.1 0 0.1 0.2 0.3 0.4 0.5 0.6
t (s)
)LJXUH 6KRUWFLUFXLWFXUUHQWZDYHIRUP)DXOWRFFXUVDWWLPHVDQGLVQRW
GLVFRQQHFWHG
1
U / Un
-1
-2
-3
-4
-5
-0.2 -0.1 0 0.1 0.2 0.3 0.4 0.5 0.6
t (s)
)LJXUH 6KRUWFLUFXLWYROWDJHZDYHIRUP)DXOWRFFXUVDWWLPHVDQGLVQRW
GLVFRQQHFWHG
The voltage drop caused by a three-phase fault provides more time for determining
the fault by means of an underimpedance relay because the ratio U/I = Z still remains
under the set value (Figure 6).
9
UI6_ Substation Automation
)LJXUH ,PSHGDQFHWUDMHFWRU\GXULQJDVKRUWFLUFXLW
The operation of the underimpedance function block UI6_ must be restrained if the
voltage in one or more phases suddenly drops close to zero without any significant
change in the current observed at the same time. This situation is considered a fuse
failure or a miniature circuit-breaker operation in the voltage transformer secondary
circuit. The voltage drop could cause an unwanted operation of the function block
since the calculated impedance could fall below the set operating limit even if there
was no actual fault in the primary system. The actual blocking operation is provided
by an external function block, FuseFail, the output of which is connected to the
BLOCK input of the underimpedance function block (Figure 7).
)LJXUH 7KH)XVH)DLOIXQFWLRQEORFNFDQEHXVHGWRJHQHUDWHWKHEORFNLQJVLJQDO
IRUWKH8,/RZDQG8,+LJKIXQFWLRQEORFNVDVZHOODVIRUDQ\RWKHU
YROWDJHGHSHQGHQWIXQFWLRQEORFN1RWHDOVRWKHXVDJHRIWHPSRUDU\
YDULDEOHV
10
Substation Automation UI6 _
The operation of the function block is resumed only after the blocking signal is
restored to zero, i.e. the voltage measurement returns to a normal level. A fuse failure
should be repaired as soon as possible to restore the normal operation of the voltage-
dependent protection functions.
The moment when an underimpedance occurs may contain so-called drop-off periods
during which the impedance is outside the set characteristic. This may happen, for
instance, when a severe fault produces high asymmetrical fault currents that partially
saturate the current transformers. An apparent drop-off period of the secondary
current of the saturated current transformer might reset the DT timer. The adjustable
delayed reset function also enables closer co-ordination with electromechanical
induction disc relays. Without the delayed reset function the DT timer would reset
once the impedance drops off.
When the DT timer has started, it goes on running as normally even if the impedance
drops off, provided the drop-off period is shorter than the set drop-off time. If the
drop-off period is longer than the set drop-off time, the DT timer will reset when the
drop-off time elapses (Figure 8).
In Figure 8 and Figure 9, the input signal IN of the DT timer is TRUE when the
impedance is inside the set offset-mho circle and FALSE when the impedance is
outside the circle.
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff1.fh7
Operate time
Operate
timer
)LJXUH 7KHVHWGURSRIIWLPHLVVKRUWHUWKDQWKHGURSRIISHULRG
11
UI6_ Substation Automation
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff2.fh7
Operate time
Operate
timer
)LJXUH 7KHVHWGURSRIIWLPHLVORQJHUWKDQWKHGURSRIISHULRG
Two different groups of setting values, group 1 and group 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
The the control parameter Active group indicates the setting group valid at a given
time.
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
12
Substation Automation UI6 _
The output signal START is always pulse-shaped. The minimum pulse width of the
corresponding output signal is set with a separate parameter on the MMI or on serial
communication. If the start situation is longer than the set pulse width, the START
signal remains active until the start situation is over. The output signal TRIP may
have a non-latching or latching feature. When the latching mode has been selected,
the TRIP signal remains active until the output is reset even if the operation criteria
have reset. When the non-latching mode has been selected, the TRIP signal remains
active until the operation criteria have reset and the time determined by the control
parameter Trip pulse has elapsed.
The function block provides a delayed trip signal CBFP after the TRIP signal unless
the fault has disappeared during the set CBFP time delay. In circuit-breaker failure
protection the CBFP output can be used to operate a circuit breaker in front of the
circuit breaker of the machine. The control parameter Trip pulse is used for setting
the width of the CBFP output signal.
2.9 Resetting
The TRIP output signal and the registers can be reset via the RESET input, or over the
serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
13
UI6_ Substation Automation
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for UI6Low is 110 and that for UI6High 111.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
14
Substation Automation UI6 _
UI6Low
Parameter Code Values Unit Default Data Explanation
direction
Z-setting S1 0.0160.00 p.u. 0.07 R Start impedance
UI6High
Parameter Code Values Unit Default Data Explanation
direction
Z-setting S1 0.0160.00 p.u. 0.04 R Start impedance
UI6Low
Parameter Code Values Unit Default Data Explanation
direction
Z-setting S41 0.0160.00 p.u. 0.07 R/W Start impedance
UI6High
Parameter Code Values Unit Default Data Explanation
direction
Z-setting S41 0.0160.00 p.u. 0.04 R/W Start impedance
UI6Low
Parameter Code Values Unit Default Data Explanation
direction
Z-setting S71 0.0160.00 p.u. 0.07 R/W Start impedance
UI6High
Parameter Code Values Unit Default Data Explanation
direction
Z-setting S71 0.0160.00 p.u. 0.04 R/W Start impedance
15
UI6_ Substation Automation
CBFP time V10 1001000 ms 200 R/W Operate time of the delayed trip
CBFP
Event mask 1 V101 03071 - 2111 R/W Event mask 1 for event
transmission (E0 ... E9, E11)
Event mask 2 V103 03071 - 2111 R/W Event mask 2 for event
transmission (E0 ... E9, E11)
Event mask 3 V105 03071 - 2111 R/W Event mask 3 for event
transmission (E0 ... E9, E11)
Event mask 4 V107 03071 - 2111 R/W Event mask 4 for event
transmission (E0 ... E9, E11)
1)
UI6_ 0 = Not in use; 1 = In use
2)
Meas. signals 0 = Not selected; 1 = 2-ph, ph-e 1&2; 2 = 2-ph, ph-e 2&3; 3 = 2-ph, ph-e 3&1;
4 = 3-ph, ph-e; 5 = 2-ph, ph-ph 1&2; 6 = 2-ph, ph-ph 2&3; 7 = 2-ph, ph-ph 3&1;
8 = 3-ph, U12&U23; 9 = 3-ph, U23&U31; 10 = 3-ph, U31&U12;
11 = 3-ph, ph-ph
3)
Measuring mode 0 = Peak-to-peak; 1 = Fundam. freq.
4)
Group selection 0 = Group 1; 1 = Group 2; 2 = GROUP input
5)
Active group 0 = Group 1; 1 = Group 2
6)
Trip signal 0 = Non-latching; 1 = Latching
7)
Test 0 = Do not activate; 1 = Activate
8)
The default value of the Meas signals parameter depends on the signals connected. The function
block chooses the most covering Meas.signals option
(checking order: 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1, 0).
16
Substation Automation UI6 _
3.3.3.1 General
The information required for later fault analysis is recorded when the function block
starts or trips.
The data of last three operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,
17
UI6_ Substation Automation
The time stamp indicates the rising edge of the START or TRIP signal.
3.3.3.3 Duration
The duration of the start situation is recorded as a percentage of the set operate time.
The duration can be 100% only if the function block has tripped. If, for example, the
Drop-off time setting causes the start situation to be active over the set operate time
but a new exceeding of the operate value does not occur during the set drop-off time,
the duration will be 99%.
3.3.3.4 Impedances
If the function block trips, the impedance values are updated at the moment of
tripping i.e. on the rising edge of the TRIP signal. If the function block starts but does
not trip, the impedance values captured one fundamental cycle (20 ms at rated
frequency 50 Hz) after the beginning of the start situation are recorded. So the values
of the impedances (magnitudes ZL1, ZL2, ZL3 ) always originate from the same moment
and are recorded as multiples of the base impedance (ZN = | UN2 / SN | ). Note that the
default value (100000.00 p.u.) remains in the monitored input data and in the recorded
data if the measuring signal selection limits the number of evaluated impedances.
The status data of the input signal BLOCK and the active setting group are recorded
at the moment of triggering.
3.3.3.6 Priority
1) Tripping
2) Starting.
18
Substation Automation UI6 _
19
UI6_ Substation Automation
2)
Active group 0 = Group 1; 1 = Group 2
3.3.4 Events
E10 0 0 - -
20
Substation Automation UI6 _
Reset time 70...1030 ms (depends on the minimum pulse width set for the TRIP
output)
Reset ratio Reset ratio = (distance of the measured impedance from the center of
the circle during drop-off) / (radius of the circle).
Retardation time Total retardation time when the impedance drops below
the start value < 45 ms 2)
Operate time accuracy Depends on the frequency of the voltage and current measured:
D -
21
1MRS100095 (Stage 1) RE_5_ _
1MRS100096 (Stage 2) Three-Phase Underpower or
1MRS100097 (Stage 3)
Issued: 10/1998 Reverse Power Protection
Version: C
Stage 1 (UPOW6St1)
Data subject to change without notice
Stage 2 (UPOW6St2)
Stage 3 (UPOW6St3)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 3
2. Description of Operation.......................................................................... 4
2.1 Configuration....................................................................................... 4
2.1.1 Correction parameters for measuring devices............................ 4
2.1.2 Analogue input selection for configuration.................................. 4
2.2 Measuring mode ................................................................................. 5
2.3 Operation criteria................................................................................. 6
2.4 Delayed reset facility and drop-off time in DT Mode ............................ 8
2.5 Setting groups ..................................................................................... 9
2.6 Test mode ........................................................................................... 9
2.7 START, TRIP and CBFP outputs ........................................................ 9
2.8 Resetting........................................................................................... 10
1. Introduction
1.1 Features
1.2 Application
This document specifies the functions of the three-phase underpower or reverse power
function blocks UPOW6St1, UPOW6St2 and UPOW6St3 used in products based on
the RED 500 Platform. The three stages are identical in operation.
The primary application of the function block is the reverse power protection
(Operation mode = reverse power) of the prime mover of a generator. The function is
necessary for the following types of prime mover:
steam turbines
Francis and Kaplan hydro units
gas turbines
diesel motors
The function block can also be used for forward power monitoring (Operation mode =
reverse power). In case of parallel connected generators for example, the load of one
generator may be so low that it is better to disconnect it and let the remaining
generators feed the network.
P<
)LJXUH 3URWHFWLRQGLDJUDPV\PERORI832:6WB)RU,(&V\PEROVXVHGLQ
VLQJOHOLQHGLDJUDPVUHIHUWRWKHPDQXDO7HFKQLFDO'HVFULSWLRQVRI
)XQFWLRQV,QWURGXFWLRQ056080
2
ABB Automation UPOW6St1UPOW6St3 RE_5_ _
)LJXUH )XQFWLRQEORFNV\PEROVRI832:6W832:6WDQG832:6W
3
RE_5_ _ UPOW6St1UPOW6St3 ABB Automation
2.1 Configuration
Where a low value of reverse power setting is required, e.g. 2%, and the primary
circuit operating values must not deviate significantly from this, the correction
parameters have be used in the relay to compensate for the measuring errors. The
manufacturer of the measuring devices is to be contacted to obtain information on the
measuring errors.
If the measuring errors are not compensated for, the underpower setting should not be
lower than the sum of the current and voltage measuring errors. For example, if the
error of the current measuring device is 2 % and that of the voltage measuring device
1 %, the minimum setting is ( 2 + 1 ) % = 3 %.
The correction parameters for measuring devices can be set in the Relay
Configuration Tool as well as via the MMI of the machine terminal. For more
information on setting the correction parameters refer to the Technical Reference
Manual of REM 543.
The analogue input combinations listed below are available in the dialogue box of the
configuration tool. When all the phase currents and phase voltages are known, P and
Q are calculated from positive-sequence components. The correct input combination
is selected via the configuration tool.
4
ABB Automation UPOW6St1UPOW6St3 RE_5_ _
With the rated frequency of 50 Hz, the active and reactive power values are updated
twice each fundamental frequency cycle, i.e. every 10 ms.
Power direction can be changed via the control parameter Power direction.
5
RE_5_ _ UPOW6St1UPOW6St3 ABB Automation
UPOW6St_ can be set to monitor either reverse power or low forward power via the
setting parameter Operation mode. The function block starts if the measured power
drops below the operating line.
:DUQLQJ The phase displacement errors of sensors, i.e. voltage dividers and
Rogowski coils, are not compensated for in the relay since they are generally
negligible from the practical point of view. However, in case of resistive voltage
dividers, the phase displacement error may be so large that it will cause an inaccuracy
of more than 1% x rated value in the operation of the function block. Therefore, a
setting lower that 1.5 % is not recommended to be used when voltages are measured
by resistive voltage dividers.
Q
s
e
t
a
P
r
e
p
Hysteresis
O
.
)LJXUH 7KHRSHUDWLQJFKDUDFWHULVWLFRI832:6WBZKHQWKHRSHUDWLRQPRGHLV
UHYHUVHSRZHU
Q
s
e
t
a
P
r
e
p
Hysteresis
O
)LJXUH 7KHRSHUDWLQJFKDUDFWHULVWLFRI832:6WBZKHQRSHUDWLRQPRGHLV
XQGHUSRZHU
6
ABB Automation UPOW6St1UPOW6St3 RE_5_ _
When the parameter Disable mode is ON, the function block cannot operate if the
DISABLE input is active. When the DISABLE input is deactivated, the function
block still remains disabled for the time defined in the Wait time parameter. The
DISABLE input must be connected negated to the status of the circuit breaker. The
Wait time parameter and the DISABLE input are used when synchronizing the
generator.
When the parameter Disable mode is OFF, the DISABLE input has no effect.
)LJXUH ([DPSOHRIFRQILJXUDWLRQZKHQWKH',6$%/(LQSXWLVXVHG
START
TRIP
Wait time
Operation
allowed
)LJXUH 0HDQLQJRIWKH',6$%/(LQSXWDQG:DLWWLPHSDUDPHWHUZKHQ
'LVDEOHPRGH 21
START
TRIP
)LJXUH 2SHUDWLRQLVDOORZHGDOOWKHWLPHDQGWKH:DLWWLPHSDUDPHWHUKDVQR
HIIHFWLIWKH'LVDEOHPRGH 2))
7
RE_5_ _ UPOW6St1UPOW6St3 ABB Automation
At reciprocating load conditions, the power measuring element may pick up briefly
and periodically. The purpose of the delayed reset function is to ensure that the
function block operates within its predetermined operating time even in such power
swing conditions. Without the delayed reset function the DT timer would reset as
soon as the measuring element drops off.
When the DT timer has started, it goes on running normally even if the measuring
element drops off, provided the drop-off period is shorter than the set drop-off time. If
the drop-off period is longer than the set drop-off time, the DT timer will reset when
the drop-off time elapses (Figure 8).
In Figures 8 and 9 the input signal IN of the DT timer is TRUE when the measured
power is below the set start value and FALSE when the measured power is above the
set start value.
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff1.fh7
Operate time
Operate
timer
)LJXUH 7KHGURSRIISHULRGLVORQJHUWKDQWKHVHWGURSRIIWLPH
If the drop-off period is shorter than the set drop-off time and the DT timer has
elapsed during the drop-off period, the function block will trip once the measured
power drops below the set start value again (Figure 9).
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff2.fh7
Operate time
Operate
timer
)LJXUH 7KHGURSRIISHULRGLVVKRUWHUWKDQWKHVHWGURSRIIWLPH
8
ABB Automation UPOW6St1UPOW6St3 RE_5_ _
Two different groups of setting values, group 1 and group 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The output signal START is always pulse-shaped. The minimum pulse width of the
corresponding output signal is set with a separate parameter on the MMI or on serial
communication. If the start situation is longer than the set pulse width, the START
signal remains active until the start situation is over. The output signal TRIP may
have a non-latching or latching feature. When the latching mode has been selected,
the TRIP signal remains active until the output is reset even if the operation criteria
have reset.
The function block provides a delayed trip signal CBFP after the TRIP signal unless
the fault has disappeared during the set CBFP time delay. In circuit-breaker failure
protection the CBFP output can be used to operate a circuit breaker in front of the
circuit breaker of the machine. The control parameter Trip pulse also sets the width
of the CBFP output signal.
9
RE_5_ _ UPOW6St1UPOW6St3 ABB Automation
2.8 Resetting
The TRIP output signal and the registers can be reset via the RESET input, or over the
serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
10
ABB Automation UPOW6St1UPOW6St3 RE_5_ _
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for UPOW6St1 is 95, that for UPOW6St2 96
and that for UPOW6St3 97.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
11
RE_5_ _ UPOW6St1UPOW6St3 ABB Automation
Wait time S44 0.0...60.0 s 0.0 R/W Waiting time after closing a circuit
breaker
Wait time S74 0.0...60.0 s 0.0 R/W Waiting time after closing a circuit
breaker
12
ABB Automation UPOW6St1UPOW6St3 RE_5_ _
CBFP time V10 100...1000 ms 100 R/W Operate time of the delayed
trip CBFP
13
RE_5_ _ UPOW6St1UPOW6St3 ABB Automation
3.3.3.1 General
The information required for later fault analysis is recorded when the function block
starts or trips.
The data of three last operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
14
ABB Automation UPOW6St1UPOW6St3 RE_5_ _
The time stamp indicates the rising edge of the START or TRIP signal.
3.3.3.3 Duration
The duration of the start situation is recorded as a percentage of the set operate time.
3.3.3.4 Power
If the function block trips, the power values are updated at the moment of tripping i.e.
on the rising edge of the TRIP signal. If the function block starts but does not trip, the
power values captured one fundamental cycle (20 ms at rated frequency 50 Hz) after
the beginning of the start situation are recorded. Consequently, the active and reactive
power values P and Q always originate from the same moment and are recorded as
multiples of the rated power Sn.
The status data of the input signal BLOCK (Active or Not active) and the Active
group parameter are recorded at the moment of triggering. The Active group
parameter indicates the setting group valid for the recorded data.
3.3.3.6 Priority
1 Tripping
2 Starting
15
RE_5_ _ UPOW6St1UPOW6St3 ABB Automation
16
ABB Automation UPOW6St1UPOW6St3 RE_5_ _
3.3.4 Events
17
RE_5_ _ UPOW6St1UPOW6St3 ABB Automation
or
Start time Injected power < 0.5 x Power setting (Operation mode = underpower)
or 2.0 x Power setting (Operation mode = reverse power):
Reset time 70...1030 ms (depends on the minimum pulse width set for the TRIP
output)
Reset ratio Typ. 0.98 (range 0.8...0.98) when Operation mode = reverse power
Retardation time Total retardation time when the power exceeds the
the value set for the Power setting parameter < 45 ms2)
Operate time accuracy Depends on the frequency of the current and voltage measured:
18
1MRS752332-MUM UPOW6St_
Issued: 10/1998
Version: D/28.1.2002
Three-Phase Underpower or
Reverse Power Protection
Stage 1 (UPOW6St1)
Stage 2 (UPOW6St2)
Data subject to change without notice Stage 3 (UPOW6St3)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 3
1.4 Output description ............................................................................... 3
2. Description of Operation.......................................................................... 4
2.1 Configuration....................................................................................... 4
2.1.1 Correction parameters for measuring devices............................ 4
2.1.2 Analogue input selection for configuration.................................. 4
2.2 Measuring mode ................................................................................. 5
2.3 Operation criteria................................................................................. 6
2.4 Delayed reset facility and drop-off time in DT Mode ............................ 8
2.5 Setting groups ..................................................................................... 9
2.6 Test mode ........................................................................................... 9
2.7 START, TRIP and CBFP outputs ........................................................ 9
2.8 Resetting........................................................................................... 10
1. Introduction
1.1 Features
1.2 Application
This document specifies the functions of the three-phase underpower or reverse power
function blocks UPOW6St1, UPOW6St2 and UPOW6St3 used in products based on
the RED 500 Platform. The three stages are identical in operation.
The primary application of the function block is the reverse power protection
(Operation mode = reverse power) of the prime mover of a generator. The function is
necessary for the following types of prime mover:
steam turbines
Francis and Kaplan hydro units
gas turbines
diesel motors
The function block can also be used for forward power monitoring (Operation mode =
reverse power). In case of parallel connected generators for example, the load of one
generator may be so low that it is better to disconnect it and let the remaining
generators feed the network.
P<
)LJXUH 3URWHFWLRQGLDJUDPV\PERORI832:6WB)RU,(&V\PEROVXVHGLQ
VLQJOHOLQHGLDJUDPVUHIHUWRWKHPDQXDO7HFKQLFDO'HVFULSWLRQVRI
)XQFWLRQV,QWURGXFWLRQ056080
2
Substation Automation UPOW6St _
)LJXUH )XQFWLRQEORFNV\PEROVRI832:6W832:6WDQG832:6W
3
UPOW6St _ Substation Automation
2.1 Configuration
Where a low value of reverse power setting is required, e.g. 2%, and the primary
circuit operating values must not deviate significantly from this, the correction
parameters have be used in the relay to compensate for the measuring errors. The
manufacturer of the measuring devices is to be contacted to obtain information on the
measuring errors.
If the measuring errors are not compensated for, the underpower setting should not be
lower than the sum of the current and voltage measuring errors. For example, if the
error of the current measuring device is 2 % and that of the voltage measuring device
1 %, the minimum setting is ( 2 + 1 ) % = 3 %.
The correction parameters for measuring devices can be set in the Relay
Configuration Tool as well as via the MMI of the machine terminal. For more
information on setting the correction parameters refer to the Technical Reference
Manual of REM 543.
The analogue input combinations listed below are available in the dialogue box of the
configuration tool. When all the phase currents and phase voltages are known, P and
Q are calculated from positive-sequence components. The correct input combination
is selected via the configuration tool.
4
Substation Automation UPOW6St _
With the rated frequency of 50 Hz, the active and reactive power values are updated
twice each fundamental frequency cycle, i.e. every 10 ms.
Power direction can be changed via the control parameter Power direction.
5
UPOW6St _ Substation Automation
UPOW6St_ can be set to monitor either reverse power or low forward power via the
setting parameter Operation mode. The function block starts if the measured power
drops below the operating line.
:DUQLQJ The phase displacement errors of sensors, i.e. voltage dividers and
Rogowski coils, are not compensated for in the relay since they are generally
negligible from the practical point of view. However, in case of resistive voltage
dividers, the phase displacement error may be so large that it will cause an inaccuracy
of more than 1% x rated value in the operation of the function block. Therefore, a
setting lower that 1.5 % is not recommended to be used when voltages are measured
by resistive voltage dividers.
Q
s
e
t
a
P
r
e
p
Hysteresis
O
.
)LJXUH 7KHRSHUDWLQJFKDUDFWHULVWLFRI832:6WBZKHQWKHRSHUDWLRQPRGHLV
UHYHUVHSRZHU
Q
s
e
t
a
P
r
e
p
Hysteresis
O
)LJXUH 7KHRSHUDWLQJFKDUDFWHULVWLFRI832:6WBZKHQRSHUDWLRQPRGHLV
XQGHUSRZHU
6
Substation Automation UPOW6St _
When the parameter Disable mode is ON, the function block cannot operate if the
DISABLE input is active. When the DISABLE input is deactivated, the function
block still remains disabled for the time defined in the Wait time parameter. The
DISABLE input must be connected negated to the status of the circuit breaker. The
Wait time parameter and the DISABLE input are used when synchronizing the
generator.
When the parameter Disable mode is OFF, the DISABLE input has no effect.
)LJXUH ([DPSOHRIFRQILJXUDWLRQZKHQWKH',6$%/(LQSXWLVXVHG
START
TRIP
Wait time
Operation
allowed
)LJXUH 0HDQLQJRIWKH',6$%/(LQSXWDQG:DLWWLPHSDUDPHWHUZKHQ
'LVDEOHPRGH 21
START
TRIP
)LJXUH 2SHUDWLRQLVDOORZHGDOOWKHWLPHDQGWKH:DLWWLPHSDUDPHWHUKDVQR
HIIHFWLIWKH'LVDEOHPRGH 2))
7
UPOW6St _ Substation Automation
At reciprocating load conditions, the power measuring element may pick up briefly
and periodically. The purpose of the delayed reset function is to ensure that the
function block operates within its predetermined operating time even in such power
swing conditions. Without the delayed reset function the DT timer would reset as
soon as the measuring element drops off.
When the DT timer has started, it goes on running normally even if the measuring
element drops off, provided the drop-off period is shorter than the set drop-off time. If
the drop-off period is longer than the set drop-off time, the DT timer will reset when
the drop-off time elapses (Figure 8).
In Figures 8 and 9 the input signal IN of the DT timer is TRUE when the measured
power is below the set start value and FALSE when the measured power is above the
set start value.
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff1.fh7
Operate time
Operate
timer
)LJXUH 7KHGURSRIISHULRGLVORQJHUWKDQWKHVHWGURSRIIWLPH
If the drop-off period is shorter than the set drop-off time and the DT timer has
elapsed during the drop-off period, the function block will trip once the measured
power drops below the set start value again (Figure 9).
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff2.fh7
Operate time
Operate
timer
)LJXUH 7KHGURSRIISHULRGLVVKRUWHUWKDQWKHVHWGURSRIIWLPH
8
Substation Automation UPOW6St _
Two different groups of setting values, group 1 and group 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The output signal START is always pulse-shaped. The minimum pulse width of the
corresponding output signal is set with a separate parameter on the MMI or on serial
communication. If the start situation is longer than the set pulse width, the START
signal remains active until the start situation is over. The output signal TRIP may
have a non-latching or latching feature. When the latching mode has been selected,
the TRIP signal remains active until the output is reset even if the operation criteria
have reset.
The function block provides a delayed trip signal CBFP after the TRIP signal unless
the fault has disappeared during the set CBFP time delay. In circuit-breaker failure
protection the CBFP output can be used to operate a circuit breaker in front of the
circuit breaker of the machine. The control parameter Trip pulse also sets the width
of the CBFP output signal.
9
UPOW6St _ Substation Automation
2.8 Resetting
The TRIP output signal and the registers can be reset via the RESET input, or over the
serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
10
Substation Automation UPOW6St _
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for UPOW6St1 is 95, that for UPOW6St2 96
and that for UPOW6St3 97.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
11
UPOW6St _ Substation Automation
Wait time S44 0.0...60.0 s 0.0 R/W Waiting time after closing a circuit
breaker
Wait time S74 0.0...60.0 s 0.0 R/W Waiting time after closing a circuit
breaker
12
Substation Automation UPOW6St _
CBFP time V10 100...1000 ms 100 R/W Operate time of the delayed
trip CBFP
13
UPOW6St _ Substation Automation
3.3.3.1 General
The information required for later fault analysis is recorded when the function block
starts or trips.
The data of three last operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
14
Substation Automation UPOW6St _
The time stamp indicates the rising edge of the START or TRIP signal.
3.3.3.3 Duration
The duration of the start situation is recorded as a percentage of the set operate time.
3.3.3.4 Power
If the function block trips, the power values are updated at the moment of tripping i.e.
on the rising edge of the TRIP signal. If the function block starts but does not trip, the
power values captured one fundamental cycle (20 ms at rated frequency 50 Hz) after
the beginning of the start situation are recorded. Consequently, the active and reactive
power values P and Q always originate from the same moment and are recorded as
multiples of the rated power Sn.
The status data of the input signal BLOCK (Active or Not active) and the Active
group parameter are recorded at the moment of triggering. The Active group
parameter indicates the setting group valid for the recorded data.
3.3.3.6 Priority
1 Tripping
2 Starting
15
UPOW6St _ Substation Automation
16
Substation Automation UPOW6St _
3.3.4 Events
17
UPOW6St _ Substation Automation
or
Start time Injected power < 0.5 x Power setting (Operation mode = underpower)
or 2.0 x Power setting (Operation mode = reverse power):
Reset time 70...1030 ms (depends on the minimum pulse width set for the TRIP
output)
Reset ratio Typ. 0.98 (range 0.8...0.98) when Operation mode = reverse power
Retardation time Total retardation time when the power exceeds the
the value set for the Power setting parameter < 45 ms2)
Operate time accuracy Depends on the frequency of the current and voltage measured:
E -
18
1MRS100064 (UV3Low) RE_5_ _
1MRS100065 (UV3High) Three-Phase Undervoltage Protection
Issued 10/1997
Version: E Low-Set Stage (UV3Low)
Data subject to change without notice High-Set Stage (UV3High)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 4
1.4 Output description ............................................................................... 4
2. Description of Operation.......................................................................... 5
2.1 Configuration....................................................................................... 5
2.2 Measuring mode ................................................................................. 5
2.3 Operation criteria................................................................................. 6
2.3.1 Operation hysteresis and reset ratio........................................... 7
2.4 IDMT type operation of UV3Low ......................................................... 8
2.5 Setting groups ..................................................................................... 9
2.6 Test mode ........................................................................................... 9
2.7 START and TRIP outputs.................................................................... 9
2.8 Resetting........................................................................................... 10
3. Parameters and Events .......................................................................... 11
3.1 General ............................................................................................. 11
3.2 Setting values.................................................................................... 12
3.2.1 Actual settings.......................................................................... 12
3.2.2 Setting group 1......................................................................... 12
3.2.3 Setting group 2......................................................................... 13
3.2.4 Control settings ........................................................................ 14
3.3 Measurement values ......................................................................... 15
3.3.1 Input data ................................................................................. 15
3.3.2 Output data .............................................................................. 15
3.3.3 Recorded data.......................................................................... 15
3.3.4 Events ...................................................................................... 18
4. Technical Data ........................................................................................ 19
RE_5_ _ UV3Low ABB Automation
UV3High
1. Introduction
1.1 Features
1.2 Application
This document specifies the functions of the three-phase undervoltage function blocks
UV3Low and UV3High used in products based on the RED 500 Platform. The
inverse-time operation is only included in the UV3Low function block.
3U< 3U<<
2
ABB Automation UV3Low RE_5_ _
UV3High
)LJXUH )XQFWLRQEORFNV\PEROVRI89/RZDQG89+LJK
3
RE_5_ _ UV3Low ABB Automation
UV3High
4
ABB Automation UV3Low RE_5_ _
UV3High
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The phase-to-phase voltages U12, U23 and
U31 are connected to the corresponding UL1_U12, UL2_U23 and UL3_U31 inputs of
the function block. Digital inputs are connected to the boolean inputs of the function
block and in the same way, the outputs of the function block are connected to the
output signals.
1RWH If phase voltages are measured, the phase voltage UL1 is connected to the
input UL1_U12, the phase voltage UL2 to the input UL2_U23 and the phase voltage
UL3 to the input UL3_U31. The control parameter Measuring mode has to be in
position Mode 3. Phase-to-phase voltages are derived from phase voltages within the
function block as follows:
1RWH When phase-to-phase voltages are derived numerically in the relay, only the
fundamental frequency measurement can be used: peak-to-peak measurement is not
available (see section Measuring mode).
When phase-to-phase voltages are measured, the function block operates on two
alternative measuring principles: the average value of consecutive instantaneous peak-
to-peak values of voltages or the numerically calculated fundamental frequency
voltage. The measuring mode is selected with either an MMI parameter or a serial
communication parameter as follows:
5
RE_5_ _ UV3Low ABB Automation
UV3High
With both the measuring principles, the operation is insensitive to the DC component
and the operation accuracy is defined in the frequency range f/fn=0.95...1.05. In peak-
to-peak measurement, the harmonics of the voltages are not suppressed, whereas in
fundamental frequency measurement the harmonics suppression is about
-50 dB at f = n x fn, where n = 2, 3, 4, 5,...
The phase-to-phase voltages used for undervoltage protection are selected with the
setting parameter Voltage select. If at least one phase-to-phase voltage of the
selected voltages falls below the set start voltage, the module delivers the START
signal. When the function block starts, the START signal and the STATUS_ output
signal of the specific phase-to-earth or phase-to-phase voltage are set to TRUE.
Should the undervoltage situation exceed the preset definite operate time or, at the
inverse-time operation of UV3Low, the time determined by the level of the measured
voltage, the function block operates. At the inverse-time operation, the voltage/time
curve C is available. The delay of the heavy-duty output relay is included in the total
operate time. When the function block operates, the TRIP signal is set to TRUE.
The DT or IDMT timer is allowed to run only if the external blocking signal BS1 and
the internal undervoltage blocking are inactive. When the blocking signal or the
undervoltage blocking becomes active (TRUE), the timer will be stopped (frozen).
When the external blocking signal BS2 or the internal undervoltage blocking is active,
the TRIP signal cannot be activated. The TRIP signal can be blocked externally by
activating the BS2 signal until the function block drops off.
6
ABB Automation UV3Low RE_5_ _
UV3High
The Oper. hysteresis control parameter can be set to adjust the level of a
comparator. The operation hysteresis affects the reset ratio. If the hysteresis is set to
3%, for example, the reset ratio of an overvoltage function block (OV3_) will be 0.97.
On the other hand, the same setting for an undervoltage function block (UV3_) will
lead to the reset ratio of 1.03. Furthermore, an absolute operation hysteresis of 0.005
per unit is included. The absolute hysteresis affects the reset ratio when a low start
voltage setting is used. For example, if the start voltage setting is 0.2 x Un and the
operation hysteresis is set to 2%, the reset ratio would normally be 0.996 (OV_) or
1.004 (UV_). Due to the absolute hysteresis, however, the reset ratio will be 0.995
(OV_) or 1.005 (UV_).
Figure 3 below clarifies the effect of the Oper. hysteresis parameter. The start
voltage of overvoltage protection is set to 1.1 x Un and that of undervoltage
protection to 0.9 x Un. Both protection functions have the same setting of 4% for the
Oper. hysteresis parameter.
U/Un
hysteresis zones
1
1.1
4%
2
4
0.9 4%
3
7
RE_5_ _ UV3Low ABB Automation
UV3High
At the inverse-time characteristic, the operate time will be the shorter, the more the
voltage deviates from the set start voltage. The relationship between time and voltage
can be expressed as follows:
ka
t= +c
U < -U p
(b U < - 0.5)
where
The parameter Operation mode is used for selecting the definite-time or inverse-
time operation for UV3Low.
8
ABB Automation UV3Low RE_5_ _
UV3High
Two different groups of setting values, group 1 and group 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The output signal START is always pulse-shaped. The minimum pulse width of the
corresponding output signal is set via a separate parameter on the MMI or on serial
communication. If the start situation is longer than the set pulse width, the START
signal remains active until the start situation is over. The output signal TRIP may be
non-latching or latching. When the latching mode has been selected, the TRIP signal
remains active until the output is reset even if the operation criteria have reset.
9
RE_5_ _ UV3Low ABB Automation
UV3High
2.8 Resetting
The TRIP output signal and the registers can be reset either with the RESET input or
over the serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
10
ABB Automation UV3Low RE_5_ _
UV3High
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for UV3Low is 64 and that for UV3High 65.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
11
RE_5_ _ UV3Low ABB Automation
UV3High
UV3Low
UV3High
UV3Low
Time multiplier S44 0.1...1.0 - 0.1 R/W Time multiplier at IDMT mode
1)
Operation mode 0 = Not in use; 1 = Definite time; 2 = C curve
12
ABB Automation UV3Low RE_5_ _
UV3High
UV3High
UV3Low
Time multiplier S74 0.1...1.0 - 0.1 R/W Time multiplier at IDMT mode
1)
Operation mode 0 = Not in use; 1 = Definite time; 2 = C curve
UV3High
13
RE_5_ _ UV3Low ABB Automation
UV3High
14
ABB Automation UV3Low RE_5_ _
UV3High
The information required for later fault analysis is recorded when the function block
starts or trips, or when the recording function is triggered via the external TRIGG
input.
The data of three last operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
15
RE_5_ _ UV3Low ABB Automation
UV3High
The time stamp indicates the rising edge of the START, TRIP or TRIGG signal.
3.3.3.2 Duration
3.3.3.3 Voltages
If the function block trips, the voltage values are updated at the moment of tripping,
i.e. on the rising edge of the TRIP signal. At external triggering, the voltage values are
updated at the moment of triggering, i.e. on the rising edge of the input signal TRIGG.
If the function block starts but does not trip, the voltage values captured one
fundamental cycle (20 ms at rated frequency 50 Hz) after the beginning of the start
situation will be recorded. So, the values of the phase-to-phase voltages U12, U23 and
U31 are always recorded at the same moment, as multiples of the rated voltage Un.
The status data of the input signals BS1 and BS2 as well as the Active group
parameter are recorded at the moment of triggering. The Active group parameter
indicates the setting group valid for the recorded data.
3.3.3.5 Priority
1 Tripping
2 Starting
3 External triggering,
which means that if the function block has started, it will neglect an external
triggering request.
16
ABB Automation UV3Low RE_5_ _
UV3High
Voltage UL1_U12 V204 0.00...2.00 x Un 0.00 R/M Filtered value of U12 or UL1
Voltage UL2_U23 V205 0.00...2.00 x Un 0.00 R/M Filtered value of U23 or UL2
Voltage UL3_U31 V206 0.00...2.00 x Un 0.00 R/M Filtered value of U31 or UL3
1)
BS1 V207 0 or 1 - 0 R/M Status of BS1 input
Voltage UL1_U12 V304 0.00...2.00 x Un 0.00 R/M Filtered value of U12 or UL1
Voltage UL2_U23 V305 0.00...2.00 x Un 0.00 R/M Filtered value of U23 or UL2
Voltage UL3_U31 V306 0.00...2.00 x Un 0.00 R/M Filtered value of U31 or UL3
1)
BS1 V307 0 or 1 - 0 R/M Status of BS1 input
17
RE_5_ _ UV3Low ABB Automation
UV3High
Voltage UL1_U12 V404 0.00...2.00 x Un 0.00 R/M Filtered value of U12 or UL1
Voltage UL2_U23 V405 0.00...2.00 x Un 0.00 R/M Filtered value of U23 or UL2
Voltage UL3_U31 V406 0.00...2.00 x Un 0.00 R/M Filtered value of U31 or UL3
1)
BS1 V407 0 or 1 - 0 R/M Status of BS1 input
3.3.4 Events
18
ABB Automation UV3Low RE_5_ _
UV3High
Reset time 40...1000 ms (depends on the minimum pulse width set for the TRIP
output)
19
RE_5_ _ UV3Low ABB Automation
UV3High
20
1MRS752333-MUM UV3 _
Issued 10/1997
Version: F/28.1.2002
Three-Phase Undervoltage Protection
Low-Set Stage (UV3Low)
Data subject to change without notice High-Set Stage (UV3High)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 4
1.4 Output description ............................................................................... 4
2. Description of Operation.......................................................................... 5
2.1 Configuration....................................................................................... 5
2.2 Measuring mode ................................................................................. 5
2.3 Operation criteria................................................................................. 6
2.3.1 Operation hysteresis and reset ratio........................................... 7
2.4 IDMT type operation of UV3Low ......................................................... 8
2.5 Setting groups ..................................................................................... 9
2.6 Test mode ........................................................................................... 9
2.7 START and TRIP outputs.................................................................... 9
2.8 Resetting........................................................................................... 10
3. Parameters and Events .......................................................................... 11
3.1 General ............................................................................................. 11
3.2 Setting values.................................................................................... 12
3.2.1 Actual settings.......................................................................... 12
3.2.2 Setting group 1......................................................................... 12
3.2.3 Setting group 2......................................................................... 13
3.2.4 Control settings ........................................................................ 14
3.3 Measurement values ......................................................................... 15
3.3.1 Input data ................................................................................. 15
3.3.2 Output data .............................................................................. 15
3.3.3 Recorded data.......................................................................... 15
3.3.4 Events ...................................................................................... 18
4. Technical Data ........................................................................................ 19
UV3 _ Substation Automation
1. Introduction
1.1 Features
1.2 Application
This document specifies the functions of the three-phase undervoltage function blocks
UV3Low and UV3High used in products based on the RED 500 Platform. The
inverse-time operation is only included in the UV3Low function block.
3U< 3U<<
2
Substation Automation UV3 _
)LJXUH )XQFWLRQEORFNV\PEROVRI89/RZDQG89+LJK
3
UV3 _ Substation Automation
4
Substation Automation UV3 _
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The phase-to-phase voltages U12, U23 and
U31 are connected to the corresponding UL1_U12, UL2_U23 and UL3_U31 inputs of
the function block. Digital inputs are connected to the boolean inputs of the function
block and in the same way, the outputs of the function block are connected to the
output signals.
1RWH If phase voltages are measured, the phase voltage UL1 is connected to the
input UL1_U12, the phase voltage UL2 to the input UL2_U23 and the phase voltage
UL3 to the input UL3_U31. The control parameter Measuring mode has to be in
position Mode 3. Phase-to-phase voltages are derived from phase voltages within the
function block as follows:
1RWH When phase-to-phase voltages are derived numerically in the relay, only the
fundamental frequency measurement can be used: peak-to-peak measurement is not
available (see section Measuring mode).
When phase-to-phase voltages are measured, the function block operates on two
alternative measuring principles: the average value of consecutive instantaneous peak-
to-peak values of voltages or the numerically calculated fundamental frequency
voltage. The measuring mode is selected with either an MMI parameter or a serial
communication parameter as follows:
5
UV3 _ Substation Automation
With both the measuring principles, the operation is insensitive to the DC component
and the operation accuracy is defined in the frequency range f/fn=0.95...1.05. In peak-
to-peak measurement, the harmonics of the voltages are not suppressed, whereas in
fundamental frequency measurement the harmonics suppression is about
-50 dB at f = n x fn, where n = 2, 3, 4, 5,...
The phase-to-phase voltages used for undervoltage protection are selected with the
setting parameter Voltage select. If at least one phase-to-phase voltage of the
selected voltages falls below the set start voltage, the module delivers the START
signal. When the function block starts, the START signal and the STATUS_ output
signal of the specific phase-to-earth or phase-to-phase voltage are set to TRUE.
Should the undervoltage situation exceed the preset definite operate time or, at the
inverse-time operation of UV3Low, the time determined by the level of the measured
voltage, the function block operates. At the inverse-time operation, the voltage/time
curve C is available. The delay of the heavy-duty output relay is included in the total
operate time. When the function block operates, the TRIP signal is set to TRUE.
The DT or IDMT timer is allowed to run only if the external blocking signal BS1 and
the internal undervoltage blocking are inactive. When the blocking signal or the
undervoltage blocking becomes active (TRUE), the timer will be stopped (frozen).
When the external blocking signal BS2 or the internal undervoltage blocking is active,
the TRIP signal cannot be activated. The TRIP signal can be blocked externally by
activating the BS2 signal until the function block drops off.
6
Substation Automation UV3 _
The Oper. hysteresis control parameter can be set to adjust the level of a
comparator. The operation hysteresis affects the reset ratio. If the hysteresis is set to
3%, for example, the reset ratio of an overvoltage function block (OV3_) will be 0.97.
On the other hand, the same setting for an undervoltage function block (UV3_) will
lead to the reset ratio of 1.03. Furthermore, an absolute operation hysteresis of 0.005
per unit is included. The absolute hysteresis affects the reset ratio when a low start
voltage setting is used. For example, if the start voltage setting is 0.2 x Un and the
operation hysteresis is set to 2%, the reset ratio would normally be 0.996 (OV_) or
1.004 (UV_). Due to the absolute hysteresis, however, the reset ratio will be 0.995
(OV_) or 1.005 (UV_).
Figure 3 below clarifies the effect of the Oper. hysteresis parameter. The start
voltage of overvoltage protection is set to 1.1 x Un and that of undervoltage
protection to 0.9 x Un. Both protection functions have the same setting of 4% for the
Oper. hysteresis parameter.
U/Un
hysteresis zones
1
1.1
4%
2
4
0.9 4%
3
7
UV3 _ Substation Automation
At the inverse-time characteristic, the operate time will be the shorter, the more the
voltage deviates from the set start voltage. The relationship between time and voltage
can be expressed as follows:
ka
t= +c
U < -U p
(b U < - 0.5)
where
The parameter Operation mode is used for selecting the definite-time or inverse-
time operation for UV3Low.
8
Substation Automation UV3 _
Two different groups of setting values, group 1 and group 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The output signal START is always pulse-shaped. The minimum pulse width of the
corresponding output signal is set via a separate parameter on the MMI or on serial
communication. If the start situation is longer than the set pulse width, the START
signal remains active until the start situation is over. The output signal TRIP may be
non-latching or latching. When the latching mode has been selected, the TRIP signal
remains active until the output is reset even if the operation criteria have reset.
9
UV3 _ Substation Automation
2.8 Resetting
The TRIP output signal and the registers can be reset either with the RESET input or
over the serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
10
Substation Automation UV3 _
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for UV3Low is 64 and that for UV3High 65.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
11
UV3 _ Substation Automation
UV3Low
UV3High
UV3Low
Time multiplier S44 0.1...1.0 - 0.1 R/W Time multiplier at IDMT mode
1)
Operation mode 0 = Not in use; 1 = Definite time; 2 = C curve
12
Substation Automation UV3 _
UV3High
UV3Low
Time multiplier S74 0.1...1.0 - 0.1 R/W Time multiplier at IDMT mode
1)
Operation mode 0 = Not in use; 1 = Definite time; 2 = C curve
UV3High
13
UV3 _ Substation Automation
14
Substation Automation UV3 _
The information required for later fault analysis is recorded when the function block
starts or trips, or when the recording function is triggered via the external TRIGG
input.
The data of three last operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
15
UV3 _ Substation Automation
The time stamp indicates the rising edge of the START, TRIP or TRIGG signal.
3.3.3.2 Duration
3.3.3.3 Voltages
If the function block trips, the voltage values are updated at the moment of tripping,
i.e. on the rising edge of the TRIP signal. At external triggering, the voltage values are
updated at the moment of triggering, i.e. on the rising edge of the input signal TRIGG.
If the function block starts but does not trip, the voltage values captured one
fundamental cycle (20 ms at rated frequency 50 Hz) after the beginning of the start
situation will be recorded. So, the values of the phase-to-phase voltages U12, U23 and
U31 are always recorded at the same moment, as multiples of the rated voltage Un.
The status data of the input signals BS1 and BS2 as well as the Active group
parameter are recorded at the moment of triggering. The Active group parameter
indicates the setting group valid for the recorded data.
3.3.3.5 Priority
1 Tripping
2 Starting
3 External triggering,
which means that if the function block has started, it will neglect an external
triggering request.
16
Substation Automation UV3 _
Voltage UL1_U12 V204 0.00...2.00 x Un 0.00 R/M Filtered value of U12 or UL1
Voltage UL2_U23 V205 0.00...2.00 x Un 0.00 R/M Filtered value of U23 or UL2
Voltage UL3_U31 V206 0.00...2.00 x Un 0.00 R/M Filtered value of U31 or UL3
1)
BS1 V207 0 or 1 - 0 R/M Status of BS1 input
Voltage UL1_U12 V304 0.00...2.00 x Un 0.00 R/M Filtered value of U12 or UL1
Voltage UL2_U23 V305 0.00...2.00 x Un 0.00 R/M Filtered value of U23 or UL2
Voltage UL3_U31 V306 0.00...2.00 x Un 0.00 R/M Filtered value of U31 or UL3
1)
BS1 V307 0 or 1 - 0 R/M Status of BS1 input
17
UV3 _ Substation Automation
Voltage UL1_U12 V404 0.00...2.00 x Un 0.00 R/M Filtered value of U12 or UL1
Voltage UL2_U23 V405 0.00...2.00 x Un 0.00 R/M Filtered value of U23 or UL2
Voltage UL3_U31 V406 0.00...2.00 x Un 0.00 R/M Filtered value of U31 or UL3
1)
BS1 V407 0 or 1 - 0 R/M Status of BS1 input
3.3.4 Events
18
Substation Automation UV3 _
Reset time 40...1000 ms (depends on the minimum pulse width set for the TRIP
output)
19
UV3 _ Substation Automation
D -
20
1MRS100091 (VOC6Low) RE_5_ _
1MRS100107 (VOC6High) Voltage-Dependent
Issued: 10/1998
Version: C Overcurrent Protection
Data subject to change without notice Low-Set Stage (VOC6Low)
High-Set Stage (VOC6High)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 4
1.4 Output description ............................................................................... 4
2. Description of Operation.......................................................................... 5
2.1 Configuration....................................................................................... 5
2.2 Measuring mode ................................................................................. 6
2.3 Operation criteria................................................................................. 6
2.3.1 Voltage step ............................................................................... 6
2.3.2 Voltage slope ............................................................................. 7
2.3.3 Input step ................................................................................... 8
2.4 Delayed reset facility and drop-off time in DT mode ............................ 8
2.5 IDMT type operation............................................................................ 9
2.5.1 Standard curve groups ............................................................. 10
2.5.2 RI and RD curve groups........................................................... 11
2.6 Setting groups ................................................................................... 12
2.7 Test mode ......................................................................................... 12
2.8 START, TRIP and CBFP outputs ...................................................... 12
2.9 Resetting........................................................................................... 13
3. Parameters and Events .......................................................................... 14
3.1 General ............................................................................................. 14
3.2 Setting values.................................................................................... 15
3.2.1 Actual settings.......................................................................... 15
3.2.2 Setting group 1......................................................................... 16
3.2.3 Setting group 2......................................................................... 16
3.2.4 Control settings ........................................................................ 17
3.3 Measurement values ......................................................................... 18
3.3.1 Input data ................................................................................. 18
3.3.2 Output data .............................................................................. 18
3.3.3 Recorded data.......................................................................... 19
3.3.4 Events ...................................................................................... 22
4. Technical Data ........................................................................................ 23
RE_5_ _ VOC6Low ABB Automation
VOC6High
1. Introduction
1.1 Features
1.2 Application
The function blocks VOC6Low and VOC6High are designed for short-circuit
protection whenever the DT (Definite Time) or the IDMT (Inverse Definite Minimum
Time) characteristic is appropriate.
I (U) >
I (U) >>
2
ABB Automation VOC6Low RE_5_ _
VOC6High
)LJXUH )XQFWLRQEORFNV\PEROVRI92&/RZDQG92&+LJK
3
RE_5_ _ VOC6Low ABB Automation
VOC6High
4
ABB Automation VOC6Low RE_5_ _
VOC6High
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The phase currents IL1, IL2 and IL3 are
connected to the corresponding IL1, IL2 and IL3 inputs and the phase-to-phase
voltages U12, U23 and U31 (or phase-to-earth voltages U1, U2 and U3) to the
corresponding U1, U2 and U3 inputs of the function block. Furthermore, digital
inputs are connected to the boolean inputs of the function block and in the same way,
the outputs of the function block are connected to the output signals.
Note ! If phase-to-earth voltages are used, the control parameter Voltage selection
(F091V002 for VOC6Low and F107V002 for VOC6High) has to be in position
Phase-to-earth. The phase-to-phase voltages are derived from phase-to-earth
voltages within the function block as follows:
U12 = U1 - U2
U23 = U2 - U3
U31 = U3 - U1
The default value of the parameter Voltage selection is Phase-to-phase, i.e. the
relay measures phase-to-phase voltages.
It is also possible to use one (or two) phase-to-phase voltage(s) and three currents in
case there are no more voltages available. In this case, the function block is to be
configured so that a voltage signal is connected to each voltage input of the function
block in the configuration tool. If two phase-to-phase voltages are used, one is
connected to the corresponding voltage input of the function block (e.g. voltage U12
to the input U12) and the other to the two remaining voltage inputs of the function
block (e.g. voltage U23 to the inputs U23 and U31). Note that at least one phase-to-
phase voltage is required (any of U12, U23 and U31) and the control parameter
Voltage selection is to be set to Phase-to-phase. It is recommended, however, that
three voltages and three currents are used whenever possible.
5
RE_5_ _ VOC6Low ABB Automation
VOC6High
The function block operates on two alternative measuring principles: the average
value of consecutive instantaneous peak-to-peak values or the numerically calculated
fundamental frequency component of the short-circuit current.
The operating characteristic of start current is selected via the setting parameter
Control mode. The start current can be selected to be voltage-dependent in the three
different ways described below: Voltage step, Voltage slope and Input step.
The voltage dependency is phase sensitive, which means that one voltage controls
only the corresponding phase (e.g. voltage U12 controls the current setting in phase
L1 etc.). However, if only one voltage is connected, it controls all the phases (e.g. the
current setting for each phase is dependent on voltage U12) and if two voltages are
used, the one connected to two inputs of the function block also controls the
corresponding two phases.
The voltage dependency affects both the definite-time (DT) mode and the inverse
definite minimum time (IDMT) mode. In DT mode the voltage has an effect on the
current setting rather than on the operate time. In IDMT mode the voltage drop also
quickens the operate time if the fault current remains at the same level during a fault.
This can be considered as if an inverse-time curve was dropped according to the
current setting (which is dependent on voltage).
When the function block starts, the START signal is set to TRUE. Should the
overcurrent situation exceed the set definite operate time or, at the inverse-time
operation, the time determined by the level of the measured current, the function
block operates. The delay of the heavy-duty output relay is included in the total
operate time. When the function block operates, the TRIP signal is set to TRUE.
The DT or IDMT timer is allowed to run only if the blocking signal BLOCK is
inactive, i.e. its value is FALSE. When the blocking signal becomes active, i.e. its
value turns to TRUE, the timer will be stopped (frozen).
If the measured voltage drops below the value set for the Voltage limit parameter,
the start current is dropped by multiplying it by the value set for the Current
6
ABB Automation VOC6Low RE_5_ _
VOC6High
multiplier parameter (K). If the voltage rises above the voltage limit, the set start
current value is valid. The procedure is shown in Figure 3.
)LJXUH )XQFWLRQDOLW\RI92&/RZDQG92&+LJKLQWKHFRQWUROPRGH9ROWDJH
VWHS
The following equations determine how the start current is influenced by the voltage
in Voltage step mode:
If the measured voltage is below the value Voltage limit 2, the start current is
dropped by multiplying it by the current multiplier (K). If the voltage is above the
value Voltage limit 2 but below the value Voltage limit 1, the start current is
calculated from the slope from point(Voltage limit 2, KI>) to point(Voltage limit 1,
I>). If the measured voltage rises above the value Voltage limit 1, the set start
current value is valid. The procedure is shown in Figure 4.
)LJXUH )XQFWLRQDOLW\RI92&/RZDQG92&+LJKLQWKHFRQWUROPRGH9ROWDJH
VORSH
7
RE_5_ _ VOC6Low ABB Automation
VOC6High
The following equations determine how the start current is influenced by the voltage
in Voltage slope mode:
The start current value is dropped by multiplying it by the current multiplier (K) when
the CONTROL input is activated.
The following equations determine how the start current is influenced by the
CONTROL input in Input step mode:
The purpose of the delayed reset function is to enable fast clearance of intermittent
faults, e.g. self-sealing insulation faults, and severe faults which may produce high
asymmetrical fault currents that partially saturate the current transformers. It is typical
for an intermittent fault that the fault current contains so-called drop-off periods
during which the fault current is below the set start current. Without the delayed reset
function the DT timer would reset once the current drops off. In the same way, an
apparent drop-off period of the secondary current of the saturated current transformer
might reset the DT timer. The adjustable delayed reset function also enables closer
co-ordination with electromechanical induction disc relays.
When the DT timer has started, it goes on running normally even if the current drops
off, provided the drop-off period is shorter than the set drop-off time. If the drop-off
period is longer than the set drop-off time, the DT timer will reset when the drop-off
time elapses (Figure 5).
8
ABB Automation VOC6Low RE_5_ _
VOC6High
In Figures 5 and 6 the input signal IN of the DT timer is TRUE when the current is
above the set start value and FALSE when the current is below the set start value.
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff1.fh7
Operate time
Operate
timer
)LJXUH 7KHGURSRIISHULRGLVORQJHUWKDQWKHVHWGURSRIIWLPH
If the drop-off period is shorter than the set drop-off time and the DT timer time has
elapsed during the drop-off period, the function block will trip once the current
exceeds the set value again (Figure 6).
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff2.fh7
Operate time
Operate
timer
)LJXUH 7KHGURSRIISHULRGLVVKRUWHUWKDQWKHVHWGURSRIIWLPH
At the inverse-time mode the operate time of the function block is a function of the
current; the higher the current, the shorter is the operate time. Six time/current curve
groups are available. Four of the groups comply with the BS 142 and IEC 60255
standards, whereas the two curve groups RI and RD (RXIDG) are special type of
curve groups corresponding to the ABB praxis. The setting Operation mode is used
for selecting the desired operate time characteristic. (For a graphical presentation of
the curves, refer to the manual Technical Descriptions of Functions, Introduction.)
9
RE_5_ _ VOC6Low ABB Automation
VOC6High
kx
t[s] =
I
( ) 1
I>
where
Inverse-time
characteristic
Normal inverse 0.02 0.14
Very inverse 1.0 13.5
Extremely inverse 2.0 80.0
Long-time inverse 1.0 120
According to the standard BS 142: 1966 the effective current range is defined as
2...20 times the set start current. If the time/current characteristic is normal inverse,
very inverse or extremely inverse, the function block has to start at the latest when the
current exceeds the set start current by 1.3 times. For the long-time inverse
characteristic, the effective current range is specified to be 2...7 times the set start
current and the relay is to start at the latest when the current exceeds the setting value
by 1.1 times. The voltage-dependent overcurrent function block will start and the
IDMT integration will begin once the current exceeds the set start value.
10
ABB Automation VOC6Low RE_5_ _
VOC6High
The operate time tolerances specified by the standard BS 142 : 1966 are the following
(E denotes the accuracy in per cent):
The tolerance factors have to be smaller than those defined by the standard BS 142:
1966 for currents 2 and 5 times the setting. The function block complies with the
tolerances of class 5 (E = 5.0%) for all inverse-time curves.
k
t s =
I>
0. 339 0. 236 x
I
The RD-type characteristic is a special characteristic mainly used in earth-fault
protection where a high degree of selectivity is required also at high-resistance faults.
Mathematically, the characteristic can be expressed as follows:
I
t[s] = 5. 8 -1. 35 x ln
k x I>
The accuracy of the RI- and RD-type characteristics is 5%. Also with the RI- and RD-
type characteristics, the function block will start and the IDMT integration will begin
once the current exceeds the set start current.
11
RE_5_ _ VOC6Low ABB Automation
VOC6High
Two different groups of setting values, group 1 and group 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The output signal START is always pulse-shaped. The minimum pulse width of the
corresponding output signal is set with a separate parameter on the MMI or on serial
communication. If the start situation is longer than the set pulse width, the START
signal remains active until the start situation is over. The output signal TRIP may
have a non-latching or latching feature. When the latching mode has been selected,
the TRIP signal remains active until the output is reset even if the operation criteria
have reset.
The function block provides a delayed trip signal CBFP after the TRIP signal unless
the fault has disappeared during the set CBFP time delay. In circuit-breaker failure
protection the CBFP output can be used to operate a circuit breaker in front of the
circuit breaker of the machine. The control parameter Trip pulse also sets the width
of the CBFP output signal.
12
ABB Automation VOC6Low RE_5_ _
VOC6High
2.9 Resetting
The TRIP output signal and the registers can be reset via the RESET input, or over the
serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
13
RE_5_ _ VOC6Low ABB Automation
VOC6High
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for VOC6Low is 91 and that for VOC6High
107.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
14
ABB Automation VOC6Low RE_5_ _
VOC6High
15
RE_5_ _ VOC6Low ABB Automation
VOC6High
Time multiplier S44 0.05...1.00 - 0.05 R/W Time multiplier at IDMT mode
2)
Control mode S45 0...2 - 0 R/W Selection of mode for voltage
control
Voltage limit S46 0.10...1.00 x Un 0.10 R/W Voltage setting value for voltage
step mode
Voltage limit 1 S47 0.60...1.00 x Un 0.60 R/W Upper voltage setting value for
voltage slope mode
Voltage limit 2 S48 0.10...0.59 x Un 0.10 R/W Lower voltage setting value for
voltage slope mode
Curr.multiplier S49 0.05...1.00 - 0.05 R/W Multiplier for lower start current
value
1)
Operation mode 0 = Not in use; 1 = Definite time; 2 = Extremely inv.; 3 = Very inverse;
4 = Normal inverse; 5 = Long-time inv.; 6 = RI-type inv.; 7 = RD-type inv.
2)
Control mode 0 = Voltage step; 1 = Voltage slope; 2 = Input step
Time multiplier S74 0.05...1.00 - 0.05 R/W Time multiplier at IDMT mode
Voltage limit S76 0.10...1.00 x Un 0.10 R/W Voltage setting value for voltage
step mode
Voltage limit 1 S77 0.60...1.00 x Un 0.60 R/W Upper voltage setting value for
voltage slope mode
Voltage limit 2 S78 0.10...0.59 x Un 0.10 R/W Lower voltage setting value for
voltage slope mode
Curr.multiplier S79 0.05...1.00 - 0.05 R/W Multiplier for lower start current
value
1)
Operation mode 0 = Not in use; 1 = Definite time; 2 = Extremely inv.; 3 = Very inverse;
4 = Normal inverse; 5 = Long-time inv.; 6 = RI-type inv.; 7 = RD-type inv.
2)
Control mode 0 = Voltage step; 1 = Voltage slope; 2 = Input step
16
ABB Automation VOC6Low RE_5_ _
VOC6High
Drop-off time V3 0.00...10.00 s 0.00 R/W Resetting time of the operate time
counter at DT and IDMT modes
CBFP time V10 100...1000 ms 100 R/W Operate time of the delayed trip
CBFP
17
RE_5_ _ VOC6Low ABB Automation
VOC6High
Current IL2 I2 0.00...60.00 x In 0.00 R/M Input for meas. phase current IL2
Current IL3 I3 0.00...60.00 x In 0.00 R/M Input for meas. phase current IL3
Voltage U12 I4 0.00...2.00 x Un 0.00 R/M Input for measuring voltage U12
Voltage U23 I5 0.00...2.00 x Un 0.00 R/M Input for measuring voltage U23
Voltage U31 I6 0.00...2.00 x Un 0.00 R/M Input for measuring voltage U31
1)
Input BLOCK I7 0 or 1 - 0 R/M Blocking signal
Input CONTROL I10 0 or 1 1) - 0 R/M Signal for lower current setting in the
control mode Input step
18
ABB Automation VOC6Low RE_5_ _
VOC6High
3.3.3.1 General
The information required for later fault analysis is recorded when the function block
starts or trips.
The data of three last operations (operation 1...3) are recorded and the values of the
most recent operation always replace the data of the oldest operation. The registers
are updated in the following order: Operation 1, Operation 2, Operation 3, Operation
1, Operation 2,...
The time stamp indicates the rising edge of the START or TRIP signal.
3.3.3.3 Duration
3.3.3.4 Currents
If the function block trips, the current values are updated at the moment of tripping
i.e. on the rising edge of the TRIP signal. If the function block starts but does not trip,
the current values captured one fundamental cycle (20 ms at rated frequency 50 Hz)
after the beginning of the start situation are recorded. So the values of the phase
currents IL1, I L2 and I L3 always originate from the same moment and are recorded as
multiples of the rated current IN. Both the peak and the mean values of the current are
recorded for each phase.
3.3.3.5 Voltages
The voltage values are recorded using the same principle as for the currents. If only
one or two phase-to-phase voltages are used, the same voltage value is recorded more
than once. For example, if the voltage U12 is used to control all three phases, it is
recorded in the value fields for U12, U23 and U31.
19
RE_5_ _ VOC6Low ABB Automation
VOC6High
The status data of the input signals BLOCK and DOUBLE (Active or Not active) and
the Active group parameter are recorded at the moment of triggering. The Active
group parameter indicates the setting group valid for the recorded data.
3.3.3.7 Priority
1 Tripping
2 Starting
20
ABB Automation VOC6Low RE_5_ _
VOC6High
21
RE_5_ _ VOC6Low ABB Automation
VOC6High
3.3.4 Events
22
ABB Automation VOC6Low RE_5_ _
VOC6High
f/fn = 0.95...1.05:
Reset time 80...1040 ms (depends on the minimum pulse width set for the
TRIP output)
23
1MRS752334-MUM VOC6_
Voltage-Dependent
Overcurrent Protection
Issued: 10/1998
Version: D/28.1.2002 Low-Set Stage (VOC6Low)
Data subject to change without notice High-Set Stage (VOC6High)
Contents
1. Introduction .............................................................................................. 2
1.1 Features.............................................................................................. 2
1.2 Application........................................................................................... 2
1.3 Input description.................................................................................. 4
1.4 Output description ............................................................................... 4
2. Description of Operation.......................................................................... 5
2.1 Configuration....................................................................................... 5
2.2 Measuring mode ................................................................................. 6
2.3 Operation criteria................................................................................. 6
2.3.1 Voltage step ............................................................................... 6
2.3.2 Voltage slope ............................................................................. 7
2.3.3 Input step ................................................................................... 8
2.4 Delayed reset facility and drop-off time in DT mode ............................ 8
2.5 IDMT type operation............................................................................ 9
2.5.1 Standard curve groups ............................................................. 10
2.5.2 RI and RD curve groups........................................................... 11
2.6 Setting groups ................................................................................... 12
2.7 Test mode ......................................................................................... 12
2.8 START, TRIP and CBFP outputs ...................................................... 12
2.9 Resetting........................................................................................... 13
3. Parameters and Events .......................................................................... 14
3.1 General ............................................................................................. 14
3.2 Setting values.................................................................................... 15
3.2.1 Actual settings.......................................................................... 15
3.2.2 Setting group 1......................................................................... 16
3.2.3 Setting group 2......................................................................... 16
3.2.4 Control settings ........................................................................ 17
3.3 Measurement values ......................................................................... 18
3.3.1 Input data ................................................................................. 18
3.3.2 Output data .............................................................................. 18
3.3.3 Recorded data.......................................................................... 19
3.3.4 Events ...................................................................................... 22
4. Technical Data ........................................................................................ 23
VOC6_ Substation Automation
1. Introduction
1.1 Features
1.2 Application
The function blocks VOC6Low and VOC6High are designed for short-circuit
protection whenever the DT (Definite Time) or the IDMT (Inverse Definite Minimum
Time) characteristic is appropriate.
I (U) >
I (U) >>
2
Substation Automation VOC6_
)LJXUH )XQFWLRQEORFNV\PEROVRI92&/RZDQG92&+LJK
3
VOC6_ Substation Automation
4
Substation Automation VOC6_
2.1 Configuration
When the analogue channels and digital inputs have been selected and configured in
the dialogue box, the inputs and outputs of the function block can be configured on a
graphic worksheet of the configuration tool. The phase currents IL1, IL2 and IL3 are
connected to the corresponding IL1, IL2 and IL3 inputs and the phase-to-phase
voltages U12, U23 and U31 (or phase-to-earth voltages U1, U2 and U3) to the
corresponding U1, U2 and U3 inputs of the function block. Furthermore, digital
inputs are connected to the boolean inputs of the function block and in the same way,
the outputs of the function block are connected to the output signals.
Note ! If phase-to-earth voltages are used, the control parameter Voltage selection
(F091V002 for VOC6Low and F107V002 for VOC6High) has to be in position
Phase-to-earth. The phase-to-phase voltages are derived from phase-to-earth
voltages within the function block as follows:
U12 = U1 - U2
U23 = U2 - U3
U31 = U3 - U1
The default value of the parameter Voltage selection is Phase-to-phase, i.e. the
relay measures phase-to-phase voltages.
It is also possible to use one (or two) phase-to-phase voltage(s) and three currents in
case there are no more voltages available. In this case, the function block is to be
configured so that a voltage signal is connected to each voltage input of the function
block in the configuration tool. If two phase-to-phase voltages are used, one is
connected to the corresponding voltage input of the function block (e.g. voltage U12
to the input U12) and the other to the two remaining voltage inputs of the function
block (e.g. voltage U23 to the inputs U23 and U31). Note that at least one phase-to-
phase voltage is required (any of U12, U23 and U31) and the control parameter
Voltage selection is to be set to Phase-to-phase. It is recommended, however, that
three voltages and three currents are used whenever possible.
5
VOC6_ Substation Automation
The function block operates on two alternative measuring principles: the average
value of consecutive instantaneous peak-to-peak values or the numerically calculated
fundamental frequency component of the short-circuit current.
The operating characteristic of start current is selected via the setting parameter
Control mode. The start current can be selected to be voltage-dependent in the three
different ways described below: Voltage step, Voltage slope and Input step.
The voltage dependency is phase sensitive, which means that one voltage controls
only the corresponding phase (e.g. voltage U12 controls the current setting in phase
L1 etc.). However, if only one voltage is connected, it controls all the phases (e.g. the
current setting for each phase is dependent on voltage U12) and if two voltages are
used, the one connected to two inputs of the function block also controls the
corresponding two phases.
The voltage dependency affects both the definite-time (DT) mode and the inverse
definite minimum time (IDMT) mode. In DT mode the voltage has an effect on the
current setting rather than on the operate time. In IDMT mode the voltage drop also
quickens the operate time if the fault current remains at the same level during a fault.
This can be considered as if an inverse-time curve was dropped according to the
current setting (which is dependent on voltage).
When the function block starts, the START signal is set to TRUE. Should the
overcurrent situation exceed the set definite operate time or, at the inverse-time
operation, the time determined by the level of the measured current, the function
block operates. The delay of the heavy-duty output relay is included in the total
operate time. When the function block operates, the TRIP signal is set to TRUE.
The DT or IDMT timer is allowed to run only if the blocking signal BLOCK is
inactive, i.e. its value is FALSE. When the blocking signal becomes active, i.e. its
value turns to TRUE, the timer will be stopped (frozen).
If the measured voltage drops below the value set for the Voltage limit parameter,
the start current is dropped by multiplying it by the value set for the Current
6
Substation Automation VOC6_
multiplier parameter (K). If the voltage rises above the voltage limit, the set start
current value is valid. The procedure is shown in Figure 3.
)LJXUH )XQFWLRQDOLW\RI92&/RZDQG92&+LJKLQWKHFRQWUROPRGH9ROWDJH
VWHS
The following equations determine how the start current is influenced by the voltage
in Voltage step mode:
If the measured voltage is below the value Voltage limit 2, the start current is
dropped by multiplying it by the current multiplier (K). If the voltage is above the
value Voltage limit 2 but below the value Voltage limit 1, the start current is
calculated from the slope from point(Voltage limit 2, KI>) to point(Voltage limit 1,
I>). If the measured voltage rises above the value Voltage limit 1, the set start
current value is valid. The procedure is shown in Figure 4.
)LJXUH )XQFWLRQDOLW\RI92&/RZDQG92&+LJKLQWKHFRQWUROPRGH9ROWDJH
VORSH
7
VOC6_ Substation Automation
The following equations determine how the start current is influenced by the voltage
in Voltage slope mode:
The start current value is dropped by multiplying it by the current multiplier (K) when
the CONTROL input is activated.
The following equations determine how the start current is influenced by the
CONTROL input in Input step mode:
The purpose of the delayed reset function is to enable fast clearance of intermittent
faults, e.g. self-sealing insulation faults, and severe faults which may produce high
asymmetrical fault currents that partially saturate the current transformers. It is typical
for an intermittent fault that the fault current contains so-called drop-off periods
during which the fault current is below the set start current. Without the delayed reset
function the DT timer would reset once the current drops off. In the same way, an
apparent drop-off period of the secondary current of the saturated current transformer
might reset the DT timer. The adjustable delayed reset function also enables closer
co-ordination with electromechanical induction disc relays.
When the DT timer has started, it goes on running normally even if the current drops
off, provided the drop-off period is shorter than the set drop-off time. If the drop-off
period is longer than the set drop-off time, the DT timer will reset when the drop-off
time elapses (Figure 5).
8
Substation Automation VOC6_
In Figures 5 and 6 the input signal IN of the DT timer is TRUE when the current is
above the set start value and FALSE when the current is below the set start value.
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff1.fh7
Operate time
Operate
timer
)LJXUH 7KHGURSRIISHULRGLVORQJHUWKDQWKHVHWGURSRIIWLPH
If the drop-off period is shorter than the set drop-off time and the DT timer time has
elapsed during the drop-off period, the function block will trip once the current
exceeds the set value again (Figure 6).
1
IN
0
START
TRIP
Drop-off time
Drop-off
timer
Dropoff2.fh7
Operate time
Operate
timer
)LJXUH 7KHGURSRIISHULRGLVVKRUWHUWKDQWKHVHWGURSRIIWLPH
In the inverse-time mode the operate time of the function block is a function of the
current; the higher the current, the shorter is the operate time. Six time/current curve
groups are available. Four of the groups comply with the BS 142 and IEC 60255
standards, whereas the two curve groups RI and RD (RXIDG) are special type of
curve groups corresponding to the ABB praxis. The setting Operation mode is used
for selecting the desired operate time characteristic. (For a graphical presentation of
the curves, refer to the manual Technical Descriptions of Functions, Introduction.)
9
VOC6_ Substation Automation
kx
t[s] =
I
( ) 1
I>
where
Inverse-time
characteristic
Normal inverse 0.02 0.14
Very inverse 1.0 13.5
Extremely inverse 2.0 80.0
Long-time inverse 1.0 120
According to the standard BS 142: 1966 the effective current range is defined as
2...20 times the set start current. If the time/current characteristic is normal inverse,
very inverse or extremely inverse, the function block has to start at the latest when the
current exceeds the set start current by 1.3 times. For the long-time inverse
characteristic, the effective current range is specified to be 2...7 times the set start
current and the relay is to start at the latest when the current exceeds the setting value
by 1.1 times. The voltage-dependent overcurrent function block will start and the
IDMT integration will begin once the current exceeds the set start value.
10
Substation Automation VOC6_
The operate time tolerances specified by the standard BS 142 : 1966 are the following
(E denotes the accuracy in per cent):
The tolerance factors have to be smaller than those defined by the standard BS 142:
1966 for currents 2 and 5 times the setting. The function block complies with the
tolerances of class 5 (E = 5.0%) for all inverse-time curves.
k
t s =
I>
0. 339 0. 236 x
I
The RD-type characteristic is a special characteristic mainly used in earth-fault
protection where a high degree of selectivity is required also at high-resistance faults.
Mathematically, the characteristic can be expressed as follows:
I
t[s] = 5. 8 -1. 35 x ln
k x I>
The accuracy of the RI- and RD-type characteristics is 5%. Also with the RI- and RD-
type characteristics, the function block will start and the IDMT integration will begin
once the current exceeds the set start current.
11
VOC6_ Substation Automation
Two different groups of setting values, group 1 and group 2, are available for the
function block. Switching between the two groups can be done in the following three
ways:
The control parameter Active group indicates the setting group valid at a given
time.
The digital outputs of the function block can be activated with separate control
parameters for each output either locally via the MMI or externally via the serial
communication. When an output is activated with the test parameter, an event
indicating the test is generated.
The protection functions operate normally while the outputs are tested.
The output signal START is always pulse-shaped. The minimum pulse width of the
corresponding output signal is set with a separate parameter on the MMI or on serial
communication. If the start situation is longer than the set pulse width, the START
signal remains active until the start situation is over. The output signal TRIP may
have a non-latching or latching feature. When the latching mode has been selected,
the TRIP signal remains active until the output is reset even if the operation criteria
have reset.
The function block provides a delayed trip signal CBFP after the TRIP signal unless
the fault has disappeared during the set CBFP time delay. In circuit-breaker failure
protection the CBFP output can be used to operate a circuit breaker in front of the
circuit breaker of the machine. The control parameter Trip pulse also sets the width
of the CBFP output signal.
12
Substation Automation VOC6_
2.9 Resetting
The TRIP output signal and the registers can be reset via the RESET input, or over the
serial bus or the local MMI.
The operation indicators, latched trip signal and recorded data can be reset as follows:
13
VOC6_ Substation Automation
3.1 General
Each function block has a specific channel number for serial communication
parameters and events. The channel for VOC6Low is 91 and that for VOC6High
107.
The data direction of the parameters defines the use of each parameter as follows:
Data direction Description
R, R/M Read only
W Write only
R/W Read and write
The different event mask parameters (see section Control settings) affect the
visibility of events on the MMI or on serial communication (LON or SPA) as
follows:
Event mask 1 (FxxxV101/102) SPA / MMI (LON)
Event mask 2 (FxxxV103/104) LON
Event mask 3 (FxxxV105/106) LON
Event mask 4 (FxxxV107/108) LON
For example, if only the events E3, E4 and E5 are to be seen on the MMI of the
relay terminal, the event mask value 56 (8 + 16 + 32) is written to the Event mask
1 parameter (FxxxV101).
In case a function block includes more than 32 events, there are two parameters
instead of e.g. the Event mask 1 parameter: the parameter Event mask 1A
(FxxxV101) covers the events 0...31 and Event mask 1B(FxxxV102) the events
32...63.
14
Substation Automation VOC6_
15
VOC6_ Substation Automation
Time multiplier S44 0.05...1.00 - 0.05 R/W Time multiplier in IDMT mode
2)
Control mode S45 0...2 - 0 R/W Selection of mode for voltage
control
Voltage limit S46 0.10...1.00 x Un 0.10 R/W Voltage setting value for voltage
step mode
Voltage limit 1 S47 0.60...1.00 x Un 0.60 R/W Upper voltage setting value for
voltage slope mode
Voltage limit 2 S48 0.10...0.59 x Un 0.10 R/W Lower voltage setting value for
voltage slope mode
Curr.multiplier S49 0.05...1.00 - 0.05 R/W Multiplier for lower start current
value
1)
Operation mode 0 = Not in use; 1 = Definite time; 2 = Extremely inv.; 3 = Very inverse;
4 = Normal inverse; 5 = Long-time inv.; 6 = RI-type inv.; 7 = RD-type inv.
2)
Control mode 0 = Voltage step; 1 = Voltage slope; 2 = Input step
Time multiplier S74 0.05...1.00 - 0.05 R/W Time multiplier in IDMT mode
Voltage limit S76 0.10...1.00 x Un 0.10 R/W Voltage setting value for voltage
step mode
Voltage limit 1 S77 0.60...1.00 x Un 0.60 R/W Upper voltage setting value for
voltage slope mode
Voltage limit 2 S78 0.10...0.59 x Un 0.10 R/W Lower voltage setting value for
voltage slope mode
Curr.multiplier S79 0.05...1.00 - 0.05 R/W Multiplier for lower start current
value
1)
Operation mode 0 = Not in use; 1 = Definite time; 2 = Extremely inv.; 3 = Very inverse;
4 = Normal inverse; 5 = Long-time inv.; 6 = RI-type inv.; 7 = RD-type inv.
2)
Control mode 0 = Voltage step; 1 = Voltage slope; 2 = Input step
16
Substation Automation VOC6_