Sei sulla pagina 1di 144

FANTASY - FATA

SIRENA - STORY

I Installazione, uso e manutenzione pag. 2


UK Installation, use and maintenance pag. 25
F Installation, usage et maintenance pag. 48
E Instalacin, uso y mantenimiento pag. 71
D Installations-, Betriebs- und Wartungsanleitung pag. 94
NL Installatie, gebruik en onderhoud pag. 117

-1-
ITALIANO
Gentile Signora / Egregio Signore
La ringraziamo e ci complimentiamo con Lei per aver scelto il nostro prodotto.
3ULPDGLXWLOL]]DUOR/HFKLHGLDPRGLOHJJHUHDWWHQWDPHQWHTXHVWDVFKHGDDOQHGLSRWHUQHVIUXWWDUHDOPHJOLRHGLQWRWDOHVLFX-
rezza tutte le prestazioni.

3HUXOWHULRULFKLDULPHQWLRQHFHVVLWjFRQWDWWLLO5,9(1',725(SUHVVRFXLKDHIIHWWXDWRODFTXLVWRRYLVLWLLOQRVWURVLWRLQWHUQHW
www.edilkamin.com alla voce CENTRI ASSISTENZA TECNICA.

NOTA
'RSRDYHUGLVLPEDOODWRLOSURGRWWRVLDVVLFXULGHOOLQWHJULWjHGHOODFRPSOHWH]]DGHOFRQWHQXWR ULYHVWLPHQWRWHOHFRPDQGRFRQ
GLVSOD\PDQLJOLDPDQRIUHGGDSHUDSHUWXUDDQWLQDOLEUHWWRGLJDUDQ]LDJXDQWR&'VFKHGDWHFQLFDVSDWRODVDOLGHXPLGLFDQ-
ti, chiave a brugola).

,QFDVRGLDQRPDOLHVLULYROJDVXELWRDOULYHQGLWRUHSUHVVRFXLKDHIIHWWXDWRODFTXLVWRFXLYDFRQVHJQDWDFRSLDGHOOLEUHWWRGL
JDUDQ]LDHGHOGRFXPHQWRVFDOHGDFTXLVWR

- Messa in servizio/collaudo
'HYHVVHUHDVVROXWDPHQWHHVHJXLWDGDO&HQWUR$VVLVWHQ]D7HFQLFDDXWRUL]]DWR(GLONDPLQ &$7 SHQDODGHFDGHQ]DGHOODJDUDQ-
zia. La messa in servizio cos come descritta dalla norma UNI 10683/2012 consiste in una serie di operazioni di controllo esegui-
WHDVWXIDLQVWDOODWDHQDOL]]DWHDGDFFHUWDUHLOFRUUHWWRIXQ]LRQDPHQWRGHOVLVWHPDHODULVSRQGHQ]DGHOORVWHVVRDOOHQRUPDWLYH

Presso il rivenditore, sul sito www.edilkamin.com o al numero verde pu trovare il nominativo del Centro Assistenza pi vicino.

LQVWDOOD]LRQLVFRUUHWWHPDQXWHQ]LRQLQRQFRUUHWWDPHQWHHIIHWWXDWHXVRLPSURSULRGHOSURGRWWRVROOHYDQROD]LHQGDSURGXWWULFHGD
RJQLHYHQWXDOHGDQQRGHULYDQWHGDOOXVR
LOQXPHURGLWDJOLDQGRGLFRQWUROORQHFHVVDULRSHUOLGHQWLFD]LRQHGHOODVWXIDqLQGLFDWR
QHOODSDUWHDOWDGHOOLPEDOOR
VXOOLEUHWWRGLJDUDQ]LDUHSHULELOHDOOLQWHUQRGHOIRFRODUH
VXOODWDUJKHWWDDSSOLFDWDVXOUHWURGHOODSSDUHFFKLR

'HWWDGRFXPHQWD]LRQHGHYHVVHUHFRQVHUYDWDSHUOLGHQWLFD]LRQHXQLWDPHQWHDOGRFXPHQWRVFDOHGDFTXLVWRLFXLGDWLGRYUDQ-
QRHVVHUHFRPXQLFDWLLQRFFDVLRQHGLHYHQWXDOLULFKLHVWHGLLQIRUPD]LRQLHPHVVLDGLVSRVL]LRQHLQFDVRGLHYHQWXDOHLQWHUYHQWRGL
PDQXWHQ]LRQH

LSDUWLFRODULUDSSUHVHQWDWLVRQRJUDFDPHQWHHJHRPHWULFDPHQWHLQGLFDWLYL

',&+,$5$=,21(',&21)250,7$
La scrivente EDILKAMIN S.p.a. con sede legale in Via Vincenzo Monti 47 - 20123 Milano - Cod. Fiscale P.IVA 00192220192

'LFKLDUDVRWWRODSURSULDUHVSRQVDELOLWjFKH
/HVWXIHDSHOOHWVRWWRULSRUWDWDVRQRFRQIRUPLDOOD'LUHWWLYD&(( 3URGRWWLGD&RVWUX]LRQH
STUFE A PELLET, a marchio commerciale EDILKAMIN, denominate FANTASY - FATA - SIRENA - STORY
1GL6(5,(   5LI7DUJKHWWDGDWL$112',)$%%5,&$=,21( 5LI7DUJKHWWDGDWL

/DFRQIRUPLWjDLUHTXLVLWLGHOOD'LUHWWLYD&((qLQROWUHGHWHUPLQDWDGDOODFRQIRUPLWjDOODQRUPDHXURSHD
(1

$OWUHVuGLFKLDUDFKH
VWXIHDSHOOHWGLOHJQR)$17$6<)$7$6,5(1$6725<ULVSHWWDQRLUHTXLVLWLGHOOHGLUHWWLYHHXURSHH
&('LUHWWLYD%DVVD7HQVLRQH
2004/108/CE - Direttiva Compatibilit Elettromagnetica

(',/.$0,16SDGHFOLQDRJQLUHVSRQVDELOLWjGLPDOIXQ]LRQDPHQWRGHOODSSDUHFFKLDWXUDLQFDVRGLVRVWLWX]LRQHPRQWDJJLRHR
PRGLFKHHIIHWWXDWHQRQGDSHUVRQDOH(',/.$0,1VHQ]DDXWRUL]]D]LRQHGHOODVFULYHQWH
-2-
ITALIANO
35,1&,3,2',)81=,21$0(172 INFORMAZIONI PER LA SICUREZZA
/HVWXIHVFDOGDQRODULDXWLOL]]DQGRFRPHFRPEXVWLELOHLOSHOOHW Le stufe sono progettate per scaldare, attraverso una combu-
stione automatica di pellet nel focolare, il locale nel quale si
di legno, la cui combustione gestita elettronicamente. trova sia, per irraggiamento che per movimento di aria che esce
'LVHJXLWRQHLOOXVWUDWRLOIXQ]LRQDPHQWR OHOHWWHUHIDQQR dalla griglia frontale.
ULIHULPHQWRDOODJXUD 
,OFRPEXVWLELOH SHOOHW YLHQHSUHOHYDWRGDOVHUEDWRLRGLVWRF- /DSSDUHFFKLRQRQqGHVWLQDWRDHVVHUHXVDWRGDSHUVRQH
EDPELQLFRPSUHVLOHFXLFDSDFLWjVLFKHVHQVRULDOLRPHQWDOL
FDJJLR $ HWUDPLWHXQDFRFOHD % DWWLYDWDGDPRWRULGXWWRUH siano ridotte. I bambini devono essere sorvegliati per sincerarsi
& YLHQHWUDVSRUWDWRQHOFURJLRORGLFRPEXVWLRQH '  FKHQRQJLRFKLQRFRQODSSDUHFFKLR
/DFFHQVLRQHGHOSHOOHWDYYLHQHWUDPLWHDULDFDOGDSURGRWWDGD
una resistenza elettrica (E) e aspirata nel crogiolo tramite un *OLXQLFLULVFKLGHULYDELOLGDOOLPSLHJRGHOODVWXIDSRVVR-
no essere legati a una non corretta installazione, a un diretto
ventilatore estrattore fumi (F). contatto con parti elettriche in tensione (interne), a un contatto
,IXPLSURGRWWLGDOODFRPEXVWLRQHYHQJRQRHVWUDWWLGDOIRFRODUH FRQIXRFRHSDUWLFDOGH YHWURWXELXVFLWDDULDFDOGD DOOLQWUR-
WUDPLWHORVWHVVRYHQWLODWRUHHGHVSXOVLGDOERFFKHWWRQH *  duzione di sostanze estranee, a combustibili non raccomandati,
ubicato nella zona bassa del retro delle stufe. a una non corretta manutenzione.
/HVWXIHSHUPHWWRQRODFDQDOL]]D]LRQHGHOODULDFDOGDLQPRGR 1HOFDVRGLPDQFDWRIXQ]LRQDPHQWRGLFRPSRQHQWLRDQRPD-
da veicolarla per riscaldare locali adiacenti. lie, la stufa dotata di dispositivi di sicurezza che ne garanti-
6XOUHWURGHOOHVWXIHVRQRSUHVHQWLGXHERFFKHWWRQLFP scono lo spegnimento, da lasciar avvenire senza intervenire.
maschio per il collegamento della canalizzazione aria calda.
3HUFDQDOL]]DUHODULDFDOGDLQXQRRGXHORFDOLDWWLJXLODVWXID 3HUXQUHJRODUHIXQ]LRQDPHQWRODVWXIDGHYHHVVHUHLQVWDOODWD
rispettando quanto indicato su questa scheda.
dotata di due bocchettoni sul retro ai quali devono essere
collegati appositi tubi in alluminio. 'XUDQWHLOIXQ]LRQDPHQWRQRQGHYHHVVHUHDSHUWDODSRUWDGHO
3HUDJHYRODUHODGLVWULEX]LRQHGHOODULDFDOGDVRQRGLVSRQLELOL focolare: la combustione infatti gestita automaticamente e
L.,7H.,7%,6RSWLRQDO YHGLSDJ  non necessita di alcun intervento.
/DTXDQWLWGLFRPEXVWLELOHHOHVWUD]LRQHIXPLDOLPHQWD]LRQH 8VDUHFRPHFRPEXVWLELOHVRORSHOOHWGLOHJQRGLDPPPGL
aria comburente, sono regolate tramite scheda elettronica dotata RWWLPDTXDOLWjHFHUWLFDWR
di software con sistema LeonardoDOQHGLRWWHQHUHXQD
combustione ad alto rendimento e basse emissioni. ,QQHVVXQFDVRGHYRQRHVVHUHLQWURGRWWHQHOIRFRODUHRQHO
serbatoio sostanze estranee, rispetto al pellet.
6XOWRSLQVWDOODWRLOSDQQHOORVLQRWWLFR 0 FKHFRQVHQWHOD
gestione e la visualizzazione di tutte le fasi di funzionamento. 3HUODSXOL]LDGHOFDQDOHGDIXPR WUDWWRGLFDQQDFKHFROOHJD
Le principali fasi possono essere gestite anche attraverso il il bocchettone di uscita fumi della stufa con la canna fumaria)
telecomando. QRQGHYRQRHVVHUHXWLOL]]DWLSURGRWWLLQDPPDELOL
La stufa dotata sul retro di una presa seriale per collegamento /HSDUWLGHOIRFRODUHHGHOVHUEDWRLRGHYRQRHVVHUHVRORDVSL-
FRQFDYHWWRRSWLRQDOFRG DGLVSRVLWLYLGLDFFHQVLRQH UDWHVRORD)5(''2
remota (quali combinatori telefonici, cronotermostati ect.).
Le stufe sono realizzate con una struttura interna completamen- ,OYHWURSXHVVHUHSXOLWRD)5(''2FRQDSSRVLWRSURGRWWR
te in ghisa. HV*ODVV.DPLQ(GLONDPLQ HXQSDQQR
1RQSXOLUHDFDOGR
$VVLFXUDUVLFKHODVWXIDYLHQHSRVDWDHDFFHVDGD&$7DELOLWD-
WR(GLONDPLQ FHQWURDVVLVWHQ]DWHFQLFD VHFRQGROHLQGLFD]LR-
M ni della presente scheda; condizioni peraltro indispensabili per
la validazione della garanzia.
'XUDQWHLOIXQ]LRQDPHQWRGHOODVWXIDLWXELGLVFDULFRHOD
SRUWDUDJJLXQJRQRDOWHWHPSHUDWXUH QRQWRFFDUHVHQ]DODSSR-
sito guanto).
1RQGHSRVLWDUHRJJHWWLQRQUHVLVWHQWLDOFDORUHQHOOHLPPHGLD-
te vicinanze della stufa.
A 1RQXVDUH0$,FRPEXVWLELOLOLTXLGLSHUDFFHQGHUHODVWXIDR
ravvivare la brace.
B 1RQRFFOXGHUHOHDSHUWXUHGLDHUD]LRQHQHOORFDOHGLLQVWDOOD-
zione, n gli ingressi di aria della stufa stessa.
E 1RQEDJQDUHODVWXIDQRQDYYLFLQDUVLDOOHSDUWLHOHWWULFKHFRQ
le mani bagnate.
C 1RQLQVHULUHULGX]LRQLVXLWXELGLVFDULFRIXPL

' /DVWXIDGHYHHVVHUHLQVWDOODWDLQORFDOLDGHJXDWLDOODSUHYHQ-
zione antincendio e serviti da tutti i servizi (alimentazione e
G VFDULFKL FKHODSSDUHFFKLRULFKLHGHSHUXQFRUUHWWRHVLFXUR
funzionamento.
,1&$62',)$//,7$$&&(16,21(1215,3(7(-
5(/$&&(16,21(35,0$',$9(5(69827$72,/
F CROGIOLO.
$ttenzione: il pellet svuotato dal crogiolo non deve essere
J depositato nel serbatoio.
-3-
ITALIANO

',0(16,21,(),1,785(
- FANTASY: pietra ollare
- FATA: ceramica bianco panna, rossa, cuoio.
- SIRENA: ceramica bianco panna, rossa, cuoio.
- STORY: acciaio verniciato grigio. canalizzazione aria
FDOGDPP

)5217( 5(752
68
13 13

ia
ar ne
m io
4 c st
mbu
115

104
co
cm
8 ta fumi
i
usc

39
31
7

),$1&2 3,$17$
53
53
115

68

0,685(9$/,'(3(5,02'(//,

-4-
ITALIANO
CARATTERISTICHE
APPARATI ELETTRONICI
/(21$5'2 un sistema di sicurezza e regolazione della combustione che consente un funzionamen-
to ottimale in qualunque condizione, grazie a due sensori che rilevano il livello di pressione nella camera
di combustione e la temperatura dei fumi.
La rilevazione e la conseguente ottimizzazione dei due parametri avviene in continuo, in modo da
FRUUHJJHUH LQ WHPSR UHDOH HYHQWXDOL DQRPDOLH GL IXQ]LRQDPHQWR ,O VLVWHPD RWWLHQH XQD FRPEXVWLRQH
costante regolando automaticamente il tiraggio in base alle caratteristiche della canna fumaria (curve,
lunghezza, forma, diametro ecc.) ed alle condizioni ambientali (vento, umidit, pressione atmosferica,
installazioni in alta quota ecc.).
/(21$5'2LQROWUHLQJUDGRGLULFRQRVFHUHLOWLSRGLSHOOHWHUHJRODUQHDXWRPDWLFDPHQWHODIXVVR
per garantire attimo dopo attimo il livello di combustione richiesto.

6&+('$(/(77521,&$

+ ---

Lithium
+
CR2032

FUSIBILE
sulla presa con interruttore posta sul retro
della stufa, sono inseriti due fusibili, di
cui uno funzionale *HODOWURGLVFRUWD**.
PORTA SERIALE
6XOOXVFLWDVHULDOH56FRQDSSRVLWRFDYHWWR FRG SRVVLELOHIDULQVWDOODUH
GDO&$7XQRSWLRQDOSHULOFRQWUROORGHOOHDFFHQVLRQLHVSHJQLPHQWLHVFRPELQDWRUH
telefonico, termostato ambiente.

BATTERIA TAMPONE
6XOODVFKHGDHOHWWURQLFDSUHVHQWHXQDEDWWHULDWDPSRQH WLSR&5GD9ROW 
,OVXRPDOIXQ]LRQDPHQWR QRQFRQVLGHUDELOHGLIHWWRGLSURGRWWRPDQRUPDOHXVXUD 
YLHQHLQGLFDWRFRQVFULWWH&RQWURO%DWWHULD
3HUPDJJLRULULIHULPHQWLFRQWDWWDUHLO&$7FKHKDHIIHWWXDWRODqDFFHQVLRQH
* **
-5-
ITALIANO

CARATTERISTICHE
CARATTERISTICHE TERMOTECNICHE ai sensi EN 14785
Potenza Nominale Potenza Ridotta
Portata termica bruciata kW
Potenza termica 13,2 5,1 kW
5HQGLPHQWR(IFHQ]D 92,5 93,3 %
Emissione CO al 13% O2 0,019 0,038 %
Temperatura massima fumi   C
Tiraggio minimo 12 10 Pa
Portata in Massa dei fumi 13,5 7,4 g/s
Consumo combustibile 2,9 1,1 kg/h
Capacit serbatoio 23,5 kg
Autonomia 7 18,5 ore
Volume riscaldabile * 345 m3
Diametro condotto fumi (maschio) 80 mm
Diametro condotto presa aria (maschio) 40 mm
3HVRFRQLPEDOOR)$17$6<)$7$6,5(1$6725<  kg

* ,OYROXPHULVFDOGDELOHFDOFRODWRFRQVLGHUDQGRXQLVRODPHQWRGHOODFDVDFRPHGD/HVXFFHVVLYHPRGLFKHHXQDULFKLHVWD
GLFDORUHGL.FDOPtRUD

CARATTERISTICHE ELETTRICHE
$OLPHQWD]LRQH 9DF+]
,QWHUUXWWRUHRQRII si
3RWHQ]DDVVRUELWDPHGLD  W
3RWHQ]DDVVRUELWDLQDFFHQVLRQH  W
Frequenza telecomando infrarossi
3URWH]LRQHVXDOLPHQWD]LRQHJHQHUDOH* YHGLSDJ )XVLELOH$79DF[
3URWH]LRQHVXVFKHGDHOHWWURQLFD )XVLELOH$79DF[

N.B.
 WHQHUHLQFRQVLGHUD]LRQHFKHDSSDUHFFKLDWXUHHVWHUQHSRVVRQRSURYRFDUHGLVWXUELDOIXQ]LRQDPHQWRGHOODVFKHGDHOHWWURQLFD
 DWWHQ]LRQHLQWHUYHQWLVXFRPSRQHQWLLQWHQVLRQHPDQXWHQ]LRQLHRYHULFKHGHYRQRHVVHUHIDWWHGDSHUVRQDOHTXDOLFDWR
SULPDGLHIIHWWXDUHTXDOVLDVLPDQXWHQ]LRQHGLVLQVHULUHODSSDUHFFKLRGDOODUHWHGLDOLPHQWD]LRQHHOHWWULFD

I dati sopra riportati sono indicativi.


(',/.$0,1VSDVLULVHUYDGLPRGLFDUHLSURGRWWLVHQ]DSUHDYYLVRHDVXRLQVLQGDFDELOHJLXGL]LR

',6326,7,9,GL6,&85(==$
7(502&233,$
SRVWDVXOORVFDULFRIXPLQHULOHYDODWHPSHUDWXUD,QIXQ]LRQHGHLSDUDPHWULLPSRVWDWLFRQWUROODOHIDVLGLDFFHQVLRQHODYRURHVSHJQLPHQWR

VACUOMETRO:
3RVWRVXOOHVWUDWWRUHIXPLFKHULOHYDLOYDORUHGHOODGHSUHVVLRQH ULVSHWWRDOODPELHQWHGLLQVWDOOD]LRQH LQFDPHUDGLFRPEXVWLRQH

6(1625()/8662$5,$
SRVWRQHOFDQDOHGDVSLUD]LRQHLQWHUYLHQHTXDQGRLOXVVRGHOODULDFRPEXUHQWHQRQFRUUHWWRFRQFRQVHJXHQWLSUREOHPLGLGH-
pressione nel circuito fumi provocando lo spegnimento della stufa.

7(50267$72',6,&85(==$
,QWHUYLHQHQHOFDVRLQFXLODWHPSHUDWXUDDOOLQWHUQRGHOODVWXIDWURSSRHOHYDWD%ORFFDLOFDULFDPHQWRGHOSHOOHWSURYRFDQGROR
spegnimento della stufa.
-6-
ITALIANO
0217$**,25,9(67,0(172)$7$6,5(1$
0,187(5,$,1'27$=,21(
75 QUYLWL0[
QUYLWL0[
33
 nr. 4 distanziali in silicone per top in ceramica
QUURQGHOOH0
QUEXVVROH
QUGLVWDQ]LDOLLQVLOLFRQHSHUHOHPHQWLFHUDPLFD
QUSLDVWULQHVVDJJLRFHUDPLFKH
0217$**,23,$675(//(/$7(5$/, J
6PRQWDUHLOSDQQHOORSRVWHULRUH  HLGXHSUROL  
75 )LVVDUHOHGXHSLDVWULQH  VXLDQFKL]LQFDWL
J J SHULOPRGHOOR)$7$ J
/DSLDVWULQDGLVLQLVWUDGHYHHVVHUHVVDWDDLIRULFHQWUDOHH
J 150 VXSHULRUHPHQWUHODSLDVWULQDGLGHVWUDGHYHHVVHUHVVDWDDLIRUL
150
centrale e inferiore.
138 &DO]DUHOHSLDVWUHOOHLQFHUDPLFD  VXOOHSLDVWULQH  
 ,QWHUSRUUHGLVWDQ]LDOLVLOLFRQDWL  QHOODSDUWHSRVWHULRUH
WUDLOEDVDPHQWRLQJKLVDHODSLDVWUHOODLQIHULRUHGHVWUD  
139
YHGLSDUW<J 
 150 150
3HUXQFRUUHWWRVVDJJLRGHOODSLDVWUHOODLQFHUDPLFDODWHUDOH
138 superiore destra e della piastrella in ceramica laterale inferiore
139
sinistra opportuno agire sulle viti di regolazione di fermo
SUHVHQWLVXLDQFL]LQFDWLGHOODVWUXWWXUD J 

J
150
SDUW< 150 Fianco dx J 5HJRODUHODYLWHGLVVDJJLRLQEDWWXWDDOOD
SLDVWUHOODLQFHUDPLFDODWHUDOHVXSHULRUHGHVWUD  
Fianco sx J 5LPXRYHUHODSLDVWUHOODLQFHUDPLFDVXSH-
ULRUHVLQLVWUD  HUHJRODUHODYLWHGLVVDJJLRLQEDWWXWDDOOD
SLDVWUHOODLQFHUDPLFDODWHUDOHLQIHULRUHVLQLVWUD  
5LPRQWDUHODSLDVWUHOODLQFHUDPLFDVXSHULRUHVLQLVWUD  
J
SHULOPRGHOOR6,5(1$ J
(QWUDPEHOHSLDVWULQHGHYRQRHVVHUHVVDWHDLIRULFHQWUDOHH
inferiore.
&DO]DUHOHSLDVWUHOOHLQFHUDPLFD  VXOOHSLDVWULQH  
127$/HSLDVWUHOOHHVVHQGRUHDOL]]DWHSHUFRODJJLRSRWUHE-
J EHURULVXOWDUHOHJJHUPHQWHGLIIHUHQWLLQDOWH]]DOXQDGDOODO-
J WUD3HURYYLDUHDOOHYHQWXDOHOHJJHUDYDULD]LRQHGLDOWH]]D
SRVVLELOHLQWHUSRUUHLGLVWDQ]LDOLVLOLFRQDWL J VHQ]D
150 150 SHUDOWURSUHJLXGLFDUHOHVWHWLFDGHOODVWXID
61
5LPRQWDUHLSUROL  HGLOSDQQHOORSRVWHULRUH  
 61
150 MONTAGGIO FRONTALINO SUPERIORE
$17(5,25()$7$6,5(1$ J
3RVL]LRQDUHLOIURQWDOLQRDQWHULRUHVXSHULRUHLQFHUDPLFD
61 150
61
 LQDSSRJJLRDOVXSSRUWRIURQWDOLQR  SRVL]LRQDWRVRSUD
61 ODQWLQD
)LVVDUHLOIURQWDOLQRFRQOHYLWL0[ XWLOL]]DQGRFKLDYH
150
a brugola).
150 3ULPDGLHIIHWWXDUHWDOHRSHUD]LRQHQHFHVVDULRDSULUHODQWLQD
J J
127$3HUXQFRUUHWWRPRQWDJJLRGHOIURQWDOLQRDQWHULRUH
VXSHULRUH  QHFHVVDULRLQWHUSRUUHIUDGLHVVRHLOIURQWDOLQR
Part. Z  ODEXVVRODIRUQLWDLQGRWD]LRQHFRPHLQGLFDWRQHOSDUWLFR-
 ODUH=DJ
62
MONTAGGIO FRONTALINO INFERIORE
62 $17(5,25()$7$6,5(1$ J
bussola 6YLWDUHFRQODFKLDYHDEUXJRODLQGRWD]LRQHOHYLWLGLIHUPR
della griglia inferiore in ghisa (4) e rimuoverla.
62 3RVL]LRQDUHLOIURQWDOLQR  HVVDUORFRQOHYLWL0[
24 (utilizzando chiave a brugola) come indicato nel particolare
vite ;DJ

J J
-7-
ITALIANO

0217$**,25,9(67,0(172)$7$6,5(1$
0217$**,2723,1&(5$0,&$)$7$6,5(1$ J
 ,QVHULUHLGLVWDQ]LDOLSHUFHUDPLFD QHLULVSHWWLYLIRUL
* OLEHULGHOWRSLQJKLVDHDSSRJJLDUHLOWRSLQFHUDPLFD 
2YHQHFHVVDULRDSSRUUHWUDLOGLVWDQ]LDOHLQVLOLFRQHHLOWRSLQ
62 ghisa una rondella.
n2 viti 127$
ORVPDOWRURVVRFRQFULVWDOOLQDDSSOLFDWRVXOODPDLROLFD
FDYLOODXQLIRUPHPHQWH VFUHSRODWXUH VXWXWWDODVXSHUFLH
Part. X Questa cavillatura non un difetto ma una caratteristica
GHOORVPDOWRDSSOLFDWRVXPDLROLFDGHQRPLQDWDFUDFO
,SDUWLFRODULGLFHUDPLFD PDLROLFD VRQRFRODWLHVPDOWDWL
manualmente e possono presentare piccole imperfezioni
J J (piccoli avvallamenti o porosit dello smalto) che non ne pre-
giudicano la loro qualit, ma anzi ne testimonia la lavoarazione
manuale.

0217$**,25,9(67,0(1726725<
0,187(5,$,1'27$=,21(
QUYLWL0[
QUYLWL0[

nr. 4 distanziali in silicone per ceramica top
QUURQGHOOH0
62 QUEXVVROH

/DVWXIDYLHQHFRQVHJQDWDFRQLDQFKLODWHUDOLLQPHWDOOR
gi montati, mentre i frontalini in ceramica superiore e inferio-
UH  HGLOWRS  VRQRLPEDOODWLDSDUWHHGHYRQRHVVHUH
montati procedendo come segue:

62 MONTAGGIO FRONTALINO SUPERIORE



J $17(5,25( J
3RVL]LRQDUHLOIURQWDOLQRDQWHULRUHVXSHULRUHLQFHUDPLFD
 LQDSSRJJLRDOVXSSRUWRIURQWDOLQR  SRVL]LRQDWRVRSUD
Part. Z
ODQWLQD
)LVVDUHLOIURQWDOLQRFRQOHYLWL0[ XWLOL]]DQGRFKLDYH
62 a brugola).
62
3ULPDGLHIIHWWXDUHWDOHRSHUD]LRQHQHFHVVDULRDSULUHODQWLQD
bussola n2 viti

127$
3HUXQFRUUHWWRPRQWDJJLRGHOIURQWDOLQRDQWHULRUHVXSHULRUH
24 Part. X
 QHFHVVDULRLQWHUSRUUHIUDGLHVVRHLOIURQWDOLQR  OD
vite
EXVVRODIRUQLWDLQGRWD]LRQHFRPHLQGLFDWRQHOSDUWLFRODUH=
DJ
J J
MONTAGGIO FRONTALINO INFERIORE
$17(5,25( J
*  6YLWDUHFRQODFKLDYHDEUXJRODLQGRWD]LRQHOHYLWLGL
fermo della griglia inferiore in ghisa (4) e rimuoverla.
3RVL]LRQDUHLOIURQWDOLQR  HVVDUORFRQOHYLWL
0[ XWLOL]]DQGRFKLDYHDEUXJROD FRPHLQGLFDWRQHOSDUWL-
FRODUH;DJ

MONTAGGIO TOP IN CERAMICA J


,QVHULUHLGLVWDQ]LDOLSHUFHUDPLFD QHLULVSHWWLYLIRUL
OLEHULGHOWRSLQJKLVDHDSSRJJLDUHLOWRSLQFHUDPLFD 
2YHQHFHVVDULRDSSRUUHWUDLOGLVWDQ]LDOHLQVLOLFRQHHLOWRSLQ
ghisa una rondella in dotazione.

J
-8-
ITALIANO
INSTALLAZIONE
7XWWHOHOHJJLORFDOLHQD]LRQDOLHOH1RUPH(XURSHHGHYRQR SCARICO FUMI
HVVHUHVRGGLVIDWWHQHOOLQVWDOOD]LRQHHQHOOXVRGHOODSSDUHFFKLR ,OVLVWHPDGLVFDULFRGHYHHVVHUHXQLFRSHUODVWXID
,Q,WDOLDIDUHULIHULPHQWRDOODQRUPD81,QRQFK QRQVLDPPHWWRQRVFDULFKLLQFDQQDIXPDULDFRPXQHFRQ
DGHYHQWXDOLLQGLFD]LRQLUHJLRQDOLRGHOOH$6/ORFDOL altri dispositivi).
(LQGLVSHQVDELOHFRPXQTXHIDUHULIHULPHQWRDOOHOHJJLYLJHQWL Lo scarico dei fumi avviene dal bocchettone di diametro 8
cm posto sul retro. Lo scarico fumi deve essere collegato con
nelle singole nazioni. ,QFDVRGLLQVWDOOD]LRQHLQFRQGRPLQLR OHVWHUQRXWLOL]]DQGRWXELLQDFFLDLRFHUWLFDWL(1
FKLHGHUHSDUHUHSUHYHQWLYRDOODPPLQLVWUDWRUH ,OWXERGHYHHVVHUHVLJLOODWRHUPHWLFDPHQWH
3HUODWHQXWDGHLWXELHLOORURHYHQWXDOHLVRODPHQWRQHFHVVDULR
9(5,),&$',&203$7,%,/,7$&21$/75,',6326,7,9, utilizzare materiali resistenti alle alte temperature (silicone o
/DVWXID121GHYHHVVHUHLQVWDOODWDQHOORVWHVVRDPELHQWHLQ mastici per alte temperature).
FXLVLWURYDQRDSSDUHFFKLGDULVFDOGDPHQWRDJDVGHOWLSR% HV /XQLFRWUDWWRRUL]]RQWDOHDPPHVRSXDYHUHOXQJKH]]DQRDP
caldaie a gas, stufe e apparecchi asserviti da cappa aspirante) (SRVVLELOHXQQXPHURGLFXUYHFRQDPSLH]]DPD[q ULVSHW-
LQTXDQWRODVWXIDSRWUHEEHPHWWHUHLQGHSUHVVLRQHODPELHQWH WRDOODYHUWLFDOH QRDGXH
compromettendo il funzionamento di tali apparecchi oppure (QHFHVVDULR VHORVFDULFRQRQVLLQVHULVFHLQXQDFDQQD
HVVHUHLQXHQ]DWD IXPDULD XQWUDWWRYHUWLFDOHGLDOPHQRPWHXQWHUPLQDOH
DQWLYHQWR ULIHULPHQWR81, ,OFRQGRWWRYHUWLFDOH
SXHVVHUHLQWHUQRRHVWHUQR
9(5,),&$$//$&&,$0(172(/(775,&2 SRVL]LRQD- 6HLOFDQDOHGDIXPRDOOHVWHUQRGHYHHVVHUHFRLEHQWDWR
UHODSUHVDGLFRUUHQWHLQXQSXQWRIDFLOPHQWHDFFHVVLELOH adeguatamente. Se il canale da fumo si inserisce in una canna
La stufa fornita di un cavo di alimentazione elettrica da colle- fumaria, questa deve essere idonea per combustibili solidi e se
JDUVLDGXQDSUHVDGL9+]SUHIHULELOPHQWHFRQLQWHUUXW- SLJUDQGHGLPPQHFHVVDULRULVDQDUODLQWXEDQGRODFRQ
tore magnetotermico. WXELGLVH]LRQHHPDWHULDOLLGRQHL HVDFFLDLRPP 
9DULD]LRQLGLWHQVLRQHVXSHULRULDOSRVVRQRFRPSURPHWWHUH 7XWWLLWUDWWLGHOFRQGRWWRIXPLGHYRQRHVVHUHLVSH]LRQDELOL
il funzionamento della stufa. ,FRPLJQROLHFRQGRWWLGLIXPRDLTXDOLVRQRFROOHJDWLJOLDS-
parecchi utilizzatori di combustibili solidi devono venire puliti
/LPSLDQWRHOHWWULFRGHYHHVVHUHDQRUPDYHULFDUHLQSDUWLFR- DOPHQRXQDYROWDDOODQQR YHULFDUHVHQHOODSURSULDQD]LRQH
ODUHOHIFLHQ]DGHOFLUFXLWRGLWHUUD esiste una normativa al riguardo).
/DQRQHIFLHQ]DGHOFLUFXLWRGLWHUUDSURYRFDPDOIXQ]LRQD- /DVVHQ]DGLFRQWUROORHSXOL]LDUHJRODULDXPHQWDODSUREDELOLW
PHQWRGLFXL(GLONDPLQQRQVLSXIDUFDULFR GLLQFHQGLRGHOFRPLJQROR1HOFDVRSURFHGHUHFRPHVHJXH
La linea di alimentazione deve essere di sezione adeguata alla non spegnere con acqua; svuotare il serbatoio del pellet. Rivol-
SRWHQ]DGHOODSSDUHFFKLDWXUD gersi a personale specializzato prima di riavviare la macchina.
La stufa progettata per funzionare con qualsiasi condizione
POSIZIONAMENTO FOLPDWLFD1HOFDVRGLSDUWLFRODULFRQGL]LRQLFRPHYHQWRIRUWH
3HULOFRUUHWWRIXQ]LRQDPHQWRODVWXIDGHYHHVVHUHSRVL]LRQDWD potrebbero intervenire sistemi di sicurezza che portano in
LQEROOD9HULFDUHODFDSDFLWSRUWDQWHGHOSDYLPHQWR VSHJQLPHQWRODVWXID,QTXHVWRFDVRQRQIDUIXQ]LRQDUHODS-
parecchio con le sicurezze disabilitate, se il problema dovesse
SHUVLVWHUHFRQWDWWDUHLO&HQWUR$VVLVWHQ]D7HFQLFD
',67$1=(',6,&85(==$$17,&(1',2
La stufa deve essere installata nel rispetto delle seguenti condi- CASI TIPICI
zioni di sicurezza: Fig. 1 Fig. 2
GLVWDQ]DPLQLPDVXLODWLHVXOUHWURGLFPGDLPDWHULDOL
LQDPPDELOL
- davanti alla stufa non possono essere collocati materiali
LQDPPDELOLDPHQRGLFP
Se non risultasse possibile rispettare le distanze sopra indicate,
necessario mettere in atto provvedimenti tecnici ed edili
per evitare ogni rischio di incendio.
,QFDVRGLFROOHJDPHQWRFRQSDUHWHLQOHJQRRDOWURPDWHULDOH
LQDPPDELOHQHFHVVDULRFRLEHQWDUHDGHJXDWDPHQWHLOWXERGL
scarico fumi.

35(6$'$5,$
indispensabile che venga predisposta dietro alla stufa una
SUHVDGDULDFROOHJDWDDOOHVWHUQRGLVH]LRQHXWLOHPLQLPDGL
FPsFKHJDUDQWLVFDVXIFLHQWHDOLPHQWD]LRQHGLDULDSHUOD
combustione. A: canna fumaria in acciaio coibentata
,QDOWHUQDWLYDSRVVLELOHSUHOHYDUHODULDSHUODVWXIDGLUHWWD- B:DOWH]]DPLQLPDPHFRPXQTXHROWUHODTXRWDGLJURQGDGHO 
PHQWHGDOOHVWHUQRDWWUDYHUVRXQSUROXQJDPHQWRLQDFFLDLRGHO tetto
tubo di diametro 4 cm ubicato sullo schienale della stufa stessa. C-E:SUHVDGDULDGDOODPELHQWHHVWHUQR VH]LRQHSDVVDQWHPLQLPR
,OWXERGHYHHVVHUHGLOXQJKH]]DLQIHULRUHDPHWURHQRQGHYH FPs
' canna fumaria in acciaio, interna alla canna fumaria esistente in
SUHVHQWDUHFXUYH,QRJQLFDVROXQJRWXWWRLOSHUFRUVRLOFRQGRW- muratura.
to presa aria deve essere garantita una sezione libera almeno
COMIGNOLO
GLFPs,OWHUPLQDOHHVWHUQRGHOFRQGRWWRSUHVDDULDGHYH Le caratteristiche fondamentali sono:
WHUPLQDUHFRQXQWUDWWRDqJUDGLYHUVRLOEDVVRRFRQXQD - sezione interna alla base uguale a quella della canna fumaria
protezione antivento ed essere protetto con una rete anti insetti - sezione di uscita non minore del doppio di quella della canna
FKHFRPXQTXHQRQULGXFDODVH]LRQHSDVVDQWHXWLOHGLFPs fumaria
- posizione al di sopra del colmo tetto ed al di fuori delle zone
GLUHXVVR
-9-
ITALIANO

INSTALLAZIONE
J$ &,5&2/$=,21($5,$&$/'$
/HURJD]LRQHGLDULDFDOGDQHOORFDOHGLLQVWDOOD]LRQHDYYLHQH
GDOODJULJOLDLQVWDOODWDIURQWDOPHQWHQHOODSDUWHVXSHULRUH J( 

3HUFDQDOL]]DUHODULDFDOGDLQXQRRGXHORFDOLDWWLJXLODVWXID
GRWDWDGLGXHERFFKHWWRQLVXOUHWUR J$ DLTXDOLGHYRQR
essere collegati appositi tubi in alluminio.

bocchettoni 3HUDJHYRODUHODGLVWULEX]LRQHGHOODULDFDOGDVRQRGLVSRQLELOL
uscita aria calda LO.,7H.,7%,6RSWLRQDO YHGLSDJ 

LPSRUWDQWHULFRUGDUHOLPSRUWDQ]DGLRSSRUWXQDFRLEHQWD]LR-
J%
QHGHOWXERLQFXLSDVVDODULDFDOGDSHUHYLWDUHGLVSHUVLRQL
Sono da evitare il pi possibile curve dei tubi stessi.

N.B.: I TUBI SUI BOCCHETTONI USCITA ARIA CAL-


'$'(9212(66(5(&$/=$7,35,0$',$33/,-
P &$5(,/5,9(67,0(172(35(9,260217$**,2
P '(/),$1&+(772/$7(5$/683(5,25(,1*+,6$
/$3$57(,1,=,$/('(/78%2)/(66,%,/('(9(
(66(5(',67(6$&203/(7$0(17(,102'2
'$(/,0,1$5(,/&2558*$0(172,17$/
02'2,/',$0(752,17(5126,$//$5*+(5$
6(16,%,/0(17()$925(1'2/,0%2&&2
J&
/DGLVWULEX]LRQHGHOODULDFDQDOL]]DWDUHJRODELOHPDQXDOPHQWH
WUDPLWHGHOOHOHYH/ J' 
P 3HUHVVHUHPRYLPHQWDWHELVRJQDWRJOLHUHOHSLDVWULQHGLEORF-
P FDJJLR3VVDWHFRQYLWL J%& 
L 8QDYROWDWROWHOHSLDVWULQHODULDFDOGDSXHVVHUHLQGLUL]]DWD
L RQHOODSDUWHVXSHULRUHIURQWDOHJ( OHYDLQSRVL]LRQHWXWWD
LQGLHWURYHGLJ' RQHOODSDUWHSRVWHULRUHJ) OHYDLQ
SRVL]LRQHWXWWDDYDQWLYHGLJ' RPHWQHOODSDUWHVXSHULRUH
frontale e met nella parte nella parte posteriore (leva nella
SRVL]LRQHLQWHUPHGLDYHGLJ' 
J'
1%6(/$678)$1219,(1(&$1$/,==$7$/(
3,$675,1( 3 121'(9212(66(5(5,0266(
frontale

intermedia

posteriore

J( J)

- 10 -
ITALIANO
INSTALLAZIONE
q62/8=,21(.,7 FRG 62/2/2&$/($77,*82
1%,78%,68,%2&&+(7721,86&,7$$5,$&$/'$'(9212(66(5(&$/=$7,35,0$',$33/,&$5(
,/5,9(67,0(172(35(9,260217$**,2'(/),$1&+(772/$7(5$/(683(5,25(,1
*+,6$/$3$57(,1,=,$/('(/78%2)/(66,%,/('(9((66(5(',67(6$&203/(7$0(17(
,102'2'$(/,0,1$5(,/&2558*$0(172,17$/02'2,/',$0(752,17(5126,$//$5*+(5$
6(16,%,/0(17()$925(1'2/,0%2&&2
'HQLUHLOSRVL]LRQDPHQWRGHOODVWXIDULVSHWWRODPXUDWXUD JD 
6PRQWDUHODSDUWHVXSHULRUHGHOORVFKLHQDOH  HGDVSRUWDUHXQRGHLGXHWDSSLSUHLQFLVLLQFRUULVSRQGHQ]DGHLERFFKHWWRQL
XVFLWDDULDFDOGD JE 
$WWLYDUHODOHYDGLFRPDQGRFDQDOL]]D]LRQHDULDFDOGD  WRJOLHQGRODSLDVWULQHGLEORFFR   JE 
7DJOLHUHLOFRSULFDQQDDPLVXUD D LQWHUYHQHQGRVXOODSDUWHODWRPXUR JF
6LVWHPDUHODVWXIDQHOODSRVL]LRQHGHQLWLYD
(VWHQGHUHLOWXERGLDOOXPLQLR  SHUODFDQDOL]]D]LRQHGHOODULDFDOGDVHQ]DFROOHJDUORDOERFFKHWWRQHGHOODVWXID
&DO]DUHSUHYHQWLYDPHQWHVXOWXERLQDOOXPLQLRLOURVRQH  HLOFRSULWXER D VHQ]DEORFFDUOR JF 
&DO]DUHLOWXERLQDOOXPLQLRDOERFFKHWWRQHXVFLWDDULDFDOGDVXOUHWURGHOODVWXID   JG 
5LPRQWDUHODSDUWHVXSHULRUHGHOORVFKLHQDOH  
6LVWHPDUHLQSRVL]LRQHGHQLWLYDLOFRSULWXER D HVVDUORDOUHWURGHOODVWXIDFRQOHYLWLLQGRWD]LRQH   JG 
,QVWDOODUHODERFFKHWWDWHUPLQDOH  HLOUHODWLYRWXERLQDOOXPLQLR   JG 
)LVVDUHLOURVRQHDPXUR  FRQVLOLFRQH JG 

JD JE
23

132 1
133
5

13
4
132 7

JF 5 3
6 6a
8
6
6a

4 8
5

JG 5
88 3
4
4
8 6
7

6
6a

Qq .,7
 Scatola  
 7XER  
4 %RFFKHWWDWHUPLQDOH  
 Rosone a muro  
6a &RSULFDQQD  
 9LWLVVDJJLRFRSULFDQQD 4 
8 Fascetta bloccaggio tubi  
- 11 -
ITALIANO

INSTALLAZIONE
q62/8=,21(.,7%,6 FRG 62/2/2&$/(121$77,*82
1%,78%,68,%2&&+(7721,86&,7$$5,$&$/'$'(9212(66(5(&$/=$7,35,0$',$33/,&$5(,/
5,9(67,0(172(35(9,260217$**,2'(/),$1&+(772/$7(5$/(683(5,25(,1*+,6$/$3$57(
,1,=,$/('(/78%2)/(66,%,/('(9((66(5(',67(6$&203/(7$0(17(,102'2'$(/,0,1$5(
,/&2558*$0(172,17$/02'2,/',$0(752,17(5126,$//$5*+(5$6(16,%,/0(17()$92-
5(1'2/,0%2&&2
'HQLUHLOSRVL]LRQDPHQWRGHOODVWXIDULVSHWWRODPXUDWXUD JD 
6PRQWDUHODSDUWHVXSHULRUHGHOORVFKLHQDOH  HGDVSRUWDUHXQRGHLGXHWDSSLSUHLQFLVLLQFRUULVSRQGHQ]DGHLERFFKHWWRQL
XVFLWDDULDFDOGD JE 
$WWLYDUHODOHYDGLFRPDQGRFDQDOL]]D]LRQHDULDFDOGD  WRJOLHQGRODSLDVWULQHGLEORFFR   JE 
7DJOLHUHLOFRSULFDQQDDPLVXUD D LQWHUYHQHQGRVXOODSDUWHODWRPXUR JF
6LVWHPDUHODVWXIDQHOODSRVL]LRQHGHQLWLYD
(VWHQGHUHLOWXERGLDOOXPLQLR  SHUODFDQDOL]]D]LRQHGHOODULDFDOGDVHQ]DFROOHJDUORDOERFFKHWWRQHGHOODVWXID
&DO]DUHSUHYHQWLYDPHQWHVXOWXERLQDOOXPLQLRLOURVRQH  HLOFRSULWXER D VHQ]DEORFFDUOR JF 
&DO]DUHLOWXERLQDOOXPLQLRDOERFFKHWWRQHXVFLWDDULDFDOGDVXOUHWURGHOODVWXID   JG 
5LPRQWDUHODSDUWHVXSHULRUHGHOORVFKLHQDOH  
6LVWHPDUHLQSRVL]LRQHGHQLWLYDLOFRSULWXER D HVVDUORDOUHWURGHOODVWXIDFRQOHYLWLLQGRWD]LRQH   JG 
,QVWDOODUHODERFFKHWWDWHUPLQDOH  HLOUHODWLYRWXERLQDOOXPLQLR  VVDQGRORFRQLOFROODUHDPXUR  HGLWDVVHOOLFRQYLWL
  JG 
)LVVDUHLOURVRQHDPXUR  FRQVLOLFRQH JG 

JD JE 2
2

132
133 1
5
7

13
4 6 6a
132

JF 5
9 9
8

6 10 11

10 9
9 4
10
8 8
JG 5
4 2
8
7

5
6 6

Qq .,7%,6
 Scatola  
 7XER  
4 %RFFKHWWDWHUPLQDOH  
 Rosone a muro  
6a &RSULFDQQD  
 9LWLVVDJJLRFRSULFDQQD 4 
8 Fascetta bloccaggio tubi  
 &ROODUHDPXUR  
 9LWL 4 
 7DVVHOOL 4 
- 12 -
ITALIANO
INSTALLAZIONE
q62/8=,21(.,7 FRG FRQ.,7%,6 FRG (175$0%,,/2&$/,
1%,78%,68,%2&&+(7721,86&,7$$5,$&$/'$'(9212(66(5(&$/=$7,35,0$',$33/,&$5(,/
5,9(67,0(172(35(9,260217$**,2'(/),$1&+(772/$7(5$/(683(5,25(,1*+,6$/$3$57(
,1,=,$/('(/78%2)/(66,%,/('(9((66(5(',67(6$&203/(7$0(17(,102'2'$(/,0,1$5(
,/&2558*$0(172,17$/02'2,/',$0(752,17(5126,$//$5*+(5$6(16,%,/0(17()$92-
5(1'2/,0%2&&2
'HQLUHLOSRVL]LRQDPHQWRGHOODVWXIDULVSHWWRODPXUDWXUD JD 
6PRQWDUHODSDUWHVXSHULRUHGHOORVFKLHQDOH  HGDVSRUWDUHLWDSSLSUHLQFLVLLQFRUULVSRQGHQ]DGHLERFFKHWWRQLXVFLWDDULD
FDOGD JE 
$WWLYDUHOHOHYHGLFRPDQGRFDQDOL]]D]LRQHDULDFDOGD  WRJOLHQGROHSLDVWULQHGLEORFFR   JE 
7DJOLHUHLFRSULFDQQDDPLVXUD D LQWHUYHQHQGRVXOODSDUWHODWRPXUR JF
6LVWHPDUHODVWXIDQHOODSRVL]LRQHGHQLWLYD
(VWHQGHUHLWXELGLDOOXPLQLR  SHUODFDQDOL]]D]LRQHGHOODULDFDOGDVHQ]DFROOHJDUOLDLERFFKHWWRQLGHOODVWXID
&DO]DUHSUHYHQWLYDPHQWHVXLWXELLQDOOXPLQLRLURVRQL  HLFRSULWXEL D VHQ]DEORFFDUOL JF 
&DO]DUHLWXELLQDOOXPLQLRDLERFFKHWWRQLXVFLWDDULDFDOGDVXOUHWURGHOODVWXID   JG 
5LPRQWDUHODSDUWHVXSHULRUHGHOORVFKLHQDOH  
6LVWHPDUHLQSRVL]LRQHGHQLWLYDLFRSULWXEL D HVVDUOLDOUHWURGHOODVWXIDFRQOHYLWLLQGRWD]LRQH   JG 
,QVWDOODUHOHERFFKHWWHWHUPLQDOL  HLUHODWLYLWXELLQDOOXPLQLR  VVDQGROLFRQLFROODULDPXUR  HGLWDVVHOOLFRQYLWL
  JG 
)LVVDUHLURVRQLDPXUR  FRQVLOLFRQH JG 

JD JE
2

5
3 132 1
5
133 2
7
6
13 4
6a

6 6a
132

JF 5 3 8
9 9

6 10 11

4
8
5

10 9 4
10 9
8 8
JG 5
4 3 2
8
7
8 6

4 5
6 5 6

Qq .,7 .,7%,6


 Scatola   
 7XER  - 
 7XER   -
4 %RFFKHWWDWHUPLQDOH   
 Rosone a muro   
6a &RSULFDQQD   
 9LWLVVDJJLRFRSULFDQQD 8  
8 Fascetta bloccaggio tubi 4  
 &ROODUHDPXUR  - 
 9LWL 4 - 
 7DVVHOOL 4 - 
- 13 -
ITALIANO

,6758=,21,'862
/DPHVVDLQVHUYL]LRGHYHHVVHUHHVHJXLWD$FXUDGHO&HQWUR
$VVLVWHQ]D7HFQLFDDXWRUL]]DWR(GLONDPLQ &$7 SULPDDFFHQ-
VLRQHHFROODXGRQHOULVSHWWRGHOODQRUPD81,

'HWWDQRUPDLQGLFDOHRSHUD]LRQLGLFRQWUROORGDHVHJXLUHVXO
SRVWRQDOL]]DWHDGDFFHUWDUHLOFRUUHWWRIXQ]LRQDPHQWRGHO
sistema.

3ULPDGLDFFHQGHUH
3HUODSULPDDFFHQVLRQHLQGLVSHQVDELOHULYROJHUVLDOFHQWUR
DVVLVWHQ]DWHFQLFD(GLONDPLQGL]RQD &$7  SHULQIRUPD]LRQL
consultare il sito ZZZHGLONDPLQFRP) che tarer la stufa in
base al tipo di pellet e alle condizioni di installazione attivando
cos la garanzia.
J
/DPDQFDWDDFFHQVLRQHGDSDUWHGLXQ&$7DXWRUL]]DWRQRQ
SHUPHWWHD(GLONDPLQGLJDUDQWLUHLOFRUUHWWRIXQ]LRQDPQHWR

'XUDQWHOHSULPHDFFHQVLRQLVLSRVVRQRVYLOXSSDUHOHJJHULRGRUL
di vernice che scompariranno in breve tempo.

3ULPDGLDFFHQGHUHFRPXQTXHQHFHVVDULRYHULFDUH
La corretta installazione.
/DOLPHQWD]LRQHHOHWWULFD
La chiusura della porta, che deve essere a tenuta
La pulizia del crogiolo.
/DSUHVHQ]DVXOGLVSOD\GHOOLQGLFD]LRQHGLVWDQGE\ 
(data, potenza o temperatura lampeggiante).

&$5,&$0(172'(/3(//(71(/6(5%$72,2
,OFRSHUFKLRGHOVHUEDWRLRVLDSUHHVLFKLXGHDWWUDYHUVRLOSUD-
WLFRVLVWHPDDFOLNFODNPHGLDQWHXQDOHJJHUDSUHVVLRQHVXOOD
SDUWHDQWHULRUHGHOFRSHUFKLRLQJKLVD J 

ATTENZIONE :
utilizzare apposito guanto in dotazione se si carica la stufa
PHQWUHLQIXQ]LRQHHTXLQGLFDOGD

127$VXOFRPEXVWLELOH
Le stufe sono progettate e programmate per bruciare pellet di GLDPHWURPLOOLPHWUL
legno di diametro di 6 mm circa. OXQJKH]]DPDVVLPDPP
,OSHOOHWXQFRPEXVWLELOHFKHVLSUHVHQWDLQIRUPDGLSLFFROL XPLGLWPDVVLPD
cilindretti, ottenuti pressando segatura, ad alti valori, senza UHVDFDORULFDNFDONJDOPHQR
uso di collanti o altri materiali estranei. /XVRGLSHOOHWFRQGLYHUVHFDUDWWHULVWLFKHLPSOLFDODQHFHVVLW
(FRPPHUFLDOL]]DWRLQVDFFKHWWLGD.J GLXQDVSHFLFDWDUDWXUDGHOODWHUPRVWXIDDQDORJDDTXHOODFKH
3HU121FRPSURPHWWHUHLOIXQ]LRQDPHQWRGHOODVWXIDLQGL- IDLO&$7 FHQWURDVVLVWHQ]DWHFQLFD DOODqDFFHQVLRQH
VSHQVDELOH121EUXFLDUYLDOWUR /XVRGLSHOOHWQRQLGRQHLSXSURYRFDUHGLPLQX]LRQHGHO
/LPSLHJRGLDOWULPDWHULDOL OHJQDFRPSUHVD ULOHYDELOHGD rendimento; anomalie di funzionamento; blocchi per intasa-
analisi di laboratorio, implica la decadenza della garanzia. mento, sporcamento del vetro, incombusti,
(GLONDPLQKDSURJHWWDWRWHVWDWRHSURJUDPPDWRLSURSULSUR- 8QDVHPSOLFHDQDOLVLGHOSHOOHWSXHVVHUHFRQGRWWDYLVLYDPHQWH
dotti perch garantiscano le migliori prestazioni con pellet Buono: liscio, lunghezza regolare, poco polveroso.
delle seguenti caratteristiche: Scadente: con spaccature longitudinali e trasversali, molto
polveroso, lunghezza molto variabile e con presenza di corpi
estranei.
- 14 -
ITALIANO
,6758=,21,'862
Pannello sinottico
SHUDFFHQGHUHHVSHJQHUH WHQHUHSUHPXWRSHU HSHUXVFLUHGDOPHQGXUDQWHOHSURJUDPPD]LRQL

3UHPXWREUHYHPHQWHFRPPXWDODVWXIDGDIXQ]LRQDPHQWRPDQXDOHDIXQ]LRQDPHQWRDXWRPDWLFRPDQWHQHQGRORSUH-
PXWR WHQHUHSUHPXWRSHU SHUPHWWHGLDFFHGHUHDLYDULPHQGLSURJUDPPD]LRQH

per incrementare le diverse regolazioni

per decrementare le diverse regolazioni

$GRJQLSUHVVLRQHLQIRUPDODPHPRULDGHOODVFKHGDHOHWWURQLFDFKHVRQRVWDWLLQVHULWLQHOVHUEDWRLR.JXQDSUHVVLRQH
FRQWLQXDGLFDQFHOODL.JUHVLGXLRSUHFHGHQWHPHQWHLQVHULWL

3UHPXWREUHPHQWHFRPPXWDDOWHUQDWLYDPHQWHODYHQWLOD]LRQHGHOODVWXIDGDXQOLYHOORSLVLOHQ]LRVRGHQRPLQDWR
&RPIRUWDGXQOLYHOORSLHQHUJLFRGHQRPLQDWR7XUER

7RFFDUHLOFRUULVSRQGHQ]DGHLSXQWLOHGSHUVHOH]LRQDUHODSRWHQ]DGLODYRURGHVLGHUDWD
6LSXXWLOL]]DUHLQDOWHUQDWLYDOLPSRVWD]LRQHWUDGL]LRQDOHFKHDYYLHQHWUDPLWHOXWLOL]]RGHL
 WDVWL

5LHPSLPHQWRFRFOHD $FFHQVLRQHPDQXDOH
1HOFDVRVLVYXRWLFRPSOHWDPHQWHLOVHUEDWRLRGHOSHOOHW ,QFDVLGLWHPSHUDWXUDVRWWRLq&FKHQRQSHUPHWWDDOODUHVL-
necessario effettuare il riempimento della coclea premendo stenza elettrica di arroventarsi o di temporanea non funzionalit
FRQWHPSRUDQHDPHQWHLWDVWLH GDOWHOHFRPDQGRRGDOSDQ- GHOODUHVLVWHQ]DVWHVVDSRVVLELOHXVDUHSHUODFFHQVLRQHGHOOD
nello sinottico) per qualche secondo dopo di che, lasciati i tasti, GLDYROLQD,QWURGXUUHQHOFURJLRORXQFXEHWWRGLGLDYROLQDEHQ
DGLVSOD\FRPSDUHODVFULWWD5,&$5,&$ DFFHVDFKLXGHUHODSRUWDHSUHPHUHGDOSDQQHOORVLQRWWLFRR
/RSHUD]LRQHGDHVHJXLUVLSULPDGHOODFFHQVLRQHVHODVWXIDVL dal telecomando.
fermata per esaurimento del pellet.
(QRUPDOHFKHQHOVHUEDWRLRUHVWLXQDTXDQWLWUHVLGXDGLSHOOHW 5HJLPLGLIXQ]LRQDPHQWR
che la coclea non riesce ad aspirare. Manuale: OXWHQWHLPSRVWDODSRWHQ]DGLODYRURYROXWD
8QDYROWDDOPHVHDVSLUDUHFRPSOHWDPHQWHLOVHUEDWRLRSHU GDPLQLPDDPDVVLPD
HYLWDUHODFFXPXORGLUHVLGXLSROYHURVL $XWRPDWLFROXWHQWHLPSRVWDWUDPLWHWDVWRRGDOWHOHFR-
mando, la temperatura desiderata nella stanza, la stufa leg-
$FFHQVLRQHDXWRPDWLFD JHQGRODVWHVVDPRGXODODSRWHQ]DDOQHGLUDJJLXQJHUHOD
$VWXIDLQVWDQGE\SUHPHQGRSHULOWDVWR GDOSDQQHOOR WHPSHUDWXUDLPSRVWDWDSHUSRLSRVL]LRQDUVLLQSRWHQ]D
sinottico o dal telecomando) si avvia la procedura di accensio-
QHHYLHQHYLVXDOL]]DWDODVFULWWD$FFHQVLRQHHXQFRQWRDOOD )XQ]LRQDPHQWRPDQXDOHGDSDQQHOORVLQRWWLFRWHOHFRPDQGR
URYHVFLDLQVHFRQGL  /DIDVHGLDFFHQVLRQHQRQWXWWDYLD $VWXIDLQIXQ]LRQHRLQVWDQGE\SUHPHQGRXQDYROWDLOWDVWR
a tempo predeterminato: la sua durata automaticamente ab- 0(18GDSDQQHOORVLQRWWLFRWHOHFRPDQGRYLHQHYLVXDOL]]DWR
EUHYLDWDVHODVFKHGDULOHYDLOVXSHUDPHQWRGLDOFXQLWHVW'RSR DGLVSOD\ODVFULWWD3RWHQ]D FRQODSRWHQ]DLQFXLODVWXIDVWD
FLUFDPLQXWLFRPSDUHODDPPD ODYRUDQGR LOWDVWRGDWHOHFRPDQGRSRVVLELOHLQFUHPHQWDUH
ODSRWHQ]DGLIXQ]LRQDPHQWR GD3RWHQ]DD3RWHQ]D 

- 15 -
ITALIANO

,6758=,21,'862
)XQ]LRQDPHQWRDXWRPDWLFRGDSDQQHOORVLQRWWLFRWHOHFRPDQGR 8VDUHLOWDVWR0(18SHUYLVXDOL]]DUHLQRUGLQHLQYHUVR
3UHPHQGRLOWDVWR0(18YROWHVLFRPPXWDGDIXQ]LRQDPHQ 6HVLVHOH]LRQDqSURJUDPPDYLHQHYLVXDOL]]DWDORUDGHOOD
to manuale a funzionamento automatico regolando la tempera- accensione.
tura che si vuole raggiungere nel locale (per regolare la tempe- $GLVSOD\FRPSDUH$FFHVRRUHFRQLOWDVWRVL
UDWXUDGDq&Dq&XWLOL]]DUHLWDVWLHFROWHOHFRPDQGR  YDULDORUDHVLFRQIHUPDFRQ0(18
e la stufa regola la potenza di lavoro per raggiungerla. Se si $GLVSOD\FRPSDUH$FFHVVRPLQXWLFRQLOWDVWR
imposta una temperatura inferiore a quella del locale, la stufa VLYDULDQRLPLQXWLHVLFRQIHUPDFRQ0(18
ODYRUDLQ3RWHQ]D ,QPDQLHUDDQDORJDVLUHJRODORUDGHJOLVSHJQLPHQWL/D
conferma del programma viene data con la pressione del tasto
6SHJQLPHQWR 0(18TXDQGRVLOHJJH6DOYDWDJJLR2.VXOGLVSOD\
3HULOPDJJLRUFRQIRUWODVWXIDVLVSHJQHFRQLOYHQWLODWRUH &RQIHUPDQGR3URJUDPPDVHWWVLGRYUVFHJOLHUHLOJLRUQR
DULDDPELHQWHDOODVWHVVDSRWHQ]DLQFXLVWDYDODYRUDQGR nel quale eseguire la programmazione:
$VWXIDIXQ]LRQDQWHSUHPHQGRSHULOWDVWR GDSDQQHOOR /X0D0H*L9H6D'R
sinottico o dal telecomando) si avvia la procedura di spegni- 8QDYROWDVHOH]LRQDWRLOJLRUQRVFRUUHQGROLFRLWDVWLHH
mento e viene visualizzato il conto alla rovescia, variabile a FRQIHUPDQGRFROWDVWR0(18VLSURVHJXLUFRQODSURJUDP
seconda della potenza in cui si trovava quando stata avviata la PD]LRQHFRQODVWHVVDPRGDOLWFRQODTXDOHVLHVHJXHXQ3UR-
IDVHGLVSHJQLPHQWR/DIDVHGLVSHJQLPHQWR FKHKDORELHWWLYR JUDPPDJLRUQVFHJOLHQGRSHURJQLJLRUQRGHOODVHWWLPDQD
GLVSHJQHUHODDPPDQRQODVFLDUHLQFRPEXVWLQHOFURJLRORH se attivare una programmazione stabilendone numero di inter-
raffreddare la stufa) prevede : venti ed a quali orari.
,QWHUUX]LRQHFDGXWDSHOOHW in caso di errore in qualunque momento della programmazione
9HQWLOD]LRQHDWWLYDDOOLYHOORLQFXLODVWXIDVWDYDIXQ]LRQDQGR VLSXXVFLUHGDOSURJUDPPDVHQ]DVDOYDUHSUHPHQGRWDVWR
0RWRUHHVSXOVLRQHIXPLDWWLYR
1RQVWDFFDUHPDLODVSLQDGXUDQWHOHIDVLGLVSHJQLPHQWR 1RWDVXOODYDULDELOLWGHOODDPPD
(YHQWXDOLYDULD]LRQLGHOORVWDWRGHOODDPPDGLSHQGRQRGDO
Regolazione orologio tipo di pellet impiegato, nonch da una normale variabilit
3UHPHQGRSHULOWDVWR0(18HVHJXHQGRFRLWDVWLHOH GHOODDPPDGLFRPEXVWLELOHVROLGRHGDOOHSXOL]LHSHULRGLFKH
LQGLFD]LRQLGHOGLVSOD\VLDFFHGHDO0HQ2URORJLR del crogiolo che la stufa automaticamente esegue.
3HUPHWWHQGRGLLPSRVWDUHORURORJLRLQWHUQRDOODVFKHGDHOHW- 1%OHSXOL]LHDXWRPDWLFKHHVHJXLWHGDOODVWXIDQRQVRQRVRVWL-
WURQLFD3UHPHQGRVXFFHVVLYDPHQWHLOWDVWR0(18DSSDLRQR WXWLYHGHOODQHFHVVDULDDVSLUD]LRQHDIUHGGRGDSDUWHGHOOXWHQWH
LQVHTXHQ]DHSRVVRQRHVVHUHUHJRODWLLVHJXHQWLGDWL*LRUQR SULPDGHOODFFHQVLRQH 
0HVH$QQR2UD0LQXWL*LRUQRGHOODVHWWLPDQD
/DVFULWWD6DOYDWDJJLR"GDFRQIHUPDUHFRQ0(18SHUPHWWHGL Segnalazione riserva pellet
YHULFDUHOHVDWWH]]DGHOOHRSHUD]LRQLFRPSLXWHSULPDGLFRQ- La stufa dotata di funzione elettronica rilevamento di quantit
IHUPDUOH YLHQHDOORUDYLVXDOL]]DWRVXOGLVSOD\6DOYDWDJJLR2.  SHOOHW,OVLVWHPDGLULOHYDPHQWRSHOOHWLQWHJUDWRDOOLQWHUQR
della scheda elettronica permette alla stufa di monitorare in
3URJUDPPDWRUHGLDFFHQVLRQLHVSHJQLPHQWLRUDULGXUDQWH TXDOVLDVLPRPHQWRGXUDQWHLOIXQ]LRQDPHQWRTXDQWLNJPDQFD-
ODVHWWLPDQD QRDOOHVDXULPHQWRFDULFRGLSHOOHWHIIHWWXDWR
3UHPHQGRSHUVHFRQGLLOWDVWR0(18GDOWHOHFRPDQGRVL importante per il corretto funzionamento del sistema che alla
DFFHGHDOODUHJROD]LRQHGHOORURORJLRHSUHPHQGRLOWDVWRVL qDFFHVVLRQH FKHGHYHHVVHUHHVHJXLWDGDO&$7 YHQJDHIIHW-
accede alla funzione di programmazione oraria settimanale, tuato il seguente procedimento.
LGHQWLFDWDVXOGLVSOD\FRQODGHVFUL]LRQH3URJUDP212)) 3ULPDGLLQL]LDUHDGXWLOL]]DUHLOVLVWHPDGLULOHYDPHQWRSHOOHW
La programmazione permette di impostare un numero di ac- necessario caricare e consumare completamente un primo sac-
FHQVLRQLHVSHJQLPHQWLDOJLRUQR QRDXQPDVVLPRGLWUH LQ co di pellet, questo per ottenere un breve rodaggio del sistema
ognuno dei giorni della settimana. di caricamento.
&RQIHUPDQGRDGLVSOD\FROWDVWR0(18DSSDUHXQDGHOOH &DULFDUHTXLQGLNJGLSHOOHW
seguenti possibilit: 'RSRGLFKHSUHPHUHXQDYROWDLOWDVWRULVHUYDLQVHUHQGRFRV
1R3URJ QHVVXQSURJUDPPDLPSRVWDWR LQPHPRULDFKHVRQRVWDWLFDULFDWLNJ
3URJUDPPDJLRUQ XQLFRSURJUDPPDSHUWXWWLLJLRUQL 'DTXHVWRPRPHQWRVXOGLVSOD\YLVXDOL]]DWDODULPDQHQ]DGL
3URJUDPPDVHWW LPSRVWD]LRQHSHURJQLVLQJRORJLRUQR SHOOHWFRQLQGLFD]LRQHGHFUHVFHQWHLQNJ  
6LSDVVDGDOOXQDDOODOWUDFRLWDVWLH $GRJQLULFDULFDYDLQVHULWRLQPHPRULDLOTXDQWLWDWLYRGLSHOOHW
&RQIHUPDQGRFROWDVWR0(18OHRS]LRQH3URJUDPPD FDULFDWR3HUOLQVHULPHQWRLQPHPRULDVHODULFDULFDVDUGL
JLRUQVLDFFHGHDOODVFHOWDGHOQXPHURGLSURJUDPPL NJVXIFLHQWHSUHPHUHLOWDVWRFDULFRSHOOHWSHUTXDQWLW
DFFHQVLRQLVSHJQLPHQWL HVHJXLELOLLQXQJLRUQR GLYHUVHRLQFDVRGLHUURULVLSXLQGLFDUHLOTXDQWLWDWLYRDWWUD-
8WLOL]]DQGR3URJUDPPDJLRUQLOSURJUDPPDLLPSRVWDWRL verso il men riserva pellet come segue.
sar lo stesso per tutti i giorni della settimana. 3UHPHQGRSHULOWDVWR0(18VLYLVXDOL]]D6(77$**,
3UHPHQGRVXFFHVVLYDPHQWHVLSRVVRQRYLVXDOL]]DUH 3UHPHQGRLOWDVWRRFRQVHFXWLYDPHQWHVLYLVXDOL]]D5,-
1R3URJUDPPL 6(59$3(//(7
q3URJUDPPDJLRUQ XQDDFFHQVLRQHHXQRVSHJQLPHQWRDOJLRU- &RQIHUPDQGRFRQLOWDVWR0(18FRPSDUHLOTXDQWLWDWLYRGL
QR q3URJUDPPDJLRUQ LGHP q3URJUDPPDJLRUQ LGHP SHOOHWSUHVHQWHTXHOORFKHVLFDULFD GLGHIDXOWYDULDELOH
FRLWDVWL 

- 16 -
ITALIANO
,6758=,21,'862
3UHPHQGRLOWDVWRLQFUHPHQWRL.JGDLQVHULUHSUHPHQGRLO 5HJROD]LRQHGHOODWHPSHUDWXUDFRQWHUPRVWDWRHVWHUQR
tasto - li diminuisco, premendo ripetutamente il tasto - raggiun- 'LVSRQLELOHXQVLVWHPDGLFRQWUROORGHOODWHPSHUDWXUDDPELHQWH
JRLOFDULFR.J 5DGLVSOD\ FKHSHUPHWWHGLFDQFHOODUHLO alternativo al telecomando, infatti possibile collegare alla por-
carico residuo. ta seriale il proprio termostato ambiente di casa oppure uno
1HOFDVRLOSHOOHWVLHVDXULVFDQHOVHUEDWRLRODVWXIDYDLQEORFFR qualsiasi (uscita in contatto pulito) di semplice reperibilit:
FRQODVFULWWD6WRS)LDPPD La stufa riconoscer automaticamente il collegamento alla
1%2JQLWDQWRULFRUGDUVLGLD]]HUDUHODVHJQDOD]LRQHULVHUYD porta seriale del termostato, osservando quindi le seguenti
SHOOHWLQPRGRGDSHUPHWWHUHXQDPLJOLRUHDIGDELOLWGHOOD condizioni:
funzione stessa. &RQWHPSHUDWXUDDPELHQWHLQIHULRUHDOOLPSRVWD]LRQHGHO
3HUTXDOVLDVLFKLDULPHQWRFRQWDWWDUHLO&HQWUR$VVLVWHQ]D7HFQL- termostato (contatto chiuso), la stufa modula normalmente le
FDDXWRUL]]DWR &$7 FKHKDHIIHWWXDWRODqDFFHQVLRQH potenze per inseguire il set di temperatura
6LWUDWWDGLXQULIHULPHQWRLQGLFDWLYR8QDPDJJLRUSUHFLVLRQHVL &RQWHPSHUDWXUDDPELHQWHUDJJLXQWDGDOWHUPRVWDWR FRQWDWWR
ottiene con un regolare azzeramento prima del nuovo carica- aperto), la stufa si porta in fase di stand-by.
PHQWR(GLONDPLQQRQULVSRQGHULQDOFXQPRGRGLYDULD]LRQL
ULVSHWWRDOOLQGLFDWR SXGLSHQGHUHGDIDWWRULHVWHUQL  7HPSHUDWXUD
1HVVXQD
7HPSHUDWXUD fornita da
5HJROD]LRQHWHPSHUDWXUDDPELHQWH regolazione
&RQJXUD]LRQH fornita da termostato
(impostazione
8QDFRQIRUWHYROHHVHPSOLFHUHJROD]LRQHSUHYLVWDGLVHULHLQ telecomando ambiente
di fabbrica)
questa linea di prodotti, permette di gestire la potenza della esterno
stufa in funzione della temperatura ambiente.
3DUDPHWUR
3UHYLDDWWLYD]LRQHGHOODIXQ]LRQH&RPIRUW&OLPDGDOPHQ &RPIRUW 21 21 2))
SDUDPHWUL ULFKLHGHUHDO&$7 SRVVLDPRXWLOL]]DUHGHWWDIXQ- &OLPD
zione per spegnere la stufa al raggiungimento della temperatura
impostata. 3DUDPHWUR
7DOHIXQ]LRQDOLWDEELQDWDDODOOLPSRVWD]LRQHGHOODVWXIDLQ 21 2)) 21
6RQGD,5
$8720$7,&2LOIXQ]LRQDPHQWRLQPRGDOLW0$18$/(
rimarr in ogni caso invariato. &ROOHJDPHQWR 12 6, 12
'RSRODELOLWD]LRQHHVHJXLWDGDO&$7SRVVLELOHDWWLYDUHGL- alla porta nessun con cavo nessun
VDWWLYDUHODIXQ]LRQH&RPIRUWFOLPDGDOPHQXWHQWHSUHPHUHLO seriale collegamento seriale blu collegamento
WDVWR6(7FHUFDUHLOPHQ&RPIRUWFOLPDFRQLWDVWL
VHOH]LRQDUORFRQLOWDVWR6(7LPSRVWDUH212))FRQLWDVWL
VDOYDUHOLPSRVWD]LRQHGHVLGHUDWDXVFHQGRFRQLOWDVWR

)XQ]LRQDPHQWR&RPIRUWFOLPD21
/DVWXIDTXDQGRSRVWDLQ$8720$7,&2PRGXODODVXD
SRWHQ]DLQVHJXHQGRODWHPSHUDWXUDLPSRVWDWDGDOOXWHQWHDO
raggiungimento della temperatura ambiente la stufa si spe-
gne, per poi riaccendersi autonomamente allo riscendere della
temperatura.
6HOH]LRQHWHPSHUDWXUD,QPRGDOLW&RPIRUWFOLPDSUHPHQGR
LWDVWLVXOSDQQHOORVLQRWWLFRRVXOWHOHFRPDQGRVLLPSRVWDD
display la temperatura desiderata in ambiente, avremo quindi le
seguenti situazioni:
&RQWHPSHUDWXUDDPELHQWHLQIHULRUHDOOLPSRVWD]LRQHODVWXID
si accende in autonomia modulando in automatico la potenza.
&RQWHPSHUDWXUDDPELHQWHUDJJLXQWD q& ODVWXIDVLSRUWD
in fase di stand-by
- La temperatura ambiente viene trasmessa dal telecomando
in dotazione; il trasmettitore del telecomando deve trovarsi in
allineamento visivo con il ricevitore del panello sinottico.
1HOFDVRLQFXLDFDXVDGLXQQRQFRUUHWWRSRVL]LRQDPHQWRGHO
WHOHFRPDQGRQRQDYYHQJDOLQYLRGHOODWHPSHUDWXUDUHJLVWUDWD
GDOORVWHVVRODVWXIDGHFLGHDXWRQRPDPHQWHGLSDVVDUHDOOXWL-
lizzo della sonda di temperatura installata a bordo, questo sino
a quando non si ripristini il collegamento con il telecomando.

- 17 -
ITALIANO

,6758=,21,'862
7(/(&20$1'2FRG

Legenda tasti e display:


WDVWRDFFHQVLRQHVSHJQLPHQWR
+ WDVWRSHULQFUHPHQWDUHODSRWHQ]DWHPSHUDWXUDGLODYRUR DOOLQWHUQRGLXQPHQLQFUHPHQWDODYDULDELOHYLVXDOL]]DWD
- WDVWRSHUGHFUHPHQWDUHODSRWHQ]DWHPSHUDWXUDGLODYRUR DOOLQWHUQRGLXQPHQGHFUHPHQWDODYDULDELOHYLVXDOL]]DWD
A : tasto per passare alla programmazione EASY TIMER
M : tasto per passare alternativamente dalla funzione automatica a quella manuale e viceversa

,QGLFDXQDWUDVPLVVLRQHGLGDWLGDOWHOHFRPDQGRDOODVFKHGD

WDVWLHUDEORFFDWDHYLWDDWWLYD]LRQLLQGHVLGHUDWH SUHPHUH$
H0LQFRQWHPSRUDQHDSHUTXDOFKHVHFRQGRSHUEORFFDUHR
sbloccare la tastiera)
EDWWHULDVFDULFD QqSLOHDONDOLQHPLQLVWLOR$$$

,QGLFDFKHVLVWDLPSRVWDQGRXQDFFHQVLRQHVSHJQLPHQWRFRQLO
programma EASY TIMER

,QGLFDODWHPSHUDWXUDDPELHQWHULOHYDWDGDOWHOHFRPDQGR GXUDQ-
WHODFRQJXUD]LRQHWHFQLFDGHOWHOHFRPDQGRLQGLFDLYDORULGHL
parametri settati).

,QGLFDFKHVWDWRWUDVPHVVRXQRUGLQHGLDFFHQVLRQHDOODVWXID

LQGLFDWRUHVHWWDJJLRWHOHFRPDQGRSHUXQDVWXIDDSHOOHWDULD

funzione automatica
(appare sul display il valore della temperatura)

funzione di regolazione manuale


(appare sul display il valore della potenza di lavoro)

7(03(5$785$5,/(9$7$'$/7(/(&20$1'2
,OWHOHFRPDQGRGRWDWRGLVRQGDLQWHUQDSHULOULOHYDPHQWRGHOODWHPSHUDWXUDDPELHQWHYLVXDOL]]DWDLQWHPSRUHDOHVXOGLVSOD\GHOOR
stesso. La temperatura rilevata viene trasmessa periodicamente alla scheda elettronica della stufa se il led trasmettitore del teleco-
mando ed il sensore ricevente del pannello sinottico della stufa si trovano reciprocamente in campo visivo.
6HODWHPSHUDWXUDGHOWHOHFRPDQGRQRQJLXQJHDOODVFKHGDGHOODVWXIDSHUXQWHPSRVXSHULRUHDPLQXWLVLXWLOL]]DLOGDWRGHOOD
temperatura proveniente dalla sonda collegata nel pannello sinottico.

6(/(=,21(02'$/,7$)81=,21$0(172
&RQODSUHVVLRQHEUHYHGHOWDVWR0SRVVLDPRVFRUUHUHHUHJRODUHOHVHJXHQWLIXQ]LRQL
regolazione automatica della potenza

regolazione manuale della potenza

- 18 -
ITALIANO
,6758=,21,'862
87,/,==2'(/352*5$00$($6<7,0(5
7UDPLWHLOWHOHFRPDQGRSRVVLELOHXWLOL]]DUHSURJUDPPD]LRQHRUDULDPROWRLQWXLWLYDHYHORFH
- 6HODVWXIDDFFHVD possibile impostare uno spegnimento con un posticipo regolabile tra una e dodici ore; nel display del
pannello sinottico verr visualizzato il tempo mancante allo spegnimento programmato.
- 6HODVWXIDVSHQWDSRVVLELOHLPSRVWDUHXQDFFHQVLRQHFRQXQSRVWLFLSRUHJRODELOHWUDXQDHGRGLFLRUHQHOGLVSOD\GHOSDQQHO-
ORVLQRWWLFRYHUUYLVXDOL]]DWRLOWHPSRPDQFDQWHDOODFFHVVLRQHSURJUDPPDWD

- ,PSRVWD]LRQH: per impostare il timer proseguire come segue:


D 3UHPHUHLOWDVWR$VLDFFHQGHVXOGLVSOD\OLFRQD FRQIHUPDQGRODFFHVVRDOODSURJUDPPD]LRQH(DV\WLPHU
E &RQLWDVWLLPSRVWDUHLOQXPHURGLRUHGHVLGHUDWRHVHPSLR

F 3XQWDUHLOWHOHFRPDQGRYHUVRLOULFHYLWRUHGHOSDQQHOORVLQRWWLFR
G &RQIHUPDUHODSURJUDPPD]LRQHSUHPHQGRLOWDVWR$SHUXQSDLRGLVHFRQGLVLVSHJQHUOLFRQD apparir sul pannello
VLQRWWLFROLQGLFD]LRQHGHOWHPSRPDQFDQWHSHUOLQWHUYHQWRSURJUDPPDWR

H 3HUDQQXOODUHODSURJUDPPD]LRQHULSHWHUHLLSXQWLD E F G LPSRVWDQGRLOQXPHURGLRUHD+

BLOCCO TASTIERA
(SRVVLELOHEORFFDUHODWDVWLHUDGHOWHOHFRPDQGRSHUHYLWDUHDWWLYD]LRQLDFFLGHQWDOLQRQFRQWUROODWHGDOOXWHQWH
3UHPHQGRFRQWHPSRUDQHDPHQWHLWDVWL$H0VLDFFHQGHULOVLPERORGHOODFKLDYHDFRQIHUPDGHOEORFFRWDVWLHUDDYYHQXWR
3HUVEORFFDUHODWDVWLHUDSUHPHUHQXRYDPHQWHLWDVWL$H0VLPXOWDQHDPHQWH

,1',&$=,21(%$77(5,(6&$5,&+(
/DFFHQVLRQHGHOOLFRQDGHOODEDWWHULDLQGLFDFKHOHSLOHLQWHUQHDOWHOHFRPDQGRVRQRTXDVLHVDXULWHSURYYHGHUHDOODORURVRVWLWX]LR-
QHFRQWUHHOHPHQWLGHOORVWHVVRPRGHOOR VL]H$$$9 
1RQPHVFRODUHQHOWHOHFRPDQGREDWWHULHQXRYHFRQEDWWHULHSDU]LDOPHQWHXVDWH
1RQPHVFRODUHPDUFKHHWLSLGLYHUVLSRLFKRJQLWLSRHPDUFDKDGLIIHUHQWLFDSDFLW
1RQPHVFRODUHSLOHWUDGL]LRQDOLHULFDULFDELOL
1RQFHUFDUHGLULFDULFDUHSLOHDOFDOLQHH]LQFRFDUERQHSRLFKVLSRWUHEEHURSURYRFDUHURWWXUHRIXRULXVFLWHGLOLTXLGR

INFORMAZIONI AGLI UTENTI


$LVHQVLGHOODUWGHOGHFUHWROHJLVODWLYROXJOLRQ$WWXD]LRQHGHOOH'LUHWWLYH&(&(H
&(UHODWLYHDOODULGX]LRQHGHOOXVRGLVRVWDQ]HSHULFRORVHQHOOHDSSDUHFFKLDWXUHHOHWWULFKHHGHOHWWURQLFKHQRQFKDOOR
VPDOWLPHQWRGHLULXWL,OVLPERORGHOFDVVRQHWWREDUUDWRULSRUWDWRVXOODSSDUHFFKLDWXUDRVXOODFRQIH]LRQHLQGLFDFKHLOSURGRWWR
DOODQHGHOODSURSULDYLWDXWLOHGHYHHVVHUHUDFFROWRVHSDUDWDPHQWHGDJOLDOWULULXWL/XWHQWHGRYUSHUWDQWRFRQIHULUHODSSD-
UHFFKLDWXUDJLXQWDDQHYLWDDJOLLGRQHLFHQWULGLUDFFROWDGLIIHUHQ]LDWDGHLULXWLHOHWWURQLFLHGHOHWWURWHFQLFLRSSXUHULFRQVHJQDU-
ODDOULYHQGLWRUHDOPRPHQWRGHOODFTXLVWRGLXQDQXRYDDSSDUHFFKLDWXUDGLWLSRHTXLYDOHQWHLQUDJLRQHGLXQRDXQR
- 19 -
ITALIANO

MANUTENZIONE
3ULPDGLHIIHWWXDUHTXDOVLDVLPDQXWHQ]LRQHVFROOHJDUHODSSDUHFFKLRGDOODUHWHGLDOLPHQWD]LRQHHOHWWULFD

8QDUHJRODUHPDQXWHQ]LRQHDOODEDVHGHOEXRQIXQ]LRQDPHQWRGHOODVWXID
/$0$1&$7$0$187(1=,21(121SHUPHWWHDOODVWXIDGLIXQ]LRQDUHUHJRODUPHQWH
(YHQWXDOLSUREOHPLGRYXWLDOODPDQFDWDPDQXWHQ]LRQHFDXVHUDQQRODGHFDGHQ]DGHOODJDUDQ]LD

127$2JQLNJGLSHOOHWEUXFLDWRFRPSDUHODVFULWWD0DQXWHQ]BLRQHSHUULFRUGDUHODSXOL]LDGHLFDQDOLIXPRDFXUD
GHOSULYDWRLOPHVVDJJLRVFRPSDUHSUHPHQGRSHUVHFRQGLLOWDVWR785%2
$OUDJJLXQJLPHQWRGHLNJGLSHOOHWEUXFLDWRFRPSDUHODVFULWWD0DQXWHQ]BLRQH&$7FKHQRQVFRPSDUHSLHG
TXLQGLQHFHVVDULROLQWHUYHQWRGLXQFHQWURDVVLVWHQ]DWHFQLFD(GLONDPLQ &$7 
7DOHPHVVDJJLRVLUHVHWWDGDOPHQSDUDPHWUL

N.B.:
(YLHWDWDRJQLPRGLFDQRQDXWRUL]]DWD
8WLOL]]DUHSH]]LGLULFDPELRUDFFRPDQGDWLGDOFRVWUXWWRUH
/LPSLHJRGLFRPSRQHQWLQRQRULJLQDOLLPSOLFDODGHFDGHQ]DGHOODJDUDQ]LD

MANUTENZIONE GIORNALIERA
2SHUD]LRQLGDHVHJXLUHDVWXIDVSHQWDIUHGGDHVFROOHJDWDGDOODUHWHHOHWWULFD
'HYHHVVHUHHIIHWWXDWDFRQODLXWRGLXQDVSLUDSROYHUH YHGLRSWLRQDOSDJ 
/LQWHUDSURFHGXUDULFKLHGHSRFKLPLQXWL
$SULUHODQWLQDHGHVWUDUUHHVYXRWDUHLOFDVVHWWRFHQHUH J% 
1216&$5,&$5(,5(6,'8,1(/6(5%$72,2'(/3(//(7
$VSLUDUHDOOLQWHUQRGHOORVSRUWHOORLOSLDQRIXRFRLOYDQRDWWRUQRDOFURJLRORGRYHFDGHODFHQHUH
7RJOLHUHLOFURJLROR J& HVFURVWDUORFRQODVSDWROLQD LQGRWD]LRQH SXOLUHHYHQWXDOLRFFOXVLRQLGHOOHDVROH
$VSLUDUHLOYDQRFURJLRORSXOLUHLERUGLGLFRQWDWWR
6HQHFHVVDULRSXOLUHLOYHWUR DIUHGGR

1RQDVSLUDUHPDLODFHQHUHFDOGDFRPSURPHWWHODVSLUDWRUHLPSLHJDWRFRQSRVVLELOHULVFKLRGLLQFHQGLR

**
J% J&
MANUTENZIONE SETTIMANALE
3XOL]LDGHOIRFRODUH FRQVFRYROR GRSRDYHUWROWRLOGHYLDWRUHIXPR J'( 
$JLUHVXJOLVFRYROL J( 
6YXRWDUHLOVHUEDWRLRSHOOHWHDVSLUDUQHLOIRQGR 
'XUDQWHODSXOL]LDGHOFURJLRORVROOHYDUHLWDSSLIXPR J) HDVSLUDUHLTXDWWURWXELVRWWRVWDQWL J) 

 


* 2
2
J' J( J)
- 20 -
ITALIANO
MANUTENZIONE
MANUTENZIONE STAGIONALE DFXUDGHO&$7FHQWURDVVLVWHQ]DWHFQLFD(GLONDPLQ
3XOL]LDJHQHUDOHLQWHUQDHGHVWHUQD
3XOL]LDDFFXUDWDGHLWXELGLVFDPELR
3XOL]LDDFFXUDWDHGLVLQFURVWD]LRQHGHOFURJLRORHGHOUHODWLYRYDQR
3XOL]LDYHQWLODWRULYHULFDPHFFDQLFDGHLJLRFKLHGHLVVDJJL
3XOL]LDFDQDOHGDIXPR VRVWLWX]LRQHGHOODJXDUQL]LRQHVXOWXERVFDULFRIXPL 
3XOL]LDFRQGRWWRIXPL YHGLSXOL]LDVHWWLPDQDOH 
3XOL]LDGHOYDQRYHQWLODWRUHHVWUD]LRQHIXPL
3XOL]LDVHQVRUHGLXVVR
&RQWUROORWHUPRFRSSLD
3XOL]LDLVSH]LRQHHGLVLQFURVWD]LRQHGHOYDQRGHOODUHVLVWHQ]DGLDFFHQVLRQHHYHQWXDOHVRVWLWX]LRQHGHOODVWHVVD
3XOL]LDFRQWUROORGHOSDQQHOORVLQRWWLFR
,VSH]LRQHYLVLYDGHLFDYLHOHWWULFLGHOOHFRQQHVVLRQL
3XOL]LDVHUEDWRLRSHOOHWHYHULFDJLRFKLDVVLHPHFRFOHDPRWRULGXWWRUH
6RVWLWX]LRQHGHOODJXDUQL]LRQHSRUWHOOR
&ROODXGRIXQ]LRQDOHFDULFDPHQWRFRFOHDDFFHQVLRQHIXQ]LRQDPHQWRSHUPLQXWLHVSHJQLPHQWR

,QFDVRGLXQXVRPROWRIUHTXHQWHGHOODVWXIDVLFRQVLJOLDODSXOL]LDGHOFDQDOHGDIXPRRJQLPHVL

ATTENZIONE !!!
'RSRODQRUPDOHSXOL]LDLO121&255(772DFFRSSLDPHQWRGHOFURJLRORVXSHULRUH $  J con il crogiolo inferiore
(B) J SXFRPSURPHWWHUHLOIXQ]LRQDPHQWRGHOODVWXID
4XLQGLSULPDGHOODFFHQVLRQHGHOODVWXIDDVVLFXUDUVLFKHLFURJLROLVLDQRDFFRSSLDWLFRUUHWWDPHQWHFRPHLQGLFDWRLQ J 
VHQ]DSUHVHQ]DGLFHQHUHRLQFRPEXVWLVXOSHULPHWURGLDSSRJJLR

J J

- 21 -
ITALIANO

3266,%,/,,1&219(1,(17,
,QFDVRGLSUREOHPLODVWXIDVLDUUHVWDDXWRPDWLFDPHQWHHVHJXHQGRORSHUD]LRQHGLVSHJQLPHQWRHVXOGLVSOD\VLYLVXDOL]]D
XQDVFULWWDUHODWLYDDOODPRWLYD]LRQHGHOORVSHJQLPHQWR YHGLVRWWROHYDULHVHJQDOD]LRQL 

1RQVWDFFDUHPDLODVSLQDGXUDQWHODIDVHGLVSHJQLPHQWRSHUEORFFR

1HOFDVRGLDYYHQXWREORFFRSHUULDYYLDUHODVWXIDQHFHVVDULRODVFLDUDYYHQLUHODSURFHGXUDGLVSHJQLPHQWR PLQXWL
FRQULVFRQWURVRQRUR HTXLQGLSUHPHUHLOWDVWR

1RQULDFFHQGHUHODVWXIDSULPDGLDYHUYHULFDWRODFDXVDGHOEORFFRH5,38/,7269827$72LOFURJLROR

6(*1$/$=,21,',(9(178$/,&$86(',%/2&&2(,1',&$=,21,(5,0(',
 6HJQDOD]LRQH9HULFDXDULD LQWHUYLHQHVHLOVHQVRUHGLXVVRULOHYDXVVRDULDFRPEXUHQWHLQVXIFLHQWH 
,QFRQYHQLHQWH6SHJQLPHQWRSHUPDQFDQ]DGHSUHVVLRQH
,OXVVRSXHVVHUHLQVXIFLHQWHVHFSRUWHOORDSHUWRRWHQXWDQRQSHUIHWWDGHOSRUWHOORVWHVVR HVJXDUQL]LR
 QH VHFSUREOHPDGLDVSLUD]LRQHDULDRGLHVSXOVLRQHIXPLRSSXUHFURJLRORLQWDVDWRRSSXUHVHQVRUHGL
 XVVRVSRUFR SXOLUHFRQDULDVHFFD
Azioni: &RQWUROODUH
  FKLXVXUDSRUWHOOR
  FDQDOHGLDVSLUD]LRQHDULDFRPEXUHQWH SXOLUHIDFHQGRDWWHQ]LRQHDJOLHOHPHQWLGHOVHQVRUHGLXVVR 
  SXOLUHLOVHQVRUHGLXVVRFRQDULDVHFFD WLSRSHUWDVWLHUDGL3&
  SRVL]LRQHVWXIDQRQGHYHHVVHUHDGGRVVDWDDOPXUR
  SRVL]LRQHHSXOL]LDFURJLROR FRQIUHTXHQ]DOHJDWDDOWLSRGLSHOOHW
  FDQDOHGDIXPR SXOLUH
  LQVWDOOD]LRQH VHQRQDQRUPDHSUHVHQWDSLGLFXUYHORVFDULFRIXPLQRQUHJRODUH
Se si sospetta un malfunzionamento del sensore, fare collaudo a freddo. Se variando le condizioni, aprendo il
portello ad esempio, il valore visualizzato non cambia, un problema di sensore.

N.B.:/DOODUPHGHSUHVVLRQHSXYHULFDUVLDQFKHGXUDQWHODIDVHGLDFFHQVLRQHLQTXDQWRLOVHQVRUHGLXVVRLQL]LD
 DPRQLWRUDUHGDOGRSRORVWDUWFLFORDFFHQVLRQH

 6HJQDOD]LRQH9HULFDHVWUDWW LQWHUYLHQHVHLOVHQVRUHJLULHVWUDWWRUHIXPLULOHYDXQDQRPDOLD
,QFRQYHQLHQWH6SHJQLPHQWRSHUULOHYD]LRQHDQRPDOLDJLULHVWUDWWRUHIXPL
Azioni: 9HULFDUHIXQ]LRQDOLWHVWUDWWRUHIXPL FROOHJDPHQWRVHQVRUHGLJLUL  &$7
  9HULFDUHSXOL]LDFDQDOHGDIXPR
  9HULFDUHLPSLDQWRHOHWWULFR PHVVDDWHUUD
  9HULFDUHVFKHGDHOHWWURQLFD &$7

 6HJQDOD]LRQH6WRS)LDPPD(interviene se la termocoppia rileva una temperatura fumi inferiore a un valore


  LPSRVWDWRLQWHUSUHWDQGRFLFRPHDVVHQ]DGLDPPD 
,QFRQYHQLHQWH6SHJQLPHQWRSHUFUROORWHPSHUDWXUDIXPL
Azioni: /DDPPDSXHVVHUHPDQFDWDSHUFK
 9HULFDUHPDQFDQ]DSHOOHWQHOVHUEDWRLR
 9HULFDUHVHWURSSRSHOOHWKDVRIIRFDWRODDPPDYHULFDUHTXDOLWSHOOHW &$7
 9HULFDUHVHLQWHUYHQXWRLOWHUPRVWDWRGLPDVVLPD FDVRUDURSHUFKFRUULVSRQGHUHEEHDG2YHU
WHPSHUDWXUDIXPL  &$7

 6HJQDOD]LRQH%ORFFR$)12$YYLR LQWHUYLHQHVHLQXQWHPSRPDVVLPRGLPLQXWLQRQFRPSDUHDPPDRQRQ
raggiunta la temperatura di avvio).
,QFRQYHQLHQWH6SHJQLPHQWRSHUWHPSHUDWXUDIXPLQRQFRUUHWWDLQIDVHGLDFFHQVLRQH
'LVWLQJXHUHLGXHFDVLVHJXHQWL
 121FRPSDUVDDPPD
Azioni: 9HULFDUHSRVL]LRQDPHQWRHSXOL]LDGHOFURJLROR
   IXQ]LRQDOLWUHVLVWHQ]DGLDFFHQVLRQH &$7
   WHPSHUDWXUDDPELHQWH VHLQIHULRUHq&VHUYHGLDYROLQD HXPLGLW
   3URYDUHDGDFFHQGHUHFRQGLDYROLQD YHGLSDJ 
  (FRPSDUVDDPPDPDGRSRODVFULWWD$YYLRFRPSDUVR%ORFFR$)12$YYLR
Azioni: 9HULFDUHIXQ]LRQDOLWWHUPRFRSSLD &$7
   WHPSHUDWXUDGLDYYLRLPSRVWDWDQHLSDUDPHWUL &$7 

 6HJQDOD]LRQH0DQFDWD(QHUJLD (non un difetto della stufa).


,QFRQYHQLHQWH6SHJQLPHQWRSHUPDQFDQ]DHQHUJLDHOHWWULFD
Azioni: 9HULFDUHDOODFFLDPHQWRHOHWWULFRHFDOLGLWHQVLRQH

 6HJQDOD]LRQH*XDVWR7& LQWHUYLHQHVHODWHUPRFRSSLDJXDVWDRVFROOHJDWD
,QFRQYHQLHQWH6SHJQLPHQWRSHUWHUPRFRSSLDJXDVWDRVFROOHJDWD
Azioni: 9HULFDUHFROOHJDPHQWRGHOODWHUPRFRSSLDDOODVFKHGDYHULFDUHIXQ]LRQDOLWQHOFROODXGRD
  IUHGGR &$7 
- 22 -
ITALIANO
3266,%,/,,1&219(1,(17,
 6HJQDOD]LRQHq&IXPLDOWD (spegnimento per eccessiva temperatura dei fumi)
,QFRQYHQLHQWH6SHJQLPHQWRSHUVXSHUDPHQWRWHPSHUDWXUDPDVVLPDIXPL
Azioni:9HULFDUHWLSRGLSHOOHW
  9HULFDUHDQRPDOLDPRWRUHHVWUD]LRQHIXPL
  9HULFDUHHVLVWHQ]DGLHYHQWXDOLRVWUX]LRQLVXOFDQDOHGDIXPR
  9HULFDUHFRUUHWWDLQVWDOOD]LRQH
  9HULFDUHHYHQWXDOHGHULYDGHOPRWRULGXWWRUH
  9HULFDUHHVLVWHQ]DSUHVDDULDQHOORFDOH

 Segnalazione: ALLARME CORRENTE ALTA:,QWHUYLHQHTXDQGRYLHQHULOHYDWRXQDQRPDORHGHFFHVVLYR


assorbimento di corrente del motoriduttore.
Azioni: 9HULFDUHIXQ]LRQDPHQWR &$7 PRWRULGXWWRUH&ROOHJDPHQWLHOHWWULFLHVFKHGDHOHWWURQLFD

 Segnalazione: ALLARME CORRENTE BASSA:,QWHUYLHQHTXDQGRYLHQHULOHYDWRXQDQRPDORHGLQVXIFHQWH


assorbimento di corrente del motoriduttore.
Azioni: 9HULFDUHIXQ]LRQDPHQWR &$7 PRWRULGXWWRUHSUHVVRVWDWRWHUPRVWDWRVHUEDWRLRFROOHJDPHQWLHOHWWULFLH
scheda elettronica

 6HJQDOD]LRQH&RQWURO%DWWHULD
,QFRQYHQLHQWH/DVWXIDQRQVLIHUPDPDDSSDUHODVFULWWDDGLVSOD\
Azioni: 'HYHHVVHUHVRVWLWXLWDODEDWWHULDWDPSRQHVXOODVFKHGD
Si ricorda che un componente soggetto ad usura e quindi non coperto da garanzia.

 ,QFRQYHQLHQWH7HOHFRPDQGRLQHIFLHQWH
Azioni: DYYLFLQDUVLDOULFHWWRUHGHOODVWXID
  FRQWUROODUHHQHOFDVRFDPELDUHODSLOD

12) Inconveniente: Aria in uscita non calda:


Azioni: SXOLUHORVFDPELDWRUHGDOOLQWHUQRGHOIRFRODUHXWLOL]]DQGROHDSSRVLWHDVWH

 ,QFRQYHQLHQWH'XUDQWHODIDVHGLDFFHQVLRQHVDOWDLOGLIIHUHQ]LDOH SHULO&HQWUR$VVLVWHQ]D7HFQLFD&$7
Azioni: 9HULFDUHXPLGLWGHOODUHVLVWHQ]DGLDFFHQVLRQH

 ,QFRQYHQLHQWH0DQFDWDDFFHQVLRQH
Azioni: 3XOLUHFURJLROR

NOTA
7XWWHOHVHJQDOD]LRQLUHVWDQRYLVXDOL]]DWHQRDFKHQRQVLLQWHUYLHQHVXOSDQQHOORSUHPHQGRLOWDVWR
6LUDFFRPDQGDGLQRQIDUULSDUWLUHODVWXIDSULPDGLDYHUYHULFDWROHOLPLQD]LRQHGHOSUREOHPD

N.B.:
I comignoli e condotti di fumo ai quali sono collegati gli apparecchi utilizzatori di combustibili solidi devono venire puliti una
YROWDDOODQQR YHULFDUHVHQHOODSURSULDQD]LRQHHVLVWHXQDQRUPDWLYDDOULJXDUGR 

Nel caso di omissioni di regolari controlli e la pulizia, si aumenta la probabilit di un incendio del comignolo.

IMPORTANTE !!!
Nel caso si manifestasse un principio di incendio nella stufa, nel canale da fumo o nel camino, procedere come segue:
- Staccare alimentazione elettrica
- Intervenire con estintore ad anidride carbonica CO2
- Richiedere lintervento dei Vigili del fuoco

NON TENTARE DI SPEGNERE IL FUOCO CON ACQUA!

6XFFHVVLYDPHQWHULFKLHGHUHODYHULFDGHOODSSDUUHFFKLRGDSDUWHGLXQ&HQWURGL$VVLVWHQ]D7HFQLFD$XWRUL]]DWR &$7 HIDU


YHULFDUHLOFDPLQRGDXQWHFQLFRDXWRUL]]DWR

- 23 -
ITALIANO

&+(&./,67
'DLQWHJUDUHFRQODOHWWXUDFRPSOHWDGHOODVFKHGDWHFQLFD
Posa e installazione
 0HVVDLQVHUYL]LRHIIHWWXDWDGD&$7DELOLWDWRFKHKDULODVFLDWRODJDUDQ]LD
 $HUD]LRQHQHOORFDOH
 ,OFDQDOHGDIXPRODFDQQDIXPDULDULFHYHVRORORVFDULFRGHOODVWXID
 ,OFDQDOHGDIXPRSUHVHQWDPDVVLPRFXUYH
    PDVVLPRPHWULLQRUL]]RQWDOH
 FRPLJQRORROWUHOD]RQDGLUHXVVR
 LWXELGLVFDULFRVRQRLQPDWHULDOHLGRQHR FRQVLJOLDWRDFFLDLRLQR[
 QHOODWWUDYHUVDPHQWRGLHYHQWXDOLPDWHULDOLLQDPPDELOL HVOHJQR VRQRVWDWHSUHVHWXWWHOH
precauzioni per evitare incendi

Uso
 ,OSHOOHWXWLOL]]DWRGLEXRQDTXDOLWHQRQXPLGR
 ,OFURJLRORHLOYDQRFHQHUHVRQRSXOLWLHEHQSRVL]LRQDWL
 ,OSRUWHOOREHQFKLXVR
 ,OFURJLROREHQLQVHULWRQHOODSSRVLWRYDQR

5,&25'$56,GL$63,5$5(LO&52*,2/235,0$',2*1,$&&(16,21(
,QFDVRGLIDOOLWDDFFHQVLRQH121ULSHWHUHODFFHQVLRQHSULPDGLDYHUHVYXRWDWRLOFURJLROR

OPTIONAL
&20%,1$725(7(/()21,&23(5$&&(16,21($',67$1=$ FRG
(SRVVLELOHRWWHQHUHODFFHQVLRQHDGLVWDQ]DIDFHQGRFROOHJDUHGDO&$7 FHQWURDVVLVWHQ]DWHFQLFD LOFRPELQDWRUHWHOHIRQLFRDOODSRUWD
VHULDOHGLHWURODVWXIDWUDPLWHFDYHWWRRSWLRQDO FRG

.,7SHUODFDQDOL]]D]LRQHDULDFDOGDLQ1qORFDOHDWWLJXRFRQOXQJKH]]DGHOWXERGLFDQDOL]]D]LRQHPD[PW FRG 

.,7%,6SHUODFDQDOL]]D]LRQHDULDFDOGDLQ1qORFDOHQRQDWWLJXRFRQOXQJKH]]DGHOWXERGLFDQDOL]]D]LRQHPD[PW
FRG 

ACCESSORI PER LA PULIZIA


*ODVV.DPLQ FRG %LGRQHDVSLUDFHQHUHVHQ]DPRWRUH
8WLOHSHUODSXOL]LDGHOYHWURFHUDPLFR FRG
8WLOHSHUODSXOL]LDGHOIRFRODUH

- 24 -
Dear Sir/Madam
&RQJUDWXODWLRQVDQGWKDQN\RXIRUFKRRVLQJRXUSURGXFW
3OHDVHUHDGWKLVGRFXPHQWFDUHIXOO\EHIRUH\RXXVHWKLVSURGXFWLQRUGHUWRREWDLQWKHEHVWSHUIRUPDQFHLQFRPSOHWH
VDIHW\
)RUIXUWKHUGHWDLOVRUDVVLVWDQFHSOHDVHFRQWDFWWKH'($/(5ZKHUH\RXSXUFKDVHGWKHSURGXFWRUYLVLWRXUZHEVLWH
www.edilkamin.com. and click on DEALERS.

ENGLISH
NOTE
$IWHUKDYLQJXQSDFNHGWKHVWRYHHQVXUHWKDWLWVFRQWHQWVDUHFRPSOHWHDQGLQWDFW FODGGLQJUHPRWHFRQWUROZLWKGLVSOD\cold
KDQGKDQGOHIRURSHQLQJGRRUJXDUDQWHHERRNOHWJORYH&'WHFKQLFDOGDWDVKHHWVSDWXODGHKXPLGLI\LQJVDOWDOOHQZUHQFK 

,QFDVHRIDQRPDOLHVSOHDVHFRQWDFWWKHGHDOHUZKHUH\RXSXUFKDVHGWKHSURGXFWLPPHGLDWHO\
<RXZLOOQHHGWRSUHVHQWDFRS\RIWKHZDUUDQW\ERRNOHWDQGYDOLGSURRIRISXUFKDVH

- Commissioning/ testing
&RPPLVVLRQLQJDQGWHVWLQJPXVWEHSHUIRUPHGE\WKH'($/(5)DLOXUHWRGRVRZLOOYRLGWKHZDUUDQW\
&RPPLVVLRQLQJDVVSHFLHGLQVWDQGDUG81,FRQVLVWVLQDVHULHVLQVSHFWLRQVWREHSHUIRUPHGZLWKWKHLQVHUWLQVWDOOHG
LQRUGHUWRDVFHUWDLQWKHFRUUHFWRSHUDWLRQRIWKHV\VWHPDQGLWVFRPSOLDQFHWRDSSOLFDEOHUHJXODWLRQV
.
,QFRUUHFWLQVWDOODWLRQLQFRUUHFWPDLQWHQDQFHRULPSURSHUXVHRIWKHSURGXFWVKDOOUHOLHYHWKHPDQXIDFWXUHUIURPDQ\GDPDJH
UHVXOWLQJIURPWKHXVHRIWKLVSURGXFW

WKHSURRIRISXUFKDVHWDJQHFHVVDU\IRULGHQWLI\LQJWKHLQVHUWLVORFDWHG
RQWKHWRSRIWKHSDFNDJH
LQWKHZDUUDQW\ERRNOHWIRXQGLQVLGHWKHUHER[
RQWKH,'SODWHDI[HGWRWKHEDFNVLGHRIWKHXQLW

7KLVGRFXPHQWDWLRQPXVWEHVDYHGIRULGHQWLFDWLRQWRJHWKHUZLWKWKHYDOLGSURRIRISXUFKDVHUHFHLSW7KHGDWDFRQWDLQHG
WKHUHLQPXVWEHUHSRUWHGZKHQUHTXHVWLQJLQIRUPDWLRQDQGPDGHDYDLODEOHVKRXOGVHUYLFLQJEHUHTXLUHG

$OOLPDJHVDUHIRULOOXVWUDWLRQSXUSRVHVRQO\DFWXDOSURGXFWVPD\YDU\

DECLARATION OF CONFORMITY
7KHXQGHUVLJQHG(',/.$0,16SDZLWKKHDGRIFHKHDGTXDUWHUVDW9LD9LQFHQ]R0RQWL0LODQ,WDO\9$7,7

'HFODUHVXQGHULWVRZQUHVSRQVDELOLW\DVIROORZV
7KHZRRGSHOOHWVWRYHVVSHFLHGEHORZLVLQDFFRUGDQFHZLWKWKH((& &RQVWUXFWLRQ3URGXFWV
WOOD PELLET STOVES, trademark EDILKAMIN, called FANTASY - FATA - SIRENA - STORY

<HDURIPDQXIDFWXUH5HI'DWDQDPHSODWH6HULDOQXPEHU5HI'DWDQDPHSODWH

7KHFRPSOLDQFHZLWKWKH((&GLUHFWLYHLVEHVLGHVGHWHUPLQHGE\WKHFRPSOLDQFHZLWKWKH(XURSHDQVWDQGDUG
81,(1

WKHZRRGSHOOHWVWRYH)$17$6<)$7$6,5(1$6725<LVLQFRPSOLDQFHZLWKWKHUHTXLUHPHQWVRIWKH(XURSHDQGLUHFWLYHV
2006/95/EC - Low voltage directive
2004/108/EC - Electromagnetic compatibility directive

(',/.$0,16SDZLOOGHFOLQHDOOUHVSRQVDELOLW\RIPDOIXQFWLRQLQJRUGDPDJHWRWKHHTXLSPHQWLQFDVHRIXQDXWKRUL]HG
VXEVWLWXWLRQDVVHPEO\RUPRGLFDWLRQVRIDQ\VRUWRQWKHVDLGHTXLSPHQWRQWKHSDUWRIQRQ(',/.$0,1SHUVRQQHO
- 25 -
PRINCIPLE OF OPERATION SAFETY INFORMATION
7KHVWRYHVKHDWWKHDLUXVLQJZRRGSHOOHWVDVIXHOZLWKHOHFWUR- The stove is designed to heat, through automatic pellet com-
QLFDOO\FRQWUROOHGFRPEXVWLRQ+HUHXQGHULVWKHH[SODQDWLRQRI bustion in the hearth, the room where it is installed, both by
radiation and the air that comes out of the front grille.
LWVIXQFWLRQV WKHOHWWHUVUHIHUWRJXUH 
7KHIXHO SHOOHWV LVWUDQVIHUUHGIURPWKHVWRUDJHKRSSHU $  7KHDSSOLDQFHLVQRWGHVLJQHGWREHXVHGE\SHRSOHLQFOXGLQJ
WRWKHFRPEXVWLRQFKDPEHU ' E\PHDQVRIDIHHGVFUHZ %  children, with reduced physical, sensorial or mental abilities.
ZKLFKLVGULYHQE\DJHDUPRWRU & 
ENGLISH

Children must be supervised to ensure they do not play with


7KHSHOOHWVDUHLJQLWHGE\WKHDLUWKDWLVKHDWHGE\DQHOHFWULFDO the appliance.
resistance (E) and drawn into the combustion chamber by a
7KHRQO\ULVNVWKDWPD\GHULYHIURPXVLQJWKHVWRYHSHUWDLQ
VPRNHH[WUDFWRU )  to non-compliance with installation instructions, direct contact
7KHIXPHVSURGXFHGGXULQJWKHFRPEXVWLRQSURFHVVDUH ZLWKOLYHHOHFWULFDOSDUWV LQWHUQDO FRQWDFWZLWKWKHUHRUKRW
H[WUDFWHGIURPWKHKHDUWKE\WKHVDPHFHQWULIXJDOIDQ ) DQG parts (glass, pipes, hot air output), when extraneous substances
H[SHOOHGWKURXJKWKHRXWOHW * ORFDWHGRQWKHORZHUSDUWDWWKH or non-recommended fuel are introduced, or due to incorrect
EDFNRIWKHVWRYH maintenance.
7KHVWRYHVDOORZIRUKRWDLUFKDQQHOOLQJWRWRFRQYH\WKH 2QO\XVHFHUWLHGKLJKTXDOLW\PPGLDPHWHUZRRGHQSHOOHWV
air to heat adjacent rooms. for fuel.
7ZRPDOHSLSHVRIDFPIRUKRWDLUFKDQQHOOLQJFRQQHF-
WLRQDUHIRXQGRQWKHEDFNSDUW 6KRXOGFRPSRQHQWVIDLOWKHVWRYHVDUHHTXLSSHGZLWKVDIHW\
7RFKDQQHOWKHKRWDLULQRQHRUWZRDGMRLQLQJURRPVWKHVWRYH devices that guarantee automatic shutdown. These are activated
LVHTXLSSHGZLWKWZRSLSHVRQWKHEDFNWRZKLFKVSHFLDODOXPL- without any intervention required.
nium pipes must be connected. ,QRUGHUWRIXQFWLRQFRUUHFWO\WKHVWRYHPXVWEHLQVWDOOHGLQ
.,7DQG.,7%,6RSWLRQDODUHDYDLODEOHWRIDFLOLWDWHDLU accordance with the instructions given herein and the door
GLVWULEXWLRQ VHHSDJH  must not be opened during operation: combustion is fully
)XHOTXDQWLW\VPRNHH[WUDFWLRQDQGFRPEXVWLRQDLUVXSSO\ automatic and requires no intervention.
are all controlled by an electronic control board, which is
8QGHUQRFLUFXPVWDQFHVVKRXOGDQ\IRUHLJQVXEVWDQFHVEH
equipped with Leonardo software to achieve high combustion entered into the hearth or hopper.
HIFLHQF\DQGORZHPLVVLRQV
7KHV\QRSWLFSDQHO 0 LVLQVWDOOHGRQWKHWRSWKURXJK 'RQRWXVHDPPDEOHSURGXFWVWRFOHDQWKHVPRNHFKDQQHO
which all phases of operation can be displayed and controlled. WKHXHVHFWLRQFRQQHFWLQJWKHVWRYHVPRNHRXWOHWWRWKH
7KHPDLQIXQFWLRQVFDQDOVREHFRQWUROOHGE\UHPRWHFRQWURO FKLPQH\XH 
$VHULDOSRUWLVIRXQGDWWKHEDFNRIWKHVWRYH RSWLRQDO 7KHKHDUWKDQGKRSSHUSDUWVPXVWRQO\EHFOHDQHGZKHQ
FDEOHFRGH WREHFRQQHFWHGWRGHYLFHVWKDWDOORZ COLD.
remote ignition (e.g. remote telephone, local thermostat).
7KHVWRYHVKDYHDQLQWHUQDOVWUXFWXUHWKDWLVPDGHHQWLUHO\ 7KHJODVVFDQEHFOHDQHGZKHQ&2/'ZLWKDVXLWDEOHSURGXFW
of cast iron. (e.g. GlassKamin Edilkamin) and a cloth.
'RQRWFOHDQZKHQKRW
0DNHVXUHWKHVWRYHLVLQVWDOOHGDQGLJQLWHGWKHUVWWLPH
E\(GLONDPLQTXDOLHG&$7SHUVRQQHO WHFKQLFDODVVLVWDQ-
M ce centre) in accordance with the instructions provided here
within; this is an essential requirement for the validation of the
guarantee.
:KHQWKHVWRYHLVLQRSHUDWLRQWKHH[KDXVWSLSHVDQGGRRU
become very hot (do not touch without wearing the thermal
glove).
'RQRWSODFHDQ\WKLQJZKLFKLVQRWKHDWUHVLVWDQWQHDUWKH
A stove.
1(9(5XVHOLTXLGIXHOWRLJQLWHWKHVWRYHRUUHNLQGOHWKHHPEHUV
B 'RQRWREVWUXFWWKHYHQWLODWLRQDSHUWXUHVLQWKHURRPZKHUH
the stove is installed, nor the air inlets of the stove itself.
E 'RQRWZHWWKHVWRYHDQGGRQRWJRQHDUHOHFWULFDOSDUWV
with wet hands.
C 'RQRWXVHUHGXFHUVRQWKHVPRNHH[KDXVWSLSHV

' 7KHVWRYHPXVWEHLQVWDOOHGLQDURRPWKDWLVVXLWDEOHIRU
G UHSUHYHQWLRQDQGHTXLSSHGZLWKDOOWKDWLVUHTXLUHG SRZHU
and air supply and outlets) for the stove to function correctly
and safely.
Should ignition fail, DO NOT re-ignite until you have
F emptied the combustion chamber.
$77(17,217+(3(//(7(037,(')5207+(
J &20%867,21&+$0%(50867127%('(326,-
7(',16,'(7+(+233(57(',16,'(7+(+233(5
- 26 -
',0(16,216$1'),1,6+,1*6
- FANTASY: soapstone.
- FATA: ceramic cream white, rossa, leather.
- SIRENA: ceramic cream white, rossa, leather.

ENGLISH
- STORY: grey painted steel. +RWDLUFKDQQHO
PP

)5217 %$&.
68
13 13

RQria e
VmWL a P
X ion
R P4Ec usPt
& mb
115

104
DcLUo OHW
N H RXW
6PR8 cP mP i
fum

usc a
  i t

39
31
7

6,'( 6<67(0

53
53
115

68

0($685(0(1769$/,')257+(02'(/6

- 27 -
CHARACTERISTICS
ELECTRONIC EQUIPMENT
/(21$5'2 is a combustion safety and control system which allows optimal performance in all
FRQGLWLRQVWKDQNVWRWZRVHQVRUVPHDVXULQJWKHSUHVVXUHOHYHOLQWKHFRPEXVWLRQFKDPEHUDQGVPRNH
temperature.
ENGLISH

7KHGHWHFWLRQRIDQGVXEVHTXHQWRSWLPLVDWLRQRIWKHVHWZRSDUDPHWHUVLVFRQWLQXRXVLQRUGHUWRFRUUHFW
operation anomalies in real time.
7KH/(21$5'2 system offers constant combustion, automatically regulating the draft based on the
FKDUDFWHULVWLFVRIWKHFKLPQH\XH EHQGVOHQJWKVKDSHGLDPHWHUHWF DQGHQYLURQPHQWDOFRQGLWLRQV
(wind, humidity, atmospheric pressure, installations at high altitude, etc.).
7KHVWDQGDUGVIRULQVWDOODWLRQPXVWEHUHVSHFWHG
/(21$5'2V\VWHPLVDOVRDEOHWRUHFRJQLVHWKHW\SHRISHOOHWVDQGDXWRPDWLFDOO\GMXVWWKHRZPR-
ment by moment to ensure the required level of combustion.
(/(&7521,&&,5&8,7%2$5'
RZ
sensor

thermocouple
optional

VPRNHUSP
3DQHOFRQWURO
sensor air
+ ---
ambient

9DFXXPJDXJH

Lithium EDFNXSEDWWHU\
+
CR2032 OLWKLXP&5

YDFSRZHU Reading
supply points
+]
ingnition element

6PRNHH[SXOVLRQPRWRU 06&5(:

3257%$&.6729(
ventilation

FUSE *
WZRIXVHVDUHLQVHUWHGLQWKHVRFNHWZLWK
VZLWFKORFDWHGRQWKHEDFNRIWKHVWRYH
one of which operational * and the other
is held in reserve **.
SERIAL PORT
7KH'HDOHUFDQLQVWDOODQRSWLRQDORQWKH$8;RXWOHWIRUFRQWUROOLQJWKHSURFHVVRI
switching on and off (e.g. telephone remote, local thermostat), located at the rear oh the
VWRYH&DQEHFRQQHFWHGYLDVSHFLDORSWLRQDOWUHVWOH FRGH 

%$&.83%$77(5<
$EDFNXSEDWWHU\LVIRXQGRQWKHFRQWUROERDUG 9ROW&5EDWWHU\ ,WVPDO-
function is indicated with the following messages (not considered a defect but due to
QRUPDOZHDUDQGWHDU %DWWHU\FKHFN
)RUPRUHGHWDLOHGLQIRUPDWLRQSOHDVHFRQWDFWWKH'($/(5ZKRKDVSHUIRUPHGWKHUVW
VWLJQLWLRQ * **
- 28 -
CHARACTERISTICS
7+(5027(&+1,&$/&+$5$&7(5,67,&6DFFRUGLQJWR(1
Nominal power Reduced power

ENGLISH
Heat input (burnt) kW
Heat output 13,2 5,1 kW
<LHOG(IFLHQF\ 92,5 93,3 %
Emissions CO 13% O2 0,019 0,038 %
0D[LPXPXHJDVWHPSHUDWXUH   C
Minimum draught 12 10 Pa
0DVVRZUDWHRIXHJDV 13,5 7,4 g/s
Fuel consumption 2,9 1,1 kg/h
Hopper capacity 23,5 kg
Autonomy 7 18,5 hours
Volume riscaldabile * 345 m3
6PRNHRXWOHWSLSHGLDPHWHU PDOH 80 mm
Air intake pipe diameter (male) 40 mm
:HLJKWLQFOXGLQJSDFNDJLQJ)$17$6<)$7$6,5(1$6725<  kg

* 7KHKHDWDEOHURRPGLPHQVLRQVDUHFDOFXODWHGRQWKHEDVLVKRPHLQVXODWLRQLQFRPSOLDQFHZLWK,WDOLDQODZDQGVXEVHTXHQW
FKDQJHVWRJHWKHUZLWKDQH[SHFWHGKHDWRXWSXWRI.FDOPtSHUKRXU

ELECTRICAL CHARACTERISTICS
3RZHUVXSSO\ 9DF+]
2QRIIVZLWFK si
$YHUDJHSRZHUFRQVXPSWLRQ  W
3RZHUFRQVXPSWLRQGXULQJLJQLWLRQ  W
Remote control frequency ,QIUDUHG
3URWHFWLRQRQPDLQVSRZHUVXSSO\  VHHSDJH  $79DF[)XVH
3URWHFWLRQRQHOHFWURQLFFLUFXLWERDUG $79DF[)XVH

N.B.
 NHHSLQPLQGWKDWH[WHUQDOGHYLFHVFDQFDXVHLQWHUIHUHQFHWRWKHRSHUDWLRQRIWKHFLUFXLWERDUG
 FDXWLRQOLYHSDUWV6HUYLFLQJDQGRULQVSHFWLRQVPXVWEHFDUULHGRXWE\TXDOLHGVWDII

The data shown above is purely indicative.


(',/.$0,1VSDUHVHUYHVWKHULJKWWRFKDQJHWKHSURGXFWVDWLWVGLVFUHWLRQZLWKRXWQRWLFH

6$)(7<'(9,&(6
7+(502&283/(
3ODFHGDWWKHVPRNHRXWOHWWRGHWHFWWKHWHPSHUDWXUH
7XUQVWKHVWRYHRQDQGRIIDQGFRQWUROVLWVRSHUDWLRQEDVHGRQGHQHGSDUDPHWHUV

9$&880*$8*(
SRVLWLRQHGRQWKHVPRNHH[WUDFWRUZKLFKGHWHFWVWKHYDFXXPYDOXH FRPSDUHGWRWKHLQVWDOODWLRQHQYLURQPHQW LQWKHFRPEXVWLRQ
chamber.

$,5)/2:6(1625
ORFDWHGLQWKHVXFWLRQFKDQQHOLWLVDFWLYDWHGZKHQWKHFRPEXVWLRQDLURZLVQRWFRUUHFWZLWKFRQVHTXHQWSUHVVXUHSUREOHPVLQ
WKHVPRNHFLUFXLWFDXVLQJWKHVWRYHWRVKXWGRZQ

6$)(7<7+(50267$7
7ULSVZKHQWKHWHPSHUDWXUHLQVLGHWKHVWRYHLVWRRKLJK,WVWRSVSHOOHWORDGLQJFDXVLQJWKHVWRYHWRJRRXW
- 29 -
&29(5,1*,167$//$7,21)$7$6,5(1$
,1&/8'('+$5':$5(
75 0[VFUHZV
 0[VFUHZV
33 4 silicone spacers for ceramic top
ENGLISH

DWZDVKHUVGLDP
EXVKLQJV
VLOLFRQHVSDFHUVIRUFHUDPLFV
FHUDPLF[LQJSODWHV

$66(0%/,1*7+(/$7(5$/7,/(6 J
75 5HPRYHWKHUHDUSDQHO  $QGWKHWZRSUROHV  
)L[WKHWZRSODWHV  WRWKH]LQFSODWHGVLGHV
J J
IRUWKH)$7$PRGHO ,OOXVWU
J 150 7KHOHIWKDQGSODWHPXVWEH[HGWRWKHFHQWUDODQGXSSHU
150 KROHVZKLOVWWKHULJKWKDQGSODWHPXVWEH[HGWRWKHFHQWUDO
138 and lower holes.
 )LWWKHFHUDPLFWLOHV  RQWRWKHSODWHV  
139 3ODFHVLOLFRQHFRDWHGVSDFHUV  LQWKHORZHUSDUWEHWZH-
HQWKHFDVWLURQEDVHDQGWKHORZHUULJKWKDQGWLOH   VHH
 150 150
GHWDLO<,OOXVWU 
138
139 )RUFRUUHFWIDVWHQLQJRIWKHXSSHUULJKWVLGHFHUDPLFWLOHDQG
the lower left side ceramic tile use the stop adjustment screws
ORFDWHGRQWKH]LQFSODWHGVLGHVRIWKHVWUXFWXUH ,OOXVWU
150
150
J GHWDLO<
Right-hand side (,OOXVWU DGMXVWWKH[LQJVFUHZDEXWWHG
DJDLQVWWKHXSSHUULJKWVLGHFHUDPLFWLOH  

Left-hand side (,OOXVWU : remove the upper left ceramic tile


 DQGDGMXVWWKH[LQJVFUHZDEXWWHGDJDLQVWWKHORZHUOHIW
VLGHFHUDPLFWLOH  
J 5HSODFHWKHXSSHUOHIWFHUDPLFWLOH  

IRUWKH6,5(1$PRGHO ,OOXVWU 
%RWKSODWHVPXVWEH[HGWRWKHFHQWUDODQGORZHUKROHV
)LWWKHFHUDPLFWLOHV  RQWRWKHSODWHV 

127(%HLQJPDGHWKURXJKDSURFHVVRIFDVWLQJWKHWLOHVPD\
J J GLIIHUVOLJKWO\LQKHLJKW7RFRPSHQVDWHIRUDQ\KHLJKWYDULD-
WLRQVVLOLFRQHVSDFHUVPD\EHLQVHUWHG J ZLWKRXW
150 150 affecting the aesthetic appearance of the stove.
61
5HSODFHWKHSUROHV  5HSODFHWKHUHDUSDQHO  
 61
150
$66(0%/,1*7+(833(5)52173$1(/)$7$6,-
5(1$ J
61 150
61 3RVLWLRQWKHFHUDPLFXSSHUIURQWSDQHO  VRWKDWLWUHVWV
DJDLQVWWKHIURQWSDQHOVXSSRUW  SRVLWLRQHGDERYHWKHGRRU
61
8VHDQ$OOHQNH\WRIDVWHQWKHIURQWSDQHOLQSODFHXVLQJ
150 WKHVXSSOLHG0[VFUHZV WKHGRRUPXVWEHRSHQHGEHIRUH
150 performing this operation).
J J
127()RUFRUUHFWDVVHPEO\RIWKHXSSHUIURQWSDQHO  SOD-
ce the bushing supplied between the same and the front panel
'(7$,/=
Part. Z  DVVKRZQLQGHWDLO=LQ,OOXVWU

62 $66(0%/,1*7+(/2:(5)52173$1(/)$7$
62 6,5(1$ J
bushings 8VHWKHVXSSOLHG$OOHQNH\WRORRVHQWKHVFUHZVWKDWKROG
the cast iron lower front grill (4) in place and remove it.
3RVLWLRQWKHIURQWSDQHO  DQGXVHDQ$OOHQNH\WR
62 IDVWHQLWLQSODFHXVLQJWKHVXSSOLHG0[VFUHZVDVLQGLFD-
24 WHGLQGHWDLO; J 
screw
vite


J J
- 30 -
&29(5,1*,167$//$7,21)$7$6,5(1$
$66(0%/,1*7+(&(5$0,&723)$7$6,5(1$ J
 ,QVHUWWKHFHUDPLFV VSDFHUVLQWRWKHLUIUHHKROHVLQWKH
* FDVWLURQWRSDQGSODFHWKHFHUDPLFWRS 
LIQHFHVVDU\LQVHUWDZDVKHUEHWZHHQWKHVLOLFRQHVSDFHU

ENGLISH
62 and the cast iron top.
VFUHZV
n2 viti
127(
WKHUHGHQDPHOZLWKFU\VWDOOLQHDSSOLHGWRWKHPDMROLFD
'(7$,/;
Part. X FUD]HV FUDFNV HYHQO\RYHUWKHZKROHVXUIDFH&UD]LQJLVQRW
a defect but is a characteristic of enamel applied to majolica
NQRZQDVFUDFO
7KHFHUDPLFSDUWV PDMROLFD DUHFDVWDQGHQDPHOOHG
J J manually and may present small defects that will not
affect their quality (small dents or enamel porosity), but instead
WHVWLHVWRWKHLUPDQXDOPDQXIDFWXUH

&29(5,1*,167$//$7,216725<
,1&/8'('+$5':$5(
0[VFUHZV
0[VFUHZV

4 silicone spacers for ceramic top
DWZDVKHUVGLDP
62 EXVKLQJV

7KHVWRYHFRPHVIXUQLVKHGZLWKLWVODWHUDOPHWDOVLGH
panels already assembled, while its ceramic upper and
ORZHUIURQWSDQHOV  DQGWRS  PXVWEHDVVHPEOHG
as follows:

62 $66(0%/,1*7+(833(5)52173$1(/ J

J 3RVLWLRQWKHFHUDPLFXSSHUIURQWSDQHO  VRWKDWLWUHVWV
DJDLQVWWKHIURQWSDQHOVXSSRUW  SRVLWLRQHGDERYHWKHGRRU
8VHDQ$OOHQNH\WRIDVWHQWKHIURQWSDQHOLQSODFHXVLQJ
'(7$,/=
Part. Z
WKHVXSSOLHG0[VFUHZV WKHGRRUPXVWEHRSHQHGEHIRUH
performing this operation).
62
62
127(
bushings VFUHZV
n2 viti )RUFRUUHFWDVVHPEO\RIWKHXSSHUIURQWSDQHO  SODFHWKH
EXVKLQJVXSSOLHGEHWZHHQWKHVDPHDQGWKHIURQWSDQHO  DV
'(7$,/; VKRZQLQGHWDLO=LQ,OOXVWU
24 Part. X
screw
vite
$66(0%/,1*7+(/2:(5)52173$1(/ J
8VHWKHVXSSOLHG$OOHQNH\WRORRVHQWKHVFUHZVWKDWKROG
J J
the cast iron lower front grill (4) in place and remove it.
3RVLWLRQWKHIURQWSDQHO  DQGXVHDQ$OOHQNH\WR
IDVWHQLWLQSODFHXVLQJWKHVXSSOLHG0[VFUHZVDVLQGLFD-
*  WHGLQGHWDLO; J 

ASSEMBLING THE CERAMIC TOP J


,QVHUWWKHFHUDPLFV VSDFHUVLQWRWKHLUIUHHKROHVLQWKH
FDVWLURQWRSDQGSODFHWKHFHUDPLFWRS 
:KHUHQHFHVVDU\DI[WKHVXSSOLHGZDVKHUEHWZHHQWKHVLOL-
cone spacer and cast iron top.

J
- 31 -
INSTALLATION
All local and national laws and European standards must be 02.(287/(7
met when installing and using the appliance. In Italy, refer to 7KHVWRYHPXVWKDYHLWVRZQVPRNHRXWOHW WKHVPRNHFDQ-
WKH81,VWDQGDUGDVZHOODVDQ\UHJLRQDORUORFDO QRWEHGLVFKDUJHGLQWRDVPRNHXHXVHGE\RWKHUGHYLFHV 
health authority regulations 7KHVPRNHLVGLVFKDUJHGWKURXJKWKHFPGLDPHWHURXWOHWDW
ENGLISH

It is necessary to refer to regulations in force in each country. If WKHEDFNRIWKHVWRYH7KHVPRNHRXWOHWPXVWEHFRQQHFWHGWR


installing in an apartment building, check with the management RXWVLGHE\PHDQVRIVXLWDEOHVWHHOSLSHV(1FHUWLHG
FRPSDQ\UVW 7KHSLSHPXVWEHKHUPHWLFDOO\VHDOHG
7KHPDWHULDOXVHGWRVHDODQGLIQHFHVVDU\LQVXODWHWKHSLSHV
9(5,)<&203$7,%,/,7<:,7+27+(5 must be resistant to high temperatures (high temperature silico-
DEVICES ne or mastic).
7KHRQO\KRUL]RQWDOVHFWLRQDOORZHGPD\EHXSWRPORQJ,W
7KHVWRYH0867127EHLQVWDOOHGLQWKHVDPHVSDFHDVW\SH% PD\KDYHXSWRWZRqEHQGV
gas heating equipment (e.g. gas boilers, stoves, and equipment $YHUWLFDOVHFWLRQRIDWOHDVWPDQGDQDQWLZLQGWHUPLQDO
served by an extraction hood) as the stove may cause a vacuum LVQHFHVVDU\ LIWKHGLVFKDUJHRXWOHWLVQRWLQDFKLPQH\XH-
LQWKHVSDFHZKLFKPD\FRPSURPLVHRULQXHQFHKRZWKHVH UHIHUHQFH81, 
units work. 7KHYHUWLFDOGXFWFDQEHLQWHUQDORUH[WHUQDO,IWKHVPRNHFKDQ-
nel is outside, it must be appropriately insulated.
9(5,)<7+(32:(56833/<&211(&7,21 ,IWKHVPRNHFKDQQHOLVWWHGLQVLGHDFKLPQH\XHWKHODWWHU
WKHSOXJPXVWEHDFFHVVLEOH PXVWEHVXLWDEOHIRUVROLGIXHO,ILWLVZLGHUWKDQPPLQ
diameter it must be improved by entering a pipe that has a sui-
7KHVWRYHLVVXSSOLHGZLWKDSRZHUFDEOHWKDWLVWREHFRQQHFWHG
WDEOHFURVVVHFWLRQDQGLVPDGHRIVXLWDEOHPDWHULDO HJPP
WRD9+]VRFNHWSUHIHUDEO\WWHGZLWKDPDJQHWRWKHU- GLDPHWHUVWHHO $OOVHFWLRQVRIWKHVPRNHGXFWPXVWEHDFFHVVL-
PLFVZLWFK9ROWDJHYDULDWLRQVH[FHHGLQJFDQGDPDJH EOHIRULQVSHFWLRQ7KHFKLPQH\SRWVDQGVPRNHGXFWVFRQ-
the stove (unless already installed, an appropriate differential nected to the solid fuel appliances must be cleaned once a year
VZLWFKPXVWEHWWHG 7KHHOHFWULFDOV\VWHPPXVWFRPSO\ YHULI\ZKHWKHUDVSHFLFOHJLVODWLRQH[LVWVLQ\RXUFRXQWU\ 
ZLWKWKHODZSDUWLFXODUO\YHULI\WKHHIFLHQF\RIWKHHDUWKLQJ Failure to regularly inspect and clean the stove increases the
V\VWHP7KHSRZHUOLQHPXVWKDYHDVXLWDEOHFURVVVHFWLRQIRU SUREDELOLW\RIDUHRFFXUULQJLQWKHFKLPQH\SRW,QWKDWFDVH
WKHVWRYHVSRZHU$QLQDGHTXDWHHDUWKLQJV\VWHPFDQFDXVH SURFHHGDVIROORZV'RQRWXVHZDWHUWRH[WLQJXLVKWKHUH
DQRPDOLHVIRUZKLFK(GLONDPLQFDQQRWEHKHOGOLDEOH (PSW\WKHSHOOHWKRSSHU&RQWDFWVSHFLDOLVWSHUVRQQHOEHIRUH
reigniting the stove. The stove is designed to work under any
weather conditions. In case of particular conditions, such as
POSITIONING strong wind, the safety system may be activated, which results
7KHVWRYHPXVWEHOHYHOIRULWWRIXQFWLRQFRUUHFWO\ in the stove being extinguished. If this happens, do not operate
9HULI\WKHEHDULQJFDSDFLW\RIWKHRRU the stove with the safety devices disabled. If the problem per-
VLVWVFRQWDFWRXU7HFKQLFDO6HUYLFH'HSDUWPHQW,QWKLVFDVHGR
),5(35(9(17,216$)(7<',67$1&(6 not operate the appliance while the safety devices are disabled.
7KHVWRYHPXVWEHLQVWDOOHGLQFRPSOLDQFHZLWKWKHIROORZLQJ ,IWKHSUREOHPSHUVLVWVFRQWDFWWKH6HUYLFH&HQWUH
safety conditions: TYPICAL EXAMPLES
PHGLXPDPPDELOLW\LWHPVPXVWEHNHSWDWDPLQLPXP
Fig. 1 Fig. 2
GLVWDQFHRIFPIURPWKHVLGHVDQGEDFNRIWKHVWRYH
KLJKO\DPPDEOHLWHPVPXVWEHNHSWDWDPLQLPXP
GLVWDQFHRIFPLISODFHGLQIURQWRIWKHVWRYH
,ILWLVQRWSRVVLEOHWRFRPSO\ZLWKWKHDERYHPHQWLRQHG
distances, technical and construction-related provisions
PXVWEHWDNHQWRSUHYHQWUHKD]DUGV,IFRQQHFWHGWRZRRGHQ
ZDOOVRURWKHUDPPDEOHPDWHULDOVWKHVPRNHH[KDXVWSLSH
must be appropriately insulated

$,5,17$.(
7KHURRPZKHUHWKHVWRYHLVORFDWHGPXVWKDYHDQDLULQWDNH
ZLWKFURVVVHFWLRQRIDWOHDVWFPWRHQVXUHUHSOHQLVKPHQW
RIWKHDLUFRQVXPHGE\FRPEXVWLRQ$OWHUQDWLYHO\WKHVWRYH
DLUPD\EHWDNHQGLUHFWO\IURPRXWVLGHWKURXJKDFPVWHHO
A: LQVXODWHGVWHHOXH
H[WHQVLRQRIWKHSLSH
B: PLQLPXPKHLJKWRIPDQGLQDQ\FDVHDERYHWKHKHLJKWRIWKH
,QWKLVFDVHWKHUHPD\EHFRQGHQVDWLRQSUREOHPVDQGLWLVQH- roof gutter
FHVVDU\WRSURWHFWWKHDLULQWDNHZLWKDJULOOHZKLFKPXVWKDYH C-E: DLULQWDNHIURPLQVLGHURRP PLQLPXPLQWHUQDOVHFWLRQFPs
DIUHHVHFWLRQRIDWOHDVWFPs 'VWHHOXHLQVLGHH[LVWLQJEULFNEXLOWFKLPQH\
7KHSLSHPXVWEHOHVVWKDQPHWUHORQJDQGKDYHQREHQGV
CHIMNEY POT
,WPXVWHQGZLWKVHFWLRQDWqIDFLQJGRZQZDUGVRUEHWWHG 7KHPDLQFKDUDFWHULVWLFVDUH
ZLWKDZLQGJXDUG,QDQ\FDVHDOOWKHZD\DLULQWDNHGXFWPXVW - an internal cross-section at the base, which is the same as that
EHDIUHHVHFWLRQRIDWOHDVWFPs RIWKHFKLPQH\XH
7KHH[WHUQDOWHUPLQDORIWKHDLULQOHWFKDQQHOPXVWEHSURWHFWHG - an outlet cross-section which is no smaller than twice that of
ZLWKDQDQWLLQVHFWQHWWLQJWKDWGRHVQRWUHGXFHWKHFPs WKHFKLPQH\XH
- its position must be high enough to catch the wind and avoid
through passage. downdraft areas in turbulent wind, it must be high enough to
catch the wind and avoid downdraft areas in turbulent wind.
- 32 -
INSTALLATION
J$ HOT AIR CIRCULATION
,QWKHLQVWDOODWLRQDUHDWKHKRWDLULVHPLWWHGWKURXJKWKH

ENGLISH
JULOOLQVWDOOHGLQWKHXSSHUIURQWSRUWLRQ J( 
7RFKDQQHOWKHKRWDLULQRQHRUWZRDGMRLQLQJURRPVWKH
VWRYHLVHTXLSSHGZLWKWZRSLSHVRQWKHEDFN J$ WR
which special aluminium pipes must be connected.

.,7DQG.,7%,6RSWLRQDODUHDYDLODEOHWRIDFLOLWDWH
hot air outlet pipes DLUGLVWULEXWLRQ VHHSDJH 

,WLVHVVHQWLDOWRUHPHPEHUWKHLPSRUWDQFHRISURSHULQVXODWLRQ
on the pipe where the hot air passes to avoid
J%
GLVSHUVLRQ$YRLGFXUYHVLQWKHSLSHDVPXFKDVSRVVLEOH

Note: THE PIPES ON THE HOT AIR OUTLETS


0867%(),77('%()25($33/<,1*7+(
&29(5,1*6$1'35,2572',6$66(0%/<2)
P 7+(833(5&$67,5216,'()/$1.7+(
P FIRST PART OF THE FLEXIBLE PIPE MUST BE
&203/(7(/<5(/$;(',168&+$:$<72
(/,0,1$7(&2558*$7,21,17+,6:$<7+(
,17(51$/',$0(7(5:,//%(6/,*+7/<
(1/$5*('72)$9285(175$1&(

J& &KDQQHOOHGDLUGLVWULEXWLRQLVDGMXVWDEOHPDQXDOO\E\
PHDQVRIWKH/OHYHU J' 
7RPRYHUHPRYHWKH3ORFNLQJSODWHVIDVWHQHGZLWK
P VFUHZV J%& 
P
2QFHWKHSODWHVKDYHEHHQUHPRYHGKRWDLUFDQEHGLUHFWHG
L HLWKHULQWKHXSSHUIURQWSDQHOSDUWJ( OHYHUSXOOHG
L DOOWKHZD\EDFNVHHJ' RULQWKHUHDUSDUWJ)
OHYHUSXOOHGDOOWKHZD\IRUZDUGVHHJ' RUKDOILQ
the upper front panel part and half in the rear part (lever
LQWKHPLGGOHVHHJ' 

J' 1RWH,)7+(6729(,6127&+$11(//('7+(
3/$7(6 3 0867127%(5(029('
front

middle

rear

J( J)

- 33 -
INSTALLATION
VW62/87,21.,7 FRGH $'-$&(17522021/<
1RWH7+(3,3(6217+(+27$,5287/(760867%(),77('%()25($33/<,1*7+(&29(5,1*6$1'
35,2572',6$66(0%/<2)7+(833(5&$67,5216,'()/$1.7+(),5673$572)7+()/(;,%/(
ENGLISH

3,3(0867%(&203/(7(/<5(/$;(',168&+$:$<72(/,0,1$7(&2558*$7,21,17+,6:$<
7+(,17(51$/',$0(7(5:,//%(6/,*+7/<(1/$5*('72)$9285(175$1&(
'HQHWKHSRVLWLRQRIWKHVWRYHZLWKUHVSHFWWRWKHZDOOLQJ JD 
'LVDVVHPEOHWKHXSSHUSDUWRIWKHEDFN  DQGUHPRYHRQHRIWKHWZRSUHGULOOHGFDSVLQFRUUHVSRQGHQFHZLWKWKHKRWDLURXWOHW
SLSHV JE 
$FWLYDWHWKHKRWDLUFKDQQHOOLQJFRQWUROOHYHU  UHPRYLQJWKHORFNLQJSODWH   JE 
&XWWKHXHFRYHUWRVL]H  RQWKHZDOOVLGH JF
3ODFHWKHVWRYHLQLWVGHQLWHSRVLWLRQ
([WHQGWKHDOXPLQLXPSLSH  IRUKRWDLUFKDQQHOOLQJZLWKRXWFRQQHFWLQJWKHVWRYHRXWOHW
)LWWKHPHGDOOLRQ  RQWKHDOXPLQLXPSLSHDQGWKHSLSHFRYHU D ZLWKRXWORFNLQJLWLQ JF 
)LWWKHDOXPLQLXPSLSHWRWKHKRWDLURXWOHWRQWKHEDFNRIWKHVWRYH   JG 
5HSODFHWKHXSSHUSDUWRIWKHEDFN  
3ODFHWKHSLSHFRYHU  LQWKHGHQLWHSRVLWLRQDQGIDVWHQLWWRWKHEDFNRIWKHVWRYHZLWKWKHVXSSOLHGVFUHZV   JG 
,QVWDOOWKHWHUPLQDORXWOHW  DQGLWVDOXPLQLXPSLSH   JG 
)DVWHQWKHZDOOPHGDOOLRQ  ZLWKVLOLFRQH JG 

JD JE
23

132 1
133
5

13
4
132 7

JF 5 3
6 6a
8
6
6a

4 8
5

JG 5
88 3
4
4
8 6
7

6
6a

Qq .,7
 %R[  
 SLSH  
4 6PRNHRXWOHWHQGSLHFH  
 Wall medallion  
6a Flue cover  
 Flue cover fastening screws 4 
8 3LSHEORFNLQJFODPS  
- 34 -
INSTALLATION
QG62/87,21.,7%,6 FRGH 121$'-$&(17522021/<
1RWH7+(3,3(6217+(+27$,5287/(760867%(),77('%()25($33/<,1*7+(&29(5,1*6$1'

ENGLISH
35,2572',6$66(0%/<2)7+(833(5&$67,5216,'()/$1.7+(),5673$572)7+()/(;,%/(
3,3(0867%(&203/(7(/<5(/$;(',168&+$:$<72(/,0,1$7(&2558*$7,21,17+,6:$<
7+(,17(51$/',$0(7(5:,//%(6/,*+7/<(1/$5*('72)$9285(175$1&(
'HQHWKHSRVLWLRQRIWKHVWRYHZLWKUHVSHFWWRWKHZDOOLQJ JD 
'LVDVVHPEOHWKHXSSHUSDUWRIWKHEDFN  DQGUHPRYHRQHRIWKHWZRSUHGULOOHGFDSVLQFRUUHVSRQGHQFHZLWKWKHKRWDLURXWOHW
SLSHV JE 
$FWLYDWHWKHKRWDLUFKDQQHOOLQJFRQWUROOHYHU  UHPRYLQJWKHORFNLQJSODWH   JE 
&XWWKHXHFRYHUWRVL]H  RQWKHZDOOVLGH JF
3ODFHWKHVWRYHLQLWVGHQLWHSRVLWLRQ
([WHQGWKHDOXPLQLXPSLSH  IRUKRWDLUFKDQQHOOLQJZLWKRXWFRQQHFWLQJWKHVWRYHRXWOHW
)LWWKHPHGDOOLRQ  RQWKHDOXPLQLXPSLSHDQGWKHSLSHFRYHU D ZLWKRXWORFNLQJLWLQ JF 
)LWWKHDOXPLQLXPSLSHWRWKHKRWDLURXWOHWRQWKHEDFNRIWKHVWRYH   JG 
5HSODFHWKHXSSHUSDUWRIWKHEDFN  
3ODFHWKHSLSHFRYHU  LQWKHGHQLWHSRVLWLRQDQGIDVWHQLWWRWKHEDFNRIWKHVWRYHZLWKWKHVXSSOLHGVFUHZV   JG 
,QVWDOOWKHWHUPLQDORXWOHW  DQGLWVDOXPLQLXPSLSH  IDVWHQLQJLWZLWKWKHZDOOFROODU  DQGWKHGRZHOVZLWKVFUHZV   JG 
)DVWHQWKHZDOOPHGDOOLRQ  ZLWKVLOLFRQH JG 

JD JE 2
2

132
133 1
5
7

13
4 6 6a
132

JF 5
9 9
8

6 10 11

10 9
9 4
10
8 8
JG 5
4 2
8
7

5
6 6

Qq .,7%,6
 %R[  
 SLSH  
4 6PRNHRXWOHWHQGSLHFH  
 Wall medallion  
6a Flue cover  
 Flue cover fastening screws 4 
8 3LSHEORFNLQJFODPS  
 Wall collar  
 Screws 4 
 'RZHOV 4 
- 35 -
INSTALLATION
UG62/87,21.,7 FRGH FRQ.,7%,6 FRGH %27+52206
1RWH7+(3,3(6217+(+27$,5287/(760867%(),77('%()25($33/<,1*7+(&29(5,1*6$1'
ENGLISH

35,2572',6$66(0%/<2)7+(833(5&$67,5216,'()/$1.7+(),5673$572)7+()/(;,%/(
3,3(0867%(&203/(7(/<5(/$;(',168&+$:$<72(/,0,1$7(&2558*$7,21,17+,6:$<
7+(,17(51$/',$0(7(5:,//%(6/,*+7/<(1/$5*('72)$9285(175$1&(
'HQHWKHSRVLWLRQRIWKHVWRYHZLWKUHVSHFWWRWKHZDOOLQJ JD 
'LVDVVHPEOHWKHXSSHUSDUWRIWKHEDFN  DQGUHPRYHWKHSUHGULOOHGFDSVLQFRUUHVSRQGHQFHZLWKWKHKRWDLURXWOHWSLSHV JE 
$FWLYDWHWKHKRWDLUFKDQQHOOLQJFRQWUROOHYHU  UHPRYLQJWKHORFNLQJSODWHV   JE 
&XWWKHXHFRYHUWRVL]H  RQWKHZDOOVLGH JF
3ODFHWKHVWRYHLQLWVGHQLWHSRVLWLRQ
([WHQGWKHDOXPLQLXPSLSHV  IRUKRWDLUFKDQQHOOLQJZLWKRXWFRQQHFWLQJWKHPWRWKHVWRYHRXWOHWV
)LWWKHPHGDOOLRQV  RQWKHDOXPLQLXPSLSHVDQGWKHSLSHFRYHUV D ZLWKRXWORFNLQJWKHPLQ JF 
)LWWKHDOXPLQLXPSLSHVWRWKHKRWDLURXWOHWVRQWKHEDFNRIWKHVWRYH   JG 
5HSODFHWKHXSSHUSDUWRIWKHEDFN  
3ODFHWKHSLSHFRYHUV  LQWKHGHQLWHSRVLWLRQDQGIDVWHQWKHPWRWKHEDFNRIWKHVWRYHZLWKWKHVXSSOLHGVFUHZV   JG 
,QVWDOOWKHWHUPLQDORXWOHWV  DQGUHODWLYHDOXPLQLXPSLSHV  IDVWHQLQJWKHPZLWKWKHZDOOFROODUV  DQG
WKHGRZHOVZLWKVFUHZV  JG 
)DVWHQWKHZDOOPHGDOOLRQV  ZLWKVLOLFRQH JG 

JD JE
2

5
3 132 1
5
133 2
7
6
13 4
6a

6 6a
132

JF 5 3 8
9 9

6 10 11

4
8
5

10 9 4
10 9
8 8
JG 5
4 3 2
8
7
8 6

4 5
6 5 6

Qq .,7 .,7%,6


 %R[   
 SLSH  - 
 SLSH   -
4 6PRNHRXWOHWHQGSLHFH   
 Wall medallion   
6a Flue cover   
 Flue cover fastening screws 8  
8 3LSHEORFNLQJFODPS 4  
 Wall collar  - 
 Screws 4 - 
 'RZHOV 4 - 
- 36 -
INSTRUCTIONS FOR USE
&RPPLVVLRQLQJPXVWEHGRQHE\D7HFKQLFDO6HUYLFH&HQWUH
authorised by Edilkamin (CAT) prior to ignition and testing
DFFRUGLQJWRWKH81,VWDQGDUG

ENGLISH
This standard indicates the control operations to be carried out
in situ, aimed at ascertaining correct system function.

Before igniting.
7RLJQLWHIRUWKHUVWWLPHLWLVHVVHQWLDOWRFRQWDFW\RXUORFDO
Edilkamin technical service centre (CAT), (for information
see the www.edilkamin.com website) to calibrate the stove
according to the type of pellets used and installation conditions,
thereby starting the guarantee.

Failure to have the stove ignited by an authorised C.A.T. pre- J


vents Edilkamin from guaranteeing correct functioning.

7KHUHPD\EHDVOLJKWVPHOORISDLQWWKHUVWIHZWLPHVLWLV
LJQLWHGKRZHYHUWKLVZLOOGLVDSSHDUTXLFNO\

%HIRUHLJQLWLQJ\RXPXVWFKHFN
that installation is correct
the power supply
that the door closes properly to a perfect seal
that the combustion chamber is clean
that the display is on standby (the date, power or temperature
DVKHV 

FILLING THE PELLET HOPPER


7KHKRSSHUOLGRSHQVDQGFORVHVZLWKDSUDFWLFDOFOLFNFODFN
system. Simply apply slight pressure to the front part of the
FDVWLURQOLG J 

ATTENTION:
XVHWKHJORYHVXSSOLHGZKHQOOLQJWKHVWRYHZKLOVWLWLVUXQ-
ning and therefore is hot.

NOTE regarding the fuel.


7KHVWRYHVLVGHVLJQHGDQGSURJUDPPHGWREXUQZRRGSHOOHWV ,ISHOOHWVZLWKGLIIHUHQWFKDUDFWHULVWLFVDUHXVHGWKHVWRYHV
with 6 mm diameter. must be recalibrated a similar procedure to that carried out by
3HOOHWVDUHDW\SHRIIXHOLQWKHIRUPRIOLWWOHF\OLQGHUVPDGH WKH'($/(5ZKHQWKHVWRYHLVLJQLWHGWKHUVWWLPH
from compacted sawdust, compressed under high pressure 8VLQJXQVXLWDEOHSHOOHWVPD\GHFUHDVHHIFLHQF\FDXVH
with no adhesives or foreign materials. malfunctions; stop the stove from functioning due to clogging,
7KH\DUHVROGLQEDJVRINJ dirt on the glass, unburnt fuel, etc.
)RUWKHVWRYHWRIXQFWLRQSURSHUO\\RX0867127EXUQ $VLPSOHYLVXDODQDO\VLVRIWKHSHOOHWVPD\EHFDUULHGRXW
DQ\WKLQJHOVHLQLW8VLQJRWKHUPDWHULDOV LQFOXGLQJZRRG  *RRGTXDOLW\ smooth, uniform length, not very dusty.
will render the warranty null and void. Such use is detected by 3RRUTXDOLW\ZLWKORQJLWXGLQDODQGWUDQVYHUVHFUDFNVYHU\
ODERUDWRU\DQDO\VHV(GLONDPLQKDVGHVLJQHGWHVWHGDQGSUR- GXVW\YDULRXVOHQJWKVDQGPL[HGZLWKIRUHLJQPDWWHU
grammed their stoves to guarantee the best performance when
pellets with the following characteristics are used:
GLDPHWHUPLOOLPHWUHV
PD[LPXPOHQJWKPP
PD[LPXPPRLVWXUHFRQWHQW
FDORULFYDOXHDWOHDVWNFDONJ
- 37 -
INSTRUCTIONS FOR USE
MIMIC PANEL
KROGGRZQIRUVHFRQGVWRWXUQVWRYHRQRURII
ENGLISH

3UHVVHGEULH\LWVZLWFKHVWKHVWRYHIURPPDQXDOWRDXWRPDWLFRSHUDWLQJPRGHKHOGGRZQ SUHVVHGDQGKHOGIRU 
it gives access to the various programming menus.

increases the various settings

decreases the various settings

(DFKWLPHLWLVSUHVVHGWHOOVWKHHOHFWURQLFFLUFXLWERDUGPHPRU\WKDW.JKDYHEHHQORDGHGLQWRWKHWDQNSUHVVLQJLW
FRQWLQXRXVO\IRUFDQFHOVDQ\UHVLGXDORUSUHYLRXVO\ORDGHG.J

3UHVVHGEULH\LWVZLWFKHVWKHVWRYHVIDQIURPWKHTXLHWHU&RPIRUWOHYHOWRWKHKLJKHUHQHUJ\7XUEROHYHO

7RXFKLQFRUUHVSRQGHQFHWRWKH/('SRLQWVWRVHOHFWWKHGHVLUHGRSHUDWLQJSRZHU
$OWHUQDWLYHO\WKHWUDGLWLRQDOVHWWLQJFDQEHXVHGZKLFKFDQEHVHOHFWHGXVLQJWKHEXWWRQV


Loading the feed screw. Manual ignition


Should the pellet hopper empty completely the feed screw $WDWHPSHUDWXUHORZHUWKDQq&WRRORZIRUWKHHOHFWULFDO
PXVWEHOOHG7RGRVRNHHSWKHDQGNH\VSUHVVHGVLPXO- resistance to become red hot - or if the resistance is temporarily
taneously for a few seconds (on the remote control or synoptic QRWZRUNLQJ\RXFDQXVHDUHOLJKWHUWRLJQLWHWKHVWRYH
SDQHO 2QFHUHOHDVHG5(),//ZLOODSSHDURQWKHGLVSOD\ ,QVHUWDZHOOOLWUHOLJKWHULQWRWKHFRPEXVWLRQFKDPEHUFORVH
7KLVPXVWEHFDUULHGRXWEHIRUHLJQLWLRQLIWKHVWRYHKDVVWRSSHG WKHGRRUDQGSUHVVRQWKHV\QRSWLFSDQHORUUHPRWHFRQWURO
GXHWRWKHSHOOHWVKDYLQJQLVKHG
,WLVTXLWHQRUPDOIRUVRPHSHOOHWUHVLGXHWRUHPDLQLQVLGHWKH 2SHUDWLQJPRGHV
KRSSHUWKLVLVZKDWWKHIHHGVFUHZLVXQDEOHWRSLFNXS Manual: the user sets the desired operating power (from
2QFHDPRQWKIXOO\YDFXXPWKHKRSSHUWRSUHYHQWGXVW\UHVL- DPLQLPXPRIWRDPD[LPXPRI
due from accumulating. $XWRPDWLFWKHXVHUVHWVWKHGHVLUHGURRPWHPSHUDWXUH
XVLQJWKHNH\RUWKHUHPRWHFRQWUROWKHVWRYHUHDGVWKH
$XWRPDWLFLJQLWLRQ VHWWLQJDQGDGMXVWVWKHSRZHUWRUHDFKWKHWHPSHUDWXUHVHW
:LWKWKHVWRYHRQVWDQGE\SUHVVWKHEXWWRQIRUVHFRQGV then sets itself to Power 1.
RQWKHV\QRSWLFSDQHORUUHPRWHFRQWURO 7KLVZLOOVWDUWXS
WKHLJQLWLRQSURFHVV6WDUWXSZLOODSSHDURQWKHGLVSOD\DQG 0DQXDOPRGHIURPV\QRSWLFSDQHOUHPRWHFRQWURO
DFRXQWGRZQZLOOFRPPHQFHLQVHFRQGV  7KHUHLVQR With the stove in operation mode or on standby, press and
preset time for the ignition process: its duration will be automa- UHOHDVHWKH0(18EXWWRQRQWKHV\QRSWLFSDQHOUHPRWH
tically shortened if the control board detects that certain tests FRQWURODQG3RZHUZLOODSSHDURQWKHGLVSOD\ VKRZLQJ
KDYHEHHQFDUULHGRXWSRVLWLYHO\7KHDPHDSSHDUVDIWHUDERXW WKHSRZHUDWZKLFKWKHVWRYHLVZRUNLQJ 3UHVVWKHNH\RQ
PLQXWHV WKHUHPRWHFRQWUROWRLQFUHDVHWKHRSHUDWLQJSRZHU IURP3RZHU
WR3RZHU 6HWWLQJWKHIDQYLDWKH6\QRSWLF3DQHO
With the stove in operation mode or on standby, rotate the
ULJKWNQREWRDGMXVWWKHYHQWLODWLRQVHWWLQJ IURPWRLQ
all powers).
- 38 -
INSTRUCTIONS FOR USE
$XWRPDWLFPRGHIURPV\QRSWLFSDQHOUHPRWHFRQWURO 7KHIROORZLQJZLOOEHGLVSOD\HGLIWKHNH\LVSUHVVHG
3UHVVWKH0(18EXWWRQWZLFHWRVZLWFKIURPPDQXDOWR 1R3URJUDPV
automatic mode and adjust the temperature desired for the VWGDLO\SURJUDP RQHLJQLWLRQDQGRQHVKXWGRZQSHU
URRP RQWKHSDQHORUWKHDQGNH\VRQWKHUHPRWHFRQWURO GD\ QGGDLO\SURJUDP VDPHDVEHIRUH UGGDLO\SURJUDP

ENGLISH
WRVHWWKHWHPSHUDWXUHEHWZHHQDQGDQGWKHVWRYHZLOO (same as before).
regulate the operating power required to reach it. 8VHWKH0(18EXWWRQWRVKRZWKHPLQUHYHUVHRUGHU
,IWKHVHWWHPSHUDWXUHLVORZHUWKDQWKHURRPWHPSHUDWXUH ,IWKHVWSURJUDPLVVHOHFWHGWKHLJQLWLRQWLPHLVVKRZQ
WKHVWRYHZRUNVDW3RZHU 7KHGLVSOD\VKRZV,JQLWLRQ+RXUXVHWKH
NH\VWRFKDQJHWKHKRXUDQGSUHVV0(18WRFRQUP
Shutdown 7KHGLVSOD\VKRZV,JQLWLRQ0LQXWHVXVHWKH
)RUJUHDWHUFRPIRUWWKHVWRYHDQGWKHDLUYHQWVJRRII NH\VWRFKDQJHWKHPLQXWHVDQGSUHVV0(18WRFRQUP
DWWKHVDPHSRZHUDWZKLFKLWZDVRSHUDWLQJ ,QWKHVDPHZD\DGMXVWWKHVKXWGRZQWLPHV7KHSURJUDPLV
:LWKWKHVWRYHLQRSHUDWLRQPRGHSUHVVWKHNH\IRU FRQUPHGE\SUHVVLQJWKH0(18EXWWRQZKHQ6DYH2.DS-
VHFRQGV RQWKHV\QRSWLFSDQHORUUHPRWHFRQWURO 7KH SHDUVRQWKHGLVSOD\:KHQFRQUPLQJWKH:HHNO\SURJUDP
shutdown procedure will begin and the countdown is the day to which the program is to apply must be selected:
GLVSOD\HG7KLVYDULHVDFFRUGLQJWRWKHSRZHUDWZKLFKLW 0RQ7XHV:HG7KXUV)UL6DW6XQ
is running when the shutdown phase begins. 2QFH\RXKDYHFKRVHQWKHGD\E\VFUROOLQJWKURXJKWKHP
7KHVKXWGRZQSKDVH ZKLFKZLOOH[WLQJXLVKWKHDPH ZLWKWKHDQGNH\VFRQUPE\SUHVVLQJ0(18DQG
without leaving any unburnt material in the combustion proceed with the settings of the programs in the same way
chamber and cool the stove), consists of: DVIRUWKH'DLO\SURJUDPVHOHFWLQJZKHWKHURUQRWWR
3HOOHWORDGLQJFHDVHV HQDEOHDSURJUDPIRUHDFKGD\RIWKHZHHNDQGFKRRVLQJ
9HQWLODWLRQLVDFWLYDWHGDWWKHOHYHODWZKLFKWKHVWRYH the number and times of interventions.
was operating. 6KRXOG\RXPDNHDPLVWDNHZKLOVWVHWWLQJWKHSURJUDPV
6PRNHH[SXOVLRQPRWRUHQDEOHG \RXFDQH[LWZLWKRXWVDYLQJE\SUHVVLQJWKHNH\
Never unplug the stove during the shutdown process.
1RWHRQDPHYDULDELOLW\
6HWWLQJWKHFORFN 7KHDPHPD\YDU\GHSHQGLQJRQWKHW\SHRISHOOHWV
3UHVVWKH0(18EXWWRQIRUVHFRQGVDQGXVHWKHDQG used, in addition to normal variability of the solid fuel
NH\VWRIROORZWKHLQVWUXFWLRQVJLYHQRQWKHGLVSOD\WR DPHDQGUHJXODUFOHDQLQJRIWKHFRPEXVWLRQFKDPEHU
DFFHVVWKH&ORFNPHQX7KLVDOORZV\RXWRVHWWKHWLPHRQWKH carried out automatically by the stove.
electronic control board. N.B.7KHDXWRPDWLFFOHDQLQJSURFHVVSHUIRUPHGE\WKH
7KHQSUHVV0(18DQGWKHIROORZLQJGDWDDSSHDUVLQ stove does not replace the need for the user to vacuum the
VHTXHQFHWKLVFDQEHDGMXVWHG stove when cold, prior to ignition).
GD\PRQWK\HDUKRXUPLQXWHVGD\RIWKHZHHN
:KHQ6DYH"DSSHDUVRQWKHGLVSOD\\RXFDQFKHFNWKDW Pellet reserve warning
WKHVHWWLQJVKDYHEHHQHQWHUHGFRUUHFWO\EHIRUHFRQUPLQJ Stoves are equipped with an electronic pellet detection
3UHVV0(18WRVDYHWKHLQIRUPDWLRQ 6DYH2.WKHQ V\VWHP7KHGHWHFWLRQV\VWHPLVLQWHJUDWHGLQWRWKHHOHFWURQLF
appears on the display). FRQWUROERDUGDOORZLQJWKHVWRYHWRPRQLWRUKRZPDQ\NLORV
RISHOOHWVDUHOHIW7KLVYHULFDWLRQLVLPSOHPHQWHGDWDQ\SRLQW
:HHNO\WLPHU whilst the stove is in operation mode. For correct system ope-
3UHVVWKH0(18EXWWRQRQWKHUHPRWHFRQWUROIRU ration, it is important that the following procedure is adhered
seconds to access the time setting function and press the ZLWKGXULQJWKHUVWLJQLWLRQ WKDWPXVWEHLPSOHPHQWHGE\WKH
NH\WRDFFHVVWKHZHHNO\WLPHUIXQFWLRQ3URJUDP21 '($/(5 %HIRUHVWDUWLQJWRXVHWKHSHOOHWGHWHFWLRQV\VWHP
2))ZLOODSSHDURQWKHGLVSOD\ \RXPXVWORDGDQGFRQVXPHDIXOOVDFNRISHOOHWV7KLVDOORZV
$PD[LPXPRIWKUHHWLPHUSURJUDPVFDQEHVHWIRUHDFK IRUDEULHIUXQQLQJLQRIWKHORDGLQJV\VWHP+HQFHORDGNJ
GD\RIWKHZHHN RISHOOHWV7KHQSUHVVWKHUHVHUYHEXWWRQRQFHWKHUHE\VWRULQJ
$V\RXFRQUPYLDWKH0(18EXWWRQRQHRIWKHIROORZLQJ WKHGDWDLQWRWKHPHPRU\WKDWNJKDYHEHHQORDGHG
options will appear: From now on the display will show the remaining pellets
1R3URJ QRSURJUDPLVVHW  DVWKH\GHFUHDVHLQNJ  
'DLO\SURJUDP DVLQJOHSURJUDPLVVHWIRUHYHU\GD\ Each time pellets are reloaded you must enter the quantity.
:HHNO\SURJUDP DSURJUDPLVVHWIRUHDFKGD\RIWKH (JZKHQORDGLQJNJVLPSO\SUHVVWKHSHOOHWORDGEXWWRQ
ZHHN  to enter this into the memory. For other quantities, or in the
0RYHIURPRQHWRWKHRWKHUXVLQJWKHDQGNH\V event of an error, you can specify the quantity using the pellet
8VHWKH0(18EXWWRQWRFRQUPWKH'DLO\SURJUDP reserve menu as follows:
option and access the selection of the number of programs 3UHVVWKH0(18EXWWRQIRUVHFRQGVWRYLHZWKH6(77,1*6
LJQLWLRQVKXWGRZQ WREHVHWSHUGD\8VHWKH'DLO\SURJUDP 3UHVVRUFRQVHFXWLYHO\WRYLHZ5(6(59(
RSWLRQWRVHWWKHLGHQWLFDOSURJUDPVIRUHYHU\GD\ 3UHVVLQJWKHNH\LQFUHDVHVWKH.JWREHORDGHGSUHVVLQJWKH
RIWKHZHHN NH\UHGXFHVWKH.JSUHVVLQJWKHNH\UHSHDWHGO\VHWVWKHORDG
WR.J 5RQWKHGLVSOD\ ZKLFKPDNHVLWSRVVLEOHWRFDQFHO
the residual load.

- 39 -
INSTRUCTIONS FOR USE
&RQUPE\SUHVVLQJ0(18DQGWKHUHPDLQLQJTXDQWLW\ 7KHVWRYHZLOODXWRPDWLFDOO\UHFRJQLVHWKHFRQQHFWLRQZLWKWKH
RISHOOHWVZLOOEHGLVSOD\HGWKDWEHLQJORDGHG GHIDXOWLV serial port of the thermostat under the following conditions:
DQGFDQEHFKDQJHGXVLQJWKHNH\V 6KRXOGWKHKRSSHUUXQ With environmental temperature lower than the thermostat
RXWRISHOOHWVWKHVWRYHZLOOEORFNDQG6WRS)ODPHZLOODSSHDU setting (contact closed), the stove modulates power normally to
ENGLISH

VHHSDJH  follow the set temperature


1RWH(YHU\QRZDQGDJDLQUHPHPEHUWRUHVHWWKHSHOOHW -With environmental temperature reached by the thermostat
UHVHUYHZDUQLQJIRULWWRIXQFWLRQLQDPRUHUHOLDEOH (contact open), the stove switches to stand-by mode.
PDQQHU)RUDQ\FODULFDWLRQSOHDVHFRQWDFWWKHDXWKRULVHG
'($/(5ZKRSHUIRUPHGWKHUVWVWLJQLWLRQ 7HPSHUDWXUH
This provides a reference indicator. Greater precision is 7HPSHUDWXUH provided by
1RDGMXVWPHQW
REWDLQHGE\UHJXODUO\]HURLQJWKHV\VWHPEHIRUHOOLQJLWDJDLQ &RQJXUDWLRQ provided by the H[WHUQDO
(factory setting)
Edilkamin does not accept any responsibility for differences remote control environmental
from what is indicated (which may be due to external factors). thermostat

&RPIRUW
(QYLURQPHQWDOWHPSHUDWXUHDGMXVWPHQW &OLPD 21 21 21
this comfortable and simple adjustment feature, as standard in parameter
this line of products, allows you to manage the stove power
based on the environmental temperature. 621'$,5
21 2)) 21
$IWHUDFWLYDWLQJWKH&OLPD&RPIRUWIXQFWLRQIURPWKHSDUD- parameter
PHWHUVPHQX DVNWKHWHFKQLFDODVVLVWDQFHFHQWUH7$& ZH
can use this function to switch off the stove when it reaches the <HV
&RQQHFWLRQWR 12 12
VHWWHPSHUDWXUH7KLVIXQFWLRQLVFRPELQHGZLWKWKH$872- with blue
serial port no connection no connection
0$7,&VWRYHVHWWLQJ0$18$/PRGHRSHUDWLRQZLOOLQDQ\ serial cable
case remain unchanged.
$IWHUWKH&RPIRUW&OLPDIXQFWLRQKDVEHHQHQDEOHGE\WKH
7$&\RXFDQDFWLYDWHGHDFWLYDWHLWIURPWKHXVHUPHQX3UHVV
WKH6(7NH\ORRNIRUWKH&RPIRUW&OLPDPHQXZLWKWKH
NH\VVHOHFWLWZLWKWKH6(7NH\VHW212))ZLWKWKH
EXWWRQVVDYHWKHGHVLUHGVHWWLQJDQGH[LWXVLQJWKHEXWWRQ

2SHUDWLRQGHWDLOV&RPIRUW&OLPD21
ZKHQVHWRQ$8720$7,&WKHVWRYHPRGXODWHVLWVSRZHU
E\IROORZLQJWKHWHPSHUDWXUHVHWE\WKHXVHU2QUHDFKLQJ
environmental temperature, the stove switches off and then
switches on again independently when the temperature drops.

7HPSHUDWXUHVHOHFWLRQ
,Q&RPIRUW&OLPDPRGHE\SUHVVLQJWKHEXWWRQVRQWKH
synoptic panel or on the remote control, you can set the display
to the desired environmental temperature. So we will have the
following situations:
$WHQYLURQPHQWDOWHPSHUDWXUHVEHORZWKHVHWWLQJWKHVWRYH
switches on independently, modulating the power automatical-
ly.
:LWKHQYLURQPHQWDOWHPSHUDWXUHUHDFKHG q& WKHVWRYH
VZLWFKHVWRVWDQGE\7KHHQYLURQPHQWDOWHPSHUDWXUHLVVHQW
from the remote control; the remote control transmitter must
be visually aligned with the receiver of the synoptic panel.
,IWKHUHPRWHFRQWUROLVLQFRUUHFWO\SRVLWLRQHGLWFDQQRWVHQG
LWVUHFRUGHGWHPSHUDWXUH7KHVWRYHWKHUHIRUHLQGHSHQGHQWO\
switches to use of its on-board temperature sensor and conti-
nues thus until the connection with the remote is restored

7HPSHUDWXUHDGMXVWPHQWZLWKH[WHUQDOWKHUPRVWDW
another temperature control system is available as an alterna-
WLYHWRWKHUHPRWHFRQWURO<RXFDQLQIDFWFRQQHFWWKHWKHUPR-
stat serial port to your home thermostat or any (clean output
contact) easily available one.

- 40 -
INSTRUCTIONS FOR USE
5(027(&21752/FRG

.H\WREXWWRQVDQGGLVSOD\
LJQLWLRQVKXWGRZQEXWWRQ

ENGLISH
+ EXWWRQWRLQFUHDVHWKHSRZHURSHUDWLQJWHPSHUDWXUH ZKHQLQVLGHDPHQXLWLQFUHDVHVWKHGLVSOD\HGYDULDEOH
- EXWWRQWRGHFUHDVHWKHSRZHURSHUDWLQJWHPSHUDWXUH ZKHQLQVLGHDPHQXLWGHFUHDVHVWKHGLVSOD\HGYDULDEOH
A EXWWRQWRVZLWFKWRWKH($6<7,0(5SURJUDP
M : button to toggle from automatic to manual mode and vice versa

,QGLFDWHVGDWDWUDQVPLVVLRQEHWZHHQWKHUHPRWHFRQWURODQGWKH
control board.

EORFNHGNH\SDGDYRLGWXUQLQJRQWKHUHPRWHFRQWURO
IRUQRUHDVRQ SUHVV$DQG0VLPXOWDQHRXVO\IRU
DIHZVHFRQGVWREORFNXQEORFNWKHNH\SDG
DWEDWWHU\ PLQLDONDOLQHEDWWHULHVW\SH$$$

,QGLFDWHVWKDWLJQLWLRQVKXWGRZQLVEHLQJYLDWKH($6<
7,0(5SURJUDP

,QGLFDWHVWKHURRPWHPSHUDWXUHGHWHFWHGE\WKHUHPRWHFRQWURO
(it indicates the values of the set parameters during its technical
set-up).

,QGLFDWHVWKDWDVHWWLQJKDVEHHQWUDQVPLWWHGIRU
the stove to ignite

SHOOHWDLUVWRYHUHPRWHFRQWUROVHWWLQJLQGLFDWRU

automatic function
(the temperature value appears on the display)

manual adjustment function


(the operating power value appears on the display)

7(03(5$785('(7(&7('%<7+(5(027(&21752/
7KHUHPRWHFRQWUROLVHTXLSSHGZLWKDQLQWHUQDOVHQVRUWRGHWHFWWKHURRPWHPSHUDWXUHDQGGLVSOD\LWLQUHDOWLPH
7KHGHWHFWHGWHPSHUDWXUHLVWUDQVPLWWHGSHULRGLFDOO\WRWKHFRQWUROERDUGRIWKHLQVHUWVWRYHLIWKHWUDQVPLVVLRQ/('RI
WKHUHPRWHFRQWURODQGWKHUHFHLYLQJVHQVRURIWKHV\QRSWLFSDQHORIWKHLQVHUWVWRYHDUHLQHDFKRWKHUVHOGRIYLHZ
,IWKHWHPSHUDWXUHRIWKHUHPRWHFRQWUROGRHVQRWUHDFKWKHFRQWUROERDUGRIWKHLQVHUWVWRYHIRURYHUPLQXWHVWKH
temperature detected by the sensor connected to the synoptic panel is used.

6(/(&7,1*7+(23(5$7,1*02'(
7KHIROORZLQJIXQFWLRQVFDQEHVFUROOHGWKURXJKDQGVHWE\EULH\SUHVVLQJWKH0EXWWRQ

automatic power adjustment

manual power adjustment

- 41 -
INSTRUCTIONS FOR USE

7(03(5$785('(7(&7('%<7+(5(027(&21752/
:LWKWKHUHPRWHFRQWUROLWLVSRVVLEOHWRXVHWKHYHU\TXLFNDQGLQWXLWLYHWLPHSURJUDPPLQJIXQFWLRQ
- If the stove is onDGHOD\HGVKXWGRZQFDQEHVHWXVLQJWKHUHPRWHFRQWUROIURPRQHWRWZHOYHKRXUV7KHUHPDLQLQJWLPHEHIR-
ENGLISH

UHWKHVFKHGXOHGVKXWGRZQLVVKRZQRQWKHV\QRSWLFSDQHOVGLVSOD\
,IWKHVWRYHLVRIIDGHOD\HGLJQLWLRQFDQEHVHWXVLQJWKHUHPRWHFRQWUROIURPRQHWRWZHOYHKRXUV7KHUHPDLQLQJWLPHEHIRUH
WKHVFKHGXOHGLJQLWLRQLVVKRZQRQWKHV\QRSWLFSDQHOVGLVSOD\

- Setting: proceed as follows to set the timer:


D 3UHVVWKH$EXWWRQDQGWKHLFRQ ZLOOOLJKWXSRQWKHGLVSOD\WKHUHE\FRQUPLQJWKH(DV\WLPHUSURJUDPKDVEHHQDFFHV-
sed.
E 6HWWKHKRXUVE\SUHVVLQJWKHEXWWRQVIRUH[DPSOH

F 3RLQWWKHUHPRWHFRQWUROWRZDUGVWKHV\QRSWLFSDQHOUHFHLYHU
G &RQUPWKHVHWWLQJE\SUHVVLQJWKH$EXWWRQIRUDIHZVHFRQGVWKHLFRQ will go off and the remaining time before the
scheduled intervention will appear on the synoptic panel.
H 5HSHDWSRLQWVD E F G WRFDQFHOWKHVHWWLQJDQGVHWWKHKRXUVWR+

%/2&.('.(<3$'
7KHUHPRWHFRQWUROEXWWRQVFDQEHEORFNHGVRDVWRSUHYHQWLWIURPJRLQJRQDFFLGHQWDOO\
3UHVVWKH$DQG0EXWWRQVVLPXOWDQHRXVO\DQGWKHNH\V\PEROZLOOOLJKWXSFRQUPLQJWKDWWKHNH\VKDYHEHHQ
EORFNHG3UHVVWKH$DQG0EXWWRQVVLPXOWDQHRXVO\RQFHDJDLQWRXQEORFNWKHNH\SDG

/2:%$77(5<,1',&$725
:KHQWKHEDWWHU\LFRQOLJKWVXSLWLQGLFDWHVWKDWWKHEDWWHULHVLQVLGHWKHUHPRWHFRQWURODUHDOPRVWDW5HSODFHWKHP
ZLWKWKUHHQHZEDWWHULHVRIWKHVDPHPRGHO VL]H$$$9 
'RQRWXVHQHZEDWWHULHVZLWKXVHGRQHV
'RQRWPL[EUDQGVDQGGLIIHUHQWW\SHVDVHYHU\W\SHDQGEUDQGKDVDGLIIHUHQWFDSDFLW\
'RQRWPL[WUDGLWLRQDOEDWWHULHVZLWKUHFKDUJHDEOHRQHV
'RQRWWU\UHFKDUJLQJDONDOLQHDQG]LQFFDUERQEDWWHULHVDVWKLVFDQFDXVHWKHPWREUHDNDQGRUDOLTXLGOHDNDJH

INFORMATION FOR USERS


,QDFFRUGDQFHZLWK$UWRIWKH/HJLVODWLYH'HFUHH1RGDWHG-XO\,PSOHPHQWDWLRQRI'LUHFWLYHV
(&(&DQG(&SHUWDLQLQJWRWKHUHGXFWLRQRIKD]DUGRXVVXEVWDQFHVXVHGLQHOHFWULFDODQG
HOHFWURQLFHTXLSPHQWDVZHOODVGLVSRVDORIZDVWH7KHFURVVHGRXWZKHHOHGELQV\PEROVKRZQRQWKHHTXLSPHQWRURQWKH
SDFNDJLQJLQGLFDWHVWKDWWKHSURGXFWPXVWEHGLVSRVHGRIVHSDUDWHO\DWWKHHQGRILWVXVHIXOOLIH7KHUHIRUHDWWKHHQGRIWKH
HTXLSPHQWVXVHIXOOLIHWKHXVHUPXVWKDQGLQWKHHTXLSPHQWWRVXLWDEOHFROOHFWLRQIDFLOLWLHVIRUHOHFWULFDODQGHOHFWURQLFZDVWHRU
return it to the retailer when a new, equivalent appliance is purchased in a ratio of one to one.
- 42 -
MAINTENANCE
%HIRUHSHUIRUPLQJDQ\PDLQWHQDQFHGLVFRQQHFWWKHDSSOLDQFHIURPWKHPDLQV

5HJXODUPDLQWHQDQFHLVUHTXLUHGIRUWKHVWRYHWRIXQFWLRQFRUUHFWO\
)$,/85(723(5)2505(*8/$50$,17(1$1&(DWOHDVWRQD6($621$/EDVLVFRXOGOHDGWRSRRUIXQFWLRQDOLW\

ENGLISH
$Q\SUREOHPVUHVXOWLQJIURPODFNRIPDLQWHQDQFHZLOOLPPHGLDWHO\YRLGWKHZDUUDQW\

127($IWHUHYHU\NJ0DLQWHQZLOODSSHDUWRUHPLQGWKHXVHUWRFOHDQWKHVPRNHFKDQQHOVZKLFKLVWKHXVHUV
UHVSRQVLELOLW\7KLVPHVVDJHZLOOGLVDSSHDUE\SUHVVLQJWKH785%2EXWWRQIRUVHFRQGV8SRQUHDFKLQJNJRISHO-
OHWVD0DLQWHQGHDOHUPHVVDJHZLOODSSHDUZKLFKZLOOQRWGLVDSSHDUEHFDXVHWKHDVVLVWDQFHRID'($/(5LVUHTXLUHG
7KLVPHVVDJHFDQEHUHVHWIURPWKHSDUDPHWHUVPHQX

N.B.
$Q\XQDXWKRULVHGPRGLFDWLRQLVIRUELGGHQ
8VHVSDUHSDUWVUHFRPPHQGHGE\WKHPDQXIDFWXUHU
- The use of pirate parts results in the guarantee becoming null and void

'$,/<0$,17(1$1&(
2SHUDWLRQVPXVWEHSHUIRUPHGZKHQWKHVWRYHLVRIIFROGDQGXQSOXJJHGIURPWKHSRZHUVXSSO\
&OHDQLQJPXVWEHFDUULHGRXWZLWKDYDFXXPFOHDQHU VHHRSWLRQDOH[WUDVSDJH 
7KHZKROHSURFHGXUHWDNHVXSDIHZPLQXWHVHYHU\GD\
2SHQWKHGRRUDQGUHPRYHDQGHPSW\WKHDVKSDQ J% 
'2127(037<7+(5(6,'8(287,1727+(3(//(7+233(5
5HPRYHWKHFRPEXVWLRQFKDPEHURUXVHWKHVSDWXODWRVFUDSHLWDQGFOHDQRXWDQ\EORFNHGKROHVRQDOOVLGHV
5HPRYHWKHFRPEXVWLRQFKDPEHU   J& DQGVFUDSHZLWKDVSDWXOD&OHDQDQ\REVWUXFWLRQVLQWKHDSHUWXUHV
6XFWLRQWKHFRPEXVWLRQFKDPEHUKROGHUFOHDQWKHFRQWDFWHGJHV
&OHDQWKHJODVVLIQHFHVVDU\ ZKHQFROG 

1HYHUYDFXXPKRWDVKLWFDQPDNHWKHYDFXXPFOHDQHUEUHDNGRZQDQGSXWVWKHKRXVHKROGURRPVDWULVNRIUH

**
J% J&
:((./<0$,17(1$1&(
&OHDQWKHKHDUWK ZLWKDEUXVK DIWHUKDYLQJUHPRYHGWKHVPRNHGHYLDWRUV J'( .
8VHWKHVZDEV J( 
(PSW\WKHSHOOHWKRSSHUDQGFOHDQWKHEDVHZLWKWKHYDFXXPFOHDQHU
:KHQFOHDQLQJWKHFRPEXVWLRQFKDPEHUOLIWWKHVPRNHFDSV J) DQGVXFWLRQWKHIRXUSLSHVXQGHUQHDWK J) 

 


* 2
2
J' J( J)
- 43 -
MAINTENANCE
SEASONAL MAINTENANCE LPSOHPHQWHGE\WKH'($/(5
&RQVLVWVLQ
&OHDQWKHVWRYHLQWHUQDOO\DQGH[WHUQDOO\
ENGLISH

&DUHIXOO\FOHDQWKHKHDWH[FKDQJHWXEHV
&DUHIXOO\FOHDQDQGUHPRYHGLUWIURPWKHFRPEXVWLRQFKDPEHUDQGWKHUHODWLYHFRPSDUWPHQW
&OHDQIDQVYHULI\PHFKDQLFDODQGFODPSORRVHQLQJ
&OHDQVPRNHFKDQQHO UHSODFHVHDOVRQVPRNHH[KDXVWSLSH
&OHDQVPRNHGXFW VHHZHHNO\FOHDQLQJ
&OHDQVPRNHH[WUDFWLRQIDQFRPSDUWPHQW
&OHDQVPRNHRZVHQVRU
&OHDQVPRNHFKHFNWKHUPRFRXSOH
&OHDQLQVSHFWDQGVFUDSHDQ\UHVLGXHIURPWKHLJQLWLRQUHVLVWDQFHFRPSDUWPHQWDQGLIQHFHVVDU\UHSODFHLW
&OHDQFKHFNWKH6\QRSWLF3DQHO
9LVXDOO\LQVSHFWWKHHOHFWULFDOZLUHVFRQQHFWLRQVDQGSRZHUFDEOH
&OHDQWKHSHOOHWKRSSHUDQGFKHFNORRVHQLQJRIWKHIHHGVFUHZJHDUPRWRUDVVHPEO\
5HSODFHWKHGRRUVHDO
)XQFWLRQDOLW\WHVWORDGWKHIHHGVFUHZLJQLWHOHWLWUXQIRUPLQXWHVDQGVKXWGRZQ

,IWKHVWRYHLVXVHGYHU\RIWHQLWLVUHFRPPHQGHGWRFOHDQWKHVPRNHFKDQQHOHYHU\PRQWKV

ATTENTION !!!
$IWHULPSOHPHQWLQJDQRUPDOFOHDQLQJSURFHGXUH,1&255(&7FRXSOLQJRIWKHXSSHU $  JXUD DQGORZHU
%  JXUD FRPEXVWLRQFKDPEHUVFDQFRPSURPLVHWKHVWRYHVSHUIRUPDQFH
%HIRUHLJQLWLQJWKHVWRYHPDNHVXUHWKHFRPEXVWLRQFKDPEHUVDUHFRUUHFWO\SDLUHGDVLQGLFDWHGLQ J ZLWKRXWDVKRU
XQEXUQWPDWHULDOSUHVHQWRQWKHVXSSRUWSHULPHWHU

J J

- 44 -
POSSIBLE TROUBLESHOOTING
,QWKHHYHQWRISUREOHPVWKHVWRYHVWRSVDXWRPDWLFDOO\DQGUXQVWKHVKXWGRZQSURFHVVDQGWKHGLVSOD\VKRZVWH[W
UHJDUGLQJWKHPRWLYDWLRQRIWKHVKXWGRZQ VHHWKHYDULRXVDODUPVEHORZ 

1HYHUSXOOWKHSOXJGXULQJVKXWGRZQRQDFFRXQWRIPDOIXQFWLRQ

ENGLISH
6KRXOGLWEORFNWRUHVWDUWWKHVWRYH\RXZLOOQHHGWRDOORZWKHWXUQRIISURFHGXUHWRWDNHSODFH VHFRQGVZLWK
DXGLEOHVLJQDO DQGWKHQSUHVVWKHEXWWRQ

'RQRWWXUQWKHVWRYHRQDJDLQEHIRUHFKHFNLQJWKHFDXVHRIWKHPDOIXQFWLRQDQG&/($1,1*(037<,1*WKHFUXFLEOH

,1',&$7,212)3266,%/(&$86(62)0$/)81&7,21$1',1',&$7,216$1'5(0(',(6
1) 6LJQDOOLQJ9HULFDLURZ LQWHUYHQHVLIWKHRZVHQVRUGHWHFWVLQVXIFLHQWFRPEXVWLRQ 
3UREOHP7XUQVRIIIRUODFNRIGHSUHVVLRQ
$LURZPD\EHLQVXIFLHQWEHFDXVHWKHGRRULVRSHQWKHGRRUGRHVQRWFORVHSURSHUO\ HJEDGVHDO WKHUHLVDQ
 DLULQWDNHRUVPRNHH[WUDFWLRQSUREOHPRUWKHFRPEXVWLRQFKDPEHULVFORJJHG
Actions: &KHFN
  GRRUFORVXUH
  FRPEXVWLRQDLULQWDNHGXFW FOHDQSD\LQJDWWHQWLRQWRWKHRZVHQVRUFRPSRQHQWV 
  FOHDQWKHRZVHQVRUZLWKGU\DLU OLNHWKDWXVHGIRU3&NH\ERDUGV 
  VWRYHORFDWLRQLWPXVWQRWEHLQVWDOOHGDJDLQVWDZDOO
  FRPEXVWLRQFKDPEHUSRVLWLRQDQGFOHDQOLQHVV FOHDQUHJXODUO\DFFRUGLQJWRWKHW\SHRISHOOHW 
  VPRNHGXFW FOHDQ 
  LQVWDOODWLRQ LILWGRHVQRWFRPSO\ZLWKUHJXODWLRQVRUWKHVPRNHRXWOHWKDVPRUHWKDQEHQGV 
  ,I\RXVXVSHFWWKHVHQVRULVPDOIXQFWLRQLQJFDUU\RXWFROGWHVWV,IWKHFRQGLWLRQVDUHFKDQJHG IRUH[DPSOHE\
opening the door) and the value does not change, there is a sensor problem.

N.B.: 7KHQRGHSUHVVLRQDODUPPD\DOVRRFFXUGXULQJLJQLWLRQVLQFHWKHRZVHQVRUVWDUWVPRQLWRULQJVHFRQGVDIWHU
the ignition cycle begins.

 6LJQDOOLQJ9HULFH[WUDFW WKLVWULSVLIWKHVPRNHH[WUDFWLRQVSHHGVHQVRUGHWHFWVDIDXOW
3UREOHP 6KXWGRZQIRUVPRNHH[WUDFWLRQVSHHGIDXOWGHWHFWLRQ
Actions: &KHFNVPRNHH[WUDFWRUIXQFWLRQ GHYROXWLRQVHQVRUFRQQHFWLRQ DQGERDUG '($/(5 
 &KHFNVPRNHFKDQQHOIRUGLUW
  9HULI\WKHHOHFWULFDOV\VWHPDQGHDUWKLQJV\VWHP
  &KHFNHOHWURQLFFLUFXLWERDUG '($/(5 

 6LJQDOOLQJ 6WRS)ODPH WKLVWULSVLIWKHWKHUPRFRXSOHGHWHFWVDVPRNHWHPSHUDWXUHORZHUWKDQWKHYDOXHVHWZKLFKLW


  LQWHUSUHWVDVWKHDEVHQFHRIDPHV
3UREOHP 7XUQVRIIGXHWRGURSLQVPRNHWHPSHUDWXUH
Actions: ODFNRISHOOHWV
  WRRPDQ\SHOOHWVKDYHVXIIRFDWHGWKHDPHFKHFNSHOOHWTXDOLW\ '($/(5
 WKHPD[LPXPWKHUPRVWDWKDVLQWHUYHQHG UDUHWKLVRQO\LQWHUYHQHVLQWKHHYHQWRIH[FHVVLYHVPRNH
 WHPSHUDWXUH  '($/(5

 6LJQDOOLQJ %ORFNB),126WDUW LQWHUYHQHVLIDDPHIDLOVWRDSSHDUZLWKLQDPD[LPXPRIPLQXWHVRULILJQLWLRQ


temperature is not reached).
3UREOHP 7XUQVRIIGXHWRLQFRUUHFWVPRNHWHPSHUDWXUHGXULQJLJQLWLRQ
'LVWLQJXLVKHLWKHURIWKHIROORZLQJFDVHV
  )ODPHGRHV127DSSHDU
Actions: &KHFNFRPEXVWLRQFKDPEHUSRVLWLRQDQGFOHDQOLQHVV
  DUULYDORIFRPEXVWLRQDLULQWKHFRPEXVWLRQFKDPEHU
  LIWKHKHDWLQJHOHPHQWLVZRUNLQJ '($/(5 
  URRPWHPSHUDWXUH LIORZHUWKDQq&XVHDUHOLJKWHU DQGGDPS
  7U\WROLJKWZLWKDUHOLJKWHU VHHSDJH 

 )ODPHVDSSHDUEXW$)DSSHDUVRQWKHGLVSOD\DIWHU$U
Actions: &KHFN RQO\E\WKH'HDOHU
  LIWKHWKHUPRFRXSOHLVZRUNLQJ '($/(5 
  VWDUWXSWHPSHUDWXUHVHWWLQJLQWKHSDUDPHWHUV '($/(5 
 5HSHDWVWDUWXSDIWHUKDYLQJHPSW\LQJWKHEUD]LHU

 6LJQDOOLQJ%ODFN2XW(not a defect of the stove).


3UREOHP7XUQVRIIGXHWRODFNRIHOHFWULFLW\
Actions: &KHFNHOHFWULFLW\FRQQHFWLRQDQGGURSVLQYROWDJH

 6LJQDOOLQJ )DXOW5&(intervenes if the thermo coupling has failed or is disconnected).


3UREOHP7XUQVRIIGXHWRWKHUPRFRXSOLQJIDLOHGRUGLVFRQQHFWHG
Actions: &KHFNFRQQHFWLRQRIWKHUPRFRXSOLQJWRERDUGFKHFNIXQFWLRQLQFROGWHVW '($/(5 

- 45 -
POSSIBLE TROUBLESHOOTING
 6LJQDOOLQJVPRNHq&KLJK
3UREOHPWXUQVRIIGXHWRH[FHHGLQJPD[LPXPVPRNHWHPSHUDWXUH
Actions: &KHFNWKHSHOOHWW\SH
  &KHFNIRUDQRPDOLHVZLWKWKHVPRNHH[WUDFWLRQPRWRU
  &KHFNWRVHHLIWKHUHDUHDQ\REVWUXFWLRQVLQWKHVPRNHFKDQQHO
ENGLISH

  &KHFNFRUUHFWLQVWDOODWLRQ
  &KHFNJHDUPRWRUGULIW
  &KHFNWRPDNHVXUHWKHUHLVDQDLULQWDNHLQWKHURRP
8) 6LJQDOOLQJ $/$50+,*+&855(17 Activated when anomalous, excessive current absorption is detected on the
gear motor..
$FWLRQV Check functioning (CAT): gear motor - Electrical connections and electronic board.
9) 6LJQDOOLQJ $/$50/2:&855(17$FWLYDWHGZKHQDQRPDORXVLQVXIFLHQWFXUUHQWDEVRUSWLRQLVGHWHFWHGRQWKH
gear motor.
$FWLRQV Check functioning (CAT): gear motor - pressure switch - tank thermostat - electrical connections and electro-
nic board

 6LJQDOOLQJ%DWWHU\FKHFN
3UREOHP7KHLQVHUWGRHVQRWVWRSEXWWKHHUURUDSSHDUVRQWKHGLVSOD\
Actions: 7KHEXIIHUEDWWHU\RIWKHFRQWUROERDUGQHHGVFKDQJLQJ '($/(5 
Remember that this component is subject to regular wear and so it is not covered by the guarantee.

 3UREOHP5HPRWHFRQWUROQRWZRUNLQJ
Actions: FORVHUWRWKHUHFHLYHURIWKHLQVHUW
  FKHFNWKHEDWWHU\DQGLIQHFHVVDU\UHSODFHLW

 3UREOHP2XWOHWDLUQRWKRW
Actions: FOHDQKHDWH[FKDQJHUIURPLQVLGHWKHUHER[

 3UREOHP'XULQJLJQLWLRQWKHGLIIHUHQWLDOVZLWFKWULSV '($/(5 
Actions: FKHFNPRLVWXUHFRQWHQWRILJQLWLRQUHVLVWDQFH

 3UREOHP'RHVQRWLJQLWH
Actions: FOHDQFRPEXVWLRQFKDPEHU

NOTA
:DUQLQJVDUHVKRZQXQWLO\RXLQWHUYHQHDQGSUHVVWKHNH\RQWKHFRQWUROSDQHO
'RQRWLJQLWHWKHVWRYHXQWLOWKHSUREOHPKDVEHHQFKHFNHGDQGUHVROYHG

N.B.:
The combustion chambers and smoke ducts connected to the solid fuel appliances must be cleaned once a year (check
LI\RXUFRXQWU\KDVVSHFLFOHJLVODWLRQFRYHULQJWKLV 
)DLOXUHWRUHJXODUO\FKHFNDQGFOHDQLQFUHDVHVWKHOLNHOLKRRGRIDUHLQWKHFKLPQH\SRW
IMPORTANT!!!
,QWKHFDVHRIDUHLQWKHVWRYHLQWKHXHRULQWKHFKLPQH\SURFHHGDVIROORZV
'LVFRQQHFWWKHSRZHUVXSSO\
- Use a carbon dioxide (CO2 H[WLQJXLVKHU
&DOOWKHUHEULJDGH
DO NOT ATTEMPT TO PUT THE FIRE OUT WITH WATER!
$IWHUWKHHYHQWKDYHWKHDSSOLDQFHFKHFNHGE\DQDXWKRULVHG6HUYLFH&HQWUHDQGKDYHDQDXWKRULVHGWHFKQLFLDQFKHFNWKHXH

- 46 -
&+(&./,67
7REHLQWHJUDWHGZLWKDFRPSOHWHUHDGLQJRIWKHWHFKQLFDOVSHFLFDWLRQV

Positioning and installing


 )LUVWLJQLWLRQSHUIRUPHGE\DXWKRULVHG&$7ZKRUHOHDVHGWKHJXDUDQWHHFHUWLFDWH

ENGLISH
 $HUD]LRQHQHOORFDOH
 ,OFDQDOHGDIXPRODFDQQDIXPDULDULFHYHVRORORVFDULFRGHOODVWXID
5RRPYHQWLODWLRQ
2QO\WKHVWRYHRXWOHWSDVVHVWKURXJKWKHVPRNHFKDQQHOFKLPQH\XH
7KHVPRNHFKDQQHOKDVDPD[LPXPRIFXUYHVDPD[LPXPKRUL]RQWDOPHWUHV
&KLPQH\SRWWKDWLVKLJKHQRXJKWRDYRLGGRZQGUDIWDUHDV
7KHGLVFKDUJHSLSHVDUHPDGHRIDVXLWDEOHPDWHULDO VWDLQOHVVVWHHOLVUHFRPPHQGHG
:KHQXVLQJDQ\DPPDEOHPDWHULDOV HJZRRG DOOSUHFDXWLRQVKDYHEHHQWDNHQWRSUHYHQWDUHKD]DUG

Use
*RRGTXDOLW\GU\SHOOHWVDUHXVHG
7KHFKLPQH\SRWDQGDVKFRPSDUWPHQWDUHFOHDQDQGZHOOSRVLWLRQHG
7KHGRRULVFORVHGSURSHUO\
7KHFRPEXVWLRQFKDPEHULVLQVHUWHGSURSHUO\LQWRWKHUHOHYDQWFRPSDUWPHQW

5(0(0%(5729$&8807+(&20%867,21&+$0%(5%()25(($&+,*1,7,21
6KRXOGLJQLWLRQIDLO'2127UHLJQLWHXQWLO\RXKDYHHPSWLHGWKHFRPEXVWLRQFKDPEHU

OPTIONAL
7(/(3+21(&20%,1(5)255(027(,*1,7,21 FRGH 
7KHVWRYHFDQEHLJQLWHGUHPRWHO\E\DVNLQJWKH'($/(5WRFRQQHFWWKHWHOHSKRQHFRPELQHUWRWKHVHULDOSRUWEHKLQGWKHVWRYHYLDWKH
RSWLRQDOFDEOH FRGH 

.,7IRUFKDQQHOOLQJKRWDLULQWRDQDGMDFHQWURRPZLWKPD[FKDQQHOOLQJSLSHOHQJWKP FRGH 

.,7%,6IRUFKDQQHOOLQJKRWDLULQWRDQRQDGMDFHQWURRPZLWKPD[FKDQQHOOLQJSLSHOHQJWKP FRGH 

CLEANING ACCESSORIES
*ODVV.DPLQ $VKYDFXXPFOHDQHU
FRGH without motor
FRGH
8VHGIRUFOHDQLQJWKH
ceramic glass 8VHUIRUFOHDQLQJ
the hearth

- 47 -
Madame, Monsieur,
1RXVYRXVUHPHUFLRQVHWQRXVYRXVIpOLFLWRQVGDYRLUFKRLVLQRWUHSURGXLW$YDQWGHOXWLOLVHUQRXVYRXVGHPDQGRQVGHOLUHDWWHQWL-
YHPHQWFHWWHFKHDQGHSRXYRLUSURWHUDXPLHX[HWHQWRXWHVpFXULWpGHWRXWHVVHVSUHVWDWLRQV

3RXUWRXWDXWUHUHQVHLJQHPHQWRXEHVRLQFRQWDFWH]OH5(9(1'(85FKH]OHTXHOYRXVDYH]HIIHFWXpYRWUHDFKDWRXYLVLWH]QRWUH
site internet www.edilkamin.com la rubrique REVENDEUR.

NOTE
$SUqVDYRLUGpVHPEDOOpOHSRrOHDVVXUH]YRXVTXHOHFRQWHQXHVWLQWqJUHHWFRPSOHW UHYrWHPHQWWpOpFRPPDQGHDYHFpFUDQ
SRLJQpHPDLQIURLGHSRXURXYHUWXUHSRUWHOOLYUHWGHJDUDQWLHJDQW&'FKHWHFKQLTXHVSDWXOHVHOVGpVKXPLGLDQWVFOpj
pans).

(QFDVGDQRPDOLHVDGUHVVH]YRXVWRXWGHVXLWHDXUHYHQGHXUFKH]OHTXHOYRXVDYH]HIIHFWXpODFKDWHWUHPHWWH]OXLXQHFRSLHGX
OLYUHWGHJDUDQWLHHWGHODIDFWXUH
FRANAIS

- Mise en service/test
(OOHGRLWDEVROXPHQWrWUHHIIHFWXpHSDUOH5(9(1'(85VRXVSHLQHGHYRLUODJDUDQWLHH[SLUHU/DPLVHHQVHUYLFHDLQVLTXHOOH
HVWGpFULWHGDQVSDUODQRUPH81,FRQVLVWHHQXQHVpULHGRSpUDWLRQVGHGHFRQWU{OHHIIHFWXpHVORUVTXHOHSRrOHHVW
LQVWDOOpHWTXLRQWSRXUEXWGHYpULHUTXHOHV\VWqPHIRQFWLRQQHELHQHWTXLOHVWHQDFFRUGDYHFOHVUqJOHPHQWDWLRQV

'HVLQVWDOODWLRQVLQFRUUHFWHVGHVHQWUHWLHQVPDOHIIHFWXpVXQHXWLOLVDWLRQLPSURSUHGXSURGXLWGpFKDUJHQWOHQWUHSULVHSURGXFWUL-
FHGHWRXWGRPPDJHpYHQWXHOGpFRXODQWGHOXWLOLVDWLRQGXSURGXLW
/HQXPpURGXFRXSRQGHFRQWU{OHQpFHVVDLUHSRXUOLGHQWLFDWLRQOHSRrOHHVWLQGLTXp
6XUOHKDXWGHOHPEDOODJH
6XUOHOLYUHWGHJDUDQWLHTXLVHWURXYHjOLQWpULHXUGXIR\HU
6XUODSODTXHWWHDSSOLTXpHjODUULqUHGHODSSDUHLO

&HWWHGRFXPHQWDWLRQDLQVLTXHODIDFWXUHGRLYHQWrWUHFRQVHUYpHVSRXUOLGHQWLFDWLRQHWOHVLQIRUPDWLRQVTXHOOHVFRQWLHQQHQW
GHYURQWrWUHFRPPXQLTXpHVjORFFDVLRQGpYHQWXHOOHVGHPDQGHVGHUHQVHLJQHPHQWVHWHOOHVGHYURQWrWUHPLVHVjGLVSRVLWLRQSRXU
XQHpYHQWXHOOHLQWHUYHQWLRQGHQWUHWLHQ

/HVGpWDLOVUHSUpVHQWpVVRQWLQGLFDWLIVGXSRLQWGHYXHJUDSKLTXHHWJpRPpWULTXH

DECLARATION DE CONFORMIT
/DVRFLHWp(',/.$0,16S$D\DQWVRQVLqJHOpJDOj9LD9LQFHQ]R0RQWL0LODQ&RGH)LVFDO3,9$

'pFODUHVRXVVDSURSUHUHVSRQVDELOLWp
TXHOHVSRrOHVjSHOOHWVGHERLVGpFULWFLGHVVRXVHVWFRQIRUPHjOD'LUHFWLYH&(( 3URGXLWVGH&RQVWUXFWLRQ
32/(3(//(76DYHFPDUTXHFRPPHUFLDOH(',/.$0,1GpQRPPp)$17$6<)$7$6,5(1$6725<

1'(6e5,(5pI3ODTXHGHVFDUDFWpULVWLTXHV$11e('()$%5,&$7,215pI3ODTXHGHVFDUDFWpULVWLTXHV

/DFRQIRUPLWpDX[FULWqUHVGHOD'LUHFWLYH&((HVWHQRXWUHGpWHUPLQpHSDUODFRQIRUPLWpjODQRUPHHXURSpHQQH
(1

/DVRFLpWpGpFODUHpJDOHPHQW
TXHOHVSRrOHVjSHOOHWVGHERLV)$17$6<)$7$6,5(1$6725<HVWFRQIRUPHDX[FULWqUHVGHVGLUHFWLYHVHXURSpHQQHV
&('LUHFWLYH%DVVH7HQVLRQ
&('LUHFWLYH&RPSDWLELOLWpeOHFWURPDJQpWLTXH

(',/.$0,16SDGpFOLQHWRXWHUHVSRQVDELOLWpHXpJDUGjWRXWG\VIRQFWLRQQHPHQWGHODSSDUHLOHQFDVGHUHPSODFHPHQWGH
PRQWDJHHWRXGHPRGLFDWLRQVTXLQHVHUDLHQWSDVHIIHFWXpVSDUGHVSHUVRQQHOV(',/.$0,1VDQVODXWRULVDWLRQSUpDODEOHGHOD
VRFLpWp
- 48 -
35,1&,3('()21&7,211(0(17 INFORMATIONS POUR LA SECURITE
/HVSROHVFKDXIIHQWODLUHQXWLOLVDQWFRPPHFRPEXVWLEOHOH /HSROHDWFRQXSRXUFKDXIIHUJUFHXQHFRPEXVWLRQ
pellet de bois, dont la combustion est gre lectroniquement. automatique du pellet dans le foyer, la pice dans laquelle il se
WURXYHSDUUD\RQQHPHQWHWSDUPRXYHPHQWGHODLUTXLVRUWGH
&LGHVVRXVHVWLOOXVWUOHIRQFWLRQQHPHQW OHVOHWWUHVIRQW la grille frontale.
UIUHQFHODJXUH 
/HFRPEXVWLEOH SHOOHW HVWSUOHYGXUVHUYRLUGHVWRFNDJH &HWDSSDUHLOQHVWSDVSUpYXSRXUrWUHXWLOLVpSDUOHVHQIDQWV
$ HWJUFHXQHYLVVDQVQ % DFWLYHSDU RXSDUGHVSHUVRQQHVGRQWOHVFDSDFLWpVSK\VLTXHVVHQVRULHOOHV
XQPRWRUGXFWHXU & LOHVWWUDQVSRUWGDQVOHFUHXVHWGH RXPHQWDOHVVRQWUpGXLWHV/HVHQIDQWVGRLYHQWrWUHVXUYHLOOpV
SRXUVDVVXUHUTXLOVQHMRXHQWSDVDYHFODSSDUHLO
FRPEXVWLRQ ' 
/DOOXPDJHGXSHOOHWVHIDLWJUFHGHODLUFKDXGSURGXLWSDU /HVVHXOVULVTXHVGpFRXODQWGHOHPSORLGHVSRrOHVVRQWOLpVj
une rsistance lectrique (E) et aspir dans le creuset par un XQQRQUHVSHFWGHOLQVWDOODWLRQRXjXQFRQWDFWGLUHFWDYHFOHV
H[WUDFWHXUGHIXPHV )  SDUWLHVpOHFWULTXHVHQWHQVLRQ LQWHUQHV RXjXQFRQWDFWDYHFOH
feu et les parties chaudes (vitre, tuyaux, sortie air chaud)
/HVIXPHVSURGXLWHVSDUODFRPEXVWLRQVRQWH[WUDLWHVGX OLQWURGXFWLRQGHVXEVWDQFHVpWUDQJqUHVjGHVFRPEXVWLEOHVQRQ
IR\HUJUFHFHPPHYHQWLODWHXUFHQWULIXJH ) HWH[SXOVHV UHFRPPDQGpVjXQHQWUHWLHQQRQDSSURSULp

FRANAIS
SDUOHUDFFRUG * VLWXHQEDVODUULUHGXSROH
/HVSROHVSHUPHWWHQWGHFDQDOLVHUODLUFKDXGGHPDQLUH &RPPHFRPEXVWLEOHXWLOLVHUVHXOHPHQWGHVSHOOHWVGHERLVGH
PPGHGLDPqWUHGH[FHOOHQWHTXDOLWpHWFHUWLp
le vhiculer pour chauffer les pices attenantes.
'HX[UDFFRUGVGHFPPOHVHWURXYHQWODUULUHGHV 6LGHVFRPSRVDQWVQHIRQFWLRQQHQWSDVOHVSRrOHVVRQW
SROHVSRXUOHUDFFRUGHPHQWGHODFDQDOLVDWLRQGDLUFKDXG GRWpVGHGLVSRVLWLIVGHVpFXULWpTXLJDUDQWLVVHQWOH[WLQFWLRQ
3RXUFDQDOLVHUODLUFKDXGGDQVXQHRXGHX[SLFHVYRLVLQHV qui doit se faire sans intervenir.
OHSROHHVWTXLSGHGHX[UDFFRUGVODUULUHDX[TXHOVLO 3RXUXQERQIRQFWLRQQHPHQWOHSRrOHGRLWrWUHLQVWDOOpHQ
IDXWUDFFRUGHUGHVWX\DX[VSFLDX[HQDOXPLQLXP UHVSHFWDQWFHTXLHVWLQGLTXpVXUFHWWHFKHHWSHQGDQWOHIRQ-
$QGHIDFLOLWHUODGLVWULEXWLRQGHODLUFKDXGOHV.,7HW FWLRQQHPHQWODSRUWHQHGRLWSDVrWUHRXYHUWHHQHIIHWOD
.,7%,6VRQWGLVSRQLEOHVHQRSWLRQ YRLUSDJH  FRPEXVWLRQHVWJpUpHDXWRPDWLTXHPHQWHWQHQpFHVVLWHDXFXQH
intervention.
/DTXDQWLWGHFRPEXVWLEOHHWOH[WUDFWLRQGHVIXPHVDOLPHQWD-
tion air comburant, sont rgles par une carte lectronique (QDXFXQFDVGHVVXEVWDQFHVpWUDQJqUHVGRLYHQWrWUHLQWURGXL-
GRWHGXQVRIWZDUHDYHFV\VWPH/HRQDUGRDQGREWHQLUXQH WHVGDQVOHIR\HURXGDQVOHUpVHUYRLU
combustion rendement lev et basses missions. 3RXUOHQHWWR\DJHGXFRQGXLWGHIXPpHV VHJPHQWGHFRQGXLW
/HSDQQHDXV\QRSWLTXH 0 HVWLQVWDOOVXUOHKDXWHWLOSHUPHW TXLUHOLHOHUDFFRUGGHVRUWLHGHVIXPpHVGXSRrOHDYHFOHFRQ-
de grer et de visualiser toutes les phases de fonctionnement. GXLWGHFKHPLQpH LOQHIDXWSDVXWLOLVHUGHVSURGXLWVLQDPPD-
Les phases principales peuvent tre gres galement avec la bles.
tlcommande. /HVSDUWLHVGXIR\HUHWGXUpVHUYRLUGRLYHQWrWUHDVSLUpHV
/HSROHHVWGRWGXQHSULVHVULHOOHODUULUH DYHFFEOH uniquement FROID.
HQRSWLRQFRG SRXUOHUDFFRUGHPHQWDYHFGHVGL-
VSRVLWLIVGDOOXPDJHGLVWDQFH SDUH[HPSOHXQFRPELQDWHXU /DYLWUHSHXWrWUHQHWWR\pH$)52,'DYHFXQSURGXLWVSpFLDO
WOSKRQLTXHRXXQWKHUPRVWDWGDPELDQFH  (ex. GlassKamin Edilkamin) et un chiffon.
Les poles sont raliss avec une structure interne complte- 1HSDVQHWWR\HUjFKDXG
ment en fonte.
6DVVXUHUTXHOHSRrOHVRLWSRVLWLRQQpHWDOOXPpSDUXQ&$7
DXWRULVp(GLONDPLQ FHQWUHGDVVLVWDQFHWHFKQLTXH VHORQOHV
M LQGLFDWLRQVGHODSUpVHQWHFKHFRQGLWLRQVGXUHVWHLQGLVSHQVD-
bles pour la validation de la garantie.
3HQGDQWOHIRQFWLRQQHPHQWGXSRrOHOHVWX\DX[GpYDFXDWLRQ
HWODSRUWHDWWHLJQHQWGHVWHPSpUDWXUHVpOHYpHV QHSDVWRXFKHU
VDQVOHJDQWSUpYXjFHWHIIHW 
1HSDVGpSRVHUGREMHWVQRQUpVLVWDQWVjODFKDOHXUWRXWSUqV
GXSRrOH
A 1H-$0$,6XWLOLVHUGHFRPEXVWLEOHVOLTXLGHVSRXUDOOXPHU
OHSRrOHRXUDYLYHUODEUDLVH
B 1HSDVREVWUXHUOHVRXYHUWXUHVGDpUDWLRQGDQVODSLqFHGLQ-
VWDOODWLRQQLOHVHQWUpHVGDLUGXSRrOH
E 1HSDVPRXLOOHUOHSRrOHQHSDVVDSSURFKHUGHVSDUWLHV
pOHFWULTXHVDYHFOHVPDLQVPRXLOOpHV
C 1HSDVLQVpUHUGHUpGXFWLRQVVXUOHVWX\DX[GpYDFXDWLRQ
GHVIXPpHV
' /HSRrOHGRLWrWUHLQVWDOOpGDQVGHVSLqFHVDGDSWpHVjOD
G VpFXULWpFRQWUHOHVLQFHQGLHVHWGRWpHVGHWRXVOHVVHUYLFHV
DOLPHQWDWLRQHWpYDFXDWLRQV GRQWODSSDUHLODEHVRLQSRXUXQ
fonctionnement correct et sr
6LODOOXPDJHpFKRXH1(3$6UpSpWHUODOOXPDJHDYDQW
F GDYRLUYLGpOHFUHXVHW
$77(17,21/(3(//(748,$e7e(1/(9e
J '8&5(86(71('2,73$675('e326e
'$16/(5e6(592,5
- 49 -
',0(16,216(7),1,7,216
- FANTASY: en pierre ollaire
- FATA: cramique blanc crme, rouge, leather.
- SIRENA: cramique blanc crme, rouge, leather.
- STORY: acier peint gris. &DQDOLVDWLRQDLU
FKDXGPP

)5217 5(7285
68
13 13
FRANAIS

RQ
iWaL
EaXrV ne
RP m tio
L U4F c bPuPs
115

$ m
104
co 
es
t i e fum
m
Sor8 PP c mi
s cita fu

u

39
31
7

&7 3/$1

53
53
115

68

0(685(69$/$%/(63285/(602'/(6

- 50 -
CARACTERISTIQUES
APPAREILS LECTRONIQUES
/(21$5'2 est un systme de scurit et de rglage de la combustion qui permet un fonctionnement
RSWLPDOTXHOOHVTXHVRLHQWOHVFRQGLWLRQVJUFHGHX[FDSWHXUVTXLUHOYHQWOHQLYHDXGHSUHVVLRQGDQV
la chambre de combustion et la temprature des fumes.
&HVGHX[SDUDPWUHVVRQWUHOHYVHWSDUFRQVTXHQWRSWLPLVVHQFRQWLQXGHPDQLUHFRUULJHUHQWHPSV
UHOOHVYHQWXHOOHVDQRPDOLHVGHIRQFWLRQQHPHQW/HV\VWPH/(21$5'2 obtient une combustion
constante en rglant automatiquement le tirage selon les caractristiques du conduit de chemine (cou-
rbes, longueur, forme, diamtre etc..) et les conditions environnementales (vent, humidit, pression
atmosphrique, installation en haute altitude etc..).
,OHVWQFHVVDLUHTXHOHVQRUPHVGLQVWDOODWLRQVRLHQWUHVSHFWHV
/HV\VWPH/(21$5'2 est, en outre, capable de reconnaitre le type de pellet et de rgler automati-
TXHPHQWODIX[SRXUJDUDQWLULQVWDQWDSUVLQVWDQWOHQLYHDXGHFRPEXVWLRQGHPDQG

FRANAIS
CARTE LECTRONIQUE
&DSWHXU
X[

7KHUPRFRXSOH
option

3DQQHDXFRPPDQGHV Sonde air


+ --- ambiant

9DFXRPWUH

Lithium batterie tampon


+
CR2032 FU

3RLQWVGH
5VHDXYDF lecture
+]

0RW([S)XPHV 9LVVDQVQ
Res allumage

3ULVHDUULUHSROH
9HQWLODWLRQ
FUSIBLE *
sur la prise avec interrupteur situe
ODUULUHGXSROHGHX[IXVLEOHVVRQW
LQVUHVOXQHVWIRQFWLRQQHO*HWODXWUH
est de rserve**.
PORT SRIE
6XUOHSRUW$8;YRXVSRXYH]IDLUHLQVWDOOHUSDUOH5HYHQGHXUXQGLVSRVLWLIHQRSWLRQ
SHUPHWWDQWOHFRQWUOHGHODOOXPDJHHWGHOH[WLQFWLRQ SDUH[HPSOHXQFRPELQDWHXU
WOSKRQLTXHRXXQWKHUPRVWDWGDPELDQFH SODFGHUULUHOHSROH3HXWWUHFRQQHFWHU
DYHFOHFKHYDOHWIRXUQLHQRSWLRQSUYXFHWHIIHW FRG 

BATTERIE TAMPON
8QHEDWWHULHWDPSRQ W\SH&5GH9ROWV VHWURXYHVXUODFDUWHOHFWURQLTXH6RQ
G\VIRQFWLRQQHPHQW QRQFRQVLGUFRPPHXQGIDXWGHSURGXLWPDLVFRPPHOXVXUH
QRUPDOH HVWLQGLTXSDU&RQWUOHEDWWHULH3RXUSOXVGHUIUHQFHVOHFDVFKDQW
FRQWDFWHUOH5HYHQGHXUTXLDHIIHFWXOHHUDOOXPDJH * **
- 51 -
CARACTERISTIQUES
&$5$&7e5,67,48(67+(5027(&+1,48(6HQFRQIRUPLWpDYHF(1
Puissance nominal 3XLVVDQFHUpGXLWH
3RUWpHWKHUPLTXHEUOpH kW
Puissance thermique 13,2 5,1 kW
Rendement / Performance 92,5 93,3 %
missions CO 13% O2 0,019 0,038 %
7HPSpUDWXUHPD[LPXPGHVIXPpHV   C
Tirage minimum 12 10 Pa
FRANAIS

3RUWpHHQPDVVHGHVIXPpHV 13,5 7,4 g/s


Consommation combustible 2,9 1,1 kg/h
&DSDFLWpUpVHUYRLU 23,5 kg
Autonomie 7 18,5 heures
Volume de chauffe * 345 m3
'LDPqWUHFRQGXLWIXPpHV $PkOH 80 mm
'LDPqWUHFRQGXLWSULVHDLUH[WpULHXU %PkOH 40 mm
3RLGVDYHFHPEDOODJHR)$17$6<)$7$6,5(1$6725<  kg

* /HYROXPHGHFKDXIIHHVWFDOFXOFRPSWHWHQXXQHLVRODWLRQGHODPDLVRQFRQIRUPHOD/RLHWPRGLFDWLRQVVXFFHVVLYHV
HWXQHGHPDQGHGHFKDOHXUGHNFDOPtSDUKHXUH

CARACTRISTIQUES LECTRIQUES
$OLPHQWDWLRQ 9DF+]
,QWHUUXSWHXURQRII oui
3XLVVDQFHDEVRUEHPR\HQQH  W
3XLVVDQFHDEVRUEHODOOXPDJH  W
Frquence tlcommande ,QIUDURXJHV
3URWHFWLRQVXUDOLPHQWDWLRQJQUDOH* YRLUSDJH )XVLEOH$79DF[
3URWHFWLRQVXUFDUWHOHFWURQLTXH )XVLEOH$79DF[

N.B.
 LOIDXWSUHQGUHHQFRQVLGUDWLRQTXHGHVDSSDUHLOVH[WHUQHVSHXYHQWSHUWXUEHUOHIRQFWLRQQHPHQWGHODFDUWHOHFWURQLTXH
 DWWHQWLRQSDUWLHVVRXVWHQVLRQIDLUHLPSUDWLYHPHQWHIIHFWXHUOHVHQWUHWLHQVHWOHVYULFDWLRQVSDUGHVWHFKQLFLHQV
spcialiss.

Les donnes reportes ci-dessus sont indicatives.


(',/.$0,1VSDVHUVHUYHOHGURLWGHPRGLHUVDQVSUDYLVVHVSURGXLWVHWVHORQVRQMXJHPHQWVDQVDSSHO

',6326,7,)6'(6(&85,7(
7+(502&283/(
6LWXVXUOYDFXDWLRQGHVIXPHVLOOLWOHXUWHPSUDWXUH(QIRQFWLRQGHVSDUDPWUHVWDEOLVLOFRQWUOHOHVSKDVHVGDOOXPDJHGH
WUDYDLOHWGH[WLQFWLRQ

9$&880*$8*(
SRVLWLRQHGRQWKHVPRNHH[WUDFWRUZKLFKGHWHFWVWKHYDFXXPYDOXH FRPSDUHGWRWKHLQVWDOODWLRQHQYLURQPHQW LQWKHFRPEXVWLRQFKDPEHU

&$37(85)/8;'$,5
6LWXGDQVOHFDQDOGDVSLUDWLRQLOLQWHUYLHQWTXDQGOHX[GHODLUFRPEXUDQWQHVWSDVFRUUHFWFDXVDQWSDUFRQVTXHQWGHVSUR-
EOPHVGHGSUHVVLRQGDQVOHFLUFXLWGHVIXPHVHWSURYRTXDQWOH[WLQFWLRQGXSROH

7+(50267$7'(6(&85,7(
,OLQWHUYLHQWVLODWHPSUDWXUHOLQWULHXUGXSROHHVWWURSOHYH,OEORTXHOHFKDUJHPHQWGXSHOOHWHQSURYRTXDQWOH[WLQFWLRQ du pole.
- 52 -
0217$*(5(9(7(0(176)$7$6,5(1$
3(7,7(63,&(6)2851,(6
75 YLV0[
YLV0[
33
 4 entretoises en silicone pour cramique haut
URQGHOOHV0
GRXLOOHV
HQWUHWRLVHVHQVLOLFRQHSRXUFUDPLTXHV
SODTXHVGH[DWLRQFUDPLTXHV
0217$*('(63(7,76&$55($8;/$7(5$8;
J
75 'PRQWHUOHSDQQHDXDUULUH  HWOHVGHX[SUROV  
)L[HUOHVGHX[SODTXHV  VXUOHVDQFV]LQJXV
J J

FRANAIS
SRXUOHPRGOH)$7$ J
J 150 )L[HUODSODTXHJDXFKHDXWURXFHQWUDOHWFHOXLVXSULHXU
et la plaque droite au trou central et celui infrieur.
150 &KDXVVHUOHVFDUUHDX[GHFUDPLTXH  VXUOHVSODTXHV
138

 ,QWHUFDOHUHQWUHWRLVHVVLOLFRQHV  GDQVODSDUWLHSR-
139 strieure entre le socle en fonte et le carreau infrieur droit
  YRLUGWDLO<J 
 150 150

3RXU[HUFRUUHFWHPHQWOHFDUUHDXHQFUDPLTXHODWUDO
138
139 suprieur droit et le carreau en cramique latral infrieur gau-
FKHLQWHUYHQLUVXUOHVYLVGHUJODJHGDUUWSUVHQWHVVXUOHV
DQFV]LQJXVGHODVWUXFWXUH J 
150
J SDUW< 150 )ODQF' J 5JOHUODYLVGH[DWLRQHQEXWHDXFDUUHDX
HQFUDPLTXHODWUDOVXSULHXUGURLW  
Flanc G J 5HWLUHUOHFDUUHDXHQFUDPLTXHVXSULHXU
JDXFKH  HWUJOHUODYLVGH[DWLRQHQEXWHDXFDUUHDXHQ
FUDPLTXHODWUDOLQIULHXUJDXFKH  
5HPRQWHUOHFDUUHDXHQFUDPLTXHVXSULHXUJDXFKH  
J
SRXUOHPRGOH6,5(1$ J
)L[HUOHVGHX[SODTXHVDXWURXFHQWUDOHWFHOXLLQIULHXU
&KDXVVHUOHVFDUUHDX[GHFUDPLTXH  VXUOHVSODTXHV 
5(0$548(/HVFDUUHDX[WDQWUDOLVVSDUFROODJHOD
KDXWHXUSHXWYHQWXHOOHPHQWYDULHUOJUHPHQWGHOXQODXWUH
J J 3RXUUHPGLHUOYHQWXHOOHYDULDWLRQGHKDXWHXULOHVWSRV-
VLEOHGLQWHUFDOHUOHVHQWUHWRLVHVHQVLOLFRQH J VDQV
SRXUDXWDQWQXLUHOHVWKWLTXHGXSROH
150 150

61
5HPRQWHUOHVSUROV  HWOHSDQQHDXSRVWULHXU  
 61 0217$*('(/$)$&$'(683(5,(85($17(5,(8-
150 5()$7$6,5(1$ J
3RVHUOHIURQWDODYDQWVXSULHXUHQFUDPLTXH  VXUOHVXS-
SRUWGXIURQWDO  VLWXVXUODSRUWH
61 150
61 )L[HUODIDDGHDYHFOHVYLV0[ HQXWLOLVDQWODFO
61 VL[SDQV DYDQWGHIIHFWXHUFHWWHRSUDWLRQLOIDXWRXYULUOHSHWLW
volet.
150

150 5(0$548(3RXUPRQWHUFRUUHFWHPHQWOHIURQWDODYDQW
J J VXSULHXU  YHXLOOH]LQWHUFDOHUODGRXLOOHIRXUQLHHQWUHFHOXL
FLHWOHIURQWDO  GHODPDQLUHLQGLTXHGDQVOHGWDLO=
J
3$57=
Part. Z
 0217$*('(/$)$&$'(,1)(5,(85($17(5,(8-
5()$7$6,5(1$ J
62 'YLVVHUDYHFODFOVL[SDQVIRXUQLHOHVYLVGHEORFDJH
62 GHODJULOOHLQIULHXUHHQIRQWH  HWOHQOHYHU
douilles 3RVLWLRQQHUODIDDGH  HWOD[HUDYHFOHVYLV0[
HQXWLOLVDQWODFOVL[SDQV FRPPHLQGLTXGDQVOHGWDLO;
62 J 
24
9LVVHV
vite


J J
- 53 -
0217$*(5(9(7(0(176)$7$6,5(1$
0217$*('8723(1&(5$0,48()$7$6,5(1$
 J
* (QOHUOHVHQWUHWRLVHVSRXUFUDPLTXH GDQVOHVWURXV
respectifs libres du haut en fonte et poser la partie suprieure en
62 FUDPLTXH 
ORFHVWQFHVVDLUHDSSOLTXHUXQHURQGHOOHHQWUHOHQWUHWRL-
9LVVHV
n2 viti se en silicone et le top en fonte.
127(
3$57;
Part. X OPDLOURXJHDYHFSRXGUHFULVWDOOLQHDSSOLTX
sur la faence, craquelle uniformment (craquelures) sur
WRXWHODVXUIDFH&HVFUDTXHOXUHVQHVRQWSDVXQGIDXW
PDLVXQHFDUDFWULVWLTXHGHOPDLODSSOLTXVXUODIDHQFH
J J /HVOPHQWVHQFUDPLTXH IDHQFH VRQWFRXOVHW
maills la main et ils peuvent prsenter de petites
FRANAIS

imperfections qui ne portent aucun prjudice leur qualit


SHWLWVFUHX[RXSRURVLWGHOPDLO PDLVDXFRQWUDLUHLQGLTXH
leur laboration manuelle.

0217$*(5(9(7(0(1766725<
3(7,7(63,&(6)2851,(6
YLV0[
YLV0[

4 entretoises en silicone pour cramique haut
URQGHOOHV0
62 GRXLOOHV

/HSROHHVWOLYUDYHFOHVFRWVODWUDX[HQPWDOGM
monts, alors que les faades en cramique suprieure et
LQIULHXUH  HWOHWRS  GRLYHQWWUHPRQWHVHQ
procdant de la manire suivante:

62 0217$*('(/$)$&$'(683(5,(85($17(5,(8-

J 5( J
3RVHUOHIURQWDODYDQWVXSULHXUHQFUDPLTXH  VXUOHVXS-
SRUWGXIURQWDO  VLWXVXUODSRUWH
3$57=
Part. Z )L[HUODIDDGHDYHFOHVYLV0[ HQXWLOLVDQWODFO
VL[SDQV DYDQWGHIIHFWXHUFHWWHRSUDWLRQLOIDXWRXYULUOHSHWLW
62 volet.
62
douilles 9LVVHV
n2 viti 127(
5(0$548(3RXUPRQWHUFRUUHFWHPHQWOHIURQWDODYDQW
VXSULHXU  YHXLOOH]LQWHUFDOHUODGRXLOOHIRXUQLHHQWUHFHOXL
24 3$57;
Part. X
FLHWOHIURQWDO  GHODPDQLUHLQGLTXHGDQVOHGWDLO=
9LVVHV
vite
J

J J 0217$*('(/$)$&$'(,1)(5,(85($17(5,(8-


5( J
'YLVVHUDYHFODFOVL[SDQVIRXUQLHOHVYLVGHEORFDJH

* 
GHODJULOOHLQIULHXUHHQIRQWH  HWOHQOHYHU
3RVLWLRQQHUODIDDGH  HWOD[HUDYHFOHVYLV0[
HQXWLOLVDQWODFOVL[SDQV FRPPHLQGLTXGDQVOHGWDLO;
J 

0217$*('8723(1&(5$0,48( J
(QOHUOHVHQWUHWRLVHVSRXUFUDPLTXH GDQVOHVWURXV
respectifs libres du haut en fonte et poser la partie suprieure en
FUDPLTXH 
6LQFHVVDLUHDSSOLTXHUHQWUHOHQWUHWRLVHHQVLOLFRQHHWOH
haut en fonte, une rondelle fournie.

J
- 54 -
INSTALLATION
/LQVWDOODWLRQHWOXWLOLVDWLRQGHODSSDUHLOGRLYHQWVDWLVIDLUHWRX- (9$&8$7,21'(6)80((6
WHVOHVORLVORFDOHVHWQDWLRQDOHVHWOHV1RUPHV(XURSpHQQHV(Q /HV\VWPHGYDFXDWLRQGRLWWUHXQLTXHSRXUOHSROH
,WDOLHVHUpIpUHUjODQRUPH81,HWDX[pYHQWXHOOHV GHVFRQGXLWVGYDFXDWLRQGDQVXQFRQGXLWGHFKHPLQH
LQGLFDWLRQVUpJLRQDOHVRXGHV$6/ORFDX[ FRPPXQGDXWUHVGLVSRVLWLIVQHVWSDVDFFHSWDEOH 
'HWRXWHPDQLqUHLOIDXWIDLUHUpIpUHQFHDX[ORLVHQYLJXHXU /YDFXDWLRQGHVIXPHVVHIDLWSDUOHWX\DXGHFPGH
GDQVFKDTXH3D\V(QFDVGLQVWDOODWLRQHQFRSURSULpWpGHPDQ- GLDPWUHVLWXODUULUH/HFRQGXLWGYDFXDWLRQGHVIXPHV
GRLWWUHUHOLDYHFOH[WULHXUHQXWLOLVDQWGHVWX\DX[HQDFLHU
GHUXQDYLVGHSUpYHQWLRQjODGPLQLVWUDWHXU RXQRLUVFHUWLV(1/HWX\DXGRLWWUHVFHOOKHUPWL-
TXHPHQW3RXUOWDQFKLWGHVWX\DX[HWOHXULVRODWLRQYHQ-
9(5,),&$7,21'(&203$7,%,/,7($9(&'$8- WXHOOHLOIDXWXWLOLVHUGHVPDWULDX[DX[WHPSUDWXUHVOHYHV
75(6',6326,7,)6 (silicone ou mastics pour tempratures leves).
/DSRrOH1(GRLW3$6rWUHLQVWDOOpHGDQVOHPrPHORFDORVH /HVVHJPHQWVKRUL]RQWDX[SHXYHQWDYRLUXQHORQJXHXUMXVTXP
WURXYHQWGHVpTXLSHPHQWVGHFKDXIIDJHjJD]GHW\SH% H[ 2QSHXWDYRLUMXVTXFRXGHVDYHFXQHDPSOLWXGHPD[LPXP

FRANAIS
FKDXGLqUHjJD]SRrOHHWGLVSRVLWLIVUDFFRUGpVjXQHKRWWHDVSL- GHq
UDQWH SXLVTXHODSRrOHSRXUUDLWPHWWUHHQGpSUHVVLRQOHORFDO ,OHVWQFHVVDLUH VLOHV\VWPHGYDFXDWLRQQHVLQVUHSDV
en compromettant le fonctionnement de ces dispositifs ou bien GDQVXQFRQGXLWGHFKHPLQH GHGLVSRVHUGXQWURQRQYHUWLFDO
HQrWUHLQXHQFpH GDXPRLQVPHWGXQHPERXWFRXSHYHQW UIUHQFH81,
 /HFRQGXLWYHUWLFDOSHXWWUHLQWHUQHRXH[WHUQH
6LOHFRQGXLWGHIXPHVHVWOH[WULHXULOGRLWWUHFDORULIXJ
9(5,),&$7,21%5$1&+(0(17(/(&75,48( GHPDQLUHDGTXDWH6LOHFRQGXLWGHIXPHVVLQVUHGDQV
SODFHUODFKHXQHQGURLWDFFHVVLEOH un conduit de chemine, celui-ci doit tre autoris pour les
/HSROHHVWSRXUYXGXQFEOHGDOLPHQWDWLRQOHFWULTXH FRPEXVWLEOHVVROLGHVHWVLOIDLWSOXVGHPPGHGLDPWUH
EUDQFKHUXQHSULVHGH9+]GHSUIUHQFHDYHFLQWHU- LOIDXWODVVDLQLUHQOHWXEDQWDYHFGHVWX\DX[GHVHFWLRQHWGH
UXSWHXUPDJQWRWKHUPLTXH'HVYDULDWLRQVGHWHQVLRQVXSULHX- PDWULDX[DGDSWV H[DFLHUPPGHGLDPWUH 7RXVOHV
UHVSHXYHQWFRPSURPHWWUHOHSROH VLOQHVWSDVGM segments du conduit de fumes doivent pouvoir tre inspects.
SUYXSUYRLUXQLQWHUUXSWHXUGLIIUHQWLHODGDSW /LQVWDOOD- /HVFKHPLQHVHWOHVFRQGXLWVGHIXPHDX[TXHOVVRQWUHOLV
WLRQOHFWULTXHGRLWWUHDX[QRUPHVULHUHQSDUWLFXOLHUOHI- les appareils qui utilisent des combustibles solides doivent tre
FDFLWGXFLUFXLWGHWHUUH/DOLJQHGDOLPHQWDWLRQGRLWDYRLUXQH QHWWR\VXQHIRLVSDUDQ YULHUVLOH[LVWHGDQVVRQSD\VXQH
rglementation ce sujet). Si on omet de contrler et de netto-
VHFWLRQDGDSWHODSXLVVDQFHGHODSSDUHLO/HPDXYDLVWDW \HUUJXOLUHPHQWRQDXJPHQWHODSUREDELOLWGXQLQFHQGLHGH
de marche du circuit de terre provoque un mauvais fonctionne- ODFKHPLQH'DQVFHFDVSURFGHUDLQVLQHSDVWHLQGUHDYHF
PHQWTX(GLONDPLQQHSHXWSUHQGUHHQFKDUJH GHOHDXYLGHUOHUVHUYRLUGXSHOOHW6DGUHVVHUDXSHUVRQQHO
VSFLDOLVDSUVOLQFLGHQWDYDQWGHUHGPDUUHUODPDFKLQH
POSITIONNEMENT /DSRrOHHVWFRQoXHSRXUIRQFWLRQQHUSDUWRXWHFRQGLWLRQ
3RXUXQIRQFWLRQQHPHQWFRUUHFWOHSROHGRLWWUH PpWpR(QFDVGHFRQGLWLRQVSDUWLFXOLqUHVFRPPHHQFDVGH
SRVLWLRQQQLYHDX9ULHUODFDSDFLWSRUWDQWHGXVRO YHQWIRUWOHVV\VWqPHVGHVpFXULWpSRXUUDLHQWVHGpFOHQFKHUHQ
FDXVDQWODFRXSXUHGHODSRrOH'DQVFHFDVQHSDVDOOXPHU
',67$1&(6'(6(&85,7(&2175(/(6,1&(1',(6 ODSSDUHLODYHFOHV\VWqPHGHVpFXULWpGpVDFWLYp6LOHSUREOqPH
Le pole doit tre install dans le respect des conditions de QHVWSDVUpJOpFRQWDFWHUOH&HQWUHG$VVLVWDQFH7HFKQLTXH
scurit suivantes: CAS TYPIQUES
GLVWDQFHPLQLPXPVXUOHVFWVHWVXUOHGRVGHFPGHV Fig. 1 Fig. 2
PDWULDX[LQDPPDEOHV
QHSODFHUDXFXQPDWULHOIDFLOHPHQWLQDPPDEOHGHYDQWOH
SROHXQHGLVWDQFHLQIULHXUHFP
6LOQHVWSDVSRVVLEOHGHSUYRLUOHVGLVWDQFHVPHQWLRQQHV
cidessus, il faut mettre en oeuvre des dispositions techniques et
GHFRQVWUXFWLRQSRXUYLWHUWRXWULVTXHGLQFHQGLH
En cas de liaison avec des parois en bois ou autre matriau
LQDPPDEOHLOIDXWFDORULIXJHUGHPDQLUHDGTXDWHOHFRQGXLW
GYDFXDWLRQGHVIXPHV

35,6('$,5
Le local o se trouve le pole doit imprativement avoir une
SULVHGDLUGXQHVHFWLRQGDXPRLQVFPsJDUDQWLVVDQWOHUWD-
EOLVVHPHQWGHODLUFRQVRPPSDUFRPEXVWLRQ
'DQVODOWHUQDWLYHODLUSRXUOHSROHSRXUUDWUHSUOHYGL-
UHFWHPHQWGHOH[WULHXUWUDYHUVOHSURORQJHPHQWHQDFLHUGX A: conduit de chemine en acier calorifug
WX\DXGHFPGHGLDPWUH'DQVFHFDVGHVSUREOPHVGHFRQ- B: +DXWHXUPLQLPXPPHWHQWRXWFDVDXGHOGHODKDXWHXUGH
GHQVDWLRQSRXUUDLHQWVHSUVHQWHUHWLOIDXGUDSURWJHUOHQWUH ODYDQWWRLW
GHODLUDYHFXQOHWGRQWXQHVHFWLRQOLEUHGDXPRLQVFPs C-E: SULVHGDLUHGHODSLFH VHFWLRQSDVVDQWHGHFPsPLQLPXP
devra tre garantie. Le tuyau doit avoir une longueur infrieure 'FRQGXLWGHFKHPLQHHQDFLHUOLQWULHXUGXFRQGXLWGH
PWUHHWLOQHGRLWSUVHQWHUDXFXQFRXGH/HWX\DXGRLW FKHPLQHH[LVWDQWGDQVOHPXU
WHUPLQHUDYHFVHJPHQWqGHJUVYHUVOHEDVRXDYHFXQH CHEMINEE
protection contrer le vent. Les caractristiques fondamentales sont:
(QWRXWFDVWRXVOHVFRQGXLWVGDGPLVVLRQGDLUGRLWWUHDLQVL - section interne la base gale celle du conduit de chemine
VHFWLRQOLEUHGDXPRLQVFPsGRLWWUHJDUDQWLH - section de sortie non infrieure au double de celle du conduit
/HWHUPLQDOH[WHUQHGXFRQGXLWGHSULVHGDLUGRLWWUHSURWJ de chemine
par un grillage contre les insectes qui toutefois ne doit pas - position en plein vent, au-dessus du toit et en-dehors des
UGXLUHODVHFWLRQSDVVDQWHXWLOHGHFPs ]RQHVGHUHX[DXGHVVXVGXIDLWHGXWRLWHWHQGHKRUVGHV
]RQHVGHUHX[
- 55 -
INSTALLATION
J$ &,5&8/$7,21$,5&+$8'
/HGELWGDLUFKDXGGDQVODSLFHGLQVWDOODWLRQVHIDLWSDUOD
JULOOHLQVWDOOHVXUOHGHYDQWGDQVODSDUWLHVXSULHXUH J( 

3RXUFDQDOLVHUODLUFKDXGGDQVXQHRXGHX[SLFHVYRLVLQHV
OHSROHHVWTXLSGHGHX[UDFFRUGVODUULUH J$ 
DX[TXHOVLOIDXWUDFFRUGHUGHVWX\DX[HQDOXPLQLXPVSFLDX[

raccords sortie air 3RXUIDFLOLWHUODGLVWULEXWLRQGHODLUFKDXGOHV.,7HW.,7


chaud %,6VRQWGLVSRQLEOHVHQRSWLRQ YRLUSDJH 
FRANAIS

,OHVWLPSRUWDQWGHUDSSHOHUOLPSRUWDQFHGXQERQFDORULIX-
J%
JHDJHGXWX\DXGDQVOHTXHOSDVVHODLUFKDXGSRXUYLWHUOHV
dispersions.
,OIDXWYLWHUOHSOXVSRVVLEOHGHFRXUEHUFHWX\DX

1%/(678<$8;'2,9(17(75((1),/(6
P 685/(65$&&25'6'(6257,('$,5&+$8'
P $9$17'$33/,48(5/(5(9(7(0(17(7
$35(6$92,5'(0217(/(&27(/$7(5$/
SUPERIEUR EN FONTE. LA PARTIE INITIALE
'878<$8)/(;,%/('2,7(75((7(1'8(
&203/(7(0(17'(0$1,(5($(/,0,1(5
/(3/,66(0(17'(&(77(0$1,(5(/(',$0(-
J& TRE INTERNE SELARGIRA SENSIBLEMENT
&(48,)$925,6(5$/(175((

P /DGLVWULEXWLRQGHODLUFDQDOLVHVWUJODEOHPDQXHOOHPHQW
P JUFHGHVOHYLHUV/ J' 
3RXUOHVDFWLRQQHULOIDXWHQOHYHUOHVSODTXHVGH[DWLRQ3
L [HVDYHFOHVYLV J%& 
L
$SUVDYRLUHQOHYOHVSODTXHVODLUFKDXGSHXWWUHGLULJ
VRLWGDQVODSDUWLHVXSULHXUHIURQWDOHJ( OHYLHUHQSRVLWLRQ
WRXWHQDUULUHYRLUJ' VRLWGDQVODSDUWLHSRVWULHXUHJ
) OHYLHUHQSRVLWLRQWRXWHQDYDQWYRLUJ' VRLWODPRLWL
J' GDQVODSDUWLHVXSULHXUHIURQWDOHHWODXWUHPRLWLGDQVODSDUWLH
SRVWULHXUH OHYLHUGDQVODSRVLWLRQLQWHUPGLDLUHYRLUJ' 
avant
N.B.: SI LE POELE NEST PAS CANALISE LES
3/$48(6 3 1('2,9(173$6(75((1/(9((6
intermdiaire

arrire

J( J)

- 56 -
INSTALLATION
UH62/87,21.,7 FRGH 6(8/(0(173,(&(92,6,1(
1%/(678<$8;'2,9(17(75((1),/(6685/(65$&&25'6'(6257,('$,5&+$8'$9$17
'$33/,48(5/(5(9(7(0(17(7$35(6$92,5'(0217(/(&27(/$7(5$/683(5,(85(1
)217(/$3$57,(,1,7,$/('878<$8)/(;,%/('2,7(75((7(1'8(&203/(7(0(17'(
0$1,(5($(/,0,1(5/(3/,66(0(17'(&(77(0$1,(5(/(',$0(75(,17(51(6(/$5*,5$
6(16,%/(0(17&(48,)$925,6(5$/(175((
'QLUOHSRVLWLRQQHPHQWGXSROHSDUUDSSRUWDXPXU JD 
'PRQWHUODSDUWLHVXSULHXUHGXSDQQHDXDUULUH  HWHQOHYHUXQGHVGHX[ERXFKRQVSUGFRXSVDXQLYHDXGHVUDFFRUGVGH
VRUWLHGDLUFKDXG JE 
$FWLYHUOHOHYLHUGHFRPPDQGHGHODFDQDOLVDWLRQGDLUFKDXG  HQHQOHYDQWODSODTXHWWHGHYHUURXLOODJH   JE 
&RXSHUOHFDFKHFRQGXLWDX[PHVXUHVDGTXDWHV  HQLQWHUYHQDQWVXUODSDUWLHGXFRWGXPXU JF 

FRANAIS
3ODFHUOHSROHGDQVVDSRVLWLRQGQLWLYH
WHQGUHOHWX\DXHQDOXPLQLXP  SRXUODFDQDOLVDWLRQGHODLUFKDXGVDQVOHEUDQFKHUDXUDFFRUGGXSROH
0HWWUHHQSODFHSUDODEOHPHQWVXUOHWX\DXHQDOXPLQLXPODURVDFH  HWOHFDFKHWX\DX D VDQVOHEORTXHU JF 
0HWWUHHQSODFHOHWX\DXHQDOXPLQLXPVXUOHUDFFRUGGHVRUWLHGDLUFKDXGODUULUHGXSROH   JG 
5HPRQWHUODSDUWLHVXSULHXUHGXSDQQHDXDUULUH  
3ODFHUOHFDFKHWX\DX[  GDQVVDSRVLWLRQGQLWLYHHWOH[HUODUULUHGXSROHDYHFOHVYLVIRXUQLHV   JG 
,QVWDOOHUODJRXORWWHWHUPLQDOH  HWOHWX\DXHQDOXPLQLXPFRUUHVSRQGDQW   JG 
)L[HUODURVDFHPXUDOH  DYHFGXVLOLFRQH JG 

JD JE
23

132 1
133
5

13
4
132 7

JF 5 3
6 6a
8
6
6a

4 8
5

JG 5
88 3
4
4
8 6
7

6
6a

Qq .,7
 %RLWH  
 7X\DX  
4 *RXORWWHWHUPLQDOH  
 Rosace murale  
6a &DFKHFRQGXLW  
 9LVGH[DWLRQFDFKHFRQGXLW 4 
8 &ROOLHUGHEORFDJHGHVWX\DX[  
- 57 -
INSTALLATION
PH62/87,21.,7%,6 FRGH 6(8/(0(173,(&(12192,6,1(
1%/(678<$8;'2,9(17(75((1),/(6685/(65$&&25'6'(6257,('$,5&+$8'$9$17
'$33/,48(5/(5(9(7(0(17(7$35(6$92,5'(0217(/(&27(/$7(5$/683(5,(85(1
)217(/$3$57,(,1,7,$/('878<$8)/(;,%/('2,7(75((7(1'8(&203/(7(0(17'(
0$1,(5($(/,0,1(5/(3/,66(0(17'(&(77(0$1,(5(/(',$0(75(,17(51(6(/$5*,5$
6(16,%/(0(17&(48,)$925,6(5$/(175((
'QLUOHSRVLWLRQQHPHQWGXSROHSDUUDSSRUWDXPXU JD 
'PRQWHUODSDUWLHVXSULHXUHGXSDQQHDXDUULUH  HWHQOHYHUXQGHVGHX[ERXFKRQVSUGFRXSVDXQLYHDXGHV
UDFFRUGVGHVRUWLHGDLUFKDXG JE 
$FWLYHUOHOHYLHUGHFRPPDQGHGHODFDQDOLVDWLRQGDLUFKDXG  HQHQOHYDQWODSODTXHWWHGHYHUURXLOODJH   JE 
&RXSHUOHFDFKHFRQGXLWDX[PHVXUHVDGTXDWHV  HQLQWHUYHQDQWVXUODSDUWLHGXFRWGXPXU JF 
3ODFHUOHSROHGDQVVDSRVLWLRQGQLWLYH
FRANAIS

WHQGUHOHWX\DXHQDOXPLQLXP  SRXUODFDQDOLVDWLRQGHODLUFKDXGVDQVOHEUDQFKHUDXUDFFRUGGXSROH
0HWWUHHQSODFHSUDODEOHPHQWVXUOHWX\DXHQDOXPLQLXPODURVDFH  HWOHFDFKHWX\DX D VDQVOHEORTXHU JF 
0HWWUHHQSODFHOHWX\DXHQDOXPLQLXPVXUOHUDFFRUGGHVRUWLHGDLUFKDXGODUULUHGXSROH   JG 
5HPRQWHUODSDUWLHVXSULHXUHGXSDQQHDXDUULUH  
3ODFHUOHFDFKHWX\DX[  GDQVVDSRVLWLRQGQLWLYHHWOH[HUODUULUHGXSROHDYHFOHVYLVIRXUQLHV   JG 
,QVWDOOHUODJRXORWWHWHUPLQDOH  HWOHWX\DXHQDOXPLQLXPFRUUHVSRQGDQW  HQOH[DQWDYHFOHFROOLHUPXUDO  HWOHVFKHYLOOHV
DYHFYLV   JG 
)L[HUODURVDFHPXUDOH  DYHFGXVLOLFRQH JG 

JD JE 2
2

132
133 1
5
7

13
4 6 6a
132

JF 5
9 9
8

6 10 11

10 9
9 4
10
8 8
JG 5
4 2
8
7

5
6 6

Qq .,7%,6
 %RLWH  
 7X\DX  
4 *RXORWWHWHUPLQDOH  
 Rosace murale  
6a &DFKHFRQGXLW  
 9LVGH[DWLRQFDFKHFRQGXLW 4 
8 &ROOLHUGHEORFDJHGHVWX\DX[  
 &ROOLHUPXUDO  
 9LV 4 
 &KHYLOOHV 4 
- 58 -
INSTALLATION
PH62/87,21.,7 FRGH HW.,7%,6 FRGH /(6'(8;3,(&(6
1%/(678<$8;'2,9(17(75((1),/(6685/(65$&&25'6'(6257,('$,5&+$8'$9$17
'$33/,48(5/(5(9(7(0(17(7$35(6$92,5'(0217(/(&27(/$7(5$/683(5,(85(1
)217(/$3$57,(,1,7,$/('878<$8)/(;,%/('2,7(75((7(1'8(&203/(7(0(17'(
0$1,(5($(/,0,1(5/(3/,66(0(17'(&(77(0$1,(5(/(',$0(75(,17(51(6(/$5*,5$
6(16,%/(0(17&(48,)$925,6(5$/(175((
'QLUOHSRVLWLRQQHPHQWGXSROHSDUUDSSRUWDXPXU JD 
'PRQWHUODSDUWLHVXSULHXUHGXSDQQHDXDUULUH  HWHQOHYHUOHVERXFKRQVSUGFRXSVDXQLYHDXGHVUDFFRUGVGHVRUWLH
GDLUFKDXG JE 
$FWLYHUOHVOHYLHUVGHFRPPDQGHGHODFDQDOLVDWLRQGDLUFKDXG  HQHQOHYDQWOHVSODTXHWWHVGHYHUURXLOODJH   JE 
&RXSHUOHFDFKHFRQGXLWDX[PHVXUHVDGTXDWHV  HQLQWHUYHQDQWVXUODSDUWLHGXFRWGXPXU JF 
3ODFHUOHSROHGDQVVDSRVLWLRQGQLWLYH

FRANAIS
WHQGUHOHVWX\DX[HQDOXPLQLXP  SRXUODFDQDOLVDWLRQGHODLUFKDXGVDQVOHVEUDQFKHUDXUDFFRUGGXSROH
0HWWUHHQSODFHSUDODEOHPHQWVXUOHVWX\DX[HQDOXPLQLXPOHVURVDFHV  HWOHVFDFKHWX\DX[ D VDQVOHEORTXHU JF 
0HWWUHHQSODFHOHWX\DX[HQDOXPLQLXPVXUOHVUDFFRUGVGHVRUWLHGDLUFKDXGODUULUHGXSROH   JG 
5HPRQWHUODSDUWLHVXSULHXUHGXSDQQHDXDUULUH  
3ODFHUOHFDFKHWX\DX[  GDQVVDSRVLWLRQGQLWLYHOHVFDFKHWX\DX[GQLWLYHHWOHV[HUODUULUHGXSROHDYHFOHVYLV
IRXUQLHV   JG 
,QVWDOOHUOHVJRXORWWHVWHUPLQDOHV  HWOHVWX\DX[HQDOXPLQLXPFRUUHVSRQGDQWV  HQOHV[DQWDYHFOHVFROOLHUPXUDO  HW
OHVFKHYLOOHVDYHFYLV   JG 
)L[HUOHVURVDFHVPXUDOHV  DYHFGXVLOLFRQH JG 

JD JE
2

5
3 132 1
5
133 2
7
6
13 4
6a

6 6a
132

JF 5 3 8
9 9

6 10 11

4
8
5

10 9 4
10 9
8 8
JG 5
4 3 2
8
7
8 6

4 5
6 5 6

Qq .,7 .,7%,6


 %RLWH   
 7X\DX  - 
 7X\DX   -
4 *RXORWWHWHUPLQDOH   
 Rosace murale   
6a &DFKHFRQGXLW   
 9LVGH[DWLRQFDFKHFRQGXLW 8  
8 &ROOLHUGHEORFDJHGHVWX\DX[ 4  
 &ROOLHUPXUDO  - 
 9LV 4 - 
 &KHYLOOHV 4 - 
- 59 -
,16758&7,216'87,/,6$7,21
/DPLVHHQVHUYLFHGRLWrWUHUpDOLVpHSDUOH&HQWUHG$VVLVWDQ-
FH7HFKQLTXHDXWRULVp(GLONDPLQ &$7 DXPRPHQWGXSUH-
PLHUDOOXPDJHHWGHOHVVDLGDQVOHUHVSHFWGHODQRUPH81,


&HWWHQRUPHLQGLTXHOHVRSpUDWLRQVGHFRQWU{OHjHIIHFWXHUVXU
SODFHD\DQWSRXUEXWGpWDEOLUOHIRQFWLRQQHPHQWFRUUHFWGX
V\VWqPH

$9$17'$//80(5
3RXUOHSUHPLHUDOOXPDJHLOHVWLQGLVSHQVDEOHGHVDGUHVVHUDX
&HQWUHG$VVLVWDQFH7HFKQLTXH(GLONDPLQOHSOXVSUqV &$7 
FRANAIS

(pour toute information, consulter le site Internet www.edilka-


min.com TXLUpJOHUDODSRrOHVXUODEDVHGXW\SHGHSHOOHWHW
GHVFRQGLWLRQVGLQVWDOODWLRQHQDFWLYDQWDLQVLODJDUDQWLH J
'DQVOHFDVRODOOXPDJHQHVRLWSDVHIIHFWXpSDUXQ&HQWUH
G$VVLVWDQFH7HFKQLTXHDXWRULVp(GLONDPLQQHSRXUUDSDV
garantir son bon fonctionnement.

3HQGDQWOHVSUHPLHUVDOOXPDJHVGHOJUHVRGHXUVGHSHLQWXUH
peuvent se dgager et elles disparaitront en peu de temps.

$YDQWGDOOXPHULOHVWQFHVVDLUHGHYULHU
/LQVWDOODWLRQFRUUHFWH
/DOLPHQWDWLRQOHFWULTXH
La fermeture de la porte, qui doit tre tanche
Le nettoyage du creuset
/DSUVHQFHVXUOHGLVSOD\GHOLQGLFDWLRQGHVWDQGE\
(date, puissance ou temprature clignotante).

&+$5*(0(17'83(//(7'$16/(56(592,5
/HFRXYHUFOHGXUVHUYRLUVRXYUHHWVHIHUPHJUFHDXV\VWPH
GHFOLFNFODFNSUDWLTXHHQH[HUDQWXQHOJUHSUHVVLRQVXUOD
SDUWLHDQWULHXUHGXFRXYHUFOHHQIRQWH J 

ATTENTION :
XWLOLVHUOHJDQWVSFLDOIRXUQLVLRQFKDUJHOHSROHSHQGDQW
TXLOIRQFWLRQQHHWTXLOHVWGRQFFKDXG.

127(VXUOHFRPEXVWLEOH
Le pole est conu et programmes pour bruler du pellet. Le /XWLOLVDWLRQGHSHOOHWVDYHFGHVFDUDFWULVWLTXHVGLIIUHQWHV
pellet est un combustible qui se prsente sous forme de petits LPSOLTXHODQFHVVLWGXQQRXYHOWDORQQDJHGHVSROHVDQD-
cylindres, obtenus en comprimant de la sciure, des valeurs ORJXHFHOXLTXHIDLWOHUHYHQGHXUDXHUDOOXPDJH
OHYHVVDQVXWLOLVDWLRQGHOLDQWVRXDXWUHVPDWULDX[WUDQJHUV /XWLOLVDWLRQGHSHOOHWVQRQDGDSWVSHXWSURYRTXHUGLPLQX-
,OHVWFRPPHUFLDOLVGDQVGHVVDFVGHNJ tion du rendement ; anomalies de fonctionnement ; blocages
3RXU1(3$6FRPSURPHWWUHOHIRQFWLRQQHPHQWGHVSROHVLO par obstruction, salet sur la vitre, non bruls...
HVWLQGLVSHQVDEOHGH1(3$6EUXOHUDXWUHFKRVH/HPSORL 8QHVLPSOHDQDO\VHGXSHOOHWSHXWWUHIDLWHYLVXHOOHPHQW
GDXWUHVPDWULDX[ ERLVFRPSULV TXLSHXWWUHUHOHYDYHFGHV %RQQHTXDOLWOLVVHORQJXHXUUJXOLUHSHXSRXGUHX[
DQDO\VHVHQODERUDWRLUHHQWUDLQHOH[SLUDWLRQGHODJDUDQWLH 0DXYDLVHTXDOLW fentes longitudinales et transversales, trs
(GLONDPLQDFRQXWHVWHWSURJUDPPVHVSURGXLWVDQTXLOV SRXVVLUHX[ORQJXHXUWUVYDULDEOHHWDYHFSUVHQFHGHFRUSV
JDUDQWLVVHQWOHVPHLOOHXUHVSUHVWDWLRQVDYHFGXSHOOHWDX[ trangers.
caractristiques suivantes :
GLDPWUHPP
ORQJXHXUPD[LPXPPP
KXPLGLWPD[LPXP
UHQGHPHQWFDORULTXHNFDONJDXPRLQV

- 60 -
,16758&7,216'87,/,6$7,21
TABLEAU SYNOPTIQUE
DSSX\HUSHQGDQWSRXUDOOXPHUHWWHLQGUH

$SSX\HUEULYHPHQWSRXUFRPPXWHUOHIRQFWLRQQHPHQWGXSROHGHPDQXHODXWRPDWLTXH/DSSXLSURORQJ SHQ-
GDQW SHUPHWGDFFGHUDX[GLIIUHQWVPHQXVGHSURJUDPPDWLRQ

pour augmenter les diffrents rglages

pour diminuer les diffrents rglages

FRANAIS
&KDTXHSUHVVLRQLQIRUPHODPPRLUHGHODFDUWHOHFWURQLTXHTXHNJRQWWLQWURGXLWVGDQVOHUVHUYRLUXQHSUHV-
VLRQFRQWLQXHSHQGDQWHIIDFHOHVNJUVLGXHOVRXFHX[SUFGHPPHQWLQWURGXLWV

8QDSSXLEUHIFRPPXWHDOWHUQDWLYHPHQWODYHQWLODWLRQGXSROHGXQQLYHDXSOXVVLOHQFLHX[DSSHO&RQIRUWXQ
QLYHDXSOXVQHUJLTXHDSSHO7XUER

7RXFKHUHQFRUUHVSRQGDQFHGHVSRLQWVOHGVSRXUVOHFWLRQQHUODSXLVVDQFHGHWUDYDLOGVLUH
'DQVODOWHUQDWLYHYRXVSRXYH]XWLOLVHUODSURJUDPPDWLRQWUDGLWLRQQHOOHHQLQWHUYHQDQWVXUOHV
 WRXFKHV

5HPSOLVVDJHYLVVDQVQ
Si on vide compltement le rservoir du pellet, il est ncessaire $OOXPDJHPDQXHO
GHUHPSOLUODYLVVDQVQHQPPHWHPSVVXUOHVWRXFKHVHW (QFDVGHWHPSUDWXUHLQIULHXUHq&TXLQHSHUPHWSDV
- (sur la tlcommande ou sur le panneau synoptique) pendant la rsistance lectrique de devenir brulante ou si la rsistance
TXHOTXHVVHFRQGHVDSUVTXRLRQUHOFKHOHVWRXFKHVGXGLVSOD\ ne fonctionne pas temporairement on peut utiliser des cubes
HW5(&+$5*(DSSDUDLW/RSUDWLRQGRLWVHIIHFWXHUDYDQW DOOXPHIHXSRXUDOOXPHUOHSROH,QWURGXLUHXQSHWLWFXEHDOOX-
ODOOXPDJHVLOHSROHVHVWDUUWFDXVHGHOSXLVHPHQWGX me-feu bien allum dans le creuset, fermer la porte et appuyer
SHOOHW,OHVWQRUPDOTXLOUHVWHXQHTXDQWLWUVLGXHOOHGHSHOOHW VXUVXUOHSDQQHDXV\QRSWLTXHRXVXUODWOFRPPDQGH
GDQVOHUVHUYRLUTXHODYLVVDQVQQHUXVVLWSDVDVSLUHU
8QHIRLVSDUPRLVDVSLUHUFRPSOWHPHQWOHUVHUYRLUSRXU 5JLPHVGHIRQFWLRQQHPHQW
YLWHUGDFFXPXOHUGHVUVLGXVSRXGUHX[ Manuel:OXWLOLVDWHXUUJOHODSXLVVDQFHGHWUDYDLOVRXKDLWH
GHPLQLPXPPD[LPXP 
$OOXPDJHDXWRPDWLTXH $XWRPDWLTXH programmer la temprature souhaite dans la
4XDQGOHSROHHVWHQVWDQGE\VLRQDSSXLHSHQGDQWVXUOD SLFHDYHFOHVWRXFKHVRXDYHFODWOFRPPDQGHOHSROHOD
WRXFKH VXUOHSDQQHDXV\QRSWLTXHRXVXUODWOFRPPDQGH  OLUDHWPRGXOHUDODSXLVVDQFHMXVTXOREWHQWLRQGHODWHPSUD-
RQPHWHQPDUFKHODSURFGXUHGDOOXPDJHHWRQYRLWVDIFKHU WXUHSURJUDPPHSRXUVHSODFHUHQVXLWHHQSXLVVDQFH
$OOXPDJHHWXQFRPSWHUHERXUVHQVHFRQGHV  /DSKDVH
GDOOXPDJHQHVWFHSHQGDQWSDVGXUHSUGWHUPLQHVD )RQFWLRQQHPHQWPDQXHOSDUWLUGXSDQQHDXV\QRSWLTXH
dure est automatiquement abrge si la carte relve la rus- WOFRPPDQGH
VLWHGHFHUWDLQVWHVWV$XERXWGHPLQXWHVHQYLURQODDPPH 4XDQGOHSROHHVWHQPDUFKHRXHQVWDQGE\HWTXRQ
apparait. DSSXLHXQHIRLVVXUODWRXFKH0(18VXUOHSDQQHDXV\QRSWL-
TXHWOFRPPDQGHOHGLVSOD\DIFKH3XLVVDQFH DYHFOD
puissance laquelle le pole travaille), e en appuyant sur la
WRXFKHGHODWOFRPPDQGHRQSHXWDXJPHQWHUODSXLVVDQFH
GHIRQFWLRQQHPHQW GH3XLVVDQFH3XLVVDQFH 
- 61 -
,16758&7,216'87,/,6$7,21
)RQFWLRQQHPHQWDXWRPDWLTXHSDUWLUGXSDQQHDXV\QRSWL- (QDSSX\DQWVXFFHVVLYHPHQWVXURQSHXWYRLU
TXHWOFRPPDQGH 1R3URJUDPPHV
(QDSSX\DQWVXUODWRXFKH0(18IRLVRQSDVVHGHIRQFWLRQ- HU3URJUDPPHMRXUQDOLHU XQDOOXPDJHHWXQHH[WLQFWLRQ
nement manuel fonctionnement automatique en rglant la SDUMRXU PH3URJUDPPHMRXUQDOLHU LGHP PH3URJUDP-
WHPSUDWXUHTXRQVRXKDLWHDWWHLQGUHGDQVODSLFH SRXUUJOHU me journalier (idem)
ODWHPSUDWXUHGHq&q&XWLOLVHUOHVWRXFKHVHWDYHF 8WLOLVHUODWRXFKH0(18SRXUYLVXDOLVHUGDQVOHVHQVLQYHUVH
la tlcommande) et le pole rgle la puissance de travail pour 6LRQVOHFWLRQQHOHHUSURJUDPPHOKHXUHGHODOOXPDJHVDIFKH
ODWWHLQGUH 6XUOHGLVSOD\DSSDUDLW$OOXPKHXUHVDYHFODWRXFKH
Si on programme une temprature infrieure celle de la RQFKDQJHOKHXUHHWRQFRQUPHDYHF0(18
SLFHOHSROHWUDYDLOOHHQ3XLVVDQFH 6XUOHGLVSOD\DSSDUDLW$OOXPPLQXWHVDYHFOD
WRXFKHRQFKDQJHOHVPLQXWHVHWRQFRQUPHDYHF0(18
Extinction 'HODPPHPDQLUHRQUJOHOKHXUHGHVH[WLQFWLRQV/D
FRANAIS

3RXUXQSOXVJUDQGFRQIRUWOHSROHVWHLQWDYHFOHVYHQWLOD- FRQUPDWLRQGXSURJUDPPHHVWGRQQHHQDSSX\DQWVXUOD
WHXUVGDLUDPELDQWODPPHSXLVVDQFHODTXHOOHLOWUDYDLOODLW WRXFKH0(18TXDQGRQOLW6DXYHJDUGH2.VXUOHGLVSOD\
4XDQGOHSROHHVWHQPDUFKHHQDSSX\DQWSHQGDQWVXUOD (QFRQUPDQW3URJUDPPHVHPDLQHRQGHYUDFKRLVLUTXHO
WRXFKH VXUOHSDQQHDXV\QRSWLTXHRXVXUODWOFRPPDQGH jour effectuer la programmation:
RQGPDUUHODSURFGXUHGH[WLQFWLRQHWOHFRPSWHUHERXUV /X0D0H-H9H6D'L
VDIFKHHWFHODHVWYDULDEOHVHORQODSXLVVDQFHODTXHOOHVH 8QHIRLVTXRQDVOHFWLRQQOHMRXUHQOHVGURXODQWDYHFOHV
WURXYDLWOHSROHORUVTXHODSKDVHGH[WLQFWLRQDWGPDUUH WRXFKHVHWHQFRQUPDQWDYHFODWRXFKH0(18RQFRQWLQXH-
/DSKDVHGH[WLQFWLRQ TXLDSRXUREMHFWLIGWHLQGUHODDPPH ra avec la programmation avec la mme modalit avec laquelle
ne pas laisser de non bruls dans le creuset et de refroidir le RQHIIHFWXHXQ3URJUDPPHMRXUQDOLHUHQFKRLVLVVDQWSRXU
pole) prvoit: chaque jour de la semaine si on va activer une programmation en
,QWHUUXSWLRQGHODFKXWHGXSHOOHW WDEOLVVDQWOHQRPEUHGLQWHUYHQWLRQVHWTXHOOHVKHXUHV(QFDV
9HQWLODWLRQDFWLYHDXQLYHDXDXTXHOOHSROHWDLWHQWUDLQ GHUUHXUWRXWPRPHQWGHODSURJUDPPDWLRQRQSHXWVRUWLUGX
de travailler SURJUDPPHVDQVVDXYHJDUGHUHQDSSX\DQWVXUODWRXFKH
0RWHXUH[SXOVLRQIXPHVDFWLI
1HMDPDLVGEUDQFKHUODSULVHSHQGDQWOHVSKDVHVGH[WLQFWLRQ 1RWHVXUODYDULDELOLWGHODDPPH
(YHQWXDOLYDULD]LRQLGHOORVWDWRGHOODDPPDGLSHQGRQRGDO
Rglage horloge 'HVYHQWXHOOHVYDULDWLRQVGHOWDWGHODDPPHGSHQGHQWGX
(QDSSX\DQWSHQGDQWVXUODWRXFKH0(18HWHQVXLYDQW type de pellet employ, ainsi que de la variabilit normale de
DYHFOHVWRXFKHVHWOHVLQGLFDWLRQVGXGLVSOD\RQDFFGH ODDPPHGXQFRPEXVWLEOHVROLGHHWGHVQHWWR\DJHVSULRGL-
DX0(18+RUORJH(QSHUPHWWDQWGHUJOHUOKRUORJH ques du creuset que le pole effectue automatiquement
OLQWULHXUGHODFDUWHOHFWURQLTXH 1%OHQHWWR\DJHDXWRPDWLTXHHIIHFWXSDUOHSROHQHUHPSOD-
(QDSSX\DQWVXFFHVVLYHPHQWVXUODWRXFKH0(18OHVGRQQHV FHSDVODVSLUDWLRQIURLGTXLHVWQFHVVDLUHHWGRLWWUH
suivantes apparaissent ensuite et peuvent tre rgles : IDLWHSDUOXWLOLVDWHXUDYDQWODOOXPDJH
-RXU0RLV$QQH+HXUH0LQXWHV-RXUGHODVHPDLQH
/DIFKDJH6DXYHJDUGHU""FRQUPHUDYHFOH0(18SHUPHW Signalisation rserve pellet
GHYULHUOH[DFWLWXGHGHVRSUDWLRQVDFFRPSOLHVDYDQWGHOHV /HVSROHVVRQWGRWVGXQHIRQFWLRQOHFWURQLTXHGHGWHFWLRQ
FRQUPHU LOVDIFKHDORUV6DXYHJDUGH2.VXUOHGLVSOD\  de la quantit de pellet. Le systme de dtection de pellet,
LQWJUOLQWULHXUGHODFDUWHOHFWURQLTXHSHUPHWDXSROHGH
3URJUDPPDWHXUGDOOXPDJHVHWGH[WLQFWLRQVKRUDLUHVSHQ- contrler tout moment pendant le fonctionnement combien de
GDQWODVHPDLQH NLORVLOUHVWHDYDQWOSXLVHPHQWGXFKDUJHPHQWGHSHOOHWHIIHF-
(QDSSX\DQWSHQGDQWVHFRQGHVVXUODWRXFKH0(18DYHF WX3RXUXQIRQFWLRQQHPHQWFRUUHFWGXV\VWPHLOHVWLPSRUWDQW
ODWOFRPPDQGHRQDFFGHDXUJODJHGHOKRUORJHHWHQ TXDXHUDOOXPDJH TXLGRLWWUHHIIHFWXSDUOHUHYHQGHXU OD
DSSX\DQWVXUODWRXFKHRQDFFGHODIRQFWLRQGHSURJUDP- SURFGXUHVXLYDQWHVRLWHIIHFWXH$YDQWGHFRPPHQFHUXWLOL-
PDWLRQKRUDLUHKHEGRPDGDLUHLGHQWLHVXUOHGLVSOD\DYHFOD ser le systme de dtection du pellet il faut charger et consom-
GHVFULSWLRQ3URJUDP212)) PHUFRPSOWHPHQWXQSUHPLHUVDFGHSHOOHWDQGREWHQLUXQ
/DSURJUDPPDWLRQSHUPHWGWDEOLUXQQRPEUHGDOOXPDJHVHW bref rodage du systme de chargement.
GH[WLQFWLRQVSDUMRXU MXVTXWURLVDXPD[LPXP SRXUFKDTXH &KDUJHUGRQFNJGHSHOOHW
jour de la semaine. Ensuite appuyer une fois sur la touche rserve , ainsi il reste-
(QFRQUPDQWVXUOHGLVSOD\DYHFODWRXFKH0(18XQH UDHQPPRLUHTXHNJRQWWFKDUJV
des possibilits suivantes apparait : $SDUWLUGHFHPRPHQWOHGLVSOD\DIFKHFHTXLUHVWHGHSHOOHW
1R3URJ DXFXQSURJUDPPHWDEOL DYHFXQHLQGLFDWLRQGFURLVVDQWHHQNJ  
3URJUDPMRXUQDO SURJUDPPHXQLTXHSRXUWRXVOHVMRXUV $FKDTXHUHFKDUJHODTXDQWLWGHSHOOHWFKDUJHVWPPRULVH
3URJUDP6HPDLQH SURJUDPPHGLIIUHQWSRXUFKDTXHMRXU  3RXUPPRULVHUXQHUHFKDUJHGHNJLOVXIUDGDSSX\HUVXU
2QSDVVHGHOXQHODXWUHDYHFOHVWRXFKHVHW la touche chargement pellet ; pour une quantit diffren-
(QFRQUPDQWDYHFODWRXFKH0(18OHVRSWLRQV3URJUDP WHRXHQFDVGHUUHXURQSHXWLQGLTXHUODTXDQWLWWUDYHUVOH
MRXUQDORQDFFGHDXFKRL[GXQRPEUHGHSURJUDPPHV menu rserve pellet comme indiqu ci-dessous. En appuyant
DOOXPDJHVH[WLQFWLRQV SRXYDQWWUHHIIHFWXVHQXQMRXU SHQGDQWVXUODWRXFKH0(18LODSSDUDLW5(*/$*(6
(QXWLOLVDQW3URJUDPMRXUQDOOHOHVSURJUDPPH V WDEOL (QDSSX\DQWVXUODWRXFKHRXFRQVFXWLYHPHQWLODSSDUDLW
s) sera le mme pour tous les jours de la semaine. 5(6(59(
- 62 -
,16758&7,216'87,/,6$7,21
(QFRQUPDQWDYHFODWRXFKH0(18ODTXDQWLWGHSHOOHW /HUJODJHGHODWHPSUDWXUHDYHFWKHUPRVWDWH[WULHXU
SUVHQWHDSSDUDLWODTXDQWLWFKDUJH GHGHIDXOWYDULDEOH un systme de contrle de la temprature ambiante autre que
DYHFOHVWRXFKHV  la tlcommande est disponible ; en effet, il est possible de
$SSX\HUVXUODWRXFKHSRXUDXJPHQWHUOHVNJLQWURGXLUHHW FRQQHFWHUDXSRUWVULHOHSURSUHWKHUPRVWDWGDPELDQFHGHOD
VXUODWRXFKHSRXUOHVGLPLQXHU$SSX\HUVXUODWRXFKHGHPD- maison ou ou un autre dispositif quelconque (sortie en contact
QLUHSURORQJHSRXUDWWHLQGUHODFKDUJHNJ 5ODIFKHXU  sec) facile trouver.
et effacer ainsi la charge rsiduelle.
6LOHSHOOHWVSXLVHGDQVOHUVHUYRLUOHSROHVHEORTXHHW /HSROHUHFRQQDLWUDDXWRPDWLTXHPHQWODFRQQH[LRQDXSRUW
DIFKH6WRS)ODPPH YRLUSDJH  srie du thermostat en observant les conditions suivantes :
1%'HWHPSVHQWHPSVQHSDVRXEOLHUGHUHPHWWUH]UROD $YHFXQHWHPSUDWXUHDPELDQWHLQIULHXUHODFRQJXUDWLRQ
signalisation rserve pellets , pour permettre une meilleure du thermostat (contact ferm), le pole rgule normalement les
puissances pour suivre la temprature paramtre.

FRANAIS
DELOLWGHFHWWHIRQFWLRQ
3RXUWRXWFODLUFLVVHPHQWFRQWDFWHUOH5HYHQGHXUTXLDHIIHFWX 8QHIRLVTXHOHWKHUPRVWDWDDWWHLQWODWHPSUDWXUHDPELDQWH
le premier allumage. (contact ouvert), le pole se met en phase de stand-by.
,OVDJLWGXQHYDOHXULQGLFDWLYH3RXUDYRLUSOXVGHSUFLVLRQLO
IDXWUHPHWWUH]URDYDQWGHIIHFWXHUOHQRXYHDXFKDUJHPHQW 7HPSUDWXUH
(GLONDPLQQHUSRQGUDHQDXFXQHPDQLUHHQFDVGHYDULD- 7HPSUDWXUH fournie par $XFXQUJODJH
tion par rapport ce qui a t indiqu (cela peut dpendre de &RQJXUDWLRQ fournie par la le thermostat FRQJXUDWLRQ
tlcommande d'ambiance en usine)
IDFWHXUVH[WULHXUV 
H[WULHXU
5JODJHGHODWHPSUDWXUHDPELDQWH 3DUDPWUH
un rglage simple et pratique prvu en srie sur cette ligne de &RPIRUW 21 21 21
produits permet de grer la puissance du thermopole en fon- &OLPD
ction de la temprature ambiante.
$YDQWGDFWLYHUODIRQFWLRQ&RPIRUW&OLPDSDUWLUGXPHQX 3DUDPWUH
21 2)) 21
SDUDPWUHV GHPDQGHUDX&$7 LOHVWSRVVLEOHGXWLOLVHUFHWWH 621'$,5
fonction pour teindre le pole une fois que la temprature con-
JXUHDWDWWHLQWH&HWWHIRQFWLRQHVWDVVRFLHODFRQJXUD- 121 2XL 121
&RQQH[LRQDX
aucune DYHFFEOH aucune
WLRQGXSROHHQ$8720$7,48(OHIRQFWLRQQHPHQWHQPRGH port srie
FRQQH[LRQ srie bleu FRQQH[LRQ
0$18(/UHVWHUDLQFKDQJTXRLTXLOHQVRLW
6XLWHOKDELOLWDWLRQHIIHFWXHSDUOH&$7LOHVWSRVVLEOH
GDFWLYHUGHGVDFWLYHUODIRQFWLRQ&RPIRUWFOLPDSDUWLUGX
PHQXXWLOLVDWHXUHQIRQFHUODWRXFKH6(7FKHUFKHUOHPHQX
&RPIRUWFOLPDDYHFOHVWRXFKHVOHVOHFWLRQQHUDYHFOD
WRXFKH6(7FRQJXUHU212))DYHFOHVWRXFKHVVDXYH-
JDUGHUODFRQJXUDWLRQVRXKDLWHHQVRUWDQWDYHFODWRXFKH

'WDLOIRQFWLRQQHPHQW&RPIRUWFOLPD21
OHSROHTXDQGLOHVWPLVHQ$,720$7,48(UJXOHVDSXLV-
VDQFHHQVXLYDQWODWHPSUDWXUHFRQJXUHSDUOXWLOLVDWHXU
XQHIRLVODWHPSUDWXUHDPELDQWHDWWHLQWHOHSROHVWHLQWSRXU
ensuite se rallumer lorsque la temprature descend.

6OHFWLRQWHPSUDWXUH
(QPRGH&RPIRUW&OLPDHQHQIRQDQWOHVWRXFKHVVXUOH
SDQQHDXV\QRSWLTXHRXVXUODWOFRPPDQGHRQFRQJXUHVXU
OFUDQODWHPSUDWXUHVRXKDLWHGDQVODSLFHRQDXUDGRQFOHV
situations suivantes :
$YHFXQHWHPSUDWXUHDPELDQWHLQIULHXUHODFRQJXUDWLRQ
OHSROHVDOOXPHGHPDQLUHDXWRQRPHHQUJXODQWDXWRPDWL-
quement la puissance.
4XDQGODWHPSUDWXUHDPELDQWHDWDWWHLQWH q& OH
pole se met en phase de stand-by, la temprature ambiante
est transmise par la tlcommande fournie ; le transmetteur de
ODWOFRPPDQGHGRLWVHWURXYHUGDQVODOLJQHPHQWYLVXHOGX
rcepteur du panneau synoptique.
6LHQUDLVRQGXQSRVLWLRQQHPHQWLQFRUUHFWGHODWOFRPPDQ-
GHOHQYRLGHODWHPSUDWXUHHQUHJLVWUHSDUFHWWHGHUQLUHQH
se fait pas, le pole dcide de manire autonome de passer
OXWLOLVDWLRQGHODVRQGHGHWHPSUDWXUHLQVWDOOHERUGHWFH
MXVTXFHTXHODFRQQH[LRQDYHFODWOFRPPDQGHVRLWUWDEOLH
- 63 -
,16758&7,216'87,/,6$7,21
7/&200$1'(FRG

Lgende touches et display:


WRXFKHDOOXPDJHH[WLQFWLRQ
+ WRXFKHSRXUDXJPHQWHUODSXLVVDQFHWHPSUDWXUHGHWUDYDLO OLQWULHXUGXQPHQXHOOHDXJPHQWHODYDULDEOHDIFKH
- WRXFKHSRXUGLPLQXHUODSXLVVDQFHWHPSUDWXUHGHWUDYDLO OLQWULHXUGXQPHQXHOOHGLPLQXHODYDULDEOHDIFKH
A WRXFKHSRXUSDVVHUODSURJUDPPDWLRQ($6<7,0(5
M : touche pour passer alternativement de la fonction automatique la fonction manuelle et vice versa.

,QGLTXHXQHWUDQVPLVVLRQGHGRQQHVGHODWOFRPPDQGH
la carte.
FRANAIS

&ODYLHUEORTXYLWHOHVPLVHVHQURXWHQRQVRXKDLWHV
DSSX\HUVXU$HW0HQPPHWHPSVSHQGDQW
TXHOTXHVVHFRQGHVSRXUEORTXHUGEORTXHUOHFODYLHU 

EDWWHULHGFKDUJH SLOHVDOFDOLQHPLQLVW\OR$$$

,QGLTXHTXRQHVWHQWUDLQGHUJOHUXQDOOXPDJHH[WLQFWLRQDYHF
OHSURJUDPPH($6<7,0(5

,QGLTXHODWHPSUDWXUHDPELDQWHUHOHYHSDUODWOFRPPDQGH
ORUVGHODFRQJXUDWLRQWHFKQLTXHGHODWOFRPPDQGHLQGLTXHOHV
valeurs des paramtres rgls).

,QGLTXHTXXQRUGUHGDOOXPDJHGHSROHDWWUDQVPLV

,QGLFDWHXUGXUJODJHGHODWOFRPPDQGHSRXUXQSROH
SHOOHWVDLU

Fonction automatique
ODYDOHXUGHODWHPSUDWXUHDSSDUDLWVXUOFUDQ

Fonction de rglage manuel


ODYDOHXUGHODSXLVVDQFHGHWUDYDLODSSDUDLWVXUOFUDQ

7(03(5$785(5(/(9((3$5/$7(/(&200$1'(
/DWOFRPPDQGHHVWGRWHGHVRQGHLQWHUQHSRXUUHOHYHUODWHPSUDWXUHDPELDQWHTXLVDIFKHHQWHPSVUHOVXUOFUDQ
/DWHPSUDWXUHUHOHYHHVWWUDQVPLVHSULRGLTXHPHQWODFDUWHOHFWURQLTXHGHOLQVHUWSROHVLOHOHGWUDQVPHWWHXUGHODWOFRP-
PDQGHHWOHFDSWHXUUFHSWHXUGXSDQQHDXV\QRSWLTXHGHOLQVHUWSROHVHWURXYHQWGDQVOHFKDPSGHYLVLRQOXQGHODXWUH
6LODWHPSUDWXUHGHODWOFRPPDQGHQDUULYHSDVODFDUWHGHOLQVHUWSROHSHQGDQWSOXVGHPLQXWHVRQXWLOLVHODWHPSUDWXUH
provenant de la sonde relie dans le panneau synoptique.

352&'85(6'(6/(&7,21/235$7,21
(QDSSX\DQWEULYHPHQWVXUODWRXFKH0RQSHXWIDLUHGOHUHWUJOHUOHVIRQFWLRQVVXLYDQWHV
rglage automatique de la puissance

rglage manuel de la puissance

- 64 -
,16758&7,216'87,/,6$7,21
87,/,6$7,21'8352*5$00(($6<7,0(5
,OHVWSRVVLEOHGXWLOLVHUDXPR\HQGHODWOFRPPDQGHXQHSURJUDPPDWLRQKRUDLUHWUVLQWXLWLYHHWUDSLGH
- 6LOHSROHHVWDOOXPLOHVWSRVVLEOHGHSURJUDPPHUOH[WLQFWLRQDYHFXQWHPSVGLIIUUJODEOHHQWUHXQHHWGRX]HKHXUHVVXU
ODIFKHXUGXSDQQHDXV\QRSWLTXHVHUDDIFKOHWHPSVUHVWDQWDYDQWOH[WLQFWLRQSURJUDPPH
- 6LOHSROHHVWWHLQWLOHVWSRVVLEOHGHSURJUDPPHUODOOXPDJHDYHFXQWHPSVGLIIUUJODEOHHQWUHXQHHWGRX]HKHXUHVVXU
ODIFKHXUGXSDQQHDXV\QRSWLTXHVHUDDIFKOHWHPSVUHVWDQWDYDQWODOOXPDJHSURJUDPP

- Rglage: pour rgler le timer continuer comme indiqu:


D $SSX\HUVXUODWRXFKH$OLFQH VDOOXPHVXUOFUDQFHTXLFRQUPHODFFVODSURJUDPPDWLRQ(DV\
WLPHU
E $YHFOHVWRXFKHVUJOHUOHQRPEUHGKHXUHVVRXKDLWH[HPSOH

FRANAIS
F 'LULJHUODWOFRPPDQGHYHUVOHUFHSWHXUGXSDQQHDXV\QRSWLTXH
G &RQUPHUODSURJUDPPDWLRQHQDSSX\DQWVXUODWRXFKH$SHQGDQWDXPRLQVGHX[VHFRQGHVOLFQH VWHLQGUDHWOLQGLFD-
WLRQGXWHPSVUHVWDQWDYDQWOLQWHUYHQWLRQSURJUDPPDSSDUDWUDVXUOHSDQQHDXV\QRSWLTXH
H 3RXUDQQXOHUODSURJUDPPDWLRQUSWHUOHVSRLQWVD E F G HQUJODQWOHQRPEUHGKHXUHV+

9(5528,//$*(&/$9,(5
2QSHXWYHUURXLOOHUOHFODYLHUGHODWOFRPPDQGHSRXUYLWHUGHVPLVHVHQURXWHDFFLGHQWHOOHVQRQFRQWUOHVSDUOXWLOLVDWHXU
(QDSSX\DQWHQPPHWHPSVVXUOHVWRXFKHV$HW0OHV\PEROHGHODFOVDOOXPHUDSRXUFRQUPHUTXHOH
FODYLHUDELHQWYHUURXLOO3RXUGEORTXHUOHFODYLHUDSSX\HUGHQRXYHDXVXUOHVWRXFKHV$HW0HQPPHWHPSV

,1',&$7,213,/(6'(&+$5*((6
/RUVTXHOLFQHGHODEDWWHULHVDOOXPHFHODLQGLTXHTXHOHVSLOHVOLQWULHXUGHODWOFRPPDQGHVRQWSUHVTXHSODW
OHVUHPSODFHUDYHFWURLVSLOHVGXPPHPRGOH VL]H$$$9 
1HSDVPODQJHUGDQVODWOFRPPDQGHGHVSLOHVQHXYHVDYHFGHVSLOHVSDUWLHOOHPHQWXWLOLVHV
1HSDVPODQJHUGHVPDUTXHVHWGHVW\SHVGLIIUHQWVFDUFKDTXHW\SHHWPDUTXHDGHVFDSDFLWVGLIIUHQWHV
1HSDVPODQJHUGHVSLOHVWUDGLWLRQQHOOHVHWGHVSLOHVUHFKDUJHDEOHV
1HSDVHVVD\HUGHUHFKDUJHUGHVSLOHVDOFDOLQHVHW]LQFFDUERQHFDUULVTXHGHFDVVXUHVRXGFRXOHPHQWVGHOLTXLGH

INFORMATIONS POUR LES UTILISATEURS


6XLYDQWODUWGXGFUHWOJLVODWLIMXLOOHWQ0LVHHQRHXYUHGHV'LUHFWLYHV&(&(HW
&(FRQFHUQDQWODUGXFWLRQGHOXWLOLVDWLRQGHVXEVWDQFHVGDQJHUHXVHVGDQVOHVDSSDUHLOVOHFWULTXHVHWOHFWURQLTXHVDLQVLTXHOH
WUDLWHPHQWGHVGFKHWV/HV\PEROHGXFRQWHQHXUEDUUUHSRUWVXUODSSDUHLORXVXUODERLWHLQGLTXHTXHTXDQGOHSURGXLWDUULYH
HQQGHYLHXWLOHLOGRLWWUHWUDLWVSDUPHQWGHVDXWUHVGFKHWV/XWLOLVDWHXUGHYUDGRQFGRQQHUODSSDUHLODUULYHQQGHYLH
DX[FHQWUHVVSFLDOLVVGHFROOHFWHVOHFWLYHGHVGFKHWVOHFWURQLTXHVHWOHFWURWHFKQLTXHVRXELHQOHUDSSRUWHUDXUHYHQGHXUDX
PRPHQWGHODFKDWGXQQRXYHODSSDUHLOGHW\SHTXLYDOHQWUDLVRQGHXQSDUXQ
- 65 -
ENTRETIEN
$YDQWGHIIHFWXHUWRXWHPDQXWHQWLRQGEUDQFKHUODSSDUHLOGXUVHDXGDOLPHQWDWLRQOHFWULTXH

8QHQWUHWLHQUJXOLHUHVWODEDVHGXERQIRQFWLRQQHPHQWGXSROH
/$%6(1&('(175(7,(1DXPRLQV6$,6211,(5SHXWSURYRTXHUXQPDXYDLVIRQFWLRQQHPHQW
'YHQWXHOVSUREOPHVGXVODEVHQFHGHQWUHWLHQHQWUDLQHURQWOH[SLUDWLRQGHODJDUDQWLH

127(7RXVOHVNJOLQVFULSWLRQ(QWUHWDSSDUDWSRXUUDSSHOHUDXSDUWLFXOLHUTXLOGRLWQHWWR\HUOHVFRQGXLWVGH
IXPHFHPHVVDJHGLVSDUDWHQDSSX\DQWSHQGDQWVHFRQGHVVXUODWRXFKH785%2
8QHIRLVDWWHLQWVOHVNJGHSHOOHWVOLQVFULSWLRQ(QWUHWUHYHQGDSSDUDWHOOHVQHGLVSDUDWSOXVHWGRQFOLQWHUYHQ-
WLRQGXQUHYHQGHXUHVWQFHVVDLUH&HPHVVDJHVHULQLWLDOLVHSDUWLUGXPHQXSDUDPWUHV

1%
FRANAIS

7RXWHPRGLFDWLRQQRQDXWRULVpHHVWLQWHUGLWH
8WLOLVH]GHVSLqFHVGHUHFKDQJHFRQVHLOOpHVSDUOHFRQVWUXFWHXU
/XWLOLVDWLRQGHFRPSRVDQWVQRQRULJLQDX[LPSOLTXHODGpFKpDQFHGHODJDUDQWLH

(175(7,(14827,',(1
2SUDWLRQVHIIHFWXHUTXDQGOHSROHHVWWHLQWIURLGHWGEUDQFKGXUVHDXOHFWULTXH
/HQHWWR\DJHGRLWWUHHIIHFWXHQVDLGDQWGXQDVSLUDWHXU YRLURSWLRQSDJH 
7RXWHODSURFGXUHQHGHPDQGHTXHTXHOTXHVPLQXWHVSDUMRXU
2XYULUOHSHWLWYROHWH[WUDLUHHWYLGHUOHWLURLUFHQGUHV J% 
1(3$6'&+$5*(5/(656,'86'$16/(7,52,5'83(//(7
(QOHYHUOHFUHXVHWRXHQOHYHUOHVFURXWHVDYHFODSHWLWHVSDWXOHIRXUQLHQHWWR\HUOHVYHQWXHOOHVRFFOXVLRQVGHVWURXVVXUWRXVOHVFRWV
(QOHYHUOHFUHXVHW   J& HWOHGVLQFUXVWHUDYHFODSHWLWHVSDWXOHQHWWR\HUOHVYHQWXHOOHVRFFOXVLRQVGHVIHQWHV
$VSLUHUODQLFKHGXFUHXVHWQHWWR\HUOHVERUGVGHFRQWDFW
6LQFHVVDLUHQHWWR\HUODYLWUH IURLG

1HMDPDLVDVSLUHUOHVFHQGUHVFKDXGHVFDUFHODFRPSURPHWODVSLUDWHXUXWLOLVHWLO\DXQULVTXHGLQFHQGLHGHVSLFHVGHODPDLVRQ

**
J% J&
(175(7,(1+(%'20$'$,5(
1HWWR\DJHGXIR\HU DYHFFRXYLOORQ DSUVDYRLUHQOHYOHVGYLDWHXUVGHIXPH J'( 
$JLUVXUOHVFRXYLOORQV J( 
9LGHUOHUVHUYRLUHWDVSLUHUOHIRQG
3HQGDQWOHQHWWR\DJHGXFUHXVHWVRXOHYHUOHVERXFKRQVGHODIXPH J) HWDVSLUHUOHVTXDWUHWX\DX[VLWXVHQGHVVRXV J)

 


* 2
2
J' J( J)
- 66 -
ENTRETIEN
ENTRETIEN SAISONNIER (par le revendeur)
&RQVLVWHHQ
1HWWR\DJHJpQpUDOLQWHUQHHWH[WHUQH
1HWWR\DJHPLQXWLHX[GHVWX\DX[GpFKDQJHVLWXpVjOLQWpULHXUGHODJULOOHGHVRUWLHGDLUFKDXGVLWXpHGDQVODSDUWLHVXSpULHXUHGH
ODIDFHGHODSRrOH
1HWWR\DJHVRLJQHX[HWGpVLQFUXVWDWLRQGXFUHXVHWHWGHVDQLFKH
1HWWR\DJHGHVYHQWLODWHXUVYpULFDWLRQPpFDQLTXHGHVMHX[HWGHV[DWLRQV
1HWWR\DJHGXFRQGXLWGHIXPpHV UHPSODFHPHQWGHVJDUQLWXUHVVXUOHWX\DXpYDFXDWLRQIXPpHV
1HWWR\DJHFRQGXLWGHIXPpHV YRLUQHWWR\DJHKHEGRPDGDLUH
1HWWR\DJHQLFKHYHQWLODWHXUH[WUDFWLRQIXPpHV
1HWWR\DJHQLFKHQHWWR\DJHFDSWHXUGHX[

FRANAIS
1HWWR\DJHQLFKHFRQWU{OHWKHUPRFRXSOH
1HWWR\DJHLQVSHFWLRQHWGpVLQFUXVWDWLRQGHODQLFKHGHODUpVLVWDQFHGDOOXPDJHUHPSODFHPHQWGHFHOOHFLVLQpFHVVDLUH
1HWWR\DJHFRQWU{OHGX3DQQHDX6\QRSWLTXH
,QVSHFWLRQYLVXHOOHGHVFkEOHVpOHFWULTXHVGHVUDFFRUGHPHQWVHWGXFkEOHGDOLPHQWDWLRQ
,QVSHFWLRQYLVXHOOHGHVFkEOHVpOHFWULTXHVGHVEUDQFKHPHQWVHWGXFkEOHGDOLPHQWDWLRQ
1HWWR\DJHGXUpVHUYRLUSHOOHWHWYpULFDWLRQGHVMHX[GHOHQVHPEOHYLVVDQVQPRWRUpGXFWHXU
5HPSODFHPHQWJDUQLWXUHSRUWH
7HVWGHIRQFWLRQQHPHQWFKDUJHPHQWYLVVDQVQDOOXPDJHIRQFWLRQQHPHQWSHQGDQWPLQXWHVHWH[WLQFWLRQ

6LYRXVXWLOLVH]WUVIUTXHPPHQWOHSROHLOHVWFRQVHLOOGHQHWWR\HUOHFRQGXLWGHIXPHVWRXVOHVPRLV

ATTENTION !!!
$SUVOHQHWWR\DJHQRUPDOODFFRXSOHPHQW121&255(&7GXFUHXVHWVXSULHXU $  JXUD DYHFOHFUHXVHWLQIULHXU
%  JXUD SHXWFRPSURPHWWUHOHIRQFWLRQQHPHQWGXSROH
3XLVDYDQWODOOXPDJHGXSROHVDVVXUHUTXHOHVFUHXVHWVVRLHQWFRUUHFWHPHQWDVVHPEOVFRPPHOLQGLTXHODJVDQVOD
SUVHQFHGHFHQGUHVRXGHVXEVWDQFHVQRQEUOHVVXUOHSULPWUHGDSSXL

J J

- 67 -
,1&219(1,(1763266,%/(6
(QFDVGHSUREOPHSROHVDUUWHDXWRPDWLTXHPHQWHQHIIHFWXDQWORSUDWLRQGH[WLQFWLRQHWOFUDQVDIFKH
XQHLQGLFDWLRQUHODWLYHODUDLVRQGHOH[WLQFWLRQ YRLUOHVGLYHUVVLJQDOHPHQWVFLGHVVRXV 

1HMDPDLVGEUDQFKHUODFKHGXUDQWODSKDVHGH[WLQFWLRQSRXUPRWLIGHEORFDJH

(QFDVGHEORFDJHSRXUUHGPDUUHUSROHLOIDXWOHODLVVHUVDUUWHU VHFRQGHVDYHFVLJQDOVRQRUH SXLV


appuyer sur la touche 

1HSDVUDOOXPHUSROHDYDQWGDYRLUYULODFDXVHGXEORFDJHHWDYDQWGDYRLU1(772<9,'OHFUHXVHW

6,*1$/(0(176'(69(178(//(6&$86(6'(%/2&$*(,1',&$7,216(762/87,216
 6LJQDOLVDWLRQ9HULFX[DLU LOLQWHUYLHQWVLOHFDSWHXUGHX[GWHFWHOHX[GDLUFRPEXUDQWLQVXIVDQW 
,QFRQYQLHQWDUUWSRXUPDQTXHGSUHVVLRQ
/HX[SHXWWUHLQVXIVDQWVLODSRUWHHVWRXYHUWHVLOWDQFKLWGHODSRUWHQHVWSDVSDUIDLWH H[MRLQW VLO\
FRANAIS

  DXQSUREOPHGDVSLUDWLRQGHODLURXGYDFXDWLRQGHVIXPHVRXVLOHFUHXVHWHVWHQFUDVV
Actions: &RQWUOHU
  ODIHUPHWXUHGHODSRUWH
  OHFDQDOGDVSLUDWLRQGHODLUFRPEXUDQW QHWWR\HUHQIDLVDQWDWWHQWLRQDX[OPHQWVGXFDSWHXUGHX[ 
  QHWWR\HUOHFDSWHXUGHX[ODLUVHF W\SHSRXUFODYLHUGH3& 
  SRVLWLRQGXSROHOHSROHQHGRLWSDVWUHDGRVVXQPXU
  SRVLWLRQHWQHWWR\DJHGXFUHXVHW DYHFXQHIUTXHQFHOLHDXW\SHGHSHOOHWV 
  FDQDOGHIXPH QHWWR\HU 
  LQVWDOODWLRQ VLOLQVWDOODWLRQQHVWSDVDX[QRUPHVHWTXHOOHSUVHQWHGHQRPEUHX[FRXGHVOYDFXDWLRQGHV
  IXPHVQHVWSDVUJXOLUH 
  6LYRXVVXVSHFWH]XQG\VIRQFWLRQQHPHQWGXFDSWHXUIDLUHXQHVVDLIURLG3DUH[HPSOHVLHQYDULDQWOHV 
  FRQGLWLRQVRXHQRXYUDQWODSRUWHODYDOHXUDIFKHQHFKDQJHSDVFHVWXQSUREOPHGHFDSWHXU

N.B.: /DODUPHGSUHVVLRQSHXWDXVVLVHYULHUGXUDQWODSKDVHGDOOXPDJHFDUOHFDSWHXUGHX[FRPPHQFH
  FRQWUOHUDSUVOHVWDUWF\FOHGDOOXPDJH

 6LJQDOLVDWLRQ9HULFH[WUDFW ODODUPHLQWHUYLHQWVLOHFDSWHXUGHWRXUVGHOH[WUDFWHXUGHIXPHVGWHFWHXQHDQRPDOLH 
,QFRQYQLHQW([WLQFWLRQSRXUUHOYHPHQWGDQRPDOLHGHVWRXUVGHOH[WUDFWHXUGHIXPHV
Actions: &RQWUOHUODIRQFWLRQQDOLWGHOH[WUDFWHXUGHIXPHV FRQQH[LRQFDSWHXUGHWRXUV HWODFKH 5HYHQGHXU 
  &RQWUOHUQHWWR\DJHFRQGXLWGHIXPHV
  &RQWUROHUOLQVWDOODWLRQOHFWULTXHHWODPLVHODWHUUH
  &RQWUOHUFDUWHOHFWURQLTXH 5HYHQGHXU

 6LJQDOLVDWLRQ6WRSDPPH(intervient si le thermocouple relve une temprature des fumes infrieure la valeur pro
 JUDPPHHQLQWHUSUWDQWFHODFRPPHXQHDEVHQFHGHDPPH
,QFRQYQLHQWDUUWSRXUFKXWHGHODWHPSUDWXUHGHVIXPHV
Actions: LOQ\DSOXVGHSHOOHW
  LO\DWURSGHSHOOHWHWFHOXLFLDWRXIIODDPPHYULHUODTXDOLWGXSHOOHW 5HYHQGHXU
  OHWKHUPRVWDWGHPD[LPXPHVWLQWHUYHQX
   FDVUDUHLOQLQWHUYLHQWTXHQFDVGHWHPSUDWXUHH[FHVVLYHGHVIXPHV  5HYHQGHXU 

 6LJQDOLVDWLRQ(&+(&$//80$*( /DOOXPDJHFKRXHVLGDQVXQGODLPD[LPXPGHPLQXWHVODDPPHQDSSDUDW
 SDVHWODWHPSUDWXUHGHGPDUUDJHQHVWSDVDWWHLQWH
,QFRQYQLHQWDUUWFDXVHGHODWHPSUDWXUHGHVIXPHVTXLQHVWSDVFRUUHFWHHQSKDVHGDOOXPDJH
'LVWLQJXHUOHVGHX[FDVVXLYDQWV
  /DDPPH1(VHVW3$6DOOXPH
Actions: 9ULHU
  OHSRVLWLRQQHPHQWHWODSURSUHWGXFUHXVHW
  ODUULYHGDLUFRPEXUDQWDXFUHXVHW
  OHERQIRQFWLRQQHPHQWGHODUVLVWDQFH 5HYHQGHXU 
  ODWHPSUDWXUHDPELDQWH VLLQIULHXUHq&XWLOLVHUXQDOOXPHIHX HWOKXPLGLW
 (VVD\HUGDOOXPHUDYHFXQDOOXPHIHX YRLUSDJH 
  /DDPPHVHVWDOOXPHPDLVDSUVOLQVFULSWLRQ$UOHVLJOH$)VHVWDIFK
$FWLRQV9ULHU 5HYHQGHXU 
  OHERQIRQFWLRQQHPHQWGXWKHUPRFRXSOH
 ODWHPSUDWXUHGHGPDUUDJHSURJUDPPHGDQVOHVSDUDPWUHV
 5HFRPPHQFHUODOOXPDJHDSUVDYRLUYLGOHEUDVHUR

 6LJQDOLVDWLRQ12HOHFWU FHQHVWSDVXQGIDXWGHSROH
,QFRQYQLHQW$UUWSRXUPDQTXHGQHUJLHOHFWULTXH
Actions: 9ULHUOHEUDQFKHPHQWOHFWULTXHHWOHVFKXWHVGHWHQVLRQ

 6LJQDOLVDWLRQ3DQQHWOFRP ODODUPHLQWHUYLHQWVLOHWKHUPRFRXSOHHVWHQSDQQHRXGEUDQFK  5HYHQGHXU 


,QFRQYQLHQW$UUWFDXVHGXWKHUPRFRXSOHTXLHVWHQSDQQHRXGFRQQHFW
Actions: 9ULHUTXHOHWKHUPRFRXSOHHVWELHQFRQQHFWODFDUWHYULHUODIRQFWLRQQDOLWDXFRXUVGXWHVWIURLG
(Revendeur).
- 68 -
,1&219(1,(1763266,%/(6
 6LJQDOLVDWLRQq&IXPHVOHYH H[WLQFWLRQSRXUWHPSUDWXUHH[FHVVLYHGHVIXPHV
,QFRQYQLHQWDUUWSRXUGSDVVHPHQWGHODWHPSUDWXUHPD[LPXPGHVIXPHV
Actions: 9ULHUOHW\SHGHSHOOHW
  9ULHUDQRPDOLHGXPRWHXUGH[WUDFWLRQGHVIXPHV
  9ULHUODSUVHQFHGYHQWXHOOHVREVWUXFWLRQVVXUOHFDQDOGHIXPH
  9ULHUVLOLQVWDOODWLRQHVWFRUUHFWH
  9ULHUOYHQWXHOOHlGULYH|GXPRWRUGXFWHXU
  9ULHUOH[LVWHQFHSULVHGDLUGDQVODSLFH

8) 6LJQDOLVDWLRQ$/$50(7(16,21e/(9e(VHGpFOHQFKHHQFDVGHGpWHFWLRQGDEVRUSWLRQGHFRXUDQW
  LUUpJXOLqUHRXH[FHVVLYHGXPRWRUpGXFWHXU
$FWLRQV 9pULHUIRQFWLRQQHPHQW &$7 PRWRUpGXFWHXU5DFFRUGHPHQWVpOHFWULTXHVHWFDUWHpOHFWURQLTXH

FRANAIS
9) 6LJQDOLVDWLRQ$/$50(7(16,21)$,%/(VHGpFOHQFKHHQFDVGHGpWHFWLRQGDEVRUSWLRQGHFRXUDQWLUUpJXOLqUH
  HWLQVXIVDQWHGXPRWRUpGXFWHXU
$FWLRQV 9pULHUIRQFWLRQQHPHQW &$7 PRWRUpGXFWHXUSUHVVRVWDWWKHUPRVWDWUpVHUYRLUUDFFRUGHPHQWV
  pOHFWULTXHVHWFDUWHpOHFWURQLTXH

 6LJQDOLVDWLRQ&RQWUOHEDWWHULH
,QFRQYQLHQWQHVDUUWHSDVPDLVOHPHVVDJHVDIFKHVXUOHGLVSOD\
Actions: /DEDWWHULHWDPSRQVXUODFDUWHGRLWWUHUHPSODFH 5HYHQGHXU 
,OHVWUDSSHOpTXLOVDJLWGXQFRPSRVDQWVXMHWjXVXUHHWGRQFLOQHVWSDVFRXYHUWGHJDUDQWLH

 ,QFRQYQLHQW7OFRPPDQGHLQHIFDFH
Actions: UDSSURFKHUOHUFHSWHXUGHOHSROH
  UHPSODFHUSDUGHVSLOHVDOFDOLQHV

 ,QFRQYQLHQW$LUODVRUWLHQRQFKDXG
Actions: QHWWR\HUOFKDQJHXUGHSXLVOLQWULHXUGHOHSROH

 ,QFRQYQLHQW3HQGDQWODSKDVHGDOOXPDJHOHGLIIUHQWLHOVDXWH SRXUOHUHYHQGHXU
Actions: YULHUKXPLGLWGHODUVLVWDQFHGDOOXPDJH

 ,QFRQYQLHQW$OOXPDJHQRQUXVVL
Actions: FOHDQFRPEXVWLRQFKDPEHU

REMARQUE
/HVVLJQDOLVDWLRQVUHVWHQWDIFKVMXVTXFHTXRQLQWHUYLHQQHVXUOHSDQQHDXHQDSSX\DQWVXUODWRXFKH
,OHVWUHFRPPDQGGHQHSDVIDLUHUHSDUWLUOHSROHDYDQWGDYRLUYULTXHOHSUREOPHHVWOLPLQ

NOTE:
Les pots de chemine et les conduits de fumes auxquels sont relis les appareils utilisant des combustibles solides doivent
WUHQHWWR\VXQHIRLVSDUDQ YULHUVLGDQVYRWUHSD\VLOH[LVWHXQHQRUPDWLYHVXUOHVXMHW 
Si vous oubliez de contrler et de nettoyer rgulirement, la probabilit dincendie de la chemine du toit augmente.

MPORTANT !!!
'DQVOHFDVRXQGEXWGLQFHQGLHVHYULHUDLWGDQVODSole, dans le conduit de fume ou dans la chemine, procder comme suit :
- Dbranchez lalimentation lectrique
- Intervenez avec un extincteur anhydride carbonique CO2
- Demandez lintervention des Sapeurs Pompiers

NESSAYEZ PAS DTEINDRE LE FEU AVEC DE LEAU !


'HPDQGH]VXFFHVVLYHPHQWODYULFDWLRQGHODSSDUHLOGHODSDUWGXQ&HQWUHG$VVLVWDQFH7HFKQLTXH$XWRULV &$7 HWIDWHV
YULHUODFKHPLQHSDUXQWHFKQLFLHQDXWRULV

- 69 -
&+(&./,67
$LQWJUHUDYHFODOHFWXUHFRPSOWHGHODFKHWHFKQLTXH
Pose et installation
0LVHHQVHUYLFHHIIHFWXHSDUOHUHYHQGHXUKDELOLWTXLGOLYUHUODJDUDQWLH
$UDWLRQGDQVODSLFH
/HFRQGXLWGHIXPHVFRQGXLWGHFKHPLQHUHRLWVHXOHPHQWOYDFXDWLRQGXSROH
/HFRQGXLWGHIXPHVSUVHQWHPD[LPXPFRXUEHV
   PD[LPXPPWUHVHQKRUL]RQWDO
FKHPLQHDXGHOGHOD]RQHGHUHX[
/HVWX\DX[GYDFXDWLRQVRQWHQPDWULDXDGTXDW FRQVHLOODFLHULQR[
(QFDVGHWUDYHUVHGYHQWXHOVPDWULDX[LQDPPDEOHV H[ERLV WRXWHVOHVSUFDXWLRQVRQWWSULVHVSRXU
YLWHUGHVLQFHQGLHV
FRANAIS

Utilisation
/HSHOOHWXWLOLVHVWGHERQQHTXDOLWHWQRQKXPLGH
/HFUHXVHWHWODQLFKHFHQGUHVVRQWSURSUHVHWELHQSRVLWLRQQV
/DSRUWHHVWELHQIHUPH
/HFUHXVHWHVWELHQLQVUGDQVVDQLFKH

6(5$33(/(5'$63,5(5/(&5(86(7$9$17&+$48($//80$*(
6LODOOXPDJHFKRXH1(3$6USWHUODOOXPDJHDYDQWGDYRLUYLGOHFUHXVHW

OPTIONS
&$'5$17(/(3+21,48(3285$//80$*($',67$1&( FRGH 
2QSHXWREWHQLUODOOXPDJHGLVWDQFHHQIDLVDQWUHOLHUSDUOHUHYHQGHXUOHFDGUDQWOSKRQLTXHODSRUWHVULHOOHGHUULUHOHSROHDYHF
XQSHWLWFEOHHQRSWLRQ FRGH 

.,7SRXUODFDQDOLVDWLRQGHODLUFKDXGGDQVXQHSLFHYRLVLQHDYHFXQHORQJXHXUGXWX\DXGHFDQDOLVDWLRQGHPPD[L-
PXP FRGH 

.,7%,6SRXUODFDQDOLVDWLRQGHODLUFKDXGGDQVXQHSLFHQRQYRLVLQHDYHFXQHORQJXHXUGXWX\DXGHFDQDOLVDWLRQGHP
PD[LPXP FRGH 

ACCESSOIRES POUR LE NETTOYAGE


*ODVVNDPLQ %LGRQSRXUDVSLUHUOHV
FRGH cendres sans moteur
FRGH
8WLOHSRXUOHQHWWR\DJHGH
la vitre cramique 8WLOHSRXUOHQHWWR\D-
ge du foyer

- 70 -
Estimado Sr./Sra.
/HDJUDGHFHPRV\OHIHOLFLWDPRVSRUKDEHUHOHJLGRXQSURGXFWRQXHVWUR$QWHVGHXWLOL]DUOROHSHGLPRVTXHOHDDWHQWDPHQWH
HVWDFKDFRQHOQGHSRGHUGLVIUXWDUGHPDQHUDySWLPD\FRQWRWDOVHJXULGDGGHWRGDVVXVFDUDFWHUtVWLFDV

3DUDPiVDFODUDFLRQHVRHQFDVRGHQHFHVLGDGGLUtMDVHDVX',675,%8,'25(GRQGHKDHIHFWXDGRODFRPSUDRYLVLWH
QXHVWURVLWLRLQWHUQHWZZZHGLONDPLQFRPHQODRSFLyQ',675,%8,'25(

NOTA
'HVSXpVGHKDEHUGHVHPEDODGRODHVWXIDDVHJ~UHVHGHTXHHODSDUDWRHVWptQWHJUR\FRPSOHWR UHYHVWLPLHQWRPDQGRDGLVWDQFLD
con pantalla,PDQLOODPDQRIUtDSDUDDSHUWXUDGHSXHUWDSHTXHxDOLEURGHJDUDQWtDJXDQWH&'FKDWpFQLFDHVSiWXODVDOHV
GHVKXPLGLFDGRUDVOODYH$OOHQ

(QFDVRGHDQRPDOtDVFRQWDFWHUiSLGDPHQWHHOGLVWULEXLGRUHGRQGHORKDFRPSUDGRDOTXHHQWUHJDUiFRSLDGHOOLEURGHJDUDQWtD\
GHOGRFXPHQWRVFDOGHFRPSUD

- Puesta en servico/ensayo
'HEHUiVHUHIHFWXDGDDEVROXWDPHQWHSRUHO',675,%8,'25(GHORFRQWUDULRGHFDHUiODJDUDQWtD/DSXHVWDHQVHUYLFLRFRPROR
GHVFULEHSRUODQRUPD81,FRQVLVWHHQXQDVHULHGHRSHUDFLRQHVGHFRQWUROFRQODHVWXIDLQVWDODGR\FRQHOREMHWLYR
GHDVHJXUDUHOIXQFLRQDPLHQWRFRUUHFWRGHOVLVWHPD\ODFRQIRUPLGDGGHOPLVPRDODVQRUPDWLYDV

LQVWDODFLRQHVLQFRUUHFWDVPDQWHQLPLHQWRVUHDOL]DGRVLQFRUUHFWDPHQWHHOXVRLPSURSLRGHOSURGXFWRH[RQHUDQDODHPSUHVD
IDEULFDQWHGHFXDOTXLHUGDxRTXHGHULYDGHOXVR

ESPAOL
(OQ~PHURGHFXSyQGHFRQWUROQHFHVDULRSDUDODLGHQWLFDFLyQGHODHVWXIDHVWiLQGLFDGR
HQODSDUWHDOWDGHOHPEDODMH
HQHOOLEURGHJDUDQWtDGHQWURGHOKRJDU
HQODSODFDDSOLFDGDHQODSDUWHSRVWHULRUGHODSDUDWR
'LFKDGRFXPHQWDFLyQGHEHVHUFRQVHUYDGDSDUDODLGHQWLFDFLyQMXQWRFRQHOGRFXPHQWRVFDOGHFRPSUDFX\RVGDWRVGHEHUiQ
FRPXQLFDUVHHQRFDVLyQGHSRVLEOHVVROLFLWXGHVGHLQIRUPDFLRQHV\SXHVWRVDGLVSRVLFLyQHQFDVRGHSRVLEOHLQWHUYHQFLyQGHPDQ-
WHQLPLHQWR

ODVSLH]DVUHSUHVHQWDGDVVRQJUiFD\JHRPpWULFDPHQWHLQGLFDWLYDV

DECLARACIN DE CONFORMIDAD
(ODEDMRUPDQWH(',/.$0,16S$FRQVHGHOHJDOHQ9LD9LQFHQ]R0RQWL0LODQR&yGLJRVFDO3,9$

'HFODUDEDMRODSURSLDUHVSRQVDELOLGDGTXH
/DHVWXIDGHSHOOHWGHOHxDGHVFULWDDFRQWLQXDFLyQFXPSOHOD'LUHFWLYD&(( 3URGXFWRVGH&RQVWUXFFLyQ
ESTUFA DE PELLET, de marca comercial EDILKAMIN, denominada FANTASY - FATA - SIRENA - STORY

1GH6(5,(5HI(WLTXHWDGDWRV$f2'()$%5,&$&,15HI(WLTXHWDGDWRV

/DFRQIRUPLGDGGHORVUHTXLVLWRVGHOD'LUHFWLYD&((KDVLGRDGHPiVGHWHUPLQDGDSRUODFRQIRUPLGDGDODQRUPDHXURSHD
(1

$VLPLVPRGHFODUDTXH
ODHVWXIDGHSHOOHWGHOHxD)$17$6<)$7$6,5(1$6725<UHVSHWDORVUHTXLVLWRVGHODVGLUHFWLYDVHXURSHDV
&('LUHFWLYD%DMD7HQVLyQ
&('LUHFWLYD&RPSDWLELOLGDG(OHFWURPDJQpWLFD

(',/.$0,16SDQRVHUHVSRQVDELOL]DGHOPDOIXQFLRQDPLHQWRGHODSDUDWRHQFDVRGHVXVWLWXFLyQPRQWDMH\RPRGLFDFLRQHV
HIHFWXDGDVSRUSHUVRQDODMHQRD(',/.$0,1VLQDXWRUL]DFLyQGHODEDMRUPDQWH
- 71 -
35,1&,3,2'()81&,21$0,(172 ,1)250$&,21(6'(6(*85,'$'
Las estufas calientan el aire utilizando como combustible el /DHVWXIDHVWSUR\HFWDGDSDUDFDOHQWDUDWUDYVGHXQDFRP-
pellet de lea, cuya combustin se controla electrnicamente. EXVWLQDXWRPWLFDGHSHOOHWHQHOKRJDUHOORFDOHQHOFXDOVH
$FRQWLQXDFLQVHLOXVWUDHOIXQFLRQDPLHQWR ODVOHWUDVKDFHQ encuentra, por radiacin que por movimiento de aire sale de las
rejillas de la parte frontal.
UHIHUHQFLDDODJXUD (OFRPEXVWLEOH SHOOHW VHUHFRJH
GHOGHSVLWRGHDOPDFHQDMH $ \DWUDYVGHXQDFFOHD %  7KHDSSOLDQFHLVQRWGHVLJQHGWREHXVHGE\SHRSOHLQFOXGLQJ
DFWLYDGDSRUXQPRWRUUHGXFWRU & VHWUDQVSRUWDHQHOFULVROGH children, with reduced physical, sensorial or mental abilities.
FRPEXVWLQ '  Children must be supervised to ensure they do not play with
El encendido del pellet se efecta por medio de aire caliente the appliance.
producido por una resistencia elctrica (E) y aspirada en el
/RV~QLFRVULHVJRVTXHGHULYDQGHOXVRGHODVHVWXIDVHVWiQ
FULVROSRUXQH[WUDFWRUHVGHKXPRV ) \VHH[SXOVDQDWUDYV relacionados con el incumplimiento de l instalacin o con
GHODERFD * XELFDGDHQOD]RQDEDMDGHODSDUWHSRVWHULRUGH XQFRQWDFWRGLUHFWRFRQSDUWHVHOpFWULFDVHQWHQVLyQ LQWHUQDV R
las estufas. con un contacto con fuego y partes calientes (vidrio, tubos,
Las estufas permiten la canalizacin del aire caliente, para tran- salida de aire caliente) a la introduccin de sustancias extraas,
sportarlo y calentar locales adyacentes. En la parte posterior de a combustibles no recomendados, a un mantenimiento no
correcto.
ODVHVWXIDVKD\GRVERFDVGHFPGHGLPHWURPDFKRSDUDOD
FRQH[LQGHODFDQDOL]DFLQGHODLUHFDOLHQWH 2QO\XVHFHUWLHGKLJKTXDOLW\PPGLDPHWHUZRRGHQSHOOHWV
3DUDFDQDOL]DUHODLUHFDOLHQWHHQXQRRGRVORFDOHVFRQWLJXRV for fuel.
ODHVWXIDHVWHTXLSDGDFRQGRVERFDVHQODSDUWHSRVWHULRUDODV
cuales se les conectan tubos de aluminio. 6LQRIXQFLRQDVHQORVFRPSRQHQWHVODVHVWXIDVHVWiQGRWDGDV
3DUDIDFLOLWDUODGLVWULEXFLQGHODLUHFDOLHQWHHVWQGLVSRQLEOHV de dispositivos de seguridad que garantizan su apagado, que
VHHIHFWXDUiVLQLQWHUYHQLUHQQLQJ~QPRPHQWR3DUDXQIXQFLR-
ORV.,7\.,7%,6RSFLRQDO YHUSJ  namiento regular la estufa ha de ser instalada respetando lo
/DFDQWLGDGGHFRPEXVWLEOH\ODH[WUDFFLQGHKXPRVDOLPHQWD- LQGLFDGRHQHVWDFKD\GXUDQWHVXIXQFLRQDPLHQWRODSXHUWD
FLQDLUHFRPEXUHQWHVHUHJXODQSRUPHGLRGHODFKDHOHF- QRGHEHUiDEULUVHGHKHFKRODFRPEXVWLyQHVFRQWURODGDDX-
ESPAOL

trnica dotada de software con sistema LeonardoFRQHOQGH WRPiWLFDPHQWH\QRQHFHVLWDQLQJXQDLQWHUYHQFLyQ


obtener una combustin de alto rendimiento y bajas emisiones.
(QQLQJ~QFDVRKDQGHLQWURGXFLUVHHQHOKRJDURHQHOGHSyVL-
(QODWDSDHVWLQVWDODGRHOSDQHOVLQSWLFR 0 TXHSHUPLWHOD to sustancias extraas.
gestin y la visualizacin de todas las fases de funcionamiento.
Las principales fases pueden ser controladas tambin por me- 3DUDODOLPSLH]DGHOFDQDOGHKXPR WUDPRGHWXERTXH
dio del mando a distancia. conecta la boca de salida de humos de la estufa con el tubo de
/DHVWXIDHVWHTXLSDGDHQODSDUWHSRVWHULRUFRQXQDWRPD KXPRV QRGHEHQXWLOL]DUVHSURGXFWRVLQDPDEOHV
GHVHULHSDUDODFRQH[LQ FRQFDEOHRSFLRQDOFG /DVSDUWHVGHOKRJDU\GHOGHSyVLWRKDQGHDVSLUDUVHH[FOXVL-
a dispositivos de encendido remoto (p. ej. conmutador telefni- vamente en FRO.
co, termostato ambiente).
/DVHVWXIDVHVWQUHDOL]DGDVFRQXQDHVWUXFWXUDLQWHUQDFRPSOH- (OFULVWDOSXHGHOLPSLDUVHHQ)52FRQHOSURGXFWRDGHFXDGR
tamente en hierro fundido. (por ej. GlassKamin Edilkamin) y un pao.
1ROLPSLHHQFDOLHQWH
$VHJXUDUVHGHTXHODHVWXIDHVFRORFDGD\HQFHQGLGDSRUHO
M 9(1'('25KDELOLWDGR(GLONDPLQ VHJ~QODVLQGLFDFLRQHV
GHHVWDFKDFRQGLFLRQHVLQGLVSHQVDEOHVSDUDODYDOLGH]GHOD
garanta.
'XUDQWHHOIXQFLRQDPLHQWRGHODHVWXIDORVWXERVGHGHVFDUJD
y la puerta alcanzan altas temperaturas (no toque sin el guante
apropiado).
1RGHSRVLWHREMHWRVQRUHVLVWHQWHVDOFDORUFHUFDGHODHVWXID
A 1RXWLOLFH181&$FRPEXVWLEOHVOtTXLGRVSDUDHQFHQGHUOD
estufa o para reavivar las brasas.
B 1RREVWUX\DODVDSHUWXUDVGHDLUHDFLyQGHOORFDOGHLQVWDOD-
cin, ni las entradas de aire de la misma estufa.
E 1RPRMHODHVWXIDQRVHDFHUTXHDODVSDUWHVHOpFWULFDVFRQ
las manos mojadas.
C 1RLQWURGX]FDUHGXFFLRQHVHQORVWXERVGHGHVFDUJDGHKX-
mos.
'
G /DHVWXIDGHEHVHULQVWDODGDHQORFDOHVDGHFXDGRVSDUDOD
seguridad contra incendios y dotados de todos los servicios
(alimentacin y descargas) que el aparato requiere para un
correcto y seguro funcionamiento.

F (QFDVRGHHQFHQGLGRIDOOLGR12UHSHWLUHOHQFHQGLGR
antes de haber vaciado el crisol

J $7(1&,1(/3(//(79$&,$'2'(/&5,62/
12'(%(&2/2&$56((1(/'(36,72
- 72 -
',0(16,21(6<$&$%$'26
- FANTASY: piedra ollar
- FATAFHUPLFDEODQFRQDWDURMDFXHUR
- SIRENAFHUPLFDEODQFRQDWDURMDFXHUR
- STORY: acero pintado gris. canalizacin aire
FDOLHQWHPP

)5(17( 98(/7$
68
13 13

Q
X
r ViaWL
PEa ne
U H
4 FcRmstio
$L PmPbu
115

104
co
os
hum

ESPAOL
i d a
c m
Sal 8 PP mi

s cita fu
u

39
31
7

/$'2 3/$17$

53
53
115

68

0(','$69/,'$63$5$/2602'(/26

- 73 -
CARACTERSTICAS
APARATOS ELECTRNICOS
/(21$5'2 es un sistema de seguridad y regulacin de la combustin que permite un funcionamien-
WRSWLPRHQFXDOTXLHUFRQGLFLQJUDFLDVDGRVVHQVRUHVTXHGHWHFWDQHOQLYHOGHSUHVLQHQODFPDUD
de combustin y la temperatura de los humos. La deteccin y la consiguiente optimizacin de los dos
SDUPHWURVVHHIHFWDQHQFRQWLQXRSDUDFRUUHJLUHQWLHPSRUHDOSRVLEOHVDQRPDODVGHIXQFLRQDPLHQWR
(OVLVWHPD/(21$5'2REWLHQHXQDFRPEXVWLQFRQVWDQWHUHJXODQGRDXWRPWLFDPHQWHHOWLURVHJQ
ODVFDUDFWHUVWLFDVGHOWXERGHKXPRV FXUYDVORQJLWXGIRUPDGLPHWURHWF \ODVFRQGLFLRQHVDPELHQ-
tales (viento, humedad, presin atmosfrica, instalaciones en alta cota, etc.).
(VQHFHVDULRTXHVHUHVSHWHQODVQRUPDVGHLQVWDODFLQ$GHPVHOVLVWHPD/(21$5'2 puede reco-
QRFHUHOWLSRGHSHOOHW\UHJXODUDXWRPWLFDPHQWHHODXMRSDUDJDUDQWL]DUDFDGDPRPHQWRHOQLYHOGH
combustin solicitado.

FICHA ELECTRNICA
Sensor
GHXMR

opcional

7HUPRSDU
ESPAOL

530KXPRV
&XDGURGHPDQGRV Sonda aire
+ --- ambiente

9DFXPHWUR

Lithium
+
CR2032

3XQWRVGH
5HG9DF lectura
+]

0RWH[SKXPRV &FOHD
Res encendido

7RPDGHWUVHVWXID
9HQWLODFLQ

FUSIBILES
en la toma con interruptor colocada
GHWUVGHODHVWXIDKD\LQWURGXFLGRVGRV
fusibiles, de los cuales uno funciona* y el
otro de reserva**.
38(57$'(6(5,(
(QODSXHUWD$8;HO'LVWULEXLGRUSXHGHLQVWDODUXQDSLH]DRSFLRQDOSDUDFRQWURODUORV
encendidos y apagados (p. ej. conmutador telefnico, termostato ambiente), el puerto
HVWVLWXDGRHQODSDUWHGHDWUVGHODHVWXID
6HFRQHFWDFRQXQSXHQWHRSFLRQDO FG 

%$7(5$&203(16$'25$
(QODWDUMHWDHOHFWUQLFDKD\XQDEDWHUDFRPSHQVDGRUD WLSR&5GH9ROW 6X
mal funcionamiento (no considerado como defecto del producto, sino como desgaste
QRUPDO VHVHDODFRQODVLQGLFDFLRQHV&RQWUROEDWHUD3DUDPD\RUHVLQIRUPDFLRQHV
al respecto, contactar con el distribuidor que ha efectuado el primer encendido. * **
- 74 -
CARACTERSTICAS
&$5$&7(567,&$67(5027e&1,&$6FRQDUUHJORDODQRUPD(1
Potencia nominal Potencia reducida
&DSDFLGDGWpUPLFDTXHPDGD kW
3RWHQFLDWpUPLFD 13,2 5,1 kW
5HQGLPLHQWR(FLHQFLD 92,5 93,3 %
Emisiones CO 13% O2 0,019 0,038 %
7HPSHUDWXUDPi[LPDKXPRV   C
Tiro minimo 12 10 Pa
Flujo en Masa de los humos 13,5 7,4 g/s
Consumo combustibil 2,9 1,1 kg/h
Capacidad depsito 23,5 kg
Autonoma 7 18,5 horas
Volumen calentable * 345 m3

ESPAOL
'LiPHWURFRQGXFWRKXPRV PDFKR 80 mm
'LiPHWURFRQGXFWRWRPDDLUH PDFKR 40 mm
3HVRFRQHPEDODMH)$17$6<)$7$6,5(1$6725<  kg

* (OYROXPHQFDOHQWDEOHVHFDOFXODFRQVLGHUDQGRXQDLVODPLHQWRGHODFDVDWDO\FRPRHVWDEOHFHOD/\VXFHVLYDVPRGLFD-
FLRQHV\XQDVROLFLWDFLQGHFDORUGH.FDOPtKRUD

CARACTERSTICAS ELCTRICAS
$OLPHQWDFLQ 9DF+]
,QWHUUXSWRURQRII s
3RWHQFLDPHGLDDEVRUELGD  W
3RWHQFLDDEVRUELGDHQHOHQFHQGLGR  W
Frecuencia mando a distancia infrarrojos
3URWHFFLQHQDOLPHQWDFLQJHQHUDO* YRLUSDJH )XVLEOH$79DF[
3URWHFFLQHQFKDHOHFWUQLFD )XVLEOH$79DF[

$'9(57(1&,$
 WHQHUHQFRQVLGHUDFLQTXHHTXLSRVH[WHUQRVSXHGHQSURYRFDUDYHUDVDOIXQFLRQDPLHQWRGHODWDUMHWDHOHFWUQLFD
 $WHQFLQ/RVWUDEDMRVFRQWHQVLQGHUHGPDQWHQLPLHQWR\FRQWUROHVGHEHQUHDOL]DUVHSRUSDUWHGHSHUVRQDOFXDOLFDGR

Los datos indicados arriba son indicativos.


(',/.$0,1VSDVHUHVHUYDPRGLFDUVLQSUHYLRDYLVRORVSURGXFWRV\DVXHQWHURMXLFLR

',6326,7,926'(6(*85,'$'
7(5023$5
Situada en la descarga de humos detecta la temperatura.
6HJQORVSDUPHWURVSURJUDPDGRVFRQWURODODVIDVHVGHHQFHQGLGRWUDEDMR\DSDJDGR

9$&80(752
'HWHFWDHOYDORUGHODGHSUHVLQ FRQUHVSHFWRDODPELHQWHGHLQVWDODFLQ HQODFPDUDGHFRPEXVWLQ

6(1625)/8-2'($,5(
FRORFDGRHQHOFDQDOGHDVSLUDFLQLQWHUYLHQHFXDQGRHOXMRGHODLUHFRPEXUHQWHQRHVFRUUHFWRFRQFRQVLJXLHQWHVSUREOHPDVGH
depresin en el circuito de humos provocando el apagado de la estufa.

7(50267$72'(6(*85,'$'
,QWHUYLHQHVLODWHPSHUDWXUDHVGHPDVLDGRHOHYDGDGHQWURGHODHVWXID
%ORTXHDODFDUJDGHOSHOOHWSURYRFDQGRHODSDJDGRGHODHVWXID
- 75 -
0217$-(5(9(67,0,(1726)$7$6,5(1$
$&&(625,269$5,26680,1,675$'26
75 WRUQLOORV0[
WRUQLOORV0[
33
 GLVWDQFLDGRUHVGHVLOLFRQDSDUDODFHUPLFDGHODSDUWHVXSHULRU
DUDQGHODV0
FDVTXLOORV
GLVWDQFLDGRUHVGHVLOLFRQDSDUDFHUPLFDV
SODFDVGHMDFLQFHUPLFDV

0217$-('(/$63/$&$6/$7(5$/(6 J
'HVPRQWDUHOSDQHOSRVWHULRU  \ORVGRVSHUOHV  
75 )LMDUODVGRVSODFDV  DORVODWHUDOHVJDOYDQL]DGRV
J J SDUDHOPRGHOR)$7$ J
/DSODFDGHODL]TXLHUGDVHWLHQHTXHMDUHQORVDJXMHURVFHQ-
J 150 tral y superior, mientras que la placa de la derecha se tiene que
150
MDUDORVDJXMHURVFHQWUDOHLQIHULRU
138 &RORFDUODVORVHWDVGHFHUPLFD  VREUHODVSODFDV
 
139
3RQHUHQODSDUWHWUDVHUDGLVWDQFLDGRUHVVLOLFRQDGRV  
HQWUHODEDVHGHIXQGLFLQ\ODORVHWDLQIHULRUGHUHFKD  
 150 150 YDVHHOGHWDOOH<J 
138
139
3DUDXQDMDFLQFRUUHFWDGHODORVHWDGHFHUPLFDODWHUDOVXSH-
ESPAOL

ULRUGHUHFKD\GHODORVHWDGHFHUPLFDODWHUDOLQIHULRUL]TXLHUGD
es oportuno actuar sobre los tornillos de regulacin de tope pre-
VHQWHVHQORVODWHUDOHVJDOYDQL]DGRVGHODHVWUXFWXUD J
150
150
J SDUW<
Lateral derecho (J :$MXVWDUHOWRUQLOORGHVXMHFLQDWRSH
FRQWUDODORVHWDGHFHUPLFDODWHUDOVXSHULRUGHUHFKD  

/DWHUDOL]TXLHUGR J :4XLWDUODORVHWDGHFHUPLFD


VXSHULRUL]TXLHUGD  \DMXVWDUHOWRUQLOORGHVXMHFLQDWRSH
FRQWUDODORVHWDGHFHUPLFDODWHUDOLQIHULRUL]TXLHUGD  
J 0RQWDUGHQXHYRODORVHWDGHFHUPLFDVXSHULRUL]TXLHUGD


SDUDHOPRGHOR6,5(1$ J
DPEDVSODFDVVHWLHQHQTXHMDUDORVDJXMHURVFHQWUDOH
inferior.
3RQHUODVORVHWDVGHFHUPLFD  VREUHODVSODFDV 
J J
127$/DDOWXUDGHODVEDOGRVDVDOHVWDUUHDOL]DGDVHQYDFLDGR
150 150
SRGUDUHVXOWDUOLJHUDPHQWHGLIHUHQWHHQWUHHOODV3DUDUHVROYHU
la posible variacin de altura, se puede interponer distancia-
61 GRUHVGHVLOLFRQD J VLQSHUMXGLFDUODHVWWLFDGHOD
 61
estufa.
150
0RQWDUGHQXHYRORVSHUOHV  HOSDQHOSRVWHULRU  

61 150
61
0217$-('(/)5217$/683(5,25'(/$17(52
)$7$6,5(1$ J
61 &RORFDUHOSDQHOIURQWDOGHODQWHURVXSHULRUGHFHUPLFD  
150 DSR\DGRVREUHHOVRSRUWH  VLWXDGRHQFLPDGHODSRUWLOOD
150
)LMDUODSDUWHIURQWDOFRQORVWRUQLOORV0[ XWLOL]DQGR
OODYH$OOHQ DQWHVGHHIHFWXDUGLFKDRSHUDFLQHVQHFHVDULR
J J abrir la puerta pequea.

Part. Z
127$3DUDPRQWDUFRUUHFWDPHQWHHOSDQHOIURQWDOGHODQWHUR
 VXSHULRU  HVQHFHVDULRSRQHUHQWUHVWH\HOIURQWDO  HO
casquillo incluido en el suministro, tal y como mostrado en el
62 GHWDOOH=GHODJ
62
0217$-('(/$3$57()5217$/,1)(5,25
casquillo
$17(5,25)$7$6,5(1$ J
'HVDWRUQLOODUFRQODOODYH$OOHQVXPLQLVWUDGDORVWRUQLOORV
62 GHWRSHGHODUHMLOODLQIHULRUHQIXQGLFLQ  \H[WUDHUOD
24 3RVLFLRQDUODSDUWHIURQWDO  \MDUODFRQORVWRUQLOORV
7RUQLOOR
vite
0[ XWLOL]DQGROODYH$OOHQ FRPRVHLQGLFDHQODJXUD;
 J 
J J
- 76 -
0217$-(5(9(67,0,(1726)$7$6,5(1$
0217$-('(/$7$3$'(&(50,&$)$7$6,5(1$ J
 ,QWURGXFLUORVGLVWDQFLDGRUHVSDUDFHUPLFD HQORV
* RULFLRVOLEUHVFRUUHVSRQGLHQWHVGHODSDUWHVXSHULRUGHDUUDELR
\FRORFDUODSDUWHVXSHULRUGHFHUPLFD 
62 GRQGHVHDQHFHVDULRFRORFDUHQWUHHOGLVWDQFLDGRUGHVLOLFRQD
7RUQLOOR
y la tapa de fundicin una arandela.
n2 viti

127$
HOHVPDOWHURMRFRQFULVWDOLQDDSOLFDGRHQODPD\OLFDVXWLOL]D
Part. X GHPDQHUDXQLIRUPH JULHWDV HQWRGDODVXSHUFLH1RVHWUDWD
de un defecto, sino que es una caracterstica del esmalte aplica-
GRVREUHODPD\OLFDGHQRPLQDGDFUDFO
J /DVSLH]DVGHFHUPLFD PD\OLFD VHSHJDQ\HVPDOWDQ
J manualmente y pueden presentar pequeas imperfecciones
que no perjudican la calidad (pequeos hundimientos o porosi-
GDGHVGHOHVPDOWH HVPVGHPXHVWUDVXHODERUDFLQPDQXDO

0217$-(5(9(67,0,(17266725<
$&&(625,269$5,26680,1,675$'26

ESPAOL
WRUQLOORV0[
WRUQLOORV0[

GLVWDQFLDGRUHVGHVLOLFRQDSDUDODFHUPLFDGHODSDUWHVXSHULRU
DUDQGHODV0
62 FDVTXLOORV

La estufa se entrega con los laterales de metal ya montados,


PLHQWUDVTXHORVIURQWDOHVGHFHUPLFDVXSHULRUHLQIHULRU  \
ODHQFLPHUD  HVWQHPSDTXHWDGRVSRUVHSDUDGR\VHWLHQHQ
que montar procediendo como sigue:

62 0217$-('(/$3$57()5217$/683(5,25

J $17(5,25 J
&RORFDUHOSDQHOIURQWDOGHODQWHURVXSHULRUGHFHUPLFD
 DSR\DGRVREUHHOVRSRUWH  VLWXDGRHQFLPDGHODSRUWLO-
Part. Z
OD

62 )LMDUODSDUWHIURQWDOFRQORVWRUQLOORV0[ XWLOL]DQGR
62
OODYH$OOHQ DQWHVGHHIHFWXDUGLFKDRSHUDFLQHVQHFHVDULR
casquillo 7RUQLOOR
n2 viti abrir la puerta pequea.

127$
24 Part. X
3DUDXQFRUUHFWRIXQFLRQDPLHQWRGHODSDUWHIURQWDODQWHULRU
7RUQLOOR
vite
VXSHULRU  HVQHFHVDULRLQWHUSRQHUHQWUHHVWD\OD
SDUWHIURQWDO  HOFDVTXLOORTXHVHVXPLQLVWUDFRPRVH
J J LQGLFDHQODJXUD= J 

0217$-('(/$3$57()5217$/,1)(5,25
*  $17(5,25 J
'HVDWRUQLOODUFRQODOODYH$OOHQVXPLQLVWUDGDORVWRUQLOORV
GHWRSHGHODUHMLOODLQIHULRUHQIXQGLFLQ  \H[WUDHUOD
3RVLFLRQDUODSDUWHIURQWDO  \MDUODFRQORVWRUQLOORV
0[ XWLOL]DQGROODYH$OOHQ FRPRVHLQGLFDHQODJXUD;
J 

0217$-('(/$7$3$'(&(50,&$ J
,QWURGXFLUORVGLVWDQFLDGRUHVSDUDFHUPLFD HQORV
RULFLRVOLEUHVFRUUHVSRQGLHQWHVGHODSDUWHVXSHULRUGHDUUDELR
\FRORFDUODSDUWHVXSHULRUGHFHUPLFD 
'RQGHVHDQHFHVDULRFRORFDUHQWUHHOGLVWDQFLDGRUGHVLOLFRQD
J y la parte superior de arrabio una arandela en dotacin.
- 77 -
INSTALACIN
Todas las leyes locales y nacionales y las Normas Europeas de- '(6&$5*$'(+8026
EHUiQVHUUHVSHWDGDVHQHOPRPHQWRGHODLQVWDODFLyQ\XVRGHO (OVLVWHPDGHGHVFDUJDGHKXPRVGHEHVHUQLFRSDUDOD
DSDUDWR(Q,WDOLDKDJDUHIHUHQFLDDODQRUPD81, HVWXID QRVHDGPLWHQGHVFDUJDVHQVDOLGDGHKXPRVFRPQ
DVtFRPRDSRVLEOHVLQGLFDFLRQHVUHJLRQDOHVRGHODV$6/ a otros dispositivos).
locales. De todas maneras es indispensable hacer referencia /DGHVFDUJDGHKXPRVVHUHDOL]DGHVGHHOWXERGHGLPHWUR
cm situado en la parte posterior. La descarga de humos debe
a las leyes vigentes en cada pas. En caso de instalacin en FRQHFWDUVHFRQHOH[WHULRUXWLOL]DQGRDSURSLDGRVWXERVGHDFHUR
comunidad de propietarios, solicite el visto bueno previo al FHUWLFDGRV(1(OWXERGHEHHVWDUVHOODGRKHUPWLFD-
administrador. PHQWH3DUDHOFLHUUHKHUPWLFRGHORVWXERV\VXHYHQWXDO
aislamiento es necesario utilizar materiales resistentes a altas
9(5,),&$&,1'(&203$7,%,/,'$'&2127526 temperaturas (silicona o masilla de altas temperaturas).
',6326,7,926 El nico tramo horizontal admitido puede tener un longitud de
La estufa NO se tiene que instalar en el mismo ambiente donde KDVWDP(VSRVLEOHXQQPHURGHKDVWDFXUYDVFRQDPSOL-
hay aparatos da calefaccin con gas del tipo B (por ej. calderas WXGP[q
Es necesario (si la descarga no se introduce en un tubo de
de gas, estufas y aparatos con campana extractora) ya que la KXPRV XQWUDPRYHUWLFDOH[WHUQRGHDOPHQRVP\XQ
estufa podra poner en depresin el ambiente perjudicando el WHUPLQDODQWLYLHQWR UHIHUHQFLD81, (OFRQGXFWR
IXQFLRQDPLHQWRGHGLFKRVDSDUDWRVRELHQVXIULUVXLQXHQFLD YHUWLFDOSXHGHVHULQWHULRURH[WHULRU6LHOFDQDOGHKXPRHVW
HQHOH[WHULRUGHEHHVWDUDLVODGRDGHFXDGDPHQWH6LHOFDQDOGH
CONTROL CONEXIN ELCTRICA humo se introduce en un tubo de salida de humos, ste debe
(posicionar el enchufe en un punto accesible) HVWDUDXWRUL]DGRSDUDFRPEXVWLEOHVVOLGRV\VLWLHQHHOGLPH-
/DHVWXIDHVWGRWDGDGHXQFDEOHGHDOLPHQWDFLQHOFWULFDTXH WURPVJUDQGHGHPPHVQHFHVDULRVDQHDUORHQWXEQGROR
VHFRQHFWDUDXQDWRPDGH9+]SUHIHULEOHPHQWHFRQ FRQWXERVGHVHFFLQ\PDWHULDOHVLGQHRV SRUHMDFHURPP
GHGLPHWUR 7RGRVORVWUDPRVGHOFRQGXFWRGHKXPRVGHEHQ
interruptor magnetotrmico. Las variaciones de tensin supe-
ESPAOL

ser accesibles. Las chimeneas y los conductos de humo a lo que


ULRUHVDOSXHGHQHVWURSHDUODHVWXID VLQRH[LVWHKD\TXH HVWQFRQHFWDGRVORVDSDUDWRVTXHXVDQFRPEXVWLEOHVVOLGRV
prever un interruptor diferencial adecuado). El sistema elctri- GHEHQOLPSLDUVHXQDYH]DODR YHULFDUVLHQHOSURSLRSDV
co debe ser segn norma de ley, comprobar de manera particu- H[LVWHXQDQRUPDWLYDDOUHVSHFWR 
ODUODHFLHQFLDGHOFLUFXLWRGHWLHUUD/DOQHDGHDOLPHQWDFLQ La ausencia de control y limpieza regulares aumenta la proba-
debe tener una seccin adecuada a la potencia del aparato. La bilidad de un incendio de la chimenea. Si as fuera, proceder de
LQHFLHQFLDGHOFLUFXLWRGHWLHUUDSURYRFDHOPDOIXQFLRQDPLHQ- la siguiente manera: no apague con agua; vaciar el depsito del
WRGHOFXDO(GLONDPLQQRVHKDFHUHVSRQVDEOH SHOOHW&RQWDFWDUDSHUVRQDOHVSHFLDOL]DGRGHVSXVGHODFFLGHQWH
DQWHVGHSRQHUHQPDUFKDODPTXLQD
La estufa ha sido diseada para funcionar con cualquier con-
COLOCACIN GLFLyQFOLPiWLFD(QFDVRGHFRQGLFLRQHVSDUWLFXODUHVFRPR
3DUDHOFRUUHFWRIXQFLRQDPLHQWRODHVWXIDWLHQHTXHVHUFRORFDGD YLHQWRIXHUWHSXHGHTXHDFW~HQORVVLVWHPDVGHVHJXULGDGTXH
HQSRVLFLQQRUPDO&RPSUREDUODFDSDFLGDGGHVXVWHQWDFLQ llevan a apagar la estufa.
del suelo. En este caso no ponga en funcionamiento el aparato con las
protecciones desactivadas, si no se solucionara el problema
',67$1&,$6'(6(*85,'$'&2175$,1&(1',2 contacte con su Vendedor.
La estufa debe ser instalada respetando las siguientes condicio- CASOS TPICOS
nes de seguridad: Fig. 1 Fig. 2
GLVWDQFLDPQLPDHQORVODGRV\HQODSDUWHSRVWHULRUGHFP
GHORVPDWHULDOHVLQDPDEOHV
GHODQWHGHODHVWXIDQRSXHGHQFRORFDUVHPDWHULDOHVLQDPD-
EOHVDPHQRVGHFP
Si no fuera posible prever las distancias arriba indicadas, es ne-
cesario poner en acto medidas tcnicas y de construccin para
HYLWDUFXDOTXLHUULHVJRGHLQFHQGLR(QFDVRGHFRQH[LQFRQ
SDUHGGHPDGHUDXRWURPDWHULDOLQDPDEOHHVQHFHVDULRDLVODU
adecuadamente el tubo de descarga de humos.

720$'($,5(
Es necesario que el local donde se coloca la estufa tenga una
WRPDGHDLUHFRQXQDVHFFLQGHDOPHQRVFPTXHJDUDQWLFH
HOFDPELRGHDLUHFRQVXPDGRSRUODFRPEXVWLQ&RPRDOWHUQD-
tiva, es posible coger el aire para la estufa directamente del
H[WHULRUDWUDYVGHXQDSURORQJDFLQGHOWXERHQDFHUR\FRQ
A: tubo de salida de humos de acero aislado
XQGLPHWURGHFP(QHVWHFDVRSXHGHQH[LVWLUSUREOHPDV
B:DOWXUDPQLPDP\PVGHODDOWXUDGHFDQDOQGHOWHFKR
de condensacin y es necesario proteger con una red la entrada
C-E:WRPDGHDLUHGHODPELHQWH VHFFLQGHFRQH[LQPQLPRFPs
GHDLUHJDUDQWL]DQGRXQDVHFFLQOLEUHGHDOPHQRVFPs(O
' tubo de salida de humos de acero, interno al tubo de salida de
WXERWLHQHTXHWHQHUXQODUJRLQIHULRUDPHWUR\QRWLHQHTXH
KXPRVH[LVWHQWHGHREUD
WHQHUFXUYDV7LHQHTXHDFDEDUFRQXQWUDPRGH{KDFLDDEDMR
o con una proteccin para el viento. En cualquier caso, todo CHIMENEA
Las caractersticas fundamentales son:
el aire de manera conducto de admisin debe ser garantizada - seccin interna en la base igual que la del tubo de humos
XQDVHFFLQOLEUHDOPHQRVGHFPs(OWHUPLQDOH[WHUQRGHO - seccin de salida no menor que el doble de la del tubo de humos
conducto toma de aire debe ser protegido con una red contra - posicin a todo viento, por encima del techo y fuera de las
LQVHFWRVTXHQRUHGX]FDODVHFFLQSDVDQWHWLOGHFPs ]RQDVGHUHXMRSRUHQFLPDGHODFXPEUHUD\SRUIXHUDGHlas
]RQDVGHUHXMR
- 78 -
INSTALACIN
J$ CIRCULACIN AIRE CALIENTE
La erogacin de aire caliente en el local de instalacin se
efecta con la rejilla instalada frontalmente en la parte superior
J( 

3DUDFDQDOL]DUHODLUHFDOLHQWHHQXQRRGRVORFDOHVFRQWLJXRV
ODHVWXIDHVWHTXLSDGDFRQGRVERFDVHQODSDUWHSRVWHULRU
J$ DODVFXDOHVVHOHVFRQHFWDQWXERVGHDOXPLQLR
bocas salida aire
caliente 3DUDIDFLOLWDUODGLVWULEXFLQGHODLUHFDOLHQWHHVWQGLVSRQLEOHV
ORV.,7\.,7%,6RSFLRQDO YHUSJ 
J%
Recuerde la importancia del aislamiento oportuno del tubo en el
cual pasa el aire para evitar dispersiones.
Se deben evitar curvas del mismo tubo.

1%/2678%26(1/$6%2&$6'(6$/,'$'($,5(
P &$/,(17('(%(1,1752'8&,56($17(6'($3/,-

ESPAOL
P &$5(/5(9(67,0,(172<35(9,2'(60217$-(
'(//$7(5$/683(5,25'()81',&,1/$3$57(
,1,&,$/'(/78%2)/(;,%/('(%((67$5(;7(1-
','$&203/(7$0(17('(02'248((/,0,1(
(/3/,(*8('((67(02'2(/',0(752,17(5-
126((16$1&+$56(16,%/(0(17()$925(-
J& &,(1'2/$(175$'$

La distribucin del aire canalizada es regulable manualmente


P SRUPHGLRGHODVSDODQFDV/ J' 
P 3DUDVHUGHVSOD]DGDVHVQHFHVDULRH[WUDHUODVODFDVGHEORTXHR
3MDGDVFRQWRUQLOORV J%& 
L
L 8QDYH]HOLPLQDGDVODVSODFDVHODLUHFDOLHQWHSXHGHVHUGLUL-
gido o en la parte superior frontal Fig. E (palanca en posicin
WRGDDWUVYHU)LJ' RHQODSDUWHSRVWHULRU)LJ) SDODQFDHQ
SRVLFLQWRGDDGHODQWHYHUJ' RPLWDGHQODSDUWHVXSHULRU
frontal y mitad en la parte posterior (palanca en la posicin
J' LQWHUPHGLDYHUJ' 

1%6,/$(678)$12(6&$1$/,=$'$/$6
frontal
3/$&$6 3 12'(%(16(5(;75$'$6
intermedia

posterior

J( J)

- 79 -
INSTALACIN
q62/8&,1.,7 FG 62/2/2&$/&217,*82
1%/2678%26(1/$6%2&$6'(6$/,'$'($,5(&$/,(17('(%(1,1752'8&,56($17(6'($3/,-
&$5(/5(9(67,0,(172<35(9,2'(60217$-('(//$7(5$/683(5,25'()81',&,1/$3$57(
,1,&,$/'(/78%2)/(;,%/('(%((67$5(;7(1','$&203/(7$0(17('(02'248((/,0,1((/
3/,(*8('((67(02'2(/',0(752,17(5126((16$1&+$56(16,%/(0(17()$925(&,(1'2
/$(175$'$
'HQLUHOSRVLFLRQDPLHQWRGHODHVWXIDFRQUHVSHFWRDODREUDGHDOEDLOHUD JD 
'HVPRQWDUODSDUWHVXSHULRUGHOUHVSDOGR  \HOLPLQDUXQRGHORVGRVWDSRQHVSUHLQFLGLGRVDQLYHOGHODVERFDVGHVDOLGDGH
DLUHFDOLHQWH JE 
$FWLYDUODSDODQFDGHPDQGRGHODFDQDOL]DFLQGHODLUHFDOLHQWH  HOLPLQDQGRODVSODFDVGHEORTXHR   JE 
&RUWDUHOFXEUHWXERDPHGLGD  LQWHUYHQLHQGRHQODSDUWHGHOODGRGHODSDUHG JF 
&RORFDUODHVWXIDHQODSRVLFLQGHQLWLYD
([WHQGHUHOWXERGHDOXPLQLR  SDUDODFDQDOL]DFLQGHODLUHFDOLHQWHVLQFRQHFWDUORDODERFDGHODHVWXID
&DO]DUSUHYHQWLYDPHQWHHQHOWXERGHDOXPLQLRHOURVHWQ  \HOFXEUHWXER D VLQEORTXHDUOR JF 
&DO]DUHOWXERGHDOXPLQLRHQODERFDGHVDOLGDGHODLUHFDOLHQWHHQODSDUWHWUDVHUDGHODHVWXID   JG 
9ROYHUDPRQWDUODSDUWHVXSHULRUGHOUHVSDOGR  
&RORFDUHQSRVLFLQGHQLWLYDHOFXEUHWXER  \MDUORHQODSDUWHSRVWHULRUGHODHVWXIDFRQORVWRUQLOORVVXPLQLVWUDGRV   JG 
,QVWDODUODERFDWHUPLQDO  \HOWXERGHDOXPLQLRFRUUHVSRQGLHQWH  JG 
)LMDUHOURVHWQHQODSDUHG  FRQVLOLFRQD JG 

JD JE
ESPAOL

23

132 1
133
5

13
4
132 7

JF 5 3
6 6a
8
6
6a

4 8
5

JG 5
88 3
4
4
8 6
7

6
6a

Qq .,7
 &DMD  
 7XER  
4 %RFDWHUPLQDO  
 Rosetn de pared  
6a &XEUHWXER  
 7RUQLOORVGHMDFLQFXEUHWXER 4 
8 $EUD]DGHUDGHEORTXHRGHWXERV  
- 80 -
INSTALACIN
q62/8&,1.,7%,6 FG 62/2/2&$/12FRQWLJXR
1%/2678%26(1/$6%2&$6'(6$/,'$'($,5(&$/,(17('(%(1,1752'8&,56($17(6'($3/,-
&$5(/5(9(67,0,(172<35(9,2'(60217$-('(//$7(5$/683(5,25'()81',&,1/$3$57(
,1,&,$/'(/78%2)/(;,%/('(%((67$5(;7(1','$&203/(7$0(17('(02'248((/,0,1((/
3/,(*8('((67(02'2(/',0(752,17(5126((16$1&+$56(16,%/(0(17()$925(&,(1'2
/$(175$'$
'HQLUHOSRVLFLRQDPLHQWRGHODHVWXIDFRQUHVSHFWRDODREUDGHDOEDLOHUD JD 
'HVPRQWDUODSDUWHVXSHULRUGHOUHVSDOGR  \HOLPLQDUXQRGHORVGRVWDSRQHVSUHLQFLGLGRVDQLYHOGHODVERFDVGHVDOLGDGH
DLUHFDOLHQWH JE 
$FWLYDUODSDODQFDGHPDQGRGHODFDQDOL]DFLQGHODLUHFDOLHQWH  HOLPLQDQGRODVSODFDVGHEORTXHR   JE 
&RUWDUHOFXEUHWXERDPHGLGD  LQWHUYHQLHQGRHQODSDUWHGHOODGRGHODSDUHG )LJ
&RORFDUODHVWXIDHQODSRVLFLQGHQLWLYD
([WHQGHUHOWXERGHDOXPLQLR  SDUDODFDQDOL]DFLQGHODLUHFDOLHQWHVLQFRQHFWDUORDODERFDGHODHVWXID
&DO]DUSUHYHQWLYDPHQWHHQHOWXERGHDOXPLQLRHOURVHWQ  \HOFXEUHWXER D VLQEORTXHDUOR JF 
&DO]DUHOWXERGHDOXPLQLRHQODERFDGHVDOLGDGHODLUHFDOLHQWHHQODSDUWHWUDVHUDGHODHVWXID   JG 
9ROYHUDPRQWDUODSDUWHVXSHULRUGHOUHVSDOGR  
&RORFDUHQSRVLFLQGHQLWLYDHOFXEUHWXER  \MDUORHQODSDUWHSRVWHULRUGHODHVWXIDFRQORVWRUQLOORVVXPLQLVWUDGRV   JG 
,QVWDODUODERFDWHUPLQDO  \HOWXERGHDOXPLQLRFRUUHVSRQGLHQWH  MQGRORFRQHODQLOORGHSDUHG  \ORV
WDFRVFRQWRUQLOORV   JG 
)LMDUHOURVHWQHQODSDUHG  FRQVLOLFRQD JG 

ESPAOL
JD JE 2
2

132
133 1
5
7

13
4 6 6a
132

JF 5
9 9
8

6 10 11

10 9
9 4
10
8 8
JG 5
4 2
8
7

5
6 6

Qq .,7%,6
 &DMD  
 7XER  
4 %RFDWHUPLQDO  
 Rosetn de pared  
6a &XEUHWXER  
 7RUQLOORVGHMDFLQFXEUHWXER 4 
8 $EUD]DGHUDGHEORTXHRGHWXERV  
 $QLOORGHSDUHG  
 7RUQLOORV 4 
 7DFRV 4 
- 81 -
INSTALACIN
q62/8&,1.,7 FG FRQ.,7%,6 FG $0%26/2&$/(6
1%/2678%26(1/$6%2&$6'(6$/,'$'($,5(&$/,(17('(%(1,1752'8&,56($17(6'($3/,-
&$5(/5(9(67,0,(172<35(9,2'(60217$-('(//$7(5$/683(5,25'()81',&,1/$3$57(
,1,&,$/'(/78%2)/(;,%/('(%((67$5(;7(1','$&203/(7$0(17('(02'248((/,0,1((/
3/,(*8('((67(02'2(/',0(752,17(5126((16$1&+$56(16,%/(0(17()$925(&,(1'2
/$(175$'$
'HQLUHOSRVLFLRQDPLHQWRGHODHVWXIDFRQUHVSHFWRDODREUDGHDOEDLOHUD JD 
'HVPRQWDUODSDUWHVXSHULRUGHOUHVSDOGR  \HOLPLQDUORVWDSRQHVSUHLQFLGLGRVDQLYHOGHODVERFDVGHVDOLGD
GHDLUHFDOLHQWH JE 
$FWLYDUODVSDODQFDVGHPDQGRGHODFDQDOL]DFLQGHODLUHFDOLHQWH  HOLPLQDQGRODVSODFDVGHEORTXHR   JE 
&RUWDUHOFXEUHWXERDPHGLGD  LQWHUYLQLHQGRHQODSDUWHGHOODGRGHODSDUHG JF
&RORFDUODHVWXIDHQODSRVLFLQGHQLWLYD
([WHQGHUORVWXERVGHDOXPLQLR  SDUDODFDQDOL]DFLQGHODLUHFDOLHQWHVLQFRQHFWDUORVDODVERFDVGHODHVWXID
&DO]DUSUHYHQWLYDPHQWHHQORVWXERVGHDOXPLQLRORVURVHWRQHV  \ORVFXEUHWXERV D VLQEORTXHDUORV JF 
&DO]DUORVWXERVGHDOXPLQLRHQODVERFDVGHVDOLGDGHODLUHFDOLHQWHHQODSDUWHWUDVHUDGHODHVWXID   JG 
9ROYHUDPRQWDUODSDUWHVXSHULRUGHOUHVSDOGR  
&RORFDUHQSRVLFLQGHQLWLYDORVFXEUHWXERV  \MDUORVHQODSDUWHSRVWHULRUGHODHVWXIDFRQORVWRUQLOORVVXPLQLVWUDGRV   JG 
,QVWDODUERFDVWHUPLQDOHV  \ORVUHODWLYRVWXERVLQDOOXPLQLR  MQGRORVFRQORVDQLOORVGHSDUHG  \ORV
WDFRVFRQWRUQLOORV   JG 
)LMDUORVURVHWRQHVHQODSDUHG  FRQVLOLFRQD JG 
ESPAOL

JD JE
2

5
3 132 1
5
133 2
7
6
13 4
6a

6 6a
132

JF 5 3 8
9 9

6 10 11

4
8
5

10 9 4
10 9
8 8
JG 5
4 3 2
8
7
8 6

4 5
6 5 6

Qq .,7 .,7%,6


 &DMD   
 7XER  - 
 7XER   -
4 %RFDWHUPLQDO   
 Rosetn de pared   
6a &XEUHWXER   
 7RUQLOORVGHMDFLQFXEUHWXER 8  
8 $EUD]DGHUDGHEORTXHRGHWXERV 4  
 $QLOORGHSDUHG  - 
 7RUQLOORV 4 - 
 7DFRV 4 - 
- 82 -
,16758&&,21(6'(862
La puesta en marcha la tiene que efectuar un Centro de
$VLVWHQFLD7pFQLFDDXWRUL]DGRSRU(GLONDPLQ &$7 FRQSULPHU
HQFHQGLGR\HQVD\RFRQDUUHJORDODQRUPD81,

Dicha norma indica las operaciones de control que efectuar en


el sitio, que aseguran el correcto funcionamiento del sistema.

Antes de encender.
Para el primer encendido es indispensable acudir al Centro
GH$VLVWHQFLD7pFQLFDGH(GLONDPLQGHOD]RQD &$7  SDUD
informacin consultar el sitio web www.edilkamin.com) que
VHHQFDUJDUiGHDMXVWDUODHVWXIDVHJ~QHOWLSRGHSHOOHWV\VHJ~Q
ODVFRQGLFLRQHVHIHFWLYDVGHLQVWDODFLyQDFWLYDQGRWDPELpQOD
garanta.
J
6LHOHQFHQGLGRQRORHIHFW~DXQ&$7DXWRUL]DGR(GLONDPLQ
no puede garantizar que la estufa funcione correctamente.

'XUDQWHORVSULPHURVHQFHQGLGRVVHSXHGHQDSUHFLDUOLJHURV
RORUHVDSLQWXUDTXHGHVDSDUHFHUQHQEUHYHWLHPSR

ESPAOL
$QWHVGHHQFHQGHUHVQHFHVDULRFRPSUREDU
/DFRUUHFWDLQVWDODFLQ
/DDOLPHQWDFLQHOFWULFD
(OFLHUUHGHODSXHUWDTXHGHEHVHUKHUPWLFR
/DOLPSLH]DGHOFULVRO
/DSUHVHQFLDHQODSDQWDOODGHODLQGLFDFLQGHHVWDGRHQHVSH
ra (fecha, potencia o temperatura intermitente).

&$5*$'(/3(//(7(1(/'(36,72
/DWDSDGHOGHSVLWRVHDEUH\VHFLHUUDDWUDYVGHOSUFWLFR
sistema de clic-clac ejerciendo una ligera presin en la parte
GHODQWHUDGHODWDSDGHIXQGLFLQ J 

ATENCIN:
XWLOL]DUHOJXDQWHDSURSLDGRVXPLQLVWUDGRVLVHFDUJDOD
HVWXIDPLHQWUDVHVWHQIXQFLRQDPLHQWR\SRUORWDQWR
caliente.

127$VREUHHOFRPEXVWLEOH
La estufa HVWSUR\HFWDGD\SURJUDPDGDSDUDTXHPDUSHOOHWGH El uso de pellet con diferentes caractersticas implica la ne-
PDGHUDGHPPGHGLPHWUR FHVLGDGGHXQHVSHFFRDMXVWHGHODVHVWXIDVDQORJRDOTXH
El pellet es un combustible que se presenta en forma de pe- UHDOL]DHO',675,%8,'25HQHOSULPHUHQFHQGLGR
queos cilindros, obtenidos prensando serrn, de altos valores, El uso de pellet no apropiados puede provocar: disminucin
VLQXVDUDJOXWLQDQWHVXRWURVPDWHULDOHVH[WUDRV del rendimiento, anomalas de funcionamiento, bloqueos por
6HFRPHUFLDOL]DHQVDFRVGH.J3DUD12SRQHUHQSHOLJUR REVWUXFFLQVXFLHGDGGHOYLGULRPDWHULDOHVLQFRPEXVWRV8Q
HOIXQFLRQDPLHQWRGHODVHVWXIDVHVLQGLVSHQVDEOH12TXHPDU VLPSOHDQOLVLVGHOSHOOHWSXHGHOOHYDUVHDFDERYLVXDOPHQWH
otras cosas. La utilizacin de otros materiales (incluida lea), Bueno: Liso, longitud regular, poco polvoroso.
GHWHFWDEOHDWUDYVGHDQOLVLVGHODERUDWRULRGHMDUDVLQHIHFWR 'HPDODFDOLGDG con grietas longitudinales y transversales
ODJDUDQWD(GLO.DPLQKDSUR\HFWDGRSUREDGR\SURJUDPDGR muy polvoroso, longitud muy variable y con presencia de
sus propios productos para que garanticen las mejores presta- FXHUSRVH[WUDRV
ciones con pellet de las siguientes caractersticas:
GLPHWURPLOPHWURV
ORQJLWXGP[LPDPP
KXPHGDGP[LPD
UHQGLPLHQWRFDOULFRNFDONJ

- 83 -
,16758&&,21(6'(862
PANEL SINPTICO
SUHVLRQDGRGXUDQWHHQFLHQGH\DSDJD

6LVHSXOVDEUHYHPHQWHVHSDVDGHOIXQFLRQDPLHQWRPDQXDOGHODHVWXIDDOIXQFLRQDPLHQWRDXWRPWLFRVLVHPDQWLHQH
DSUHWDGR GXUDQWHXQRV VHSXHGHDFFHGHUDORVYDULRVPHQVGHSURJUDPDFLQ
para aumentar las distintas regulaciones

para disminuir las distintas regulaciones

&DGDYH]TXHVHSXOVDGDDFRQRFHUDODPHPRULDGHODWDUMHWDHOHFWUQLFDTXHHQHOGHSVLWRVHKDQSXHVWR.JXQD
SUHVLQFRQWLQXDGXUDQWHERUUDORV.JTXHTXHGDQRTXHVHKDQLQJUHVDGRDQWHULRUPHQWH

6LVHSXOVDEUHYHPHQWHFRQPXWDGHPDQHUDDOWHUQDODYHQWLODFLQGHODHVWXIDHQWUHXQQLYHOPVVLOHQFLRVRGHQRPLQD-
GR&RPIRUW\XQQLYHOPVIXHUWHGHQRPLQDGR7XUER
ESPAOL

3DUDVHOHFFLRQDUODSRWHQFLDGHIXQFLRQDPLHQWRTXHVHGHVHDKD\TXHWRFDUHQFRUUHVSRQGHQ-
FLDFRQORVSXQWRV/('
 (QDOWHUQDWLYDVHSXHGHXWLOL]DUODFRQJXUDFLQWUDGLFLRQDOTXHVHUHDOL]DPHGLDQWHXQRV
ERWRQHV

Llenado cclea. (QFHQGLGRPDQXDO


En el primer uso o en caso de vaciado completo del depsito de (QFDVRVGHWHPSHUDWXUDSRUGHEDMRGHORVq&TXHQRSHUPLWD
SHOOHWSDUDOOHQDUODFFOHDSUHVLRQDUODVWHFODVHGHO DODUHVLVWHQFLDHOFWULFDHQFDQGHFHURGHPRPHQWQHDQRIXQ-
PDQGRDGLVWDQFLDFRQWHPSRUQHDPHQWHGXUDQWHDOJQVHJXQ- cionalidad de la resistencia es posible utilizar para el encendido
do, a continuacin, una vez soltadas las teclas, en la pantalla ODGLDYROLQD,QWURGXFLUHQHOFULVROXQFXELWRGHGLDYROLQD
DSDUHFHODDQRWDFLQ&$5*$5/DRSHUDFLQGHEHHIHF- ELHQHQFHQGLGRFHUUDUODSXHUWD\SUHVLRQDUGHVGHHOSDQHO
tuarse antes del encendido si la estufa se ha parado porque se sinptico o desde el mando a distancia.
KDFRQVXPLGRHOSHOOHWDOQDOGHODRSHUDFLQYDFLDUHOFULVRO
antes de girar. Es normal que en el depsito quede una cantidad 5HJPHQHVGHIXQFLRQDPLHQWR
residual de pellet que la cclea no consigue aspirar. Manual: el usuario programa la potencia de trabajo
GHVHDGD GHPQLPDDP[LPD
(QFHQGLGRDXWRPWLFR $XWRPWLFRHOXVXDULRFRQJXUDPHGLDQWHXQERWQRFRQ
&RQODHVWXIDHQHVWDGRHQHVSHUDSUHVLRQDQGRGXUDQWHOD el mando a distancia, la temperatura que desea en la habitacin;
WHFOD GHVGHHOSDQHOVLQSWLFRRGHVGHHOPDQGRDGLVWDQ- la estufa capta dicha temperatura y modula la potencia en vistas
cia) se pone en marcha el procedimiento de encendido y se GHDOFDQ]DUODWHPSHUDWXUDFRQJXUDGDSDUDVHJXLGDPHQWH
YLVXDOL]DODRSFLQ(QFHGLGR\XQDFXHQWDDWUVHQVHJXQGRV VLWXDUVHHQODSRWHQFLD
 /DIDVHGHHQFHQGLGRVLQHPEDUJRQRHVWHQWLHPSR
SUHGHWHUPLQDGR6XGXUDFLQVHDFRUWDDXWRPWLFDPHQWHVLOD )XQFLRQDPLHQWRPDQXDOGHVGHSDQHOVLQSWLFRPDQGRD
FKDGHWHFWDODVXSHUDFLQGHDOJXQDVSUXHEDV'HVSXVGH distancia
DSUR[LPDGDPHQWHPLQXWRVDSDUHFHODOODPD &RQODHVWXIDHQIXQFLRQDPLHQWRRHQHVWDGRHQHVSHUDSUHVLR-
QDQGRXQDYH]ODWHFOD0(1GHVGHHOSDQHOVLQSWLFRPDQGR
DGLVWDQFLDVHYLVXDOL]DHQODSDQWDOODODRSFLQ3RWHQFLD FRQ
ODSRWHQFLDHQODFXDOODHVWXIDHVWWUDEDMDQGR SUHVLRQDQGR
ODWHFODGHVGHHOPDQGRDGLVWDQFLDHVSRVLEOHDXPHQWDUOD
SRWHQFLDGHIXQFLRQDPLHQWR GHSRWHQFLDD3RWHQFLD 
- 84 -
,16758&&,21(6'(862
)XQFLRQDPLHQWRDXWRPWLFRGHVGHSDQHOVLQSWLFRPDQGRD 8VDUODWHFOD0(1SDUDYLVXDOL]DUHQRUGHQLQYHUVR
distancia 6LVHVHOHFFLRQDHUSURJUDPDVHYLVXDOL]DODKRUDGHOHQFHQGL-
3UHVLRQDQGRODWHFOD0HQYHFHVVHFRQPXWDGHVGHIXQFLR- do.
QDPLHQWRPDQXDODIXQFLRQDPLHQWRDXWRPWLFRUHJXODQGROD (QODSDQWDOODDSDUHFH(QFHQGLGRKRUDVFRQ
temperatura que se desea alcanzar en el local (para regular ODWHFODVHFDPELDODKRUD\VHFRQUPDFRQ0(1
ODWHPSHUDWXUDGHq&Dq&XWLOL]DUODVWHFODV\FRQHO (QODSDQWDOODDSDUHFH(QFHQGLGRPLQXWRVFRQOD
mando a distancia) y la estufa regula la potencia de trabajo para WHFODVHFDPELDQORVPLQXWRV\VHFRQUPDFRQODWHFOD
alcanzarla. Si se programa una temperatura inferior a la del 0(1'HOPLVPRPRGRVHUHJXODODKRUDGHORVDSDJDGRV
ORFDOODHVWXIDWUDEDMDHQ3RWHQFLD /DFRQUPDFLQGHOSURJUDPDVHHIHFWDSUHVLRQDQGROD
WHFOD0(1FXDQGRVHOHH*XDUGDGR2.HQODSDQWDOOD
Apagado &RQUPDQGR3URJUDPDVHPDQDVHGHEHUHOHJLUHOGDHQ
3DUDHOPD\RUFRQIRUWODHVWXIDVHDSDJDFRQORVYHQWLODGRUHV el cual efectuar la programacin:
DLUHDPELHQWHDODPLVPDSRWHQFLDHQODTXHHVWDEDWUDEDMDQGR /X0DU0LU-XH9LHU6E'RP
&RQODHVWXIDHQIXQFLRQDPLHQWRSUHVLRQDQGRGXUDQWHODWHFOD 8QDYH]VHOHFFLRQDGRHOGDXWLOL]DQGRODVWHFODV\\
 GHVGHHOSDQHOVLQSWLFRRGHVGHHOPDQGRDGLVWDQFLD VHSRQH FRQUPDQGRFRQODWHFOD0(1VHSURVHJXLUFRQOD
en marcha el procedimiento de apagado y se visualiza la cuenta programacin con la misma modalidad con la cual se efecta
DWUVYDULDEOHVHJQODSRWHQFLDHQODFXDOVHHQFRQWUDEDFXDQGRVH XQ3URJUDPDGLDULRHOLJLHQGRVLDFWLYDUXQDSURJUDPDFLQ
haba puesto en marcha la fase de apagado. para cada da de la semana estableciendo un nmero de
La fase de apagado (que tiene el objetivo de apagar la llama, no intervenciones y a qu horarios. En caso de error
dejar materiales incombustos en el crisol y enfriar la estufa) prev: en cualquier momento de la programacin se puede salir del

ESPAOL
,QWHUUXSFLQFDGDSHOOHW SURJUDPDVLQJXDUGDUSUHVLRQDQGRODWHFOD
9HQWLODFLQDFWLYDDOQLYHOHQHOTXHODHVWXIDHVWDEDIXQFLRQDQGR
0RWRUH[SXOVLQKXPRVDFWLYDGR 1RWDVREUHODYDULDELOLGDGGHODOODPD
No desconecte nunca el enchufe durante la fase de apagado. 3RVLEOHVYDULDFLRQHVGHOHVWDGRGHODOODPDGHSHQGHGHOWLSR
de pellet utilizado, y de una normal variabilidad de la llama
Regulacin del reloj de combustible slido y de las limpiezas peridicas del crisol
3UHVLRQDQGRGXUDQWHODWHFOD0(1\VLJXLHQGRFRQODV TXHODHVWXIDHIHFWDDXWRPWLFDPHQWH
WHFODV\ODVLQGLFDFLRQHVGHODSDQWDOODVHDFFHGHDO0HQ 1%ODVOLPSLH]DVDXWRPWLFDVHIHFWXDGDVSRUODHVWXIDQR
5HORM3HUPLWLHQGRSURJUDPDUHOUHORMLQWHUQRHQODFKDHOHF- sustituyen la necesaria aspiracin en fro por parte del
WUQLFD3UHVLRQDQGRODWHFOD0(1VXFHVLYDPHQWHDSDUHFHQ usuario antes del encendido).
en secuencia y pueden ser regulados los siguientes datos:
'D0HV$R+RUD0LQXWRV'DGHODVHPDQD/DRSFLQ Sealizacin reserva pellet
*XDUGDGR""TXHFRQUPDUFRQ0(1SHUPLWHYHULFDUOD /DVHVWXIDVHVWQGRWDGDVGHIXQFLQHOHFWUQLFDGHGHWHFFLQ
H[DFWLWXGGHODVRSHUDFLRQHVUHDOL]DGDVDQWHVGHFRQUPDUODV de cantidad pellet.
HQWRQFHVVHYLVXDOL]DHQODSDQWDOODODDQRWDFLQ*XDUGDGR (OVLVWHPDGHGHWHFFLQSHOOHWLQWHJUDGRGHQWURGHODFKDHOHF-
2.  trnica permite monitorizar en cualquier momento durante el
IXQFLRQDPLHQWRFXQWRVNJIDOWDQSDUDDJRWDUODFDUJDGHSHOOHW
3URJUDPDGRUGHHQFHQGLGRV\DSDJDGRVKRUDULRVGXUDQWH efectuada.
ODVHPDQD Es importante para el correcto funcionamiento del sistema que
3UHVLRQDQGRGXUDQWHVHJXQGRVODWHFOD0(1GHVGHHO HQHOSULPHUHQFHQGLGR TXHGHEHVHUHIHFWXDGRSRUHO',675,-
mando a distancia se accede a la regulacin del reloj y %8,'25 VHHIHFWHHOVLJXLHQWHSURFHGLPLHQWR
SUHVLRQDQGRODWHFODVHDFFHGHDODIXQFLQGHSURJUDPDFLQ $QWHVGHHPSH]DUDXWLOL]DUHOVLVWHPDGHGHWHFFLQSHOOHWHV
KRUDULDVHPDQDOLGHQWLFDGDHQODSDQWDOODFRQOD necesario cargar y consumir completamente un primer saco de
GHVFULSFLQ3URJUDP212))/DSURJUDPDFLQSHUPLWH pellet, esto sirve para obtener un breve rodaje del sistema de
programar un nmero de encendidos y apagados al da carga.
KDVWDXQP[LPRGHWUHV HQFDGDXQRGHORVGDVGHOD &DUJDUNJGHSHOOHW
semana. $FRQWLQXDFLQSUHVLRQDUXQDYH]ODWHFODUHVHUYDDVVHLQWUR-
&RQUPDQGRHQODSDQWDOODFRQODWHFOD0(1DSDUHFHXQD GXFHHQODPHPRULDTXHVHKDQFDUJDGRNJ
GHODVVLJXLHQWHVSRVLELOLGDGHV1R3URJ QLQJQSURJUDPD 'HVGHHVWHPRPHQWRHQODSDQWDOODVHYLVXDOL]DODFDQWLGDG
SURJUDPDGR 3URJUDPDGLDU QLFRSURJUDPDSDUD TXHTXHGDGHSHOOHWFRQLQGLFDFLQGHFUHFLHQWHHQNJ
WRGRVORVGDV 3URJUDPDVHP SURJUDPDFLQSDUDFDGD  &DGDYH]TXHVHUHFDUJDVHLQWURGXFHHQ
GD 6HSDVDGHXQRDRWURFRQODVWHFODV\ ODPHPRULDODFDQWLGDGGHSHOOHWFDUJDGD3DUDLQWURGXFLUHQOD
&RQUPDQGRFRQODWHFOD0(1ODRSFLQ3URJUDPDGLDULR PHPRULDVLODUHFDUJDGHNJHVVXFLHQWHSUHVLRQDUODWHFOD
se accede a la seleccin del nmero de programas FDUJDSHOOHWSDUDFDQWLGDGHVGLIHUHQWHVRHQFDVRGHHUURUHV
HQFHQGLGRVDSDJDGRV TXHVHHIHFWDQHQXQGD se puede indicar la cantidad por medio del men reserva pellet
8WLOL]DQGR3URJUDPD'LDULRHOSURJUDPDDVSURJUDPDGRRV de la siguiente manera.
VHUHOPLVPRSDUDWRGRVORVGDVGHODVHPDQD 3UHVLRQDQGRGXUDQWHODWHFOD0(1VHYLVXDOL]D
3UHVLRQDQGRVXFHVLYDPHQWHVHSXHGHQYLVXDOL]DU1RSUR- $-867(6
gramas 3UHVLRQDQGRODWHFODRFRQVHFXWLYDPHQWHVHYLVXDOL]D
q3URJUDPDGLDU XQHQFHQGLGR\XQDSDJDGRDO 5(6(59$
GD q3URJUDPDGLDULR LGHP HU3URJUDPDGLDULR LGHP
- 85 -
,16758&&,21(6'(862
&RQUPDQGRFRQODWHFODPHQDSDUHFHOD 5HJXODFLQGHODWHPSHUDWXUDFRQWHUPRVWDWRH[WHUQR
FDQWLGDGGHSHOOHWSUHVHQWHODTXHVHFDUJD SRUGHIHFWR disponible un sistema de control de la temperatura ambiente al-
YDULDEOHFRQODVWHFODV  WHUQDWLYRDOPDQGRDGLVWDQFLD'HKHFKRVHSXHGHFRQHFWDUDO
$ODSUHWDUHOERWQVHDXPHQWDQORV.JTXHVHLQJUHVDQSXO- puerto serial el termostato ambiente de la casa o uno cualquiera
sando el botn - se disminuyen; si se pulsa repetidas veces el VDOLGDHQFRQWDFWROLPSLR IFLOGHHQFRQWUDU
ERWQVHOOHJDDODFDUJD.J 5HQHOGLVSOD\ TXHSHUPLWH
borrar la carga que queda. /DHVWXIDUHFRQRFHUDXWRPWLFDPHQWHODFRQH[LQDOSXHUWR
Si el pellet se agotase en el depsito, la estufa se bloquea serial del termostato cumpliendo las siguientes condiciones:
FRQODRSFLQ6WRS/ODPD YHUSJ  &RQWHPSHUDWXUDDPELHQWHLQIHULRUDODFRQJXUDFLQGHOWHU-
1%5HFXHUGHGHYH]HQFXDQGRSRQHUDFHURODVHDOL]DFLQ mostato (contacto cerrado), la estufa modula normalmente las
UHVHUYDSHOOHWSDUDSHUPLWLUXQDPHMRUDELOLGDGGHODPLVPD potencias para lograr el ajuste de temperatura.
funcin. &RQODWHPSHUDWXUDDPELHQWHDOFDQ]DGDSRUHOWHUPRVWDWR FRQ-
3DUDFXDOTXLHULQIRUPDFLQFRQWDFWDUFRQHO'LVWULEXLGRUDXWRUL- tacto abierto), la estufa pasa al modo stand-by.
zado que ha efectuado el primer encendido. Se trata de una
referencia estimativa. Se logra una mayor precisin con una 7HPSHUDWXUD
SXHVWDDFHURDQWHVGHHIHFWXDUXQDQXHYDFDUJD(GLONDPLQQR 7HPSHUDWXUD 1LQJXQDUHJX-
proporcionada
proporcionada lacin
responde de ninguna manera en caso de variaciones con respec- &RQJXUDFLQ por termostato
por el mando FRQJXUDFLQ
WRDFXDQWRLQGLFDGR SXHGHGHSHQGHUGHIDFWRUHVH[WHUQRV  a distancia
ambiente
GHIEULFD
H[WHUQR
5HJXODFLQGHWHPSHUDWXUDDPELHQWH 3DUPHWUR
ESPAOL

una cmoda y sencilla regulacin que se ofrece de serie en esta &RPIRUW 21 21 21


lnea de productos permite gestionar la potencia de la termoe- &OLPD
stufa en funcin de la temperatura ambiente.
3UHYLDDFWLYDFLQGHODIXQFLQ&RPIRUW&OLPDGHVGHHO 3DUPHWUR
21 2)) 21
PHQGHSDUPHWURV VROLFLWDUDO&$7 SRGHPRVXWLOL]DUGLFKD 621'$,5
IXQFLQSDUDDSDJDUDOHVWXIDDODOFDQ]DUODWHPSHUDWXUDFRQ-
JXUDGD'LFKDIXQFLQHVWFRPELQDGDFRQODFRQJXUDFLQGH 12 S 12
&RQH[LQDO
ODHVWXIDHQPRGR$87207,&2(QWRGRFDVRHOIXQFLRQD- ninguna con cable ninguna
puerto serial
PLHQWRHQPRGR0$18$/SHUPDQHFHULQYDULDGR FRQH[LQ serial azul FRQH[LQ
7UDVODKDELOLWDFLQUHDOL]DGDSRUHO&$7VHSXHGHDFWLYDU
GHVDFWLYDUODIXQFLQ&RPIRUWFOLPDGHVGHHOPHQGHXVXDULR
SXOVDUODWHFOD6(7EXVFDUHOPHQ&RPIRUWFOLPDFRQODV
WHFODVVHOHFFLRQDUORFRQODWHFOD6(7FRQJXUDU212))
FRQODVWHFODV\JXDUGDUODFRQJXUDFLQGHVHDGDVDOLHQGR
FRQODWHFOD

'HWDOOHGHIXQFLRQDPLHQWR&RPIRUWFOLPD21
ODHVWXIDFXDQGRHVWHQPRGR$87207,&2PRGXODVX
SRWHQFLDLQWHQWDQGRDOFDQ]DUODWHPSHUDWXUDFRQJXUDGDSRU
HOXVXDULR$ODOFDQ]DUODWHPSHUDWXUDDPELHQWHODHVWXIDVH
apaga, para despus volverse a encender de manera autnoma
cuando vuelve a bajar la temperatura.

6HOHFFLQGHWHPSHUDWXUD
(QPRGR&RPIRUWFOLPDSXOVDQGRODVWHFODVHQHOSDQHO
VLQSWLFRRHQHOPDQGRDGLVWDQFLDVHFRQJXUDHQHOGLVSOD\
ODWHPSHUDWXUDGHVHDGDHQHODPELHQWH3RUWDQWRVHREWHQGUQ
las siguientes situaciones:
&RQWHPSHUDWXUDDPELHQWHLQIHULRUDODFRQJXUDFLQOD
estufa se enciende de manera autnoma modulando la potencia
DXWRPWLFDPHQWH
&RQODWHPSHUDWXUDDPELHQWHDOFDQ]DGD q& ODHVWXID
pasa al modo stand-by -La temperatura ambiente se transmite
a travs del mando a distancia en dotacin; el transmisor del
mando a distancia debe encontrarse en alineacin visual con el
receptor del panel sinptico.
En caso de que, debido a una colocacin incorrecta del mando
a distancia, no se produzca el envo de la temperatura registra-
da por el mismo, la estufa decide de manera autnoma pasar al
uso de la sonda de temperatura instalada a bordo hasta que se
UHVWDEOH]FDODFRQH[LQFRQHOPDQGRDGLVWDQFLD
- 86 -
,16758&&,21(6'(862
0$1'2$',67$1&,$FRG

Leyenda teclas y pantalla:


WHFODHQFHQGLGRDSDJDGR
+ WHFODSDUDDXPHQWDUODSRWHQFLDWHPSHUDWXUDGHWUDEDMR GHQWURGHXQPHQDXPHQWDODYDULDEOHYLVXDOL]DGD
- WHFODSDUDGLVPLQXLUODSRWHQFLDWHPSHUDWXUDGHWUDEDMR GHQWURGHXQPHQGLVPLQX\HODYDULDEOHYLVXDOL]DGD
A WHFODSDUDSDVDUDODSURJUDPDFLQ($6<7,0(5
MWHFODSDUDSDVDUDOWHUQDWLYDPHQWHGHODIXQFLQDXWRPWLFDDODPDQXDO\YLFHYHUVD

,QGLFDXQDWUDQVPLVLQGHGDWRVGHOPDQGRDGLVWDQFLDDOD
tarjeta.

WHFODGREORTXHDGRHYLWDDFWLYDFLRQHVQRGHVHDGDV SXOVDU$
\0DOPLVPRWLHPSRGXUDQWHDOJXQRVVHJXQGRVSDUDEOR-
TXHDUGHVEORTXHDUHOWHFODGR 

EDWHUDGHVFDUJDGD QqSLODVDOFDOLQDVPLQLVWLOR$$$

ESPAOL
,QGLFDTXHVHHVWSURJUDPDQGRXQHQFHQGLGRDSDJDGRFRQHO
SURJUDPD($6<7,0(5

,QGLFDODWHPSHUDWXUDDPELHQWHGHWHFWDGDSRUHOPDQGRDGLVWDQFLD
GXUDQWHODFRQJXUDFLQWFQLFDGHOPDQGRDGLVWDQFLDLQGLFDORV
YDORUHVGHORVSDUPHWURVFRQJXUDGRV 

,QGLFDTXHVHKDWUDQVPLWLGRXQDRUGHQGHHQFHQGLGRGHHVWXID

LQGLFDGRUGHFRQJXUDFLQPDQGRDGLVWDQFLDSDUDXQDHVWXID
GHSHOOHWDLUH

IXQFLQDXWRPWLFD
(aparece en la pantalla el valor de la temperatura)

funcin de regulacin manual


(aparece en la pantalla el valor de la potencia de trabajo)

7(03(5$785$'(7(&7$'$325(/0$1'2$',67$1&,$
(OPDQGRDGLVWDQFLDHVWHTXLSDGRFRQXQDVRQGDH[WHUQDSDUDODGHWHFFLQGHODWHPSHUDWXUDDPELHQWHYLVXDOL]DGDHQ
tiempo real en la pantalla del mismo. La temperatura detectada es transmitida peridicamente a la tarjeta electrnica del inserta-
EOHHVWXIDVLHOOHGWUDQVPLVRUGHOPDQGRDGLVWDQFLD\HOVHQVRUUHFHSWRUGHOSDQHOVLQSWLFRGHOLQVHUWDEOHHVWXIDVHHQFXHQWUDQ
UHFSURFDPHQWHHQFDPSRYLVXDO6LODWHPSHUDWXUDGHOPDQGRDGLVWDQFLDQROOHJDDODWDUMHWDGHOLQVHUWDEOHHVWXIDWUDQVFXUULGRV
PVGHPLQXWRVVHXWLOL]DHOGDWRGHODWHPSHUDWXUDTXHSURYLHQHGHODVRQGDFRQHFWDGDHQHOSDQHOVLQSWLFR

6(/(&&,102'$/,'$')81&,21$0,(172
3XOVDQGREUHYHPHQWHODWHFOD0SRGHPRVGHVSOD]DU\UHJXODUODVVLJXLHQWHVIXQFLRQHV

UHJXODFLQDXWRPWLFDGHODSRWHQFLD

regulacin manual de la potencia

- 87 -
,16758&&,21(6'(862
862'(/352*5$0$($6<7,0(5
3RUPHGLRGHOPDQGRDGLVWDQFLDVHSXHGHXWLOL]DUSURJUDPDFLQKRUDULDPX\LQWXLWLYD\USLGD
- 6LODHVWXIDHVWHQFHQGLGD se puede programar un apagado con un reenvo regulable entre una y doce horas; en la pantalla del
SDQHOVLQSWLFRVHYLVXDOL]DUHOWLHPSRTXHIDOWDSDUDHODSDJDGRSURJUDPDGR
- 6LODHVWXIDHVWDSDJDGD: se puede programar un encendido con un reenvo regulable entre una y doce horas, en la pantalla del
SDQHOVLQSWLFRVHYLVXDOL]DUHOWLHPSRTXHIDOWDSDUDHOHQFHQGLGRSURJUDPDGR

3URJUDPDFLQpara programar el temporizador proseguir de la siguiente manera:


D 3XOVDUODWHFOD$VHHQFLHQGHHQODSDQWDOODHOLFRQR FRQUPDQGRHODFFHVRDODSURJUDPDFLQ(DV\WLPHU
E &RQODVWHFODVSURJUDPDUHOQPHURGHKRUDVGHVHDGRHMHPSOR

F $SXQWDUHOPDQGRDGLVWDQFLDKDFLDHOUHFHSWRUGHOSDQHOVLQSWLFR
G &RQUPDUODSURJUDPDFLQSXOVDQGRODWHFOD$GXUDQWHXQSDUGHVHJXQGRVVHDSDJDUHOLFRQR \VHYHUHQHOSDQHO
sinptico la indicacin del tiempo que falta para la intervencin programada.

H 3DUDDQXODUODSURJUDPDFLQUHSHWLUORVSXQWRVD E F G SURJUDPDQGRHOQPHURGHKRUDVD+
ESPAOL

%/248(2'(/7(&/$'2
Se puede bloquear el teclado del mando a distancia para evitar activaciones accidentales no controladas por el usuario.
3XOVDQGRDOPLVPRWLHPSRODVWHFODV$\0VHHQFHQGHUHOVPERORGHODOODYHFRQUPDQGRTXHVHKDHIHFWXDGRHOEORTXHR
GHOWHFODGR3DUDGHVEORTXHDUHOWHFODGRSUHVLRQDUGHQXHYRODVWHFODV$\0DOPLVPRWLHPSR

,1',&$&,1%$7(5$6'(6&$5*$'$6
(OHQFHQGLGRGHOLFRQRGHODEDWHUDLQGLFDTXHODVSLODVGHQWURGHOPDQGRDGLVWDQFLDHVWQFDVLDJRWDGDVSURYHHUFRQ
VXVXVWLWXFLQFRQWUHVHOHPHQWRVGHOPLVPRPRGHOR VL]H$$$9 
1RPH]FOHHQHOPDQGRDGLVWDQFLDEDWHUDVQXHYDVFRQEDWHUDVSDUFLDOPHQWHDJRWDGDV
1RPH]FOHPDUFDV\WLSRVGLIHUHQWHVSXHVFDGDWLSR\PDUFDWLHQHFDSDFLGDGHVGLIHUHQWHV
1RPH]FOHSLODVWUDGLFLRQDOHV\UHFDUJDEOHV
1RLQWHQWHUHFDUJDUSLODVDOFDOLQDV\FLQFFDUEQSXHVVHSXHGHQSURGXFLUURWXUDVRSUGLGDVGHOTXLGR

INFORMACIONES A LOS USUARIOS


&RQIRUPHDODUWGHOGHFUHWROHJLVODWLYRMXOLRQ$FWXDFLQGHODV'LUHFWLYDV&(&(\
&(UHODWLYDVDODUHGXFFLQGHOXVRGHVXVWDQFLDVSHOLJURVDVHQORVHTXLSRVHOFWULFRV\HOHFWUQLFRVDVFRPRDOD
HOLPLQDFLQGHORVUHVLGXRV(OVPERORGHOFRQWHQHGRUEDUUHDGRLQGLFDGRHQHOHTXLSRRHQHOHPEDODMHVHDODTXHHOSURGXFWR
DOQDOGHVXYLGDWLOGHEHVHUHOLPLQDGRSRUVHSDUDGRGHORVGHPVUHVLGXRV3RUORWDQWRHOXVXDULRGHEHUHQWUHJDUHOHTXLSR
DOQDOGHVXYLGDWLODDSURSLDGRVFHQWURVGHUHFRJLGDVHOHFFLRQDGDGHUHVLGXRVHOHFWUQLFRV\HOHFWURWFQLFRVRHQWUHJDUORDO
distribuidore en el momento de la compra de otro nuevo equipo equivalente, cambiando el uno por el otro.
- 88 -
MANUTENCIN
$QWHVGHUHDOL]DUFXDOTXLHUPDQWHQLPLHQWRGHVHQFKXIDUHODSDUDWRGHODUHGGHDOLPHQWDFLQHOFWULFD

8QPDQWHQLPLHQWRUHJXODUHVODEDVHGHXQEXHQIXQFLRQDPLHQWRGHODHVWXID
/$)$/7$'(0$17(1,0,(172DOPHQRV(67$&,21$/SXHGHSURYRFDUHOPDOIXQFLRQDPLHQWR
3RVLEOHVSUREOHPDVGHELGRVDODIDOWDGHPDQWHQLPLHQWRKDUQTXHGHFDLJDODJDUDQWD

127$&DGDNJDSDUHFHODDQRWDFLQ0DQWHQSDUDUHFRUGDUODOLPSLH]DGHORVFDQDOHVGHKXPRVDFDUJRGHO
SDUWLFXODUHOPHQVDMHGHVDSDUHFHSXOVDQGRGXUDQWHVHJXQGRVODWHFOD785%2
&XDQGRVHDOFDQ]DQNJGHSHOOHWDSDUHFHODDQRWDFLQ0DQWHQSURIHVTXHQRGHVDSDUHFHPV\SRUORWDQWRHV
QHFHVDULDODLQWHUYHQFLQGHXQGLVWULEXLGRU'LFKRPHQVDMHVHUHDMXVWDGHVGHHOPHQSDUPHWURV

127$6
(VWiQSURKLELGDVODVPRGLFDFLRQHVVREUHHODSDUDWRQRDXWRUL]DGDV
- Usar piezas de recambio recomendadas por el constructor o SAT autorizado.
- El uso de componentes no originales anula la garanta.

0$17(1,0,(172',$5,$
2SHUDFLRQHVTXHHIHFWXDUFRQODHVWXIDDSDJDGDIUDRGHVHQFKXIDGDGHODUHGHOFWULFD
/DOLPSLH]DGHEHHIHFWXDUVHFRQXQDDVSLUDGRUD YHURSFLRQDOSJ

ESPAOL
7RGRHOSURFHGLPLHQWRUHTXLHUHSRFRVPLQXWRVDOGD
$EULUODSXHUWD\H[WUDHU\YDFLDUHOFDMQGHODVFHQL]DV J% 
12'(6&$5*8(/265(6,'826(1(/'(36,72'(/3(//(7
4XLWDUHOFULVRO\GHVLQFUXVWDUORFRQODSHTXHDHVSWXODOLPSLDUHYHQWXDOHVREVWUXFFLRQHVGHORVRULFLRVHQWRGRVORVODGRV
6DFDUHOFULVRO   J& \GHVLQFUXVWDUORFRQODHVSWXODOLPSLDUSRVLEOHVRFOXVLRQHVGHORVRULFLRV
$VSLUDUHOFRPSDUWLPHQWRFULVROOLPSLDUORVERUGHVGHFRQWDFWR
6LIXHUDQHFHVDULROLPSLDUHOYLGULR HQIUR

1RDVSLUHODFHQL]DFDOLHQWHSXHGHGDDUHODVSLUDGRU\SRQHDULHVJRGHLQFHQGLRORVORFDOHVGRPVWLFRV

**
J% J&
MANTENIMIENTO SEMANAL
/LPSLH]DGHOKRJDU FRQHVFRELOOQ GHVSXVGHKDEHUHOLPLQDGRORVGHVYLDGRUHVGHKXPRV J'( 
7UDEDMDUHQORVHVFRELOORQHV )LJ( 
9DFLDUHOGHSVLWR\DVSLUDUHOIRQGR
'XUDQWHODOLPSLH]DGHOFULVROHOHYDUORVWDSRQHVGHKXPR J) \DVSLUDUORVFXDWURWXERVGHDEDMR J) 

 


* 2
2
J' J( J)
- 89 -
MANUTENCIN
LIMPIEZA ESTACIONAL DFDUJRGHO',675,%8,'25
&RQVLVWHHQOD
/LPSLH]DJHQHUDOLQWHUQD\H[WHUQD
/LPSLH]DHVPHUDGDGHORVWXERVGHLQWHUFDPELRGHFDORUVLWXDGRVGHQWURGHODUHMLOODGHVDOLGDGHODLUHFDOLHQWHVLWXDGDHQODSDUWH
alta de la parte frontal de la estufa.
/LPSLH]DSURIXQGD\GHVLQFUXVWDFLQGHOFULVRO\GHVXUHODWLYRHVSDFLR
/LPSLH]DYHQWLODGRUHVFRPSUREDFLQPHFQLFDGHORVMXHJRV\GHODVMDFLRQHV
/LPSLH]DFDQDOGHKXPR HYHQWXDOVXVWLWXFLQGHODHPSDTXHWDGXUDHQHOWXERGHGHVFDUJDGHKXPRV
/LPSLH]DFRQGXFWRGHKXPRV YHUOLPSLH]DVHPDQDO
/LPSLH]DGHOKXHFRYHQWLODGRUH[WUDFFLQKXPRV
/LPSLH]DGHOVHQVRUGHXMR
/LPSLH]DGHOFRQWUROWHUPRSDU
/LPSLH]DLQVSHFFLQ\GHVLQFUXVWDFLQGHOKXHFRGHODUHVLVWHQFLDGHHQFHQGLGRHYHQWXDOVXVWLWXFLQGHODPLVPD
/LPSLH]DFRQWUROGHO3DQHO6LQSWLFR,QVSHFFLQYLVXDOGHORVFDEOHVHOFWULFRVGHODVFRQH[LRQHV\GHOFDEOHGHDOLPHQWDFLQ
/LPSLH]DGHSVLWRSHOOHW\FRPSUREDFLQMXHJRVFRQMXQWRFFOHDPRWRUUHGXFWRU
6XVWLWXFLQGHODHPSDTXHWDGXUDGHOSRUWLOOR
(QVD\RIXQFLRQDOFDUJDFFOHDHQFHQGLGRIXQFLRQDPLHQWRGXUDQWHPLQXWRV\DSDJDGR

6LH[LVWHXQDXWLOL]DFLQPX\IUHFXHQWHGHODHVWXIDVHDFRQVHMDODOLPSLH]DGHOFDQDOGHKXPRFDGDPHVHV
ESPAOL

ATENCIN!!!:
'HVSXVGHODOLPSLH]DQRUPDOHO,1&255(&72DFRSODPLHQWRGHOFULVROVXSHULRU $  JXUD' DOFULVROLQIHULRU % 
JXUD' SXHGHSRQHUHQSHOLJURHOIXQFLRQDPLHQWRGHODHVWXID
3RUORWDQWRDQWHVGHOHQFHQGLGRGHODHVWXIDDVHJXUDUVHGHTXHORVFULVROHVHVWQDFRSODGRVFRUUHFWDPHQWHFRPRVHLQGLFD
HQODJ(VLQSUHVHQFLDGHFHQL]DVRLQFRPEXVWRVHQHOSHUPHWURGHDSR\R

J J

- 90 -
&216(-263$5$326,%/(6,1&219(1,(17(6
(QFDVRGHSUREOHPDVODHVWXIDVHSDUDDXWRPWLFDPHQWHHIHFWXDQGRODRSHUDFLQGHDSDJDGR\HQODSDQWDOODVHYLVXDOL]D
XQDDQRWDFLQUHODWLYDDODPRWLYDFLQGHODSDJDGR YHUGHEDMRODVGLIHUHQWHVVHDOL]DFLRQHV 

1RGHVFRQHFWHQXQFDHOHQFKXIHGXUDQWHODIDVHGHDSDJDGRSRUEORTXHR

(QFDVRGHTXHVHSURGX]FDXQEORTXHRSDUDYROYHUDSRQHUHQPDUFKDODHVWXIDHVQHFHVDULRGHMDUDFRQWHFHUHOSURFHVRGH
DSDJDGR VHJXQGRVFRQSUXHEDGHVRQLGR \OXHJRSUHVLRQDUODWHFOD

1RYXHOYDDSRQHUHQIXQFLRQDPLHQWRHVWXIDDQWHVGHKDEHUYHULFDGRODFDXVDGHOEORTXHR\KDEHU/,03,$'2'(
18(929$&,$'2HOFULVRO

6($/,=$&,21(6'(326,%/(6&$86$6'(%/248(2(,1',&$&,21(6<62/8&,21(6
 6HDOL]DFLQ&RQWXDLUH LQWHUYLHQHVLHOVHQVRUGHXMRGHWHFWDXMRGHDLUHFRPEXUHQWHLQVXFLHQWH 
Inconveniente: Apagado por falta depresin
(OXMRSXHGHVHULQVXFLHQWHVLODSXHUWDHVWDELHUWDQRFLHUUDSHUIHFWDPHQWH SHMXQWD VLH[LVWHXQ
  SUREOHPDGHDVSLUDFLQGHDLUHRGHH[SXOVLQGHKXPRVRVLHOFULVROHVWREVWUXLGR
Acciones: &RPSUREDU
  FLHUUHGHODSXHUWD
  FDQDOGHDVSLUDFLQDLUHFRPEXUHQWH OLPSLDUSRQLHQGRDWHQFLQDORVHOHPHQWRVGHOVHQVRUGHXMR 
  OLPSLDUHOVHQVRUGHXMRFRQDLUHVHFR WLSRSDUDWHFODGRGHRUGHQDGRU 
  SRVLFLQHVWXIDQRVHGHEHDUULPDUDODSDUHG
  SRVLFLQ\OLPSLH]DFULVRO FRQIUHFXHQFLDYLQFXODGDDOWLSRGHSHOOHW 
  FDQDOGHKXPRV OLPSLDU 

ESPAOL
  LQVWDODFLQ VLQRHVWHQUHJOD\SUHVHQWDPVGHFRGRVODVDOLGDGHKXPRVQRHVUHJXODU 
Si se sospecha un funcionamiento inadecuado del sensor, proceder a una prueba en fro. Si tras cambiar las
condiciones, abriendo la puerta por ejemplo, el valor visualizado no cambia, se trata de un problema del sensor.

N.B.: /DDODUPDGHGHSUHVLQSXHGHDSDUHFHUWDPELQGXUDQWHODIDVHGHHQFHQGLGRGDGRTXHHOVHQVRUGHXMR
  HPSLH]DDIXQFLRQDUDSDUWLUGHOVHJXQGRWUDVHOLQLFLRGHODIDVHGHHQFHQGLGR

 6HDOL]DFLQ&RQWH[WUDFW VHDFWLYDVLHOVHQVRUGHJLURVH[WUDFWRUGHKXPRVGHWHFWDXQDDQRPDOD 
,QFRQYHQLHQWH$SDJDGRSRUGHVFHQVRGHWHPSHUDWXUDKXPRV
Acciones: &RQWURODUIXQFLRQDOLGDGH[WUDFWRUGHKXPRV FRQH[LQVHQVRUGHUHYROXFLRQHV \WDUMHWD ',675,%8,'25
&RQWURODUOLPSLH]DFDQDOGHKXPR
&RQWURODUODLQVWDODFLQHOFWULFD\SXHVWDDWLHUUD
&RQWURODUFKHHOHFWUQLFD ',675,%8,'25

 6HDOL]DFLQ6WRS/ODPD VHDFWLYDVLHOWHUPRSDUGHWHFWDXQDWHPSHUDWXUDGHKXPRVLQIHULRUDXQYDORUFRQJXUDGROR
cual se interpreta como ausencia de llama).
,QFRQYHQLHQWHDSDJDGRSRUGHVFHQVRGHWHPSHUDWXUDKXPRV
IDOWDSHOOHW
  GHPDVLDGRSHOOHWKDVRIRFDGRODOODPDYHULFDUFDOLGDGGHOSHOOHW ',675,%8,'25
  KDLQWHUYHQLGRHOWHUPRVWDWRGHP[LPD FDVRUDURLQWHUYLHQHVRORHQFDVRGHH[FHVLYD
  WHPSHUDWXUDGHKXPRV  ',675,%8,'25 

 6HDOL]DFLQ%ORTXH$)12$UUDQ VHDFWLYDVLHQXQWLHPSRP[LPRGHPLQXWRVQRDSDUHFHOODPD\QRVHFRQVLJXHOD
temperatura de puesta en marcha).
,QFRQYHQLHQWHDSDJDGRSRUWHPSHUDWXUDKXPRVQRFRUUHFWDHQIDVHGHHQFHQGLGR
+D\TXHGLVWLQJXLUORVGRVVLJXLHQWHVFDVRV
12KDDSDUHFLGRODOODPD
Acciones&RPSUREDU
  SRVLFLQ\OLPSLH]DGHOFULVRO ',675,%8,'25
  OOHJDGDDOFULVROGHDLUHFRPEXUHQWH
  IXQFLRQDOLGDGUHVLVWHQFLD
  WHPSHUDWXUDDPELHQWH VLHVLQIHULRUD{&KDFHIDOWDSDVWLOODGHHQFHQGLGR \KXPHGDG
  ,QWHQWDUHQFHQGHUFRQSDVWLOODV YHUSJ 

+DDSDUHFLGROODPDSHURWUDVODLQGLFDFLQ$UKDDSDUHFLGR$)
Acciones &RPSUREDU VORSDUDHO',675,%8,'25
  IXQFLRQDPLHQWRWHUPRSDU
  WHPSHUDWXUDGHSXHVWDHQPDUFKDDMXVWDGDHQORVSDUPHWURV
  5HSHWLUHOHQFHQGLGRGHVSXVGHKDEHUYDFLDGRHOEUDVHUR

 6HDOL]DFLQ)DOWD(QHUJD(no es un defecto la estufa).


,QFRQYHQLHQWHDSDJDGRSRUIDOWDGHHQHUJDHOFWULFD
Acciones: &RPSUREDUFRQH[LQHOFWULFD\EDMDGDVGHWHQVLQ

 6HDOL]DFLQ$YHUD7& LQWHUYLHQHVLHOWHUPRSDUHVWDYHULDGRRGHVFRQHFWDGR 
,QFRQYHQLHQWHDSDJDGRSRUWHUPRSDUDYHULDGRRGHVFRQHFWDGR
Acciones: &RPSUREDUFRQH[LQGHOWHUPRSDUHQODFKD&RPSUREDUIXQFLRQDOLGDGHQHOHQVD\RHQIUR ',675,%8,'25 
- 91 -
&216(-263$5$326,%/(6,1&219(1,(17(6
 6HDOL]DFLQq&KXPRVDOWD DSDJDGRSRUH[FHVLYDWHPSHUDWXUDGHORVKXPRV
,QFRQYHQLHQWHDSDJDGRSRUVXSHUDFLQWHPSHUDWXUDP[LPDKXPRV
Acciones: 9HULFDUWLSRGHSHOOHW
  9HULFDUDQRPDODGHOPRWRUH[WUDFFLQGHKXPRV
  9HULFDUH[LVWHQFLDGHSRVLEOHVREVWUXFFLRQHVHQHOFDQDOGHKXPR
  9HULFDUODFRUUHFWDLQVWDODFLQ
  9HULFDUSRVLEOHGHULYDFLQGHOPRWRUUHGXFWRU
  9HULFDUODH[LVWHQFLDGHWRPDGHDLUHHQHOORFDO
8) 6HxDOL]DFLyQ $/$50$&255,(17($/7$$FW~DFXDQGRVHGHWHFWDXQDDEVRUFLyQDQyPDOD\H[FHVLYDGHFRUULHQWH
por parte del motorreductor.
$FFLRQHV &RPSUREDUHOIXQFLRQDPLHQWR &$7 PRWRUUHGXFWRUFRQH[LRQHVHOpFWULFDV\WDUMHWDHOHFWUyQLFD
9) 6HxDOL]DFLyQ$/$50$&255,(17(%$-$$FW~DFXDQGRVHGHWHFWDXQDDEVRUFLyQDQyPDODHLQVXFLHQWHGHFRUULHQWH
por parte del motorreductor.
$FFLRQHV &RPSUREDUHOIXQFLRQDPLHQWR &$7 PRWRUUHGXFWRUSUHVyVWDWRWHUPRVWDWRGHSyVLWRFRQH[LRQHVHOpFWUL-
cas y tarjeta electrnica.

 Sealizacin:&RQWUROEDWHUD
Inconveniente(VWXIDQRVHSDUDSHURVLSUHVHQWDODRSFLQHQODSDQWDOOD
Acciones: 'HEHVHUVXVWLWXLGDODEDWHUDFRPSHQVDGRUDHQODWDUMHWDCabe recordar que se trata de un elemento sujeto a
  GHVJDVWH\SRUFRQVLJXLHQWHQRHVWiDPSDUDGRSRUODJDUDQWtD
ESPAOL

11) Inconveniente0DQGRDGLVWDQFLDLQHFLHQWH
Acciones: PVFHUFDGHOUHFHSWRUGHODHVWXID
  VXVWLWXLUFRQSLODVDOFDOLQDV PLQLVWLOR$$$ 

12) Inconveniente: Aire no caliente en salida:


Acciones: OLPSLDUHOLQWHUFDPELDGRUGHVGHGHQWURGHOKRJDU

 Inconveniente'XUDQWHODIDVHGHHQFHQGLGRVDOWDHOGLIHUHQFLDO ',675,%8,'25 
Acciones: YHULFDUKXPHGDGGHODUHVLVWHQFLDGHHQFHQGLGR

 Inconveniente: Mancata accensione:


Acciones: 3XOLUHFURJLROR

NOTA
/DVVHDOL]DFLRQHVVHYLVXDOL]DQKDVWDTXHQRVHLQWHUYLHQHHQHOSDQHODSUHWDQGRODWHFOD
6HUHFRPLHQGDQRYROYHUDSRQHUHQPDUFKDODHVWXIDVLDQWHVQRVHFRPSUXHEDODHOLPLQDFLQGHOSUREOHPD

ADVERTENCIA:
Las chimeneas y los conductos de humo a lo que estn conectados los aparatos que usan combustibles slidos deben
OLPSLDUVHXQDYH]DODR YHULFDUVLHQHOSURSLRSDVH[LVWHXQDQRUPDWLYDDOUHVSHFWR 
En caso de omisin de regulares controles y la limpieza, aumenta la probabilidad de un incendio de la chimenea.
IMPORTANTE!
(QFDVRGHTXHVHPDQLHVWHXQSULQFLSLRGHLQFHQGLRHQODHVWXIDHQHOFDQDOGHKXPRRHQODFKLPHQHDVHJXLUORVSDVRVVLJXLHQWHV
- Cerrar la alimentacin elctrica.
 $SDJDUFRQXQH[WLQWRUGHDQKGULGRFDUEQLFR&22.
- Llamar a los Bomberos.
NO INTENTAR APAGAR EL FUEGO CON AGUA!
7RGRVHJXLGRFRQWDFWDUDO6$7DXWRUL]DGRTXHOHFRUUHVSRQGDSDUDXQDYHULFDFLQ\FRPSUREDFLQGHODSDUDWR

- 92 -
/,67$'(&20352%$&,1
$FRPSOHWDUFRQODOHFWXUDFRPSOHWDGHODFKDWFQLFD

Colocacin e instalacin
,QVWDODFLQUHDOL]DGDSRUHO'LVWULEXLGRUKDELOLWDGRTXHKDH[SHGLGRODJDUDQWD
(OFDQDOGHKXPR
(OWXERGHVDOLGDGHKXPRVUHFLEHVORODGHVFDUJDGHODHVWXID
(OFDQDOGHKXPRSUHVHQWDP[LPRFXUYDVP[LPR
   PHWURVHQKRUL]RQWDO
FKLPHQHDDORWURODGRGHOD]RQDGHUHXMR
ORVWXERVGHGHVFDUJDVRQGHPDWHULDOLGQHR VHDFRQVHMDDFHURLQR[LGDEOH
HQHOSDVRDWUDYVGHHYHQWXDOHVPDWHULDOHVLQDPDEOHV SRUHMPDGHUD KDQVLGRWRPDGDVWRGDVODVSUHFDXFLRQHVSDUDHYLWDU
incendios.

Uso
(OSHOOHWXWLOL]DGRHVGHEXHQDFDOLGDG\QRKPHGD
(OFULVRO\HOKXHFRFHQL]DVHVWQOLPSLRV\ELHQFRORFDGRV
(OSRUWLOORHVWELHQFHUUDGR
(OFULVROHVWELHQLQWURGXFLGRHQHOKXHFRFRUUHVSRQGLHQWH

5(&25'($63,5$5HO&5,62/$17(6'(&$'$(1&(1','2
(QFDVRGHHQFHQGLGRIDOOLGR12UHSHWLUHOHQFHQGLGRDQWHVGHKDEHUYDFLDGRHOFULVRO

ESPAOL
OPCIONAL
&20%,1$'257(/()1,&23$5$(1&(1','2$',67$1&,$ FG 
(VSRVLEOHREWHQHUHOHQFHQGLGRDGLVWDQFLDVLHO',675,%8,'25FRQHFWDHOFRPELQDGRUWHOHIQLFRDODSXHUWDGHVHULHGHWUVGHOD
HVWXIDSRUPHGLRGHOFDEOHRSFLRQDO FG 

.,7SDUDODFDQDOL]DFLQDLUHFDOLHQWHHQXQORFDOFRQWLJXRFRQORQJLWXGGHOWXERGHFDQDOL]DFLQP[P FG 

.,7%,6SDUDODFDQDOL]DFLQDLUHFDOLHQWHHQXQORFDOFRQWLJXRFRQORQJLWXGGHOWXERGHFDQDOL]DFLQP[P FG 

ACCESORIOS PARA LA LIMPIEZA


*ODVV.DPLQ %LGQDVSLUD
FG cenizas sin motor
FG
WLOSDUDODOLPSLH]D
GHOYLGULRFHUPLFR WLO SDUD OD OLPSLH]D
del hogar

- 93 -
Sehr geehrte Kundin, sehr geehrter Kunde,
wir danken Ihnen und beglckwnschen Sie zur Wahl unseres Produkts.
:LUELWWHQ6LHYRUGHP*HEUDXFKGLHVHV0HUNEODWWDXIPHUNVDP]XOHVHQXPVlPWOLFKH/HLVWXQJHQGHV*HUlWVDXIGLHEHVWH:HLVH
und in vlliger Sicherheit auszunutzen.

)UZHLWHUH(UOlXWHUXQJHQRGHU(UIRUGHUQLVVHVHW]HQ6LHVLFKELWWHPLWGHP+b1'/(5LQ9HUELQGXQJEHLGHP6LHGHQ
.DXIJHWlWLJWKDEHQRGHUEHVXFKHQ6LHXQVHUH:HEVHLWHZZZHGLONDPLQFRPXQWHUGHP0HQSXQNW+b1'/(5

HINWEIS
1DFKGHP$XVSDFNHQGHV2IHQVVLFKGHU8QYHUVHKUWKHLWXQGGHU9ROOVWlQGLJNHLWGHV,QKDOWVYHUJHZLVVHUQ 9HUNOHLGXQJ)HUQEH-
GLHQXQJPLW'LVSOD\.DOWKDQGJULIIIUgIIQXQJGHU7U*DUDQWLHKHIW+DQGVFKXK&'WHFKQLVFKH%HVFKUHLEXQJ6SDFKWHO
(QWIHXFKWXQJVVDO],QEXVVFKOVVHO 

,P)DOOYRQ6W|UXQJHQZHQGHQ6LHVLFKELWWHVRIRUWDQGHQ+lQGOHUEHLGHPGHU.DXIJHWlWLJWZXUGHXQGKlQGLJHQ6LHLKP.RSLH
GHV*DUDQWLHKHIWVXQGGLHVWHXHUOLFKJOWLJH.DXIEHVFKHLQLJXQJDXV

- Inbetriebnahme/Abnahme
'LHVHKDWXQEHGLQJWGXUFKGHQ]XHUIROJHQDQGHUQIDOOVYHUIlOOWGLH*DUDQWLH
'LH,QEHWULHEQDKPHEHVWHKWJHPlGHU81,LQHLQHU5HLKHYRQ.RQWUROODUEHLWHQGLHPLWHLQJHEDXWHP+HL]RIHQ
GXUFKJHIKUWZHUGHQXQGGDUDXIDE]LHOHQGLHNRUUHNWH)XQNWLRQVZHLVHGHV6\VWHPVXQGVHLQH(QWVSUHFKXQJPLWGHQJHOWHQGHQ
9RUVFKULIWHQVLFKHU]XVWHOOHQ

)HKOHUKDIWH,QVWDOODWLRQQLFKWRUGQXQJVJHPlDXVJHIKUWH:DUWXQJVDUEHLWHQXQVDFKJHPlHU*HEUDXFKGHV3URGXNWVHQWKHEHQ
GHQ+HUVWHOOHUYRQMHJOLFKHU+DIWXQJIUGXUFKGHQ*HEUDXFKYHUXUVDFKWHQ6FKDGHQ
'LH1XPPHUGHV.RQWUROODEVFKQLWWVGHUIUGLH,GHQWL]LHUXQJGHV+HL]RIHQHUIRUGHUOLFKLVWLVWDQJHJHEHQ
- Im oberen Teil der Verpackung
,P*DUDQWLHKHIWLPLQQHUHQGHV%UHQQUDXPV
$XIGHPDXIGHU5FNVHLWHGHV*HUlWVDQJHEUDFKWHQ6FKLOG

'LHEHVDJWHQ8QWHUODJHQVLQG]XVDPPHQPLWGHU.DXIEHVFKHLQLJXQJDXI]XEHZDKUHQGHUHQ$QJDEHQEHLHWZDLJHQ$XVNXQIWVEH-
JHKUHQPLW]XWHLOHQXQGIUGHQ)DOOYRQHWZDLJHQ:DUWXQJVHLQJULIIHQ]XU9HUIJXQJ]XVWHOOHQVLQG
'(876&+

- Die abgebildeten Details sind graphisch und geometrisch unverbindlich.

&(.21)250,7b76(5./b581*
Die Firma EDILKAMIN S.p.A. mit Sitz in Via Vincenzo Monti 47 - 20123 Mailand - Cod. Fiscale P.IVA 00192220192

HUNOlUWKLHUPLWHLJHQYHUDQWZRUWOLFKGDVV
GHUQDFKJHQDQQWH3HOOHW+HL]RIHQLP(LQNODQJPLWGHU(85LFKWOLQLH(:* %DXSURGXNWH5LFKWOLQLH VWHKW
PELLET-HEIZOFEN der Handelsmarke EDILKAMIN, mit dem Modellnamen FANTASY - FATA - SIRENA - STORY

6(5,(11800(57\SHQVFKLOG'DWHQ%$8-$+57\SHQVFKLOG'DWHQ

'LH(LQKDOWXQJGHU5LFKWOLQLH(:*HUJLEWVLFKDXHUGHPDXVGHU(QWVSUHFKXQJPLWGHU(XURSDQRUP
(1

$XHUGHPZLUGHUNOlUWGDVV
GHU+RO]SHOOHW+HL]RIHQ)$17$6<)$7$6,5(1$6725<GHQIROJHQGHQ(85LFKWOLQLHQHQWVSULFKW
2006/95/CE Niederspannungsrichtlinie
&(5LFKWOLQLHEHUHOHNWURPDJQHWLVFKH9HUWUlJOLFKNHLW

(',/.$0,16SDVFKOLHWLP)DOOYRQ(UVHW]XQJHQ,QVWDOODWLRQVDUEHLWHQXQGRGHUbQGHUXQJHQGLHQLFKWYRQ(',/.$0,1
0LWDUEHLWHUQE]ZRKQHXQVHUH=XVWLPPXQJGXUFKJHIKUWZXUGHQMHGH+DIWXQJIU)XQNWLRQVVW|UXQJHQGHV*HUlWHVDXV
- 94 -
%(75,(%6:(,6( 6,&+(5+(,76+,1:(,6(
'LHIHQHUZUPHQGLH/XIWLQGHPVLH+RO]3HOOHWDOV%UHQQVWRII Der Heizofen wurde entwickelt, um den Raum, in dem er sich
EHQGHWGXUFKGLHDXWRPDWLVFKH9HUEUHQQXQJYRQ3HOOHWLP
YHUZHQGHQGHVVHQ9HUEUHQQXQJHOHNWURQLVFKJHVWHXHUWZLUG Feuerraum sowohl durch Abstrahlung als auch durch Bewe-
1DFKIROJHQGZLUGGHUHQ%HWULHEVZHLVHEHVFKULHEHQ GLH%X- gung von Warmluft, die vorne aus dem Gitter austritt, zu
FKVWDEHQEH]LHKHQVLFKDXIGLH$EELOGXQJ  erwrmen.
'HU%UHQQVWRII 3HOOHW ZLUGGHP%UHQQVWRIIEHKOWHU $  'DV*HUlWLVWQLFKWGD]XJHHLJQHWGXUFK3HUVRQHQPLWN|U-
HQWQRPPHQXQGPLWWHOVHLQHUGXUFKHLQHQ*HWULHEHPRWRU &  perlich, sensoriell oder geistig eingeschrnkten Fhigkeiten
DQJHWULHEHQHQ)UGHUVFKQHFNH % LQGHQ9HUEUHQQXQJVWLHJHO betrieben zu werden - Kinder eingeschlossen. Kinder sind zu
' EHIUGHUW berwachen, damit sichergestellt wird, dass sie nicht mit dem
'DV$Q]QGHQGHV3HOOHWHUIROJWGXUFKYRQHLQHPHOHNWULVFKHQ Gert spielen.
:LGHUVWDQG ( HU]HXJWH+HLOXIWGLHPLWWHOVHLQHV5DX- 'LHHLQ]LJHQYRP*HEUDXFKGHV2IHQVDXVJHKHQGHQ*HIDKUHQ
FKDE]XJVJHEOVHV ) LQGHQ7LHJHOJHVDXJWZLUG'LHGXUFK rhren von einer mangelnden Einhaltung der Installationsvor-
GLH9HUEUHQQXQJHU]HXJWHQ5DXFKJDVHZHUGHQGXUFKGHQVHOEHQ schriften oder einer direkten Berhrung von (inneren) elektri-
)OLHKNUDIWYHQWLODWRU ) DXVGHP)HXHUUDXPDEJH]RJHQXQGYRP schen Teilen oder einer Berhrung des Feuers und heier Teile
6FKHLEH5RKUH:DUPOXIWDXVWULWW %HLP(LQIKUHQIUHPGHU
6WXW]HQ * DXIGHUXQWHUHQ5FNVHLWHGHVIHQDXVJHVWRHQ 6WRIIHEHLIDOVFKHQ%UHQQVWRIIHQEHLXQ]XUHLFKHQGHU:DUWXQJ
'LHIHQHUPJOLFKHQGLH.DQDOLVLHUXQJGHU:DUPOXIWVRGDVV
GLHVHIUGLH(UZUPXQJGHUEHQDFKEDUWHQ5XPHGRUWKLQ $OV%UHQQPDWHULDOQXU+RO]SHOOHWVPLWHLQHP'XUFKPHVVHU
EHIUGHUWZLUG$XIGHU5FNVHLWHGHUIHQEHQGHQVLFK YRQPPYHUZHQGHQYRQVHKUJXWHU4XDOLWlWXQGPLW=HUWLNDW
6WHFN6WXW]HQPLWFPIUGHQ$QVFKOXVVGHU:DUPOXIWND- )UGHQ)DOOGHVPDQJHOKDIWHQ%HWULHEVVLQGGLHgIHQPLW
QDOLVLHUXQJ8PGLH:DUPOXIWLQHLQHQRGHU]ZHLEHQDFKEDU- 6LFKHUKHLWVYRUULFKWXQJHQDXVJHVWDWWHWGLHGHUHQ$EVFKDOWHQ
WH5XPH]XOHLWHQLVWGHU2IHQPLW]ZHL6WXW]HQDXIGHU gewhrleisten; dieses muss ohne Eingreifen des Benutzers
5FNVHLWHYHUVHKHQDQGLHGLHHQWVSUHFKHQGHQ$OXPLQLXPURK- automatisch erfolgen.
UHDQ]XVFKOLHHQVLQG )UHLQHQRUGQXQJVJHPlHQ%HWULHEPXVVGHU2IHQXQWHU
8PGLH9HUWHLOXQJGHU:DUPOXIW]XEHJQVWLJHQVLQGGLH.LW Einhaltung der in diesem technischen Merkblatt enthaltenen
XQG.,7%,6DOV2SWLRQDOHUKOWOLFK VLHKH6  Angaben installiert werden. Whrend des Betriebs darf die
'LH%UHQQVWRIIPHQJHXQGGHU5DXFKDE]XJE]ZGLH9HUVRUJXQJ 7UQLFKWJH|IIQHWZHUGHQ'LH9HUEUHQQXQJZLUGQlPOLFK
automatisch verwaltet und bedarf keines Eingriffs.
PLW9HUEUHQQXQJVOXIWZHUGHQGXUFKGLHHOHNWURQLVFKH
.DUWHJHVWHXHUWGLHPLWHLQHU6RIWZDUHPLW6\VWHP/HRQDUGR ,QNHLQHP)DOOGUIHQLQGHQ)HXHUUDXPRGHUGHQ%UHQQ-
DXVJHVWDWWHWLVWXPHLQH9HUEUHQQXQJYRQKRKHP:LUNXQJVJUDG VWRIIEHKlOWHUIUHPGH6WRIIHHLQJHIKUWZHUGHQ
XQGPLWQLHGULJHP6FKDGVWRIIDXVVWR]XHUKDOWHQ )UGLH5HLQLJXQJGHV5DXFKDEODVVHV 5RKUDEVFKQLWWGHU
$XIGHP2EHUWHLOGHV2IHQVLVWHLQ'LVSOD\ 0 HLQJHEDXWGDV GHQ5DXFKDEODVVVWXW]HQGHV2IHQVPLWGHP6FKRUQVWHLQYHU-
GHQ%HWULHEXQGGLH$Q]HLJHDOOHU%HWULHEVSKDVHQHUPJOLFKW ELQGHW GUIHQNHLQHHQWDPPEDUHQ(U]HXJQLVVHYHUZHQGHW
'LH+DXSWSKDVHQNQQHQDXFKPLWGHU)HUQEHGLHQXQJYRUJH- werden

'(876&+
QRPPHQZHUGHQ'HU2IHQLVWDXIGHU5FNVHLWHPLWHLQHPVH- 'LH7HLOHGHV)HXHUUDXPVXQGGHV%UHQQVWRIIEHKlOWHUVGUIHQ
ULHOOHQ$QVFKOXVVIUGLH9HUELQGXQJ PLWWHOVGHVDXI:XQVFK nur KALT abgesaugt werden.
HUKOWOLFKHQ.DEHOV&RGH PLW)HUQVFKDOWYRUULFKWXQJHQ
YHUVHKHQ ZLH7HOHIRQVFKDOWHU=HLWWKHUPRVWDWHQXVZ  'LH6FKHLEHNDQQLQ.$/7(0=XVWDQGPLWHLQHPEHVRQGH-
'LHIHQVLQGPLWHLQHPYOOLJDXV*XVVHLVHQEHVWHKHQGHP ren Erzeugnis (z.B. GlassKamin Edilkamin) und einem Tuch
gereinigt werden.
LQQHUHQ$XIEDXYHUVHKHQ
1LFKWLQZDUPHP=XVWDQGUHLQLJHQ

M 6LFKHUVWHOOHQGDVVGHU+HL]RIHQGXUFKHLQYRQ(GLONDPLQ
zugelassenes CAT (Technisches Kundendienst-Center) gem
den Angaben in diesem Datenblatt, die zudem fr die Vali-
dierung der Garantie unverzichtbare Voraussetzungen sind,
aufgestellt und eingeschaltet wird.
:lKUHQGGHV%HWULHEVGHV2IHQVHUUHLFKHQGLH$E]XJVURKUH
und die Tr sehr hohe Temperaturen (nicht ohne den entspre-
chenden Handschuh berhren).

A .HLQHQLFKWKLW]HEHVWlQGLJHQ*HJHQVWlQGHLQXQPLWWHOEDUHU
Nhe des Ofens ablegen.
1,(0$/6VVLJH%UHQQVWRIIHYHUZHQGHQXPGHQ
B Ofen anzuznden oder die Glut zu entfachen.
'LH%HOIWXQJV|IIQXQJHQLP,QVWDOODWLRQVUDXPQRFKGLH
E Lufteinlsse des Ofens selbst verschlieen.
'HQ2IHQQLFKWQlVVHQVLFKGHQHOHNWULVFKHQ7HLOHQQLFKW
C mit nassen Hnden nhern.
.HLQH5HGX]LHUVWFNHDXIGLH5DXFKDE]XJVURKUHVWHFNHQ
' 'HU2IHQLVWLQ5lXPHQ]XLQVWDOOLHUHQGLHGHQ
G Brandschutzvorschriften entsprechen und die mit allen fr den
ordnungsgemen und sicheren Betrieb des Gerts erforderli-
chen Ausstattungen (Luftzufuhr und Abzge) versehen sind.
,P)DOOYRQHUIROJORVHP$Q]QGHQGLHVHV1,&+7ZLH-
F derholen, ohne den Brenntiegel geleert zu haben.
$&+781*'$6$86'(0%5(117,(*(/(17/(-
$EE (57(3(//(7'$5)1,&+7,1'(13(//(7%(+b/-
7(5*(*(%(1:(5'(1
- 95 -
$%0(6681*(181'),1,6+(6
- FANTASY6SHFNVWHLQYHUNOHLGXQJ
- FATA.HUDPLNFUHPHZHLURWOHGHUHIIHNW
- SIRENA.HUDPLNFUHPHZHLURWOHGHUHIIHNW
- STORY: JUDXODFNLHUWHU6WDKO .DQDOLVLHUXQJ
:DUPOXIWPP

)5217 =85&.
68
13 13

IW
J VOX
XQri a
U H QmQ a ione
UE st
c
9H 4PmPbu
115

104
co g
hcambzu
u c i
Ra 8 PP
 a fum
uscit

39
31
'(876&+

6(,7( *581',66

53
53
115

68

)5',(02'(//(*/7,*($%0(6681*(1

- 96 -
0(5.0$/(
(/(.752$33$5$7(
/(21$5'2LVWHLQ6LFKHUKHLWVXQG5HJHOV\VWHPGHU9HUEUHQQXQJGDVXQWHUMHGHU%HGLQJXQJHLQHQ
RSWLPDOHQ%HWULHEJHZKUOHLVWHWGDQN]ZHLHU6HQVRUHQGLHGHQ'UXFNSHJHOLQGHU9HUEUHQQXQJVNDP-
PHUXQGGLH5DXFKJDVWHPSHUDWXUPHVVHQHLQHQRSWLPDOHQ%HWULHE
'LH0HVVXQJXQGGLHGDUDXVIROJHQGH2SWLPLHUXQJGHUEHLGHQ3DUDPHWHUHUIROJWVWQGLJVRGDVVHYHQ-
WXHOOH%HWULHEVVWUXQJHQLQ(FKW]HLWEHKREHQZHUGHQNQQHQ
'DV6\VWHP/(21$5'2 EHZLUNWHLQHNRQVWDQWH9HUEUHQQXQJLQGHPHVDXWRPDWLVFKGHQ2IHQ]XJ
DXI GHU *UXQGODJH GHU 0HUNPDOH GHV $E]XJVURKUV .XUYHQ /QJH )RUP 'XUFKPHVVHU XVZ  XQG
GHU8PJHEXQJVEHGLQJXQJHQ :LQG)HXFKWLJNHLW/XIWGUXFN,QVWDOODWLRQLQJURHU+KHXVZ UHJHOW
(V LVW HUIRUGHUOLFK GDVV GLH ,QVWDOODWLRQVYRUVFKULIWHQ EHIROJW ZHUGHQ 'DV 6\VWHP /(21$5'2 ist
GDUEHUKLQDXVLQGHU/DJHGHQ3HOOHW7\S]XHUNHQQHQXQGGHVVHQ%HVFKLFNXQJDXWRPDWLVFK]XUHJHOQ
XPLQMHGHP$XJHQEOLFNGDV0DGHUHUIRUGHUOLFKHQ9HUEUHQQXQJ]XJHZKUOHLVWHQ
(/(.7521,6&+(6&+$/7.$57(
Flusssensor

7KHUPRHOHPHQW
zubehr

5308PGUHKXQJHQ5DXFKJDVJHEOVH
Raum
%HGLHQWDIHO
temperatur
+ ---
-Sonde

8QWHUGUXFNPHVVHU

Lithium
pufferbatterie

'(876&+
+
CR2032 FU

$EOHVHSXQNW
QHW]9DF
+]
=QGXQJVZLGHUVWDQG

Rauchabzugsmotor )UGHUVFKQHFNH

5FNVHLWLJHU6WURPDQVFKOXVV
EHOIWXQJ

SICHERUNG
am Stromanschluss mit Schalter auf der
5FNVHLWHGHV2IHQVVLQG]ZHL6LFKH-
UXQJHQHLQJHVHW]WGDYRQHLQHUIXQNWLRQ-
VIKLJ*, der andere als Reserve**.
SERIELLEN PORT
$XIGHP$8;3RUWDOLVWHVPJOLFKYRQ+QGOHUHLQ2SWLRQDOIUGLH.RQWUROOHGHU
5HJLVWULHUXQJHQXQG/VFKXQJHQZLH]XP%HLVSLHO7HOHIRQXPVFKDOWHUXQG:UPHUH-
JOHULQVWDOOLHUHQ]XODVVHQDQGHU5FNVHLWHGHV+HL]RIHQV$QVFKOLHEDUPLWHQWVSUH-
FKHQGHP%JHODOV2SWLRQDOHUKOWOLFK $UW1U 

PUFFERBATTERIE
$XIGHU(OHNWURQLNNDUWHLVWHLQH3XIIHUEDWWHULHYRUKDQGHQ 7\S&5]X9ROW 
'HUHQPDQJHOQGHU%HWULHE QLFKWDOV3URGXNWIHKOHU]XEHWUDFKWHQVRQGHUQDOVQRUPD-
OHU9HUEUDXFK ZLUGXUFKGLH6FKULIW]JH%DWWHULHOHHU3UIDQJH]HLJW)UQKHUH
GLHVEH]JOLFKH$XVNQIWHZHQGHQ6LHVLFKDQGHQ+QGOHUGHUGLH(UVWLQEHWULHEQDKPH
vorgenommen hat. * **
- 97 -
0(5.0$/(
+(,=7(&+1,6&+(0(5.0$/(JHPl(1
Nennwrmeleistung Reduzierte Leistung
Holzdurchsatz kW
Heizleistung 13,2 5,1 kW
:LUNXQJVJUDG(I]LHQ] 92,5 93,3 %
Emissionen CO 13% O2 0,019 0,038 %
Maximale Rauchtemperatur   C
Mindestzug 12 10 Pa
Rauchdurchsatz 13,5 7,4 g/s
Brennstoffverbrauch Pellets 2,9 1,1 kg/h
)DVVXQJVYHUP|JHQGHV%UHQQVWRIIEHKlOWHUV 23,5 kg
Betriebsdauer 7 18,5 6WXQGHQ
Beheizbares Raumvolumen* 345 m3
'XUFKPHVVHUGHVXQDEKlQJLJHQ5DXFKDE]XJURKUV 6WHFNHUWHLO 80 mm
'XUFKPHVVHUGHVXQDEKlQJLJHQ$XHQOXIWHLQJDQJV 6WHFNHUWHLO 40 mm
*HZLFKWPLW9HUSDFNXQJ)$17$6<)$7$6,5(1$6725<  kg

* 'DV%HKHL]EDUH5DXPYROXPHQLVWEHUHFKQHWEHLHLQHU,VRODWLRQQDFKGHQQHXHVWHQDXULFKWOLQLHQXQGDQVFKOLHHQGHQQGHUXQ-
JHQXQGDXIJUXQGHLQHU:UPHDQIRUGHUXQJFRQ.FDOPtSUR6WXQGH

(/(.75,6&+(0(5.0$/(
'(876&+

Stromversorgung 9DF+]
6FKDOWHU$1$86 ja
'XUFKVFKQLWWOLFKH/HLVWXQJVDXIQDKPH  W
/HLVWXQJVDXIQDKPHEHL=QGYRUJDQJ  W
Frequenz der Fernbedienung ,QIUDURWZHOOHQ
6FKXW]YRUULFKWXQJDXI+DXSWYHUVRUJXQJO* VLHKH6 6LFKHUXQJ$79DF[
6FKXW]YRUULFKWXQJDXIHOHNWURQLVFKHU6FKDOWNDUWH 6LFKHUXQJ$79DF[

ACHTUNG:
 GDUDQGHQNHQGDVVH[WHUQH*HUWHGHQ%HWULHEGHUHOHNWURQLVFKHQ6FKDOWNDUWHVWUHQNQQHQ
 (LQJULIIHQXUYRQJHVFKXOWHP)DFKSHUVRQDOGXUFKIKUHQODVVHQ

'LHREHQDXIJHIKUWHQ$QJDEHQVLQG5LFKWZHUWH
(',/.$0,1VSDEHKOWVLFKGDV5HFKWYRUGLH3URGXNWHRKQH9RUDQNQGLJXQJXQGDXVVFKOLHOLFKQDFKHLJHQHP(U-
PHVVHQ]XQGHUQ
6,&+(5+(,769255,&+781*(1
7+(502(/(0(17
$P5DXFKDE]XJLQVWDOOLHUWHUPLWWHOWHVGLH5DXFKJDVWHPSHUDWXUDP$E]XJ,Q$EKQJLJNHLWYRQGHQHLQJHJHEHQHQ3DUDPHWHUQ
VWHXHUWHVGLH=QG%HWULHEVXQG$EVFKDOWSKDVHQ

817(5'58&.0(66(5
0LVVWGHQ'HSUHVVLRQVZHUW LP9HUJOHLFK]XU,QVWDOODWLRQVXPJHEXQJ LQGHU%UHQQNDPPHU

)/8666(1625/8)7
,P/XIWDQVDXJNDQDODQJHEUDFKWJUHLIWGLHVHUHLQZHQQGHU)OXVVGHU9HUEUHQQXQJVOXIWQLFKWHLQZDQGIUHLLVWPLWGDUDXVUHVXOWLH-
UHQGHQ8QWHUGUXFNSUREOHPHQLP5DXFKJDVNUHLVODXIZRGXUFKGDV(UOVFKHQGHV2IHQVEHZLUNWZLUG

6,&+(5+(,767+(50267$7
6FKUHLWHWHLQZHQQGLH7HPSHUDWXULP,QQHUHQGHV2IHQV]XVHKUDQVWHLJW(UYHUKLQGHUWGLH9HUVRUJXQJPLW3HOOHWXQG
EHZLUNWGDV(UOVFKHQVGHV2IHQV
- 98 -
0217$*('(59(5./(,'81*(1)$7$6,5(1$
0,7*(/,()(57(./(,17(,/(
75 6FKUDXEHQ0[
6FKUDXEHQ0[
33
 6LOLNRQ$EVWDQGVKDOWHUIUGLH$XIVDW]SODWWHDXV.HUDPLN
DFKH8QWHUOHJVFKHLEHQPLW'XUFKPHVVHU
%XFKVHQ
$EVWDQGVVWFNHDXV6LOLNRQIU.HUDPLNWHLOH
%HIHVWLJXQJVSOWWFKHQ.HUDPLNWHLOH
0217$*('(56(,7/,&+(1.$&+(/1 $EE
'LH5FNZDQG  DEEDXHQXQGGLHEHLGHQ3UROH  
75
'LHEHLGHQ3OWWFKHQ  DXIGHQYHU]LQNWHQ6HLWHQWHLOHQ
festmachen.
$EE $EE IUGDV0RGHOO)$7$ $EE
$EE 'DVOLQNH3OWWFKHQLVWDPPLWWOHUHQXQGREHUHQ/RFKIH-
150
VW]XPDFKHQZKUHQGGDVUHFKWH3OWWFKHQDPPLWWOHUHQXQG
150 unteren Loch festzumachen ist.
'LH.HUDPLNLHVHQ  DXIGLH3OWWFKHQ  VWUHLIHQ
 138
VLOLNRQKDOWLJH$EVWDQGVVWFNH  LPKLQWHUHQ7HLO
]ZLVFKHQGHP*XVVHLVHQVRFNHOXQGGHUXQWHUHQUHFKWHQ)OLHVH
139
 DQRUGQHQ VLHKH'HWDLO<$EE 
 150 150
=XUNRUUHNWHQ%HIHVWLJXQJGHUREHUHQUHFKWHQ6HLWHQLHVHDXV
138 .HUDPLNVRZLHGHUXQWHUHQOLQNHQ6HLWHQLHVHDXV.HUDPLN
139 die Feststellschrauben entsprechend einstellen, die sich auf den
YHU]LQNWHQ6HLWHQWHLOHQGHU6WUXNWXUEHQGHQ $EE
150
150
5HFKWH6HLWH $EE 'LH.OHPPVFKUDXEHUHJXOLHUHQGLH
$EE GHWDLO]< DOV$QVFKODJIUGLHREHUHUHFKWH6HLWHQLHVHDXV.HUDPLN
IXQJLHUW 
/LQNH6HLWH $EE 'LHREHUHOLQNH6HLWHQLHVHDXV.HUD-
PLNDEQHKPHQ  XQGGLH.OHPPVFKUDXEHUHJXOLHUHQGLH
DOV$QVFKODJIUGLHXQWHUHOLQNH6HLWHQLHVHDXV.HUDPLNGLHQW

'(876&+

$EE 'LHREHUHOLQNH6HLWHQLHVHDXV.HUDPLNZLHGHUHLQEDXHQ

IUGDV0RGHOO6,5(1$ $EE
%HLGH3OWWFKHQPVVHQDPPLWWOHUHQXQGXQWHUHQ/RFKEHIH-
stigt werden.
'LH.HUDPLNLHVHQ  DXIGLH3OWWFKHQ  VWUHLIHQ
$EE $EE
+,1:(,6'DGLH3OWWFKHQJXVVJHIHUWLJWVLQGNQQWHQVLH
LQGHU+KHYRQHLQHQDQGHUDEZHLFKHQ8PGHQHYHQWXHOOHQ
150 150 +KHQXQWHUVFKLHGDXV]XJOHLFKHQNQQHQGLH6LOLNRQ$E-
VWDQGVKDOWHU $EE GD]ZLVFKHQJHOHJWZHUGHQRKQH
61
EULJHQVGDV$XVVHKHQGHV2IHQV]XEHHLQWUFKWLJHQ
 61
'LH3UROH  ZLHGHUPRQWLHUHQGLH5FNZDQG  ZLHGHU
150
anbauen.
61 150
61 0217$*('(62%(5(1)52173$1((/6
9251)$7$6,5(1$ $EE
61
'DVYRUGHUHREHUH)URQWSDQHHODXV.HUDPLN  DEJHVWW]W
150 DXIGLH)URQWSDQHHO+DOWHUXQJ  LQ3RVLWLRQEULQJHQZXUGH
150
REHUKDOEGHU7USRVLWLRQLHUW
'LH%OHQGHPLWGHQPLWJHOLHIHUWHQ6FKUDXEHQ0[
$EE $EE PLWWHOVHLQHV,QEXVVFKOVVHOV ]XYRULVWGLH7U]XIIQHQ
+,1:(,6=XUNRUUHNWHQ0RQWDJHGHVREHUHQYRUGHUHQ
'(7$,/=
Part. Z
)URQWSDQHHOV  LVWHVQRWZHQGLJGDVV]ZLVFKHQGLHVHPXQG
 GHP)URQWSDQHHO  GHUPLWJHOLHIHUWH(LQVDW]SODW]LHUWZLUG
62 VRZLHHVLP'HWDLO=DXI$EEDQJHJHEHQLVW
62 0217$*('(5817(5(1925'(5(1%/(1'(
%XFKVHQ )$7$6,5(1$ $EE
0LWGHP,QEXVVFKOVVHOGLH%HIHVWLJXQJVVFKUDXEHQGHV
62 6RFNHOJLWWHUVDXV*XVVHLVHQ  DXVVFKUDXEHQXQGGLHVHV
24 abnehmen.
vite
Schrauben 'LH%OHQGH  SODW]LHUHQXQGVLHPLWGHQPLWJHOLHIHUWHQ
6FKUDXEHQ0[ PLWKLOIHHLQHV,QEXVVFKOVVHOV ZLHLP
 'HWDLO;DQJHJHEHQEHIHVWLJHQ $EE 
$EE $EE
- 99 -
0217$*('(59(5./(,'81*(1)$7$6,5(1$
0217$*('(6.(5$0,.$8)6$7=(6)$7$6,5(1$
 $EE
* 'LH.HUDPLN$EVWDQGVKDOWHU LQGLHHQWVSUHFKHQGHQYLHU
IUHLHQIIQXQJHQGHV*XVVHLVHQ2EHUWHLOVVWHFNHQXQGGLH
62 .HUDPLN$EODJH  DXIVHW]HQ
)DOOVHUIRUGHUOLFK]ZLVFKHQGHP$EVWDQGVKDOWHUDXV6LOLNRQ
6FKUDXEHQ
n2 viti XQGGHP*XVVHLVHQDXIVDW]HLQH8QWHUOHJVFKHLEHOHJHQ
+,1:(,6
'(7$,/;
Part. X 'LHURWH.ULVWDOOLQHPDLOOHDXIGHQ6WHLQJXWNDFKHOQELOGHW
HLQKHLWOLFKH+DDUULVVHDXIGHUJHVDPWHQ)OFKH'LHVH+DDUULVVH
VWHOOHQNHLQHQ0DQJHOGDUVRQGHUQHLQW\SLVFKHV0HUNPDOGHU
(PDLOOHDXI6WHLQJXWNDFKHOQ &UDFO(IIHNW 
'LH.HUDPLNWHLOH 6WHLQJXWNDFKHOQ VLQGYRQ+DQGJHJRV-
$EE $EE VHQXQGHPDLOOLHUWXQGNQQHQGDKHUJHULQJIJLJH8QUH-
JHOPLJNHLWHQDXIZHLVHQ NOHLQH0XOGHQRGHU3RUHQLQGHU
(PDLOOHVFKLFKW GLHLKUH4XDOLWWMHGRFKQLFKWEHHLQWUFKWLJHQ
VRQGHUQEH]HXJWGHVVHQ%HDUEHLWXQJYRQ+DQG

0217$*('(59(5./(,'81*(16725<
0,7*(/,()(57(./(,17(,/(
6FKUDXEHQ0[
6FKUDXEHQ0[

6LOLNRQ$EVWDQGVKDOWHUIUGLH$XIVDW]SODWWHDXV.HUDPLN
DFKH8QWHUOHJVFKHLEHQPLW'XUFKPHVVHU
62 %XFKVHQ

'HU2IHQZLUGPLWEHUHLWVPRQWLHUWHQ0HWDOOVHLWHQWHLOHQDXVJH-
OLHIHUWZKUHQGGDVREHUHXQGXQWHUH  )URQWSDQHHODXV
.HUDPLNXQGGDV7RS  VHSDUDWYHUSDFNWVLQGXQGZLHIROJW
'(876&+

PRQWLHUWZHUGHQPVVHQ

62 0217$*('(52%(5(1925'(5(1%/(1'( $EE

$EE 1-2)
'DVYRUGHUHREHUH)URQWSDQHHODXV.HUDPLN  DEJHVWW]W
DXIGLH)URQWSDQHHO+DOWHUXQJ  LQ3RVLWLRQEULQJHQZXUGH
'(7$,/=
Part. Z REHUKDOEGHU7USRVLWLRQLHUW
'LH%OHQGHPLWGHQPLWJHOLHIHUWHQ6FKUDXEHQ0[
62 PLWWHOVHLQHV,QEXVVFKOVVHOV ]XYRULVWGLH7U]XIIQHQ
62
%XFKVHQ 6FKUDXEHQ
n2 viti +,1:(,6=XUNRUUHNWHQ0RQWDJHGHVREHUHQYRUGHUHQ
)URQWSDQHHOV  LVWHVQRWZHQGLJGDVV]ZLVFKHQGLHVHPXQG
GHP)URQWSDQHHO  GHUPLWJHOLHIHUWH(LQVDW]SODW]LHUWZLUG
24 '(7$,/;
Part. X
VRZLHHVLP'HWDLO=LQ$EEDQJHJHEHQLVW
vite
Schrauben

0217$*('(5817(5(1925'(5(1%/(1'(
$EE $EE $EE
0LWGHP,QEXVVFKOVVHOGLH%HIHVWLJXQJVVFKUDXEHQGHV
6RFNHOJLWWHUVDXV*XVVHLVHQ  DXVVFKUDXEHQXQGGLHVHV

* 
abnehmen.
'LH%OHQGH  SODW]LHUHQXQGVLHPLWGHQPLWJHOLHIHUWHQ
6FKUDXEHQ0[ PLWKLOIHHLQHV,QEXVVFKOVVHOV ZLHLP
'HWDLO;DQJHJHEHQEHIHVWLJHQ $EE 

0217$*('(6.(5$0,.$8)6$7=(6 $EE
'LH.HUDPLN$EVWDQGVKDOWHU LQGLHHQWVSUHFKHQGHQYLHU
IUHLHQIIQXQJHQGHV*XVVHLVHQ2EHUWHLOVVWHFNHQXQGGLH
.HUDPLN$EODJH  DXIVHW]HQ
:RHUIRUGHUOLFK]ZLVFKHQGHP6LOLNRQ$EVWDQGVKDOWHUXQG
GHP*XVVHLVHQ2EHUWHLOHLQHPLWJHOLHIHUWH8QWHUOHJVFKHLEH
einlegen.
$EE
- 100 -
INSTALLATION
%HL,QVWDOODWLRQXQG*HEUDXFKGHV*HUWVPVVHQDOOHORND- 5$8&+$%=8*'
OHQXQGQDWLRQDOHQ*HVHW]HVYRUVFKULIWHQXQG(XURSDQRUPHQ 'HU$E]XJHUIROJWEHUGHQ6WXW]HQPLWFP'XUFKPHVVHUDXI
EHDFKWHWZHUGHQ,Q,WDOLHQJLOW81,VRZLHDOOH GHU5FNVHLWH'HU5DXFKDE]XJPXVVPLWGHPXHUHQPLWWHOV
HWZDLJHQUHJLRQDOHQ9RUJDEHQXQG9RUJDEHQGHUUWOLFKHQ JHHLJQHWHU6WDKOURKUH5RKQH%HKLQGHUXQJHQ(1
*HVXQGKHLWVPWHU$6/,QMHGHP)DOOVLQGGLHHLQVFKOJLJHQ 'DV5RKUPXVVKHUPHWLVFKYHUVLHJHOWZHUGHQ)UGLH'LFK-
QDWLRQDOHQ%HVWLPPXQJHQ]XEHDFKWHQ%HLGHU,QVWDOODWLRQLQ WLJNHLWGHU5RKUHXQGJHJHEHQHQIDOOVGHUHQ,VROLHUXQJLVWGLH
HLQHP0HKUSDUWHLHQKDXVVROOWH]XQFKVWGLH*HQHKPLJXQJGHV 9HUZHQGXQJYRQ0DWHULDOHUIRUGHUOLFKGDVKRKHQ7HPSHUDWXUHQ
+DXVYHUZDOWHUVHLQJHKROWZHUGHQ ZLGHUVWHKW 6LOLNRQRGHU'LFKWPDVVHIUKRKH7HPSHUDWXUHQ 
(LQHHYHQWXHOOHZDDJHUHFKWH/HLWXQJNDQQHLQH/QJHELV]X
35)81*'(59(575*/,&+.(,70,7$1'(5(1 0HWHUQEHVLW]HQ(VVLQG.XUYHQPLWHLQHP+FKVWZLQNHO
*(57(1 YRQqPJOLFK
'HU2IHQGDUI1,&+7LQ5XPHQDXIJHVWHOOWZHUGHQLQGHQHQ Falls der Rauchabzug nicht in einen Schornstein eingeleitet
*DVKHL]JHUWHYRP7\S%LQ%HWULHEVLQG ]%*DV:DVVH-
ZLUGVLQGHLQVHQNUHFKWHV$XHQVWFNYRQPLQGHVWHQVP
UHUKLW]HUIHQXQG*HUWHGLHEHU$E]XJVKDXEHQEHWULHEHQ
XQGHLQDEVFKOLHHQGHU:LQGVFKXW]HUIRUGHUOLFK JHP81,
ZHUGHQ GDGHU2IHQ8QWHUGUXFNLP5DXPHU]HXJHQXQG
GDGXUFKGHQ%HWULHEVROFKHU*HUWHEHHLQXVVHQE]ZEHHLQ-  'DVVHQNUHFKWH6WFNNDQQLQQHQRGHUDXHQ
WUFKWLJHQNDQQ YHUODXIHQ,VWGDV5RKUDXHQYHUOHJWPXVVHVDQJHPHVVHQ
JHGPPWVHLQ:LUGGHU5DXFKDE]XJLQHLQHQ6FKRUQVWHLQ
35)81*'(6(/(.752$16&+/866(6 HLQJHOHLWHWPXVVGLHVHUIU)HVWEUHQQVWRIIH]XJHODVVHQVHLQ
GLH6WHFNGRVHDQ]XJQJOLFKHU6WHOOHDQEULQJHQ XQGIDOOVVHLQ'XUFKPHVVHUPHKUDOVPPEHWUJWPXVV
'HU2IHQZLUGPLWHLQHP1HW]YHUVRUJXQJVNDEHOJHOLHIHUWGDV HLQQHXHV5RKUPLWJHHLJQHWHP'XUFKPHVVHUXQGDXVJHHL-
DQHLQH6WHFNGRVHPLW9+]DQ]XVFKOLHHQLVWYRU- JQHWHP0DWHULDOHLQJH]RJHQZHUGHQ ]%1LURVWD]XPP
]XJVZHLVHPLWHLQHP0DJQHW7KHUPRVFKXW]VFKDOWHUYHUVHKHQ 'XUFKPHVVHU $OOH5RKUDEVFKQLWWHPVVHQLQVSL]LHUEDUVHLQ
6SDQQXQJVVFKZDQNXQJHQYRQPHKUDOVNQQHQGHQ 'LH6FKRUQVWHLQHXQGGLH5DXFKDE]JHDQGLH)HVWEUHQQVWRII
2IHQEHHLQWUFKWLJHQ IDOOVQRFKQLFKWYRUKDQGHQHLQHQJHHL- 9HUEUDXFKHUDQJHVFKORVVHQVLQGVLQGHLQ0DOLP-DKU]XUHLQL-
JQHWHQ'LIIHUHQ]LDOVFKDOWHUYRUVHKHQ 'LH(OHNWURDQODJHPXVV JHQ SUIHQRELPHLJHQHQ/DQGHLQHHQWVSUHFKHQGH5HJHOXQJ
GHQ9RUVFKULIWHQHQWVSUHFKHQLQVEHVRQGHUHGLH:LUNVDPNHLW JLOW (LQHPDQJHOQGHEHUSUIXQJXQGUHJHOPLJH5HLQLJXQJ
GHV(UGXQJVNUHLVODXIVEHUSUIHQ'LH9HUVRUJXQJVOHLWXQJ HUKKWGLH:DKUVFKHLQOLFKNHLWHLQHV6FKRUQVWHLQEUDQGV
muss einen der Leistung des Einsatzes entsprechenden ,QGLHVHP)DOOZLHIROJWYRUJHKHQ
Querschnitt aufweisen. 1LFKWPLW:DVVHUOVFKHQGHQ3HOOHWEHKOWHUOHHUHQ
6LFKQDFKGHP=ZLVFKHQIDOOYRUGHPHUQHXWHQ%HWULHEGHV
AUFSTELLUNG *HUWVDQ)DFKSHUVRQDOZHQGHQ

'(876&+
)UHLQHQRUGQXQJVJHPHQ%HWULHEGHV2IHQVPXVVGLHVH Der Ofen ist fr den Betrieb unter beliebigen klimatischen Be-
mit der Wasserwaage ausgerichtet werden. dingungen ausgelegt. Unter besonderen Bedingungen, etwa bei
'LH7UDJIKLJNHLWGHV)XERGHQVEHUSUIHQ VWDUNHP:LQGVSULQJHQJJIGLH6LFKHUKHLWVHLQULFKWXQJHQDQXQG
der Ofen schaltet ab. Das Gert in diesem Fall nicht mit deakti-
%5$1'6&+87=6,&+(5+(,76$%671'( YLHUWHQ6LFKHUKHLWVYRUNHKUXQJHQEHWUHLEHQ:HQGHQ6LHVLFKEHL
'HU2IHQLVWXQWHU(LQKDOWXQJGHUIROJHQGHQ6LFKHUKHLWVEHGLQ- anhaltendem Problem an den Technischen Kundenservice.
gungen zu installieren:
6HLWOLFKXQGDXIGHU5FNVHLWHFP0LQGHVWDEVWDQG]X 7<3,6&+()//(
HQW]QGOLFKHQ0DWHULDOLHQODVVHQ Abb. 1 Abb. 2
YRUGHP2IHQGUIHQNHLQHHQW]QGOLFKHQ0DWHULDOLHQPLW
HLQHP$EVWDQGYRQZHQLJHUDOVFPDXIJHVWHOOWZHUGHQ
6ROOWHHVQLFKWPJOLFKVHLQGLHREHQDQJHJHEHQHQ$EVWQGH
HLQ]XKDOWHQPVVHQWHFKQLVFKHXQGEDXOLFKH0DQDKPHQJH-
WURIIHQZHUGHQXPMHGH%UDQGJHIDKUDXV]XVFKOLHHQ
)UGHQ)DOOGHU0RQWDJHDXIHLQHU:DQGDXV+RO]RGHUDQGH-
UHPEUHQQEDUHQ0DWHULDOPXVVGDV5DXFKDE]XJVURKUDQJHPHV-
VHQJHGPPWZHUGHQ

INSTALLATION LUFTEINLASS
'HU$XIVWHOOXQJVUDXPPXVVEHUHLQHQ/XIWHLQODVVPLWHLQHP
4XHUVFKQLWWYRQPLQGHVWHQVFPsYHUIJHQGHUVLFKHUVWHOOW
GDVVGLHEHLGHU9HUEUHQQXQJYHUEUDXFKWH/XIWHUVHW]WZLUG
6WDWWGHVVHQNDQQPDQGLH/XIWIUGHQ+HL]RIHQDXFKGLUHNW
aus dem Freien entnehmen, indem man das Rohr mit 4 cm
'XUFKPHVVHUPLWHLQHP6WDKOURKUVWFNYHUOQJHUW,QGLHVHP
A: 5DXFKDE]XJDXVJHGPPWHQ6WDKO
)DOONDQQHV]X3UREOHPHQGXUFK.RQGHQVZDVVHUELOGXQJNRP-
B: 0LQGHVWKKHPXQGMHGHQIDOOVEHUGLH7UDXIHGHV'DFKHVKLQDXV
PHQXQGHVLVWQRWZHQGLJGHQ/XIWHLQODVVPLWHLQHP*LWWHU
]XVFKW]HQGDVHLQHQIUHLHQ4XHUVFKQLWWYRQPLQGHVWHQV C-E: /XIWHLQODVVYRQDXHQ 0LQGHVWTXHUVFKQLWWFPs
FPsDXI]XZHLVHQKDW'DV5RKUPXVVHLQH/QJHYRQZHQLJHU '5DXFKDE]XJDXV6WDKOLQ5DXFKDE]XJDXV0DXHUZHUNHLQJH]RJHQ
DOV0HWHUDXIZHLVHQXQGGDUIQLFKWJHNUPPWVHLQ(VPXVV SCHORNSTEIN
LQHLQHQ(QGDEVFKQLWWPQGHQGHUXP*UDGQDFKXQWHQ 'LHZLFKWLJVWHQ0HUNPDOHVLQG
gerichtet oder mit einem Windschutz versehen ist. ,QQHQTXHUVFKQLWWDQGHU%DVLVJOHLFKGHPGHV5DXFKDE]XJV
,QMHGHP)DOOGHQJDQ]HQ:HJ/XIWDQVDXJNDQDOPXVVHLQIUHLHU IIQXQJVTXHUVFKQLWWQLFKWJHULQJHUDOVGHP]ZHLIDFKHQGHV
4XHUVFKQLWWYRQPLQGHVWHQVFPsJHZKUOHLVWHWVHLQ'DV Rauchabzugs
XHUH(QGHGHV/XIWOHLWHUVPXVVPLWHLQHP)OLHJHQJLWWHU /DJHLQYROOHP:LQGREHUKDOEGHV'DFKHVXQGDXHUKDOE
JHVFKW]WZHUGHQZREHLGHUQXW]EDUH'XUFKJDQJYRQFPs GHU5FNXVVEHUHLFKH/DJHLQYROOHP:LQGEHUGHQ
nicht verringert werden darf. 'DFKUVWKLQDXVXQGDXHUKDOEGHV5FNVFKODJEHUHLFKV
- 101 -
INSTALLATION
$EE$ :$50/8)7=,5.8/$7,21
'LH$EJDEHYRQ:DUPOXIWLQGHQ,QVWDOODWLRQVUDXPHUIROJW
GXUFKGDVLPREHUHQ7HLOIURQWDOHLQJHEDXWH*LWWHU $EE( 

8PGLH:DUPOXIWLQHLQHQRGHU]ZHLEHQDFKEDUWH5XPH
]XOHLWHQLVWGHU2IHQPLW]ZHL6WXW]HQDXIGHU5FNVHLWH
YHUVHKHQ $EE$ DQGLHHQWVSUHFKHQGH$OXPLQLXPURKUH
DQ]XVFKOLHHQVLQG
Warmluft-
$XVODVV6WXW]HQ 8PGLH9HUWHLOXQJGHU:DUPOXIW]XHUOHLFKWHUQVLQGGLH
.,7XQG.,7%,6DXI:XQVFKHUKOWOLFK VLHKH6
 
$EE%
Es ist wichtig, daran zu erinnern, dass das Rohr, durch
GDVGLH:DUPOXIWLHW]ZHFNPLJHUZHLVHJHGPPW
ZLUGXP:UPHYHUOXVWH]XYHUPHLGHQ
(VVLQGVRZHLWZLUPJOLFK.XUYHQGHV5RKUV]XYHUPHLGHQ
P
P 1%',(6&+/8&+(066(1925'(5
$1%5,1*81*'(59(5./(,'81*81'1$&+
'(0$86%$8'(62%(5(16(,7(17(,/6$86
*866(,6(1$8)',(:$50/8)7$86/$666787=(1
*(67(&.7:(5'(1'(5$1)$1*67(,/
'(66&+/$8&+(6086692//.200(1
$EE& $86*(=2*(1:(5'(180',()$/7(1
=8%(6(,7,*(1$8)',(6(:(,6(:(,7(7
6,&+'(5,11(1'85&+0(66(50(5./,&+
P
'(876&+

81'(5/(,&+7(57'$6$8)67(&.(1
P
'LH9HUWHLOXQJGHUNDQDOLVLHUWHQ/XIWZLUGPLWWHOVGHU
L +HEHO/ $EE' JHUHJHOW
L 8PGLHVHEHZHJHQ]XNQQHQPVVHQGLHPLW6FKUDXEHQ
EHIHVWLJWHQ$EGHFNXQJHQ3HQWIHUQWZHUGHQ $EE%& 

6LQGGLH$EGHFNXQJHQDEJHQRPPHQNDQQGLH:DUPOXIW
HQWZHGHU]XP)URQWJLWWHU$EE( +HEHOJDQ]QDFKKLQWHQ
$EE' VLHKH$EE' RGHU]XU5FNVHLWH$EE) +HEHOJDQ]QDFKYRU-
QHVLHKH$EE' RGHU]XU+OIWHQDFKYRUQHXQG]XU5FNVHL-
WH +HEHOLQ0LWWHOVWHOOXQJVLHKH$EE' JHOHLWHWZHUGHQ
Frontal
1%:,5''(52)(11,&+7.$1$/,6,(57'5-
0LWWHOVWHOOXQJ
)(1',($%'(&.81*(1 3 1,&+7(17)(517
:(5'(1
5FNVHLWLJ

$EE( $EE)

- 102 -
INSTALLATION
/681*.,7 $UW1U 185%(1$&+%$57(55$80
1%',(6&+/8&+(066(1925'(5$1%5,1*81*'(59(5./(,'81*81'1$&+'(0
$86%$8'(62%(5(16(,7(17(,/6$86*866(,6(1$8)',(:$50/8)7$86/$666787=(1
*(67(&.7:(5'(1'(5$1)$1*67(,/'(66&+/$8&+(6086692//.200(1$86*(=2*(1
:(5'(180',()$/7(1=8%(6(,7,*(1$8)',(6(:(,6(:(,7(76,&+'(5,11(1'85&+0(66(5
0(5./,&+81'(5/(,&+7(57'$6$8)67(&.(1
'LH6WHOOXQJGHV2IHQVJHJHQEHUGHU0DXHUIHVWOHJHQ $EED 
'HQREHUHQ7HLOGHUUFNZUWLJHQ$EGHFNXQJ  DEEDXHQXQGHLQHQGHUEHLGHQYRUJHVWDQ]WHQ'HFNHOGHU:DUPOXIWDX-
VWULWWVVWXW]HQHQWIHUQHQ $EEE 
'HQ+HEHOGHU:DUPOXIWNDQDOLVLHUXQJ  EHWWLJHQQDFKGHPGLH6SHUUDEGHFNXQJHQ  HQWIHUQWZXUGHQ $EEE 
'LH5RKUKOVH  DQGHUDXIGHU:DQG]XJHZDQGWHQ6HLWHQDFK0DDEVFKQHLGHQ $EEF 
'HQ2IHQLQGLHHQGJOWLJH6WHOOXQJVHW]HQ
'DV$OXPLQLXPURKU  IUGLH:DUPOXIWNDQDOLVLHUXQJDXVUROOHQRKQHHVDQGHQ6WXW]HQGHV2IHQVDQ]XVFKOLHHQ
$XIGDV$OXPLQLXPURKUGLH5RVHWWH  XQGGLH5RKUKOVH D DXIVWHFNHQRKQHVLH]XEHIHVWLJHQ $EEF 
'DV$OXPLQLXPURKUDXIGHQ:DUPOXIWDXVWULWWVVWXW]HQDXIGHU5FNVHLWHGHV2IHQVDXIVWHFNHQ   $EEG 
'DV2EHUWHLOGHUUFNZUWLJHQ$EGHFNXQJ  ZLHGHUDQEDXHQ
'LH5RKUKOVH  LQLKUHHQGJOWLJH6WHOOXQJEULQJHQXQGDXIGHU5FNVHLWHGHV2IHQVPLWGHQPLWJHOLHIHUWHQ6FKUDXEHQ  
EHIHVWLJHQ $EEG 
'HQ$EVFKOXVVVWXW]HQ  XQGGDVHQWVSUHFKHQGH$OXPLQLXPURKU  HLQEDXHQ $EEG 
'LH5RVHWWHDQGHU:DQG  PLW6LOLNRQEHIHVWLJHQ $EEG 
$EED $EEE
23

132 1
133
5

13
4
132 7

'(876&+
$EEF 5 3
6 6a
8
6
6a

4 8
5

$EEG 5
88 3
4
4
8 6
7

6
6a

Qq .,7
 Schachtel  
 5RKU  
4 $EVFKOXVVVWXW]HQ  
 Wandrosette  
6a 5RKUKOVH  
 %HIHVWLJXQJVVFKUDXEHQ5RKUKOVH 4 
8 %HIHVWLJXQJVVFKHOOH5RKU  
- 103 -
INSTALLATION
/681*.,7 $UW1U 1851,&+7%(1$&+%$57(5
1%',(6&+/8&+(066(1925'(5$1%5,1*81*'(59(5./(,'81*81'1$&+'(0
$86%$8'(62%(5(16(,7(17(,/6$86*866(,6(1$8)',(:$50/8)7$86/$666787=(1
*(67(&.7:(5'(1'(5$1)$1*67(,/'(66&+/$8&+(6086692//.200(1$86*(=2*(1
:(5'(180',()$/7(1=8%(6(,7,*(1$8)',(6(:(,6(:(,7(76,&+'(5,11(1'85&+0(66(5
0(5./,&+81'(5/(,&+7(57'$6$8)67(&.(1
'LH6WHOOXQJGHV2IHQVJHJHQEHUGHU0DXHUIHVWOHJHQ $EED 
'HQREHUHQ7HLOGHUUFNZUWLJHQ$EGHFNXQJ  DEEDXHQXQGHLQHQGHUEHLGHQYRUJHVWDQ]WHQ'HFNHOGHU:DUPOXIWDX-
VWULWWVVWXW]HQHQWIHUQHQ $EEE 
'HQ+HEHOGHU:DUPOXIWNDQDOLVLHUXQJ  EHWWLJHQQDFKGHPGLH6SHUUDEGHFNXQJHQ  HQWIHUQWZXUGHQ $EEE 
'LH5RKUKOVH  DQGHUDXIGHU:DQG]XJHZDQGWHQ6HLWHQDFK0DDEVFKQHLGHQ $EEF 
'HQ2IHQLQGLHHQGJOWLJH6WHOOXQJVHW]HQ
'DV$OXPLQLXPURKU  IUGLH:DUPOXIWNDQDOLVLHUXQJDXVUROOHQRKQHHVDQGHQ6WXW]HQGHV2IHQVDQ]XVFKOLHHQ
$XIGDV$OXPLQLXPURKUGLH5RVHWWH  XQGGLH5RKUKOVH D DXIVWHFNHQRKQHVLH]XEHIHVWLJHQ $EEF 
'DV$OXPLQLXPURKUDXIGHQ:DUPOXIWDXVWULWWVVWXW]HQDXIGHU5FNVHLWHGHV2IHQVDXIVWHFNHQ   $EEG 
'DV2EHUWHLOGHUUFNZUWLJHQ$EGHFNXQJ  ZLHGHUDQEDXHQ
'LH5RKUKOVH  LQLKUHHQGJOWLJH6WHOOXQJEULQJHQXQGDXIGHU5FNVHLWHGHV2IHQVPLWGHQPLWJHOLHIHUWHQ6FKUDXEHQ  
EHIHVWLJHQ $EEG 
'HQ$EVFKOXVVVWXW]HQ  XQGGDVHQWVSUHFKHQGH$OXPLQLXPURKU  HLQEDXHQZREHLGLHVHVPLWGHU5RKUPDQVFKHWWH  XQGGHQ
'EHOQPLW6FKUDXEHQ  DQGHU:DQGEHIHVWLJWZLUG $EEG 
'LH5RVHWWHDQGHU:DQG  PLW6LOLNRQEHIHVWLJHQ $EEG 

$EED $EEE 2
2

132
133 1
5
7

13
4 6 6a
132
'(876&+

$EEF 5
9 9
8

6 10 11

10 9
9 4
10
8 8
$EEG 5
4 2
8
7

5
6 6

Qq .,7%,6
 Schachtel  
 5RKU  
4 $EVFKOXVVVWXW]HQ  
 Wandrosette  
6a 5RKUKOVH  
 %HIHVWLJXQJVVFKUDXEHQ5RKUKOVH 4 
8 %HIHVWLJXQJVVFKHOOH5RKU  
 Rohrmanschette  
 Schrauben 4 
 'EHO 4 
- 104 -
INSTALLATION
/681*.,7 $UW1U XQG.,7%,6 $UW1U %(,'(580(
1%',(6&+/8&+(066(1925'(5$1%5,1*81*'(59(5./(,'81*81'1$&+'(0
$86%$8'(62%(5(16(,7(17(,/6$86*866(,6(1$8)',(:$50/8)7$86/$666787=(1
*(67(&.7:(5'(1'(5$1)$1*67(,/'(66&+/$8&+(6086692//.200(1$86*(=2*(1
:(5'(180',()$/7(1=8%(6(,7,*(1$8)',(6(:(,6(:(,7(76,&+'(5,11(1'85&+0(66(5
0(5./,&+81'(5/(,&+7(57'$6$8)67(&.(1
'LH6WHOOXQJGHV2IHQVJHJHQEHUGHU0DXHUIHVWOHJHQ $EED 
'HQREHUHQ7HLOGHUUFNZUWLJHQ$EGHFNXQJ  DEEDXHQXQGGLHEHLGHQYRUJHVWDQ]WHQ'HFNHOGHU:DUPOXIWDXVWULWWVVWXW]HQ
HQWIHUQHQ $EEE 
'LH+HEHOGHU:DUPOXIWNDQDOLVLHUXQJ  EHWWLJHQQDFKGHPGLH6SHUUDEGHFNXQJHQ  HQWIHUQWZXUGHQ $EEE 
'LH5RKUKOVHQ  DQGHUDXIGHU:DQG]XJHZDQGWHQ6HLWHQDFK0DDEVFKQHLGHQ $EEF 
'HQ2IHQLQGLHHQGJOWLJH6WHOOXQJVHW]HQ
'LH$OXPLQLXPURKUH  IUGLH:DUPOXIWNDQDOLVLHUXQJDXVUROOHQRKQHVLHDQGHQ6WXW]HQGHV2IHQVDQ]XVFKOLHHQ
$XIGLH$OXPLQLXPURKUHGLH5RVHWWHQ  XQGGLH5RKUKOVHQ D DXIVWHFNHQRKQHVLH]XEHIHVWLJHQ $EEF 
'LH$OXPLQLXPURKUHDXIGLH:DUPOXIWDXVWULWWVVWXW]HQDXIGHU5FNVHLWHGHV2IHQVDXIVWHFNHQ   $EEG 
'DV2EHUWHLOGHUUFNZUWLJHQ$EGHFNXQJ  ZLHGHUDQEDXHQ
'LH5RKUKOVHQ  LQLKUHHQGJOWLJH6WHOOXQJEULQJHQXQGDXIGHU5FNVHLWHGHV2IHQVPLWGHQPLWJHOLHIHUWHQ6FKUDXEHQ  
EHIHVWLJHQ $EEG 
'LH$EVFKOXVVVWXW]HQ  XQGGLHHQWVSUHFKHQGHQ$OXPLQLXPURKUH  HLQEDXHQZREHLGLHVHPLWGHQ5RKUPDQVFKHWWHQ  XQG
GHQ'EHOQPLW6FKUDXEHQ  DQGHU:DQGEHIHVWLJWZLUG $EEG 
'LH5RVHWWHQDQGHU:DQG  PLW6LOLNRQEHIHVWLJHQ $EEG 

$EED $EEE
2

5
3 132 1
5
133 2
7
6
13 4
6a

6 6a
132

'(876&+
$EEF 5 3 8
9 9

6 10 11

4
8
5

10 9 4
10 9
8 8
$EEG 5
4 3 2
8
7
8 6

4 5
6 5 6

Qq .,7 .,7%,6


 Schachtel   
 5RKU  - 
 5RKU   -
4 $EVFKOXVVVWXW]HQ   
 Wandrosette   
6a 5RKUKOVH   
 %HIHVWLJXQJVVFKUDXEHQ5RKUKOVH 8  
8 %HIHVWLJXQJVVFKHOOH5RKU 4  
 Rohrmanschette  - 
 Schrauben 4 - 
 'EHO 4 - 
- 105 -
*(%5$8&+6$1:(,681*(1
'LH,QEHWULHEQDKPHLVWHLQHPDXWRULVLHUWHQ6HUYLFHFHQWHU
von Edilkamin zu bertragen. Die erste Einschaltung und die
$EQDKPHKDWQDFK81,

Diese Norm bezeichnet die vor Ort vorzunehmenden Kon-


WUROOWlWLJNHLWHQGLHGHQRUGQXQJVJHPlHQ%HWULHEGHV6\VWHPV
besttigen sollen.

9RUGHP$Q]QGHQ
%HLPHUVWHQ=QGHQLVWGDV]XVWlQGLJH6HUYLFHFHQWHUYRQ
Edilkamin zu verstndigen (Informationen auf der Website
www.edilkamin.com), das den Ofen in Funktion zum verwen-
deten Pellet und der Einbausituation justiert und die Garantie
fr den Ofen ausstellt..
$EE
:HQQGDVHUVWH=QGHQQLFKWGXUFKHLQDXWRULVLHUWHV6HUYLFH-
center erfolgt, kann Edilkamin den einwandfreien Betrieb des
Ofens nicht garantieren.

:KUHQGGHUHUVWHQ%UHQQYRUJQJHNQQHQVLFKOHLFKWH
)DUEJHUFKHHQWZLFNHOQGLHQDFKNXU]HU=HLWYHUVFKZLQGHQ

9RUGHP$Q]QGHQLVWMHGHQIDOOV]XEHUSUIHQ
'LHRUGQXQJVJHPH,QVWDOODWLRQ
'LH6WURPYHUVRUJXQJ
'HU9HUVFKOXVVGHU7UGLHGLFKWVHLQPXVV
'LH6DXEHUNHLWGHV%UHQQWLHJHOV
'DV9RUOLHJHQGHU6WDQG%\$Q]HLJHDXIGHP
'LVSOD\ EOLQNHQGHV'DWXP/HLVWXQJRGHU7HPSHUDWXU 
'(876&+

/$'(1'(63(//(7,1'(1%(+/7(5
'HU'HFNHOGHV%HKOWHUVIIQHWXQGVFKOLHWVLFKPLWWHOVGHV
SUDNWLVFKHQ.OLFN.ODFN6\VWHPGXUFKHLQHQOHLFKWHQ'UXFN
DXIGDVYRUGHUH7HLOGHV*XVVHLVHQ'HFNHOV J 

ACHTUNG :
'HQEHLJHIJWHQ+DQGVFKXKEHLP/DGHQGHV2IHQVYHUZHQ-
GHQZHQQGLHVHULQ%HWULHEXQGGDKHUKHLLVW

$10(5.81*(1]XP%UHQQVWRII 'XUFKPHVVHU0LOOLPHWHU
'H2IHQLVWDXVJHOHJWIUGHQ(LQVDW]YRQ+RO]3HOOHWV]X +FKVWOQJHPP
YHUEUHQQHQPLWPP'XUFKHPHVVHU +FKVW)HXFKWLJNHLWVJHKDOW
3HOOHWLVWHLQ%UHQQVWRIIGHUVLFKLQGHU)RUPYRQNOHLQHQ +HL]ZHUW0LQGHVWHQVNFDONJ
=\OLQGHUQYRQHWZDPP'XUFKPHVVHUSUVHQWLHUWGLHGXUFK 'LH9HUZHQGXQJYRQ3HOOHWPLWXQWHUVFKLHGOLFKHQ(LJHQVFKDI-
GDV3UHVVHQYRQ6JHPHKORKQH=XVDW]YRQ.OHERGHUDQGH- WHQHUIRUGHUWHLQHVSH]LVFKH(LQVWHOOXQJGHV2IHQVGLHGHU
UHQ)UHPGVWRIIHQHUKDOWHQZHUGHQ(ULVWLP+DQGHOLQ6FNHQ HQWVSULFKWGLHGHU+QGOHUEHLGHU(UVWDQ]QGXQJYRUQLPPW
YRQNJHUKOWOLFK8PGHQ%HWULHEGHV2IHQV1,&+7]X 'HU*HEUDXFKYRQXQJHHLJQHWHP3HOOHWNDQQ)ROJHQGHVYHUXU-
EHHLQWUFKWLJHQLVWHVXQHUOVVOLFK1,&+76DQGHUHVGDULQ VDFKHQ9HUULQJHUXQJGHV:LUNXQJVJUDGV%HWULHEVVWUXQJHQ
]XYHUEUHQQHQ'LH9HUZHQGXQJYRQDQGHUHQ0DWHULDOLHQ $XVIDOOGXUFK9HUVWRSIXQJ9HUVFKPXW]XQJGHU6FKHLEH
%UHQQKRO]LQEHJULIIHQGLHGXUFK/DERUXQWHUVXFKXQJHQIHVWJH- 9HUEUHQQXQJVUFNVWQGHXVZ(LQHHLQIDFKH6LFKWSUIXQJ
VWHOOWZHUGHQNDQQEHZLUNWGHQ9HUIDOOGHU*DUDQWLH(GLOND- GHV3HOOHWNDQQ$XIVFKOXVVEHUGHVVHQ4XDOLWWJHEHQ
PLQKDWVHLQH(U]HXJQLVVHGDKLQJHKHQGHQWZLFNHOWJHSUIW *XWH4XDOLWW*ODWWUHJHOPLJH/QJHZHQLJVWDXELJ
XQGSURJUDPPLHUWGDVVVLHGLHEHVWHQ(UJHEQLVVHPLW3HOOHW 0LQGHUZHUWLJH4XDOLWWPLW/QJVXQG4XHUVSDOWHQVHKU
GHUIROJHQGHQ(LJHQVFKDIWHQJHZKUOHLVWHQ VWDXELJVHKUYHUQGHUOLFKH/QJHQXQG$QZHVHQKHLWYRQ
)UHPGNUSHUQ

- 106 -
*(%5$8&+6$1:(,681*(1
%(',(1)(/'
6HNODQJJHGUFNWVFKDOWHWHLQXQGDXV

1DFKNXU]HP'UXFNVFKDOWHWGHU2IHQYRQ+DQGEHWULHEDXI$XWRPDWLNEHWULHEXPKOWPDQGLH7DVWHKLQJHJHQHWZDV
OQJHUJHGUFNW  KDWPDQ=XJDQJ]XGHQGLYHUVHQ3URJUDPPLHUPHQV

Zur Erhhung der unterschiedlichen Einstellungen

=XU9HUPLQGHUXQJGHUXQWHUVFKLHGOLFKHQ(LQVWHOOXQJHQ

%HLMHGHP'UXFNLQIRUPLHUWGHU6SHLFKHUGHU/HLWHUSODWWHGHQ%HGLHQHUGDVV.JLP7DQNHLQJHIOOWZXUGHQHLQ
NRQWLQXLHUOLFKHV'UFNHQYRQOVFKWGLHUHVWOLFKHQRGHUYRUKHUHLQJHJHEHQHQ.J

%HLNXU]HP'UFNHQZLUGGLH%HOIWXQJGHV2IHQVDEZHFKVHOQGYRQHLQHPJHUXVFKUPHUHQ1LYHDXPLWGHP1DPHQ
&RPIRUWDXIHLQHQHUJLVFKHUHV1LYHDXPLWGHP1DPHQ7XUERXPJHVFKDOWHW

,QEHUHLQVWLPPXQJPLWGHQ/('3XQNWHQEHUKUHQXPGLHJHZQVFKWH$UEHLWVOHLVWXQJDX-
V]XZKOHQ$OWHUQDWLYGD]XNDQQPDQGLHWUDGLWLRQHOOH(LQVWHOOXQJEHQXW]HQGLHPLW+LOIHGHU
 7DVWHQHUIROJW

'(876&+
%HIOOHQGHU)UGHUVFKQHFNH 0DQXHOOHV$Q]QGHQ
%HLPHUVWHQ*HEUDXFKRGHUEHLYOOLJHU(QWOHHUXQJGHV3HOOHW- ,P)DOOYRQ7HPSHUDWXUHQXQWHUq&GLHGHP:LGHUVWDQGQLFKW
EHKOWHUVPVVHQ]XU%HIOOXQJGHU)UGHUVFKQHFNHJOHLFK]HL- HUODXEWVLFKJHQJHQG]XHUKLW]HQRGHUEHL]HLWZHLOLJHQ$XVIDOO
WLJGLH7DVWHQXQG GHV%HGLHQIHOGVRGHUGHU)HUQEH- GHV:LGHUVWDQGVVHOEVWLVWHVPJOLFKIUGHQ=QGYRUJDQJ
GLHQXQJ HLQLJH6HNXQGHQODQJJHGUFNWZHUGHQQDFKGHP =QGKLOIH]XYHUZHQGHQ,QGHQ7LHJHOHLQJXWEUHQQHQGHV
/RVODVVHQGHU7DVWHQHUVFKHLQWGLH$Q]HLJH1$&+)//81* 6WFN=QGKLOIHJHEHQGLH7UVFKOLHHQXQGDXIGHP
'HU9RUJDQJLVWYRUGHP=QGHQDXV]XIKUHQZHQQGHU2IHQ %HGLHQIHOGRGHUGHU)HUQEHGLHQXQJGUFNHQ
ZHJHQ3HOOHWPDQJHOVVHLQHQ%HWULHEHLQJHVWHOOWKDW
(VLVWQRUPDOGDVVLP%UHQQVWRIIEHKOWHUHLQH5HVWPHQJH3HO- Betriebsarten
OHW]XUFNEOHLEWGLHGLH)UGHUVFKQHFNHQLFKWDQVDXJHQNDQQ Manuell: 'HU%HQXW]HUVWHOOWGLHJHZQVFKWH/HLVWXQJHLQ YRQ
(LQPDOLP0RQDWGHQ%HKOWHUYROOVWQGLJVDXJHQXPGLH ELV 
$EODJHUXQJYRQ6WDXEUHVWHQ]XYHUPHLGHQ $XWRPDWLVFK GHU%HGLHQHUVWHOOWPLW+LOIHGHU7DVWHRGHU
PLWGHU)HUQEHGLHQXQJGLHJHZQVFKWH5DXPWHPSHUDWXUHLQ
$XWRPDWLVFKHV$Q]QGHQ GHU2IHQOLHVWGLHVHSDVVWGLH/HLVWXQJDQXPGLHJHZQVFKWH
%HL2IHQLQ6WDQGE\GXUFK'UFNHQGHU7DVWH GHV%HGLHQ- 7HPSHUDWXU]XHUUHLFKHQXQGJHKWGDQQDXI/HLVWXQJVVWXIH
IHOGVRGHUGHU)HUQEHGLHQXQJ 6HNXQGHQODQJEHJLQQWGDV EHU
=QGYHUIDKUHQXQGHVZLUGGLH6FKULIW=8(1'81*DQJH-
]HLJWJOHLFK]HLWLJEHJLQQWHLQH5FNZUWV]KOXQJLQ6HNXQ- +DQGEHWULHEPLWWHOV%HGLHQIHOG)HUQEHGLHQXQJ
GHQ YRQ 'LH=QGXQJVSKDVHLVWMHGRFK]HLWOLFKQLFKW %HQGHWVLFKGHU2IHQLQ%HWULHERGHUDXI6WDQG%\HU-
YRUEHVWLPPW,KUH'DXHUZLUGDXWRPDWLVFKYHUNU]WZHQQGLH VFKHLQWDXIGHP'LVSDO\QDFKHLQHPHLQPDOLJHQ'UFNHQGHU
6FKDOWNDUWHGDV%HVWHKHQHLQLJHU7HVWVIHVWVWHOOW1DFKHWZD 0(17DVWHYRP%HGLHQIHOGYRQGHU)HUQEHGLHQXQJDXVGLH
0LQXWHQHUVFKHLQWGLH)ODPPH $XIVFKULIW/HLVWXQJ PLWGHU/HLVWXQJPLWZHOFKHUGHU2IHQ
JHUDGHDUEHLWHW PLWGHU7DVWHNDQQPDQYRQGHU)HUQEHGLH-
QXQJDXVGLH%HWULHEVOHLVWXQJVWHLJHUQ YRQ/HLVWXQJVVWXIH
ELV 
- 107 -
*(%5$8&+6$1:(,681*(1
$XWRPDWLVFKHU%HWULHEPLWWHOV%HGLHQIHOG)HUQEHGLHQXQJ WJO3URJUDPP HLQ(LQXQGHLQ$EVFKDOWHQDP7DJ 
%HWWLJWPDQGLH0(17DVWHKLQJHJHQ0DOVFKDOWHWPDQ WJO3URJUDPP HEHQVR WJO3URJUDPP HEHQVR
YRQ+DQGEHWULHEDXI$XWRPDWLNEHWULHEXPXQGUHJHOWGLH 'LH7DVWH0(1EHQXW]HQXPLQXPJHNHKUWHU5HLKHQIROJH
7HPSHUDWXUGLHPDQLP5DXPHUUHLFKHQPFKWH ]XP5HJHOQ DQ]X]HLJHQ:KOWPDQ3URJUDPPZLUGGLH8KU]HLWGHV
GHU7HPSHUDWXUYRQq&DXIq&GLH7DVWHQXQGDXIGHU (LQVFKDOWHQVDQJH]HLJW$XIGHP'LVSOD\HUVFKHLQW(LQVFKDO-
)HUQEHGLHQXQJEHQXW]HQ XQGGHU2IHQUHJHOWGLH$UEHLWVOHL- WHQPLWGHQ7DVWHQYHUQGHUWPDQGLH8KU]HLWXQG
VWXQJXPGLHVH]XHUUHLFKHQ*LEWPDQHLQH7HPSHUDWXUHLQGLH EHVWWLJWPLW0(1
JHULQJHUDOVGLHGHV5DXPHVLVWDUEHLWHWGHU2IHQDXI/HL- $XIGLHJOHLFKH:HLVHVWHOOWPDQGLH8KU]HLWGHU$EVFKDOWXQJ
VWXQJVVWXIH HLQ'LH%HVWWLJXQJGHV3URJUDPPVHUIROJWPLWGHU7DVWH
0(1ZHQQPDQDXIGHP'LVSOD\6SHLFKHUXQJ2.OLHVW
Abstellen %HVWWLJWPDQ:FKHQWO3URJULVWGHU7DJ]XZKOHQDQ
)UHLQHJUHUH%HTXHPOLFKNHLWVWHOOWVLFKGHU2IHQPLW GHPGLH3URJUDPPLHUXQJHUIROJHQVROO
GHUJOHLFKHQ*HEOVHVWXIHDEPLWGHUHUDUEHLWHW 0R'L0L'R)U6D6R
%HL2IHQLQ%HWULHE6HNXQGHQODQJGLH7DVWHGUFNHQ DXI 1DFK:DKOGHV7DJHVPLWWHOVGHU7DVWHQXQGQDFK
GHP%HGLHQIHOGRGHUGHU)HUQEHGLHQXQJ  %HVWWLJXQJPLWGHU7DVWH0(1IKUWPDQPLWGHU
(VVWDUWHWGDV$EVWHOOYHUIDKUHQXQGHVZLUGGLH5FN]KOXQJDQJH- 3URJUDPPLHUXQJDXIGLHJOHLFKH:HLVHIRUWZLHEHLGHU
]HLJWGLHMHQDFKGHU/HLVWXQJYHUVFKLHGHQLVWLQGHUVLFKGHU2IHQ 3URJUDPPLHUXQJGHV7JO3URJUDPPVLQGHPPDQIU
EHLP6WDUWGHU$EVWHOOSKDVHEHIDQG MHGHQ7DJHQWVFKHLGHWREHLQ3URJUDPPHUIROJHQVROOXQG
'LH$EVWHOOSKDVH GLHGHQQ=ZHFNKDWGLH)ODPPH]XOVFKHQ GLH$Q]DKOGHU(LQJULIIHXQGGHU8KU]HLWHQEHVWLPPW
NHLQHXQYHUEUDQQWHQ5FNVWQGHLP%UHQQWLHJHO]XEHODVVHQXQG ,P)DOOHLQHU)DOVFKHLQJDEHNDQQPDQLQMHGHP=HLWSXQNW
GHQ2IHQDE]XNKOHQ VLHKWYRU GHU3URJUDPPLHUXQJGDV3URJUDPPGXUFK'UFNHQGHU7DVWH
8QWHUEUHFKXQJGHU3HOOHW]XIXKU RKQH]XVSHLFKHUQYHUODVVHQ
*HEOVHDXIGHU6WXIHLQGHUVLFKGHU2IHQEHIDQG
5DXFKDE]XJVPRWRULQ%HWULHE +LQZHLV]XU9HUQGHUOLFKNHLWGHU)ODPPH
:KUHQGGHU$EVWHOOSKDVHQLHPDOVGHQ1HW]VWHFNHU]LHKHQ (YHQWXHOOH9HUQGHUXQJHQGHV=XVWDQGVGHU)ODPPHKQ-
JHQYRPHLQJHVHW]WHQ3HOOHWDEVRZLHYRQHLQHUQRUPDOHQ
Einstellung der Uhrzeit 9HUQGHUOLFKNHLWGHU)ODPPHHLQHV)HVWEUHQQVWRIIHVXQGGHQ
'XUFK6HNXQGHQODQJHV'UFNHQGHU7DVWH0(1XQGPLW UHJHOPLJHQ5HLQLJXQJHQGHV%UHQQWLHJHOVGLHGHU2IHQ
GHQ7DVWHQGHQ$QJDEHQGHV'LVSOD\VIROJHQGJHODQJWPDQ DXWRPDWLVFKDXVIKUW
'(876&+

LQV0HQ8KUXQGHUPJOLFKWGDPLWGLH(LQVWHOOXQJGHULQ 1%'LHDXWRPDWLVFKYRP2IHQDXVJHIKUWHQ5HLQLJXQJHQ
GHU6FKDOWNDUWHEHQGOLFKHQ8KU'XUFKDXIHLQDQGHUIROJHQGHV HUVHW]HQQLFKWGDVHUIRUGHUOLFKH$EVDXJHQLQNDOWHP=XVWDQG
'UFNHQGHU7DVWH0(1HUVFKHLQHQIROJHQGH'DWHQLQ)ROJH VHLWHQVGHV%HQXW]HUVYRUGHP$Q]QGHQ
XQGNQQHQHLQJHVWHOOWZHUGHQ
7DJ0RQDW-DKU6WXQGH0LQXWHQ:RFKHQWDJ Pelletreserve-Anzeige
'HU6FKULIW]XJ6SHLFKHUQ"GHUPLWGHU0(17DVWH]XEH- 'LHIHQVLQGPLWHLQHUHOHNWURQLVFKHQ)XQNWLRQ]XU0HV-
VWWLJHQLVWHUPJOLFKWGLHEHUSUIXQJGHUHUIROJWHQ(LQJD- VXQJGHU3HOOHWPHQJHYHUVHKHQ'LH0HVVYRUULFKWXQJGLHLP
EHQYRUGHU%HVWWLJXQJ GDUDXIKLQHUVFKHLQWDXIGHP'LVSOD\ ,QQHUHQGHUHOHNWURQLVFKHQ6FKDOWNDUWHLQWHJULHUWLVWHUPJOLFKW
6SHLFKHUXQJ2.  GHP2IHQMHGHU]HLW]XEHUZDFKHQZLHYLHO6WXQGHQXQG
.LORVELV]XP9HUVLHJHQGHU3HOOHWODGXQJIHKOHQ
3URJUDPPLHUHUGHU(LQXQG$EVFKDOWVWXQGHQZKUHQG )UGHQRUGQXQJVJHPHQ%HWULHEGHV6\VWHPVLVWZLFKWLJ
GHU:RFKH GDVVZKUHQGGHVHUVWHQ$Q]QGHQV VHLWHQVGHV+QGOHUV IRO-
'XUFK6HNXQGHQODQJHV'UFNHQGHU7DVWH0(1GHU JHQGH3UR]HGXUEHIROJWZLUG9RUGHU$NWLYLHUXQJGHV6\VWHPV
)HUQEHGLHQXQJJHODQJWPDQ]XU(LQVWHOOXQJGHU8KUXQG PXVVHLQ6DFN3HOOHWLQGHQ%HKOWHUJHODGHQXQGELV]XP
GXUFK'UFNHQGHU7DVWH]XUZFKHQWOLFKHQ6WXQGHQSUR- 9HUVLHJHQGHVJHODGHQHQ3HOOHWYHUEUDXFKWZHUGHQ
JUDPPLHUXQJGLHDXIGHP'LVSOD\PLWGHP6FKULIW]XJ 'LHVGLHQWHLQHUNXU]HQ(LQODXISKDVHGHV/DGHV\VWHPV
3URJUDPP212))DQJH]HLJWZLUG'LH3URJUDPPLHUXQJ $QVFKOLHHQGNJ3HOOHWODGHQ
HUPJOLFKWHLQH$Q]DKOYRQWJOLFKHQ(LQXQG$EVFKDOWXQJHQ $QVFKOLHHQGHLQPDOGLH7DVWH5HVHUYHGUFNHQXPGDPLW
ELV]XGUHL DQDOOHQ7DJHQGHU:RFKH GHP6SHLFKHUPLW]XWHLOHQGDVVNJ3HOOHWJHODGHQZXUGHQ
1DFK%HVWWLJXQJPLWGHU7DVWH0(1HUVFKHLQWHLQHGHU $EGLHVHP$XJHQEOLFNHUVFKHLQWDXIGHP'LVSOD\GLHYHUEOLH-
IROJHQGHQ0JOLFKNHLWHQ EHQH3HOOHWPHQJHLQDEQHKPHQGHU$Q]HLJHLQQNJ 
1R3URJ NHLQ3URJUDPPHLQJHJHEHQ %HLMHGHP1DFKIOOHQLVWGLHJHODGHQH3HOOHWPHQJH]XVSHL-
7JO3URJU HLQHLQ]LJHV3URJUDPPIUDOOH7DJH FKHUQ%HVWHKWGLH/DGXQJDXVNJUHLFKWIUGDV6SHLFKHUQ
:FKWO3URJU (LQVWHOOXQJIUMHGHQHLQ]HOQHQ7DJ GLH%HWWLJXQJGHU7DVWH3HOOHWODGXQJEHLXQWHUVFKLHGOLFKHQ
0DQZHFKVHOWPLWGHQ7DVWHQYRQHLQHP]XPDQGHUHQ 0HQJHQRGHULP)DOOYRQ)HKOHUQNDQQGLH0HQJHPLWWHOVGHV
%HVWWLJWPDQPLWGHU7DVWH0(1GLH2SWLRQ7JO 3HOOHWUHVHUYH0HQVZLHIROJWDQJHJHEHQZHUGHQ
3URJUDPPHUKOWPDQ=XJULIIDXIGLH:DKOGHU$Q]DKOGHU 'XUFK'UFNHQGHU7DVWH0(1 6HNXQGHQODQJ ZLUG(,1-
DQHLQHP7DJDXV]XIKUHQGHQ3URJUDPPH (LQ$EVFKDOWXQ- 67(//81*(1DQJH]HLJW'XUFKPHKUPDOLJHV'UFNHQGHU
JHQ 9HUZHQGHWPDQ7JO3URJUZLUGGDVHLQJHJHEHQH 7DVWHRGHUZLUG5(6(59(DQJH]HLJW
3URJUDPPIUDOOH7DJHGHU:RFKHJOHLFKVHLQ'XUFKDXIHL- 'XUFK%HVWWLJXQJPLWGHU7DVWH0(1HUVFKHLQWGLHYRUKDQ-
QDQGHUIROJHQGHV'UFNHQYRQZHUGHQDQJH]HLJW GHQH3HOOHWPHQJHGLHGLHPDQOGW YRUHLQJHVWHOOWGDVPLW
1R3URJU NHLQH3URJUDPPH GHQ7DVWHQYHUQGHUWZHUGHQNDQQ 
- 108 -
*(%5$8&+6$1:(,681*(1
%HLP%HWWLJHQGHU7DVWHHUKKHLFKGLHHLQ]XJHEHQGHQ.J 5HJHOXQJGHU7HPSHUDWXUPLWH[WHUQHP7KHUPRVWDW
EHLP'UFNHQGHU7DVWHYHUULQJHUHLFKKLQJHJHQGHQ:HUW HVVWHKWHLQ]XU)HUQEHGLHQXQJDOWHUQDWLYHV7HPSHUDWXUVWHXHU-
EHLPZLHGHUKROWHQ%HWWLJHQGHU7DVWHHUUHLFKHLFKGLH%HOD- V\VWHP]XU9HUIJXQJHVLVWQPOLFKPJOLFKGHQVHULHOOHQ
GXQJ.J 5DXI'LVSOD\ ZDVHUPJOLFKWGLH5HVWODGXQJ]X 3RUWPLWGHP5DXPWKHUPRVWDWHQGHV+DXVHVRGHUPLWHLQHP
lschen. EHOLHELJHQOHLFKW]XHUZHUEHQGHQ]XYHUELQGHQ $XVJDQJPLW
9HUVLHJWGDV3HOOHWLP%HKOWHUEORFNLHUWGHU2IHQXQGHVZLUG VDXEHUHP.RQWDNW 
GHU6FKULIW]XJ)ODP$XV1RSHOOHWDQJH]HLJW VLHKH6HLWH 
1%$EXQG]XGDUDQGHQNHQGLH3HOOHW5HVHUYH$Q]HLJH 'HU2IHQHUNHQQWDXWRPDWLVFKGLH9HUELQGXQJGHVVHULHOOHQ
]XUFN]XVWHOOHQXPHLQHJUHUH=XYHUOVVLJNHLWGLHVHU 3RUWVPLWGHP7KHUPRVWDWHQXQGEHIROJWGDKHUIROJHQGH%HGLQ-
)XQNWLRQ]XJHZKUOHLVWHQ gungen:
6LFKIUMHGH.OUXQJPLWGHP+QGOHULQ9HUELQGXQJ %HLQLHGULJHUHU5DXPWHPSHUDWXUDOVGHU(LQVWHOOXQJGHV7KHU-
VHW]HQGHUGLHHUVWH$Q]QGXQJYRUJHQRPPHQKDW PRVWDWHQ JHVFKORVVHQHU.RQWDNW UHJHOWGHU2IHQJHZKQOLFK
+LHUEHLKDQGHOWHVVLFKXP5LFKWZHUWH*U|HUH3Ul]LVLRQZLUG GLH/HLVWXQJXPGLH6ROOZHUW7HPSHUDWXU]XYHUIROJHQ
erreicht, wenn vor jedem neuen Befllen regelmig auf null %HLYRP7KHUPRVWDWHQ RIIHQHU.RQWDNW HUUHLFKWHU
gesetzt wird. Edilkamin haftet in keiner Weise fr Abweichun- 5DXPWHPSHUDWXUVWHOOWVLFKGHU2IHQDXI6WDQGE\
JHQYRQGLHVHQ$QJDEHQ GLHVNDQQYRQlXHUHQ(LQVVHQ
abhngen).
7HPSHUDWXU
7HPSHUDWXUYRQ .HLQH5HJHOXQJ
5HJHOXQJGHU5DXPWHPSHUDWXU YRQH[WHUQHP
.RQJXULHUXQJ Fernbedienung ZHUNVVHLWLJH
Raumthermo-
HLQHNRPIRUWDEOHXQGHLQIDFKHVHULHQPLJLQGLHVHU3URGXNW geliefert Einstellung)
staten geliefert
%DXUHLKHYRUJHVHKHQH5HJHOXQJHUPJOLFKWGLH/HLVWXQJGHV
2IHQVHQWVSUHFKHQGGHU5DXPWHPSHUDWXU]XYHUZDOWHQ
1DFK$NWLYLHUXQJGHU)XQNWLRQ.OLPD.RPIRUWYRP0HQ 3DUDPHWHU.OL-
(,1 (,1 (,1
3DUDPHWHU EHLP+QGOHUDQIRUGHUQ NDQQEHVDJWH)XQNWLRQ PD.RPIRUW
GD]XYHUZHQGHWZHUGHQGHQ2IHQEHL(UUHLFKHQGHUHLQJHVWHOO-
WHQ7HPSHUDWXUDE]XVWHOOHQ'LHVH)XQNWLRQLVWPLWGHU(LQVWHO- 3DUDPHWHU,5
OXQJGHV2IHQVDXI$8720$7,.JHNRSSHOWGHU%HWULHELQ (,1 $86 (,1
621'(
+$1'%(75,(%EOHLEWLQMHGHP)DOOXQYHUQGHUW

'(876&+
1DFKGHUVHLWHQVGHV+QGOHUVHUIROJWHQ)UHLJDEHNDQQGLH $QVFKOXVVDQ -D
1(,1 1(,1
)XQNWLRQ.OLPD.RPIRUWYRP%HQXW]HU0HQDXVHLQE]Z den seriellen
NHLQ$QVFKOXVV
mit blauem
NHLQ$QVFKOXVV
DXVJHVFKDOWHWZHUGHQGLH7DVWH6(7GUFNHQGDV0HQ 3RUW VHULHOOHQ.DEHO
.OLPD.RPIRUWPLWGHQ7DVWHQVXFKHQGLHVHVPLWGHU
7DVWH6(7PDUNLHUHQPLWGHQ7DVWHQ(,1$86HLQJHEHQ
GLHJHZQVFKWH(LQVWHOOXQJEHLP9HUODVVHQPLWGHU7DVWH
speichern.

'HWDLOGHV%HWULHEVPLW.OLPD.RPIRUW(,1
LVWGHU2IHQDXI$8720$7,.HLQJHVWHOOWUHJHOWHUVHLQH
/HLVWXQJLQGHPHUGLHYRP%HQXW]HUYRUJHJHEHQH7HPSHUDWXU
YHUIROJWEHL(UUHLFKHQGHU5DXPWHPSHUDWXUVFKDOWHWGHU2IHQ
DEXPVLFKEHL$EVLQNHQGHU7HPSHUDWXUZLHGHUYRQVHOEVW
einzuschalten.
$XVZDKOGHU7HPSHUDWXU'XUFK'UFNHQGHU7DVWHQDXI
GHP%HGLHQIHOGRGHUGHU)HUQEHGLHQXQJLP%HWULHEVPRGXV
.OLPD.RPIRUWVWHOOWPDQDXIGHP'LVSOD\GLHJHZQVFKWH
Raumtemperatur ein. Es ergeben sich daher folgende Situatio-
nen:
%HLJHULQJHUHU5DXPWHPSHUDWXUDOVGLH9RUJDEHVSULQJWGHU
2IHQYRQDOOHLQHDQXQGUHJHOWGLH/HLVWXQJDXWRPDWLVFK
%HLHUUHLFKWHU5DXPWHPSHUDWXU q& VFKDOWHWGHU2IHQLQ
6WDQGE\'LH5DXPWHPSHUDWXUZLUGYRQGHUPLWJHOLHIHUWHQ
)HUQEHGLHQXQJEHUWUDJHQGHU6HQGHUGHU)HUQEHGLHQXQJPXVV
VLFKLQ6LFKWYHUELQGXQJPLWGHP(PSIQJHUGHV%HGLHQIHOGV
EHQGHQ ZLHEHLHLQHU)HUQVHK)HUQEHGLHQXQJ 
)UGHQ)DOOGDVVDXIJUXQGHLQHUQLFKWRUGQXQJVJHPHQ/DJH
GHU)HUQEHGLHQXQJGHU9HUVDQGGHUYRQGLHVHUJHPHVVHQHQ
7HPSHUDWXUQLFKWVWDWWQGHWHQWVFKHLGHWVLFKGHU2IHQYRQ
VHOEVW]XPEHUJDQJDXIGLH9HUZHQGXQJGHUDQ%RUGHLQJH-
EDXWHQ7HPSHUDWXUVRQGHGLHVVRODQJHELVGLH9HUELQGXQJPLW
der Fernbedienung wieder hergestellt ist.

- 109 -
*(%5$8&+6$1:(,681*(1
)(51%(',(181*$UW1U

/HJHQGHGHU7DVWHQXQGGHV'LVSOD\V
(LQE]Z$XVVFKDOWWDVWH
+ : 7DVWH]XU(UKKXQJGHU/HLVWXQJE]Z%HWULHEVWHPSHUDWXU LP,QQHUHQHLQHV0HQVHUKKWVLHGLHDQJH]HLJWH9HUQGHUOLFKH
- : 7DVWH]XU9HUULQJHUXQJGHU/HLVWXQJE]Z%HWULHEVWHPSHUDWXU LP,QQHUHQHLQHV0HQVYHUULQJHUWVLHGLHDQJH]HLJWH9HUQGHUOLFKH
A 7DVWHXP]XU3URJUDPPLHUXQJ($6<7,0(5]XZHFKVHOQ
M7DVWH]XPDEZHFKVHOQGHQ:HFKVHOYRQ$XWRPDWLN)XQNWLRQ]XPDQXHOOHU)XQNWLRQXQGXPJHNHKUW

=HLJWHLQH'DWHQEHUWUDJXQJYRQGHU)HUQEHGLHQXQJ]XU.DUWH
an.

7DVWDWXUJHVSHUUWXPXQHUZQVFKWH6FKDOWXQJHQ]XYHUKLQGHUQ
$XQG0JOHLFK]HLWLJHLQLJH6HNXQGHQODQJGUFNHQXP
GLH7DVWDWXU]XVSHUUHQE]ZIUHL]XJHEHQ
EDWHUDGHVFDUJDGD QqSLODVDOFDOLQDVPLQLVWLOR$$$

=HLJWGLH(LQJDEHHLQHU(LQE]Z$EVFKDOWXQJPLWGHP3UR-
JUDPP($6<7,0(5DQ

Zeigt die von der Fernbedienung gemessene Raumtemperatur an


ZKUHQGGHUWHFKQLVFKHQ.RQJXUDWLRQGHU)HUQEHGLHQXQJZHU-
GHQGLH:HUWHGHUHLQJHVWHOOWHQ3DUDPHWHUDQJH]HLJW

=HLJWGLHEHUWUDJXQJHLQHV(LQVFKDOWEHIHKOVGHV2IHQVDQ
'(876&+

$Q]HLJHGHU)HUQEHGLHQXQJV(LQVWHOOXQJIU:DUPOXIW3HOOHW
2IHQ

$XWRPDWLN)XQNWLRQ

)XQNWLRQ+DQGHLQVWHOOXQJ
DXIGHP'LVSOD\HUVFKHLQWGHU:HUWGHU%HWULHEVOHLVWXQJ

921'(5)(51%(',(181**(0(66(1(7(03(5$785
'LH)HUQEHGLHQXQJLVWPLWHLQHULQWHUQHQ6RQGHIUGLH0HVVXQJGHULQ(FKW]HLWDXIGHP'LVSOD\GHUVHOEHQDQJH]HLJWHQ
5DXPWHPSHUDWXUYHUVHKHQ'LHJHPHVVHQH7HPSHUDWXUZLUGUHJHOPLJDQGLH(OHNWURQLVFKHNDUWHGHV(LQVDW]HVE]Z2IHQVEHU-
WUDJHQIDOOVGLH6HQGHU/HGXQGGHU(PSIDQJVVHQVRUGHV%HGLHQIHOGVGHV(LQVDW]HVE]Z2IHQVVLFKMHZHLOVLP6LFKWIHOGEHQGHQ
(UUHLFKWGLH7HPSHUDWXUGHU)HUQEHGLHQXQJGLH.DUWHGHV(LQVDW]HVE]ZGHV2IHQVQLFKWLQQHUKDOEHLQHU'DXHUYRQ
0LQXWHQZLUGGHUYRQGHU6RQGHLP%HGLHQIHOGHUPLWWHOWH7HPSHUDWXUZHUWYHUZHQGHW

:$+/'(5%(75,(%6:(,6(
'XUFKHLQHQNXU]HQ'UXFNDXIGLH7DVWH0NQQHQZLUIROJHQGH)XQNWLRQHQGXUFKODXIHQXQGHLQVWHOOHQ
automatische Leistungsregelung

manuelle Leistungsregelung

- 110 -
*(%5$8&+6$1:(,681*(1
*(%5$8&+'(6352*5$006($6<7,0(5
EHUGLH)HUQEHGLHQXQJNDQQGLH8KU]HLWEHVRQGHUVLQWXLWLYXQGVFKQHOOSURJUDPPLHUWZHUGHQ
- Ist der Ofen eingeschaltet(VLVWPJOLFKHLQ$EVFKDOWHQPLWHLQHU]ZLVFKHQHLQHUXQG]ZOI6WXQGHQUHJHOEDUHQ(LQVWHOOXQJ
YRU]XQHKPHQ$XIGHP'LVSOD\GHV%HGLHQIHOGHVZLUGGLHELV]XUSURJUDPPLHUWHQ$EVFKDOWXQJYHUEOLHEHQH=HLWDQJH]HLJW
- Ist der Ofen ausgeschaltet: Es ist mglich, ein Einschalten mit einer zwischen einer und zwlf Stunden regelbaren Einstellung
YRU]XQHKPHQ$XIGHP'LVSOD\GHV%HGLHQIHOGHVZLUGGLHELV]XUSURJUDPPLHUWHQ(LQVFKDOWXQJYHUEOLHEHQH=HLWDQJH]HLJW

- Einstellung: )UGLH(LQVWHOOXQJGHV7LPHUVZLHIROJWYRUJHKHQ
D 'LH7DVWH$GUFNHQDXIGHP'LVSOD\OHXFKWHWGDV6\PERO ]XU%HVWWLJXQJGHV=XJDQJV]XU
3URJUDPPLHUXQJ(DV\WLPHUDXI
E 0LWGHQ7DVWHQGLHJHZQVFKWH6WXQGHQ]DKOHLQJHEHQ]%

F 'LH)HUQEHGLHQXQJDXIGHQ(PSIQJHULP%HGLHQIHOGULFKWHQ
G )UHLQLJH6HNXQGHQGLH7DVWH$GUFNHQXPGLH3URJUDPPLHUXQJ]XEHVWWLJHQGDV,FRQ schaltet sich aus, auf dem
%HGLHQIHOGZLUGGLHIUGHQSURJUDPPLHUWHQ(LQJULIIYHUEOLHEHQH=HLWDQJH]HLJW

H )UGDV5FNJQJLJPDFKHQGHU3URJUDPPLHUXQJGLH3XQNWHD E F G ZLHGHUKROHQZREHLGLH6WXQGHQ]DKODXI
+HLQJHVWHOOWZLUG

TASTATUR-SPERRE
(VLVWPJOLFKGLH7DVWDWXUGHU)HUQEHGLHQXQJ]XVSHUUHQXP]XIOOLJHYRP%HQXW]HUXQHUZQVFKWH6FKDOWXQJHQ]XYHUKLQGHUQ
'XUFKJOHLFK]HLWLJHV'UFNHQGHU7DVWHQ$XQG0OHXFKWHWGDV6\PEROGHV6FKOVVHOV]XU%HVWWLJXQJGHUHUIROJWHQ
6SHUUHGHU7DVWDWXUDXI8PGLH7DVWDWXUHUQHXWIUHL]XJHEHQHUQHXWGLH7DVWHQ$XQG0JOHLFK]HLWLJGUFNHQ

'(876&+
$1=(,*(9(5%5$8&+7(5%$77(5,(1
'DV$XHXFKWHQGHV6\PEROVGHU%DWWHULH]HLJWDQGDVVGLH%DWWHULHQLP,QQHUHQGHU)HUQEHGLHQXQJIDVWYHUEUDXFKW
VLQGGHUHQ$XVWDXVFKPLWGUHL%DWWHULHQGHVJOHLFKHQ7\SV *UH$$$9 YRUQHKPHQ
,QGHU)HUQEHGLHQXQJQLFKWQHXH%DWWHULHQPLWWHLOZHLVHYHUEUDXFKWHQPLVFKHQ
1LFKWYHUVFKLHGHQH0DUNHQXQG7\SHQPLVFKHQGDMHGH0DUNHXQGMHGHU7\SXQWHUVFKLHGOLFKH.DSD]LWWHQDXIZHLVW
1LFKWKHUNPPOLFKHPLWZLHGHUDXDGEDUHQ%DWWHULHQPLVFKHQ
1LFKWYHUVXFKHQ$ONDOLXQG=LQN.RKOH%DWWHULHQDXI]XODGHQGDVLFK=HUVWUXQJHQXQG)OVVLJNHLWVDXVWULWWHHUHLJQHQ
NQQWHQ

%(187=(5+,1:(,6
*HP$UWGHU9HURUGQXQJ1UYRP-XOL'XUFKIKUXQJGHU5LFKWOLQLHQ(*XQG(*
EH]JOLFKGHU(LQGPPXQJGHV*HEUDXFKVYRQJHIKUOLFKHQ6WRIIHQLQ(OHNWURXQG(OHNWURQLN*HUWHQVRZLHEH]JOLFKGHU
$EIDOOHQWVRUJXQJ'DV6\PEROGHUGXUFKNUHX]WHQ0OOWRQQHDXIGHP*HUWRGHUDXIGHU9HUSDFNXQJ]HLJWDQGDVVGDV(U-
]HXJQLVQDFKGHVVHQ1XW]XQJVGDXHUJHWUHQQWYRQDQGHUHP$EIDOO]XHQWVRUJHQLVW'HU%HQXW]HUKDWGDKHUGDV*HUWEHLGHVVHQ
/HEHQVHQGHDQGLH]XVWQGLJHQ6DPPHOVWHOOHQGHUJHWUHQQWHQ0OODEIXKUGHV(OHNWURXQG(OHNWURQLN$EIDOOVRGHUGHP+QGOHU
]XP=HLWSXQNWGHV(UZHUEVHLQHVQHXHQ*HUWVJOHLFKHU$UWLP9HUKOWQLVYRQHLQV]XHLQV]XEHUJHEHQ
- 111 -
:$5781*
$QWHVGHUHDOL9RUGHU9RUQDKPHMHJOLFKHU:DUWXQJVDUEHLWHQGHQ2IHQYRQGHU1HW]YHUVRUJXQJWUHQQHQ

(LQHUHJHOPLJH:DUWXQJLVWIUGHQJXWHQ%HWULHEGHV2IHQVJUXQGOHJHQG
',(]XPLQGHVW-$+5(6=(,7/,&+(0$1*(/1'(:$5781*NDQQVFKOHFKWHQ%HWULHEYHUXUVDFKHQ
(YHQWXHOOHGXUFKGLHPDQJHOQGH:DUWXQJYHUXUVDFKWH3UREOHPHEHZLUNHQGHQ9HUIDOOGHU*DUDQWLH

+,1:(,6$OOHNJHUVFKHLQWGLH6FKULIW5HLQLJXQ.XQGHXPDQGLH5HLQLJXQJGHU5DXFKDE]JHVHLWHQVGHV
%HVLW]HUV]XHULQQHUQGLH0HOGXQJHUOLVFKWGXUFK6HNXQGHQODQJHV'UFNHQGHU7DVWH785%2
%HL(UUHLFKHQYRQNJ3HOOHWHUVFKHLQWGLH6FKULIW:DUWXQJ+GOHUGLHQLFKWPHKUHUOLVFKWHVLVWGDKHUGDV
(LQVFKUHLWHQGHV+QGOHUVHUIRUGHUOLFK'LHVH0HOGXQJZLUGEHUGDV0HQ3DUDPHWHU]XUFNJHVHW]W

+,1:(,6
-HGHQLFKWEHIXJWH9HUlQGHUXQJLVWXQWHUVDJW
- Stets nur vom Hersteller empfohlene Ersatzteile verwenden
'HU(LQVDW]YRQQLFKWRULJLQDOHQ(UVDW]WHLOHQKDWGHQ9HUIDOOGHU*DUDQWLH]XU)ROJH

7*/,&+(:$5781*
%HLDEJHVWHOOWHPNDOWHPXQGYRP1HW]JHWUHQQWHQ2IHQDXV]XIKUHQGH$UEHLWHQ
'LH5HLQLJXQJPXVVPLWKLOIHHLQHV6WDXEVDXJHUVHUIROJHQ DXI:XQVFKHUKOWOLFK6HLWH 
'HUJDQ]H9RUJDQJHUIRUGHUWQXUZHQLJH0LQXWHQDP7DJ
7UIIQHQXQGGLH$VFKHQODGHKHUDXVQHKPHQXQGOHHUHQ $EE%  
',(5&.671'(1,&+7,1'(13(//(7%(+/7(5=85&.:(5)(1
'HQ7LHJHOHQWIHUQHQXQGPLWGHP0HWDOOVSDFKWHOHQWNUXVWHQHWZDLJH9HUVWRSIXQJHQGHUIIQXQJHQDXIDOOHQ6HLWHQUHLQLJHQ
'HQ%UHQQWLHJHO   $EE& KHUDXVQHKPHQXQGPLWGHU6SDFKWHOHQWNUXVWHQHWZDLJH9HUVWRSIXQJHQGHU6FKOLW]HVXEHUQ
'HQ%UHQQWLHJHOUDXPVDXJHQGLH.RQWDNWFKHQVXEHUQ
)DOOVHUIRUGHUOLFKGLH6FKHLEHUHLQLJHQ LQNDOWHP=XVWDQG

1LHPDOVKHLH$VFKHDXIVDXJHQGLHVJHIKUGHWGHQ6WDXEVDXJHUXQGEULQJWGLHKXVOLFKHQ5XPHLQUDQGJHIDKU
'(876&+

**
$EE% $EE&
:&+(17/,&+(:$5781*
5HLQLJXQJGHV%UHQQUDXPV PLW5HLQLJXQJVEUVWH QDFK(QWIHUQXQJGHU5DXFKJDVOHLWEOHFKH J'( 
'LH%UVWHQEHWWLJHQ $EE( 
OHHUHQ6LHGHQ3HOOHW%HKOWHUXQGGHQ*UXQGQLFKW
:KUHQGGHU5HLQLJXQJGHV%UHQQWLHJHOVGLH5DXFKVWSVHO J) DEQHKPHQXQGGLHGDUXQWHUOLHJHQGHQYLHU5RKUH J
F) aussaugen.

 


* 2
2
$EE' $EE( $EE)
- 112 -
:$5781*
-$+5(6=(,7/,&+(:$5781* 6(,7(16'(6+1'/(56
%HVWHKWLQ
$OOJHPHLQH,QQHQXQG$XHQUHLQLJXQJ
6RUJIlOWLJH5HLQLJXQJGHU:lUPHWDXVFKURKUHKLQWHUGHP+HLOXIWJLWWHUREHQDQGHU2IHQIURQW
6RUJIOWLJH5HLQLJXQJXQG(QWNUXVWHQGHV7LHJHOVXQGGHV7LHJHOUDXPV
5HLQLJXQJGHU9HQWLODWRUHQ0HFKDQLVFKH.RQWUROOHGHV6SLHOVXQGGHU%HIHVWLJXQJHQ
5HLQLJXQJGHV5DXFKNDQDOV $XVWDXVFKGHU'LFKWXQJGHV5DXFKDE]XJURKUV
5HLQLJXQJGHV5DXPVGHV5DXFKDE]XJYHQWLODWRUV
5HLQLJXQJGHV5DXPVGHV)OXVVVHQVRUV
5HLQLJXQJGHV5DXPV.RQWUROOHGHV7KHUPRHOHPHQWV
5HLQLJXQJ,QVSHNWLRQXQG(QWNUXVWHQGHV5DXPVGHV=QGZLGHUVWDQGVHYHQWXHOOHU$XVWDXVFKGHVVHOEHQ
5HLQLJXQJ3UIXQJGHV%HGLHQIHOGV
6LFKWSUIXQJGHU(OHNWURNDEHOGHU$QVFKOVVHXQGGHV9HUVRUJXQJVNDEHOV
5HLQLJXQJGHV3HOOHWEHKOWHUVXQGEHUSUIXQJGHV6SLHOVGHU(LQKHLW)UGHUVFKQHFNH*HWULHEHPRWRU
$XVWDXVFKGHU7UGLFKWXQJ
%HWULHEVDEQDKPH%HIOOXQJGHU)UGHUVFKQHFNH$Q]QGHQPLQWLJHU%HWULHEXQG$EVFKDOWHQ

:LUGGHU2IHQKXJEHQXW]WZLUGGLH5HLQLJXQJGHV5DXFKDE]XJVDOOH0RQDWHDQHPSIRKOHQ

ACHTUNG!!!
1DFKGHUJHZKQOLFKHQ5HLQLJXQJNDQQGDV1,&+725'181*6*(066($XIVHW]HQGHVREHUHQ%UHQQWLHJHOV $ DXI
GHQXQWHUHQ%UHQQWLHJHO % GHQ%HWULHEGHV2IHQVEHHLQWUFKWLJHQ $EE 
%HYRUGHU+HL]RIHQLQ%HWULHEJHQRPPHQZLUGVLFKHUVWHOOHQGDVVGLH%UHQQWLHJHONRUUHNWDQJHVFKORVVHQVLQGZLHLQ $EE
 JH]HLJWXQGGDVVVLFKNHLQH$VFKHRGHU9HUEUHQQXQJVUFNVWQGHDXIGHQ5QGHUQEHQGHQ

'(876&+
A

$EE $EE

- 113 -
MGLICHE PROBLEME
,P)DOOYRQ6WUXQJHQKOWGHU2IHQDXWRPDWLVFKDQLQGHPHUGHQ$EVWHOOYRUJDQJDXVIKUWXQGDXIGHP'LVSOD\
ZLUGGHU*UXQGIUGLH6WUXQJDQJH]HLJW VLHKH0HOGXQJHQZHLWHUXQWHQ 

:KUHQGGHU3KDVHZHJHQ$XVIDOOVQLHPDOVGHQ1HW]VWHFNHU]LHKHQ

)UGHQ)DOOGHVHUIROJWHQ$XVIDOOVLVWIUGHQHUQHXWH6WDUWGHV2IHQHUIRUGHUOLFKGDVVGLH
$EVFKDOWSUR]HGXU 6HNXQGHQPLW7RQ]HLFKHQ DEJHZDUWHWZLUGXQGDQVFKOLHHQGGLH7DVWH GUFNHQ

2IHQQLFKWHUQHXWDQVWHOOHQEHYRUQLFKWGHU*UXQGIUGHQ$XVIDOOIHVWJHVWHOOWXQGGHU%UHQQWLHJHO*(5(,1,*781'
GELEERT wurde.

0(/'81*(1(7:$,*(5$86)$//856$&+(181'+,1:(,6(81'$%+,/)(1
 $Q]HLJH3UREOHP/XIWVHQ JUHLIWHLQZHQQGHU)OXVVVHQVRUHLQHQXQ]XUHLFKHQGHQ)OXVVGHU9HUEUHQQXQJVOXIWIHVWVWHOOW 
6WUXQJ(UOVFKHQZHJHQ8QWHUGUXFNPDQJHO
'LH9HUEUHQQXQJVOXIW]XIXKUNDQQ]XJHULQJVHLQZHQQGLH2IHQWUJHIIQHWLVWRGHUQLFKWJXWVFKOLHW ]%
  EHLVFKDGKDIWHU'LFKWXQJ ZHQQHV3UREOHPHPLWGHP/XIWHLQODVVRGHUPLWGHP5DXFKDXVVWRJLEWRGHUZHQQ
  GHU%UHQQNDPPHUHLQVDW]YHUVWRSIWLVW
0DQDKPHQ.RQWUROOLHUHQ
  6FKOLHXQJGHU2IHQWU
  (LQODVVNDQDOIUGLH9HUEUHQQXQJVOXIW UHLQLJHQGDEHLDXIGLH/XIWVWURPVHQVRUHQ$FKWJHEHQ 
  GHQ/XIWVWURPVHQVRUPLWHQWIHXFKWHWHU/XIW ZLHHWZDIU3&7DVWDWXUHQ UHLQLJHQ
  $XIVWHOOSRVLWLRQGHV+HL]RIHQVGDUIVLFKQLFKWDQGHU:DQGEHQGHQ
  3RVLWLRQXQG5HLQLJXQJGHV%UHQQNDPPHUHLQVDW]HV +XJNHLWKQJWYRP3HOOHW7\SDE 
  5DXFKNDQDO UHLQLJHQ 
  ,QVWDOODWLRQ 5DXFKDE]XJLVWXQ]XOVVLJZHQQHUPHKUDOVGUHL.UPPXQJHQDXIZHLVW 
  %HL9HUGDFKWDXIHLQH)XQNWLRQVVWUXQJGHV0HVVIKOHUVLVWHLQ.DOW7HVWGXUFK]XIKUHQ:HQQVLFKEHL 
  9HUQGHUXQJGHU(LQVDW]EHGLQJXQJHQEHLVSLHOVZHLVHEHLIIQXQJGHU2IHQWUGHU$Q]HLJHZHUWQLFKWQGHUW
  OLHJWGDV3UREOHPEHLP0HVVIKOHU

N.B.: (LQ8QWHUGUXFN$ODUPNDQQDXFKZKUHQGGHU=QGSKDVHDXIWUHWHQGDGHU/XIWVWURPVHQVRU6HNXQGHQQDFK
  GHP6WDUWGHV=QGYRUJDQJV]XPHVVHQEHJLQQW

 $Q]HLJH3UREOHP$EJDVJHE JUHLIWHLQZHQQGHU8PGUHKXQJVVHQVRUGHV5DXFKDE]XJVHLQH6WUXQJIHVWVWHOOW 
'(876&+

6WUXQJ$XVVFKDOWXQJEHL)HVWVWHOOXQJHLQHU'UHK]DKVWUXQJGHV5DXFKDE]XJV
0DQDKPHQ'HQ%HWULHEGHV5DXFKDE]XJVPRWRUVEHUSUIHQ 9HUELQGXQJ]XP8PGUHKXQJVVHQVRU XQG6WHFNNDUWH
   +QGOHU 
6DXEHUNHLWGHV5DXFKDE]XJVEHUSUIHQ
'LH(OHNWURDQODJHXQGGLH(UGXQJEHUSUIHQ
.RQWUROOH6FKDOWSODQ +QGOHU 

 $Q]HLJH)ODP$XV1R3HOOHW JUHLIWHLQZHQQGDV7KHUPRHOHPHQWHLQH
6WUXQJ(UOVFKHQZHJHQ7HPSHUDWXUVWXU]GHU5DXFKJDVH
JHULQJHUHDOVGLHHLQJHJHEHQH5DXFKJDVWHPSHUDWXUIHVWVWHOOWZHLOHVGLHVDOVPDQJHOQGHV9RUOLHJHQHLQHU
Flamme auslegt).
0DQDKPHQ3HOOHWIHKOW
  ]XYLHO3HOOHWGLH)ODPPHHUVWLFNWKDW
  GHU+FKVWWHPSHUDWXU7KHUPRVWDWHLQJHVFKULWWHQLVW VHKUVHOWHQJUHLIWQXUEHL]XKRKHU  
  5DXFKJDVWHPSHUDWXUHLQ  +QGOHU 

 $Q]HLJH6SHUUH1R=QG VFKUHLWHWHLQZHQQLQHLQHU+FKVW]HLWYRQ0LQXWHQNHLQH)ODPPH
(VVLQG]ZHL)OOH]XXQWHUVFKHLGHQ
6WUXQJ$EVFKDOWHQZHJHQQLFKWRUGQXQJVJHPHU5DXFKJDVWHPSHUDWXULQGHU=QGXQJVSKDVH
(VVLQG]ZHL)OOH]XXQWHUVFKHLGHQ
.(,1()ODPPHHUVFKLHQHQ
0DQDKPHQEHUSUIHQ
  3RVLWLRQXQG9HUVFKPXW]XQJVJUDGGHV%UHQQNDPPHUHLQVDW]HV
  9HUEUHQQXQJVOXIWJHODQJWELV]XP%UHQQNDPPHUHLQVDW]" +QGOHU 
  )XQNWLRQVWFKWLJNHLWGHV+HL]ZLGHUVWDQGV
  5DXPWHPSHUDWXU EHLZHQLJHUDOVq&LVW(VELWHUIRUGHUOLFK XQG/XIWIHXFKWH)HXHUYHUVXFKVZHLVHPLW
  (VELWZUIHOHQW]QGHQ 6HLWH 

  )ODPPHLVWHUVFKLHQHQDEHUQDFKGHU0HOGXQJ$UHUVFKHLQWGLH$QJDEH$)
0DQDKPHQEHUSUIHQ QXUIU+QGOHU
  )XQNWLRQVWFKWLJNHLWGHV7HPSHUDWXUIKOHUV
  XQWHUGHQ%HWULHEVSDUDPHWHUQHLQJHJHEHQH6WDUWWHPSHUDWXU
  'DV.RKOHQEHFNHQOHHUHQXQGGLH=QGXQJZLHGHUKROHQ

 $Q]HLJH6WURPDXVIDOO GLHVLVWNHLQ)HKOHUGHV2IHQ 
6WUXQJ$EVFKDOWHQZHJHQIHKOHQGHQ6WURPV
0DQDKPHQ6WURPDQVFKOXVVXQG6SDQQXQJVVFKZDQNXQJHQEHUSUIHQ
- 114 -
MGLICHE PROBLEME
 $Q]HLJH)%GHIHNW)XQNVW JUHLIWHLQZHQQGDV7KHUPRHOHPHQWDXVJHIDOOHQRGHUQLFKWDQJHVFKORVVHQLVW 
6WUXQJ$EVFKDOWHQZHJHQDXVJHIDOOHQHPRGHUQLFKWDQJHVFKORVVHQHP7KHUPRHOHPHQW
0DQDKPHQ3HOOHWW\SEHUSUIHQ
  6WUXQJ5DXFKDE]XJVPRWRUEHUSUIHQ
  'HQ5DXFKNDQDODXIPJOLFKH9HUVWRSIXQJHQEHUSUIHQ
  'LHRUGQXQJVJHPH,QVWDOODWLRQEHUSUIHQ
  'DVHYHQWXHOOH$EWULIWHQGHV*HWULHEHPRWRUVEHUSUIHQ
  'DV9RUKDQGHQVHLQHLQHV/XIWHLQODVVHVLP5DXPEHUSUIHQ

 $Q]HLJH]XKRKH$EJDVW $EVFKDOWXQJZHJHQ]XKRKHU5DXFKWHPSHUDWXU
6WUXQJ$EVFKDOWHQZHJHQ]XKRKHU5DXFKJDVWHPSHUDWXU
EHUSUIHQ QXUIU+QGOHU 3HOOHWW\S6WUXQJGHV5DXFKDE]XJV
YHUVWRSIWHU5DXFKNDQDOQLFKWRUGQXQJVJHPH,QVWDOODWLRQ'ULIWGHV*HWULHEHPRWRUV

8) $Q]HLJH$/$5067520=8+2&+6SULQJWDQZHQQGDV8QWHUVHW]XQJVJHWULHEHXQJHZ|KQOLFKYLHO6WURPDEVRU-
biert.
0DQDKPHQ)XQNWLRQVWHVW 6HUYLFHFHQWHU 8QWHUVHW]XQJVJHWULHEH(OHNWURDQVFKOVVHXQG/HLWHUSODWWH
9) $Q]HLJH$/$5067520=81,('5,*6SULQJWDQZHQQGDV8QWHUVHW]XQJVJHWULHEHXQJHZ|KQOLFKZHQLJ6WURP
absorbiert.
0DQDKPHQ)XQNWLRQVWHVW 6HUYLFHFHQWHU 8QWHUVHW]XQJVJHWULHEH'UXFNZlFKWHU%HKlOWHUWKHUPRVWDW(OHNWURDQVFKOV-
se und Leiterplatte

 $Q]HLJH%DWWHULHOHHU3UI
6WUXQJ'DV6LJQDOOHXFKWHWDXIREZRKOGHV2IHQZHLWHUIXQNWLRQLHUW
0DQDKPHQ'LH1RWVWURPEDWWHULHGHU3ODWWHPXVVHUVHW]WZHUGHQ +QGOHU Es wird darauf hingewiesen, dass es sich
um ein Verschleiteil handelt, das nicht durch die Garantie abgedeckt ist.

 6WUXQJ)XQNVWHXHUXQJIXQNWLRQLHUWQLFKW
0DQDKPHQ1KHUDQGHQ(PSIQJHUGHV2IHQ
'LH$ONDOL%DWWHULHQHUVHW]HQ

12) Anzeige:$XVWUHWHQGH/XIWLVWQLFKWZDUP

'(876&+
0DQDKPHQ'HQ:UPHWDXVFKHUYRP,QQHUHQGHV)HXHUUDXPVDXVUHLQLJHQ

 Anzeige::KUHQGGHU=QGSKDVHJUHLIWGHU'LIIHUHQWLDOVFKDOWHUHLQ +QGOHU
0DQDKPHQ )HXFKWLJNHLWGHV=QGZLGHUVWDQGVEHUSUIHQ

 Anzeige:0DQJHOQGH=QGXQJ
0DQDKPHQ 7LHJHOUHLQLJHQ

$10(5.81*
'LH0HOGXQJHQEOHLEHQVRODQJHDQJH]HLJWELVPDQDXIGHP%HGLHQIHOGGLH7DVWHGUFNW
(VZLUGHPSIRKOHQGHQ2IHQQLFKWQHX]XVWDUWHQEHYRUQLFKWGDV3UREOHPEHKREHQZXUGH

HINWEIS:
'LH6FKRUQVWHLQHXQG5DXFKDE]JHDQGLHGLH*HUWHDQJHVFKORVVHQVLQGGLHIHVWH%UHQQVWRIIHYHUZHQGHQPVVHQ
HLQPDOLP-DKUJHUHLQLJWZHUGHQ EHUSUIHQRELP(LQVDW]ODQGGHV*HUWVHLQHGLHVEH]JOLFKH9RUVFKULIWEHVWHKW 
In Ermangelung regelmiger Kontrollen und Reinigung erhht sich die Mglichkeit eines Schornsteinbrandes.
WICHTIG!!!
)DOOVHLQ%UDQGLP2IHQLP5DXFKJDVNDQDORGHULP6FKRUQVWHLQ]XEHIUFKWHQLVWIROJHQGHUPDHQYRUJHKHQ
- Stromversorgung trennen
- Einschreiten mit einem CO2 Lschgert
)HXHUZHKUUXIHQ
KEINE LSCHVERSUCHE MIT WASSER UNTERNEHMEN!
$QVFKOLHHQGGDV*HUWYRQHLQHPYHUWUDJOLFKHQ.XQGHQVHUYLFH]HQWUXP &$7 XQGGHQ.DPLQYRQHLQHP)DFKWHFKQLNHU
berprfen lassen.

- 115 -
&+(&./,67(
0LWGHPYROOVWQGLJHQ/HVHQGHUWHFKQLVFKHQ%HVFKUHLEXQJ]XHUJQ]HQ

(LQEDXXQG,QEHWULHEQDKPH
,QEHWULHEQDKPHGXUFKHLQ]XJHODVVHQHV6HUYLFHFHQWHUGDVGLH*DUDQWLHDXVJHVWHOOWKDW
%HOIWXQJGHV5DXPV
'HU5DXFKNDQDOE]Z6FKRUQVWHLQHPSIQJWQXUGHQ$E]XJGHV2IHQV
'HU5DXFKDE]XJZHLVWDXIKFKVWHQV.XUYHQ
  KFKVWHQV0HWHULQGHU:DDJHUHFKWHQ
6FKRUQVWHLQDEVFKOXVVEHUGHP5FNVWURPEHUHLFK
'LH$E]XJVURKUHVLQGDXVJHHLJQHWHP0DWHULDO URVWIUHLHU6WDKOHPSIRKOHQ
%HLGHU'XUFKTXHUXQJYRQPJOLFKHPEUHQQEDUHQ0DWHULDO ]%+RO] ZXUGHQDOOH%UDQGYHUKWXQJVPDQDKPHQJHWURIIHQ

Gebrauch
'DVYHUZHQGHWH3HOOHWLVWYRQJXWHU4XDOLWWXQGQLFKWIHXFKW )HXFKWLJNHLWPD[
'HU7LHJHOXQGGHU$VFKHQUDXPVLQGVDXEHU
'LH5HLQLJXQJGHU6FKHLEHPXVVLPPHULQNDOWHP=XVWDQGHUIROJHQ
'LH7UPXVVJXWYHUVFKORVVHQVHLQ
'HU7LHJHOPXVVJXWLQVHLQHQ6LW]HLQJHVHW]WVHLQ

'$5$1'(1.(1'(17,(*(/925-('(0$1=1'(1=86$8*(1
,P)DOOYRQJHVFKHLWHUWHU=QGXQJYRUGHPHUQHXWHQ6WDUWGHQ7LHJHOOHHUHQ

$8):816&+(5+/7/,&+(6=8%(+5
'(876&+

7(/()21:+/(5)5)(51=1'81* $UW1U 
(VLVWPJOLFKGLH)HUQ]QGXQJ]XHUKDOWHQLQGHPHLQ7HOHIRQZKOHUPLWWHOVGHVDXI:XQVFKHUKOWOLFKHQ.DEHOV $UW1U 
DPVHULHOOHQ3RUWDXIGHU5FNVHLWHGHV2IHQVGXUFKGHQ+QGOHUDQJHVFKORVVHQZLUG

.,7IUGLH.DQDOLVLHUXQJGHU:DUPOXIWLQHLQHQEHQDFKEDUWHQ5DXPPLWHLQHU/QJHGHV.DQDOLVLHUXQJVURKUVYRQPD[
P $UW1U 

.,7%,6IUGLH.DQDOLVLHUXQJGHU:DUPOXIWLQHLQHQEHQDFKEDUWHQ5DXPPLWHLQHU/QJHGHV.DQDOLVLHUXQJVURKUVYRQ
PD[P $UW1U 

REINIGUNGS-ZUBEHR
*ODVV.DPLQ (LPHU GHV $VFKHQ-
$UW1U VDXJHUVRKQH0RWRU
$UW1U
)UGLH5HLQLJXQJ
GHU.HUDPLNVFKHLEH )UGLH5HLQLJXQJ
GHV%UHQQUDXPV

- 116 -
Geachte Meneer/Mevrouw,
:HGDQNHQXGDWXYRRURQVSURGXFWJHNR]HQKHHIWHQZHIHOLFLWHUHQXPHWXZDDQNRRS
We raden u aan om dit blad aandachtig door te lezen alvorens u van dit product gebruik maakt, teneinde de prestaties ervan opti-
maal en veilig te kunnen benutten.

9RRURYHULJHLQIRUPDWLHRIKXOSNXQWX]LFKZHQGHQWRWXZ'($/(56ZDDUXXZSURGXFWJHNRFKWKHHIWRINXQWXRQ]HZHEVLWH
ZZZHGLONDPLQFRPEH]RHNHQRQGHUKHWNRSMH'($/(56

OPMERKING
9HU]HNHUXHUYDQQDGDWXGHNDFKHOXLWJHSDNWKHHIWGDWKLMLQWHJHUHQFRPSOHHWLVLQKRXG EHNOHGLQJDIVWDQGVEHGLHQLQJ
met display, koude handgreep om deur te openenJDUDQWLHEHZLMVKDQGVFKRHQ&'WHFKQLVFKEODGVSDWHOYRFKWRSQHPHQG]RXW
inbussleutel).

:HQGXLQKHWJHYDOYDQVWRULQJHQRQPLGGHOOLMNWRWGHYHUNRSHUZDDUXXZSURGXFWJHNRFKWKHHIWHQQHHPHHQNRSLHYDQKHWJDUDQ-
WLHEHZLMVHQKHWDDQNRRSEHZLMVPHH

,QEHGULMIVWHOOLQJNHXULQJ
'H]HKDQGHOLQJPRHWDEVROXXWXLWJHYRHUGZRUGHQGRRUGHGHDOHURSVWUDIIHYDQGHYHUOLHVYDQKHWUHFKWRSJDUDQWLH'HLQEHGULMI-
stelling beschreven in de Italiaanse norm UNI 10683/2012 bestaat uit een reeks controles nadat de kachel genstalleerd is van de
LQERXZNDFKHOXLWJHYRHUGPRHWHQZRUGHQHQGLHGHFRUUHFWHIXQFWLRQHULQJYDQKHWV\VWHHPHQGHRYHUHHQVWHPPLQJHUYDQPHWGH
wetgeving vaststellen.

GHIDEULNDQWDFKW]LFKQLHWYHUDQWZRRUGHOLMNYRRUVFKDGHYHURRU]DDNWGRRUJHEUXLNLQKHWJHYDOYDQYHUNHHUGHLQVWDOODWLHV
RQMXLVWRQGHUKRXGHQHHQYHUNHHUGJHEUXLNYDQKHWSURGXFW

KHWFRQWUROHQXPPHUYRRUGHLGHQWLFDWLHYDQGHNDFKHOWUHIWX
- aan de bovenkant van de verpakking
LQKHWJDUDQWLHEHZLMVLQGHYXXUKDDUG
RSKHWSODDWMHDDQGHDFKWHUNDQWYDQKHWDSSDUDDW
'H]HGRFXPHQWHQPRHWHQEHZDDUGZRUGHQPHWKHWDDQNRRSEHZLMVZDDUYDQXGHJHJHYHQVPRHWGRRUJHYHQRSKHWPRPHQWGDWX
LQIRUPDWLHDDQYUDDJWRILQKHWJHYDOYDQRQGHUKRXG

GHZHHUJHJHYHQGHWDLOV]LMQJUDVFKHQJHRPHWULVFKLQGLFDWLHI

CONFORMITEITSVERKLARING 1('(5/$1'6
(',/.$0,16S$0HWOHJDDONDQWRRUWH9LD9LQFHQ]R0RQWL0LODDQ62),1XPPHU%7:QXPPHU

9HUNODDUWYRRUHLJHQYHUDQWZRRUGHOLMNYHUDQWZRRUGHOMNKHLG
'DWGHNDFKHORSKRXWHQSHOOHWGLHKLHURQGHUEHVFKUHYHQVWDDWFRQIRUPGH5LFKWOLMQ((* %RXZSURGXFWHQ LV
KACHEL MET PELLET met het commercile merk EDILKAMIN, genaamd FANTASY - FATA - SIRENA - STORY

6(5,(1800(55HI*HJHYHQVSODDWMH%28:-$$55HI*HJHYHQVSODDWMH

'HFRQIRUPLWHLWPHWGHYHUHLVWHQYDQGH5LFKWOLMQ((*ZRUGWWHYHQVEHSDDOGGRRUGHFRQIRUPLWHLWPHWGH(XURSHVHQRUP
(1

9HUNODDUWWHYHQVGDW
'HNDFKHOPHWKRXWHQSHOOHWV)$17$6<)$7$6,5(1$6725<GHYHUHLVWHQYDQGH(XURSHVHULFKWOLMQHQUHVSHFWHHUW
(*/DDJVSDQQLQJVULFKWOLMQ
(*5LFKWOLMQ(OHNWURPDJQHWLVFKH&RPSDWLELOLWHLW

(',/.$0,16SDZLMVWHONHYHUDQWZRRUGHOLMNKHLGYRRUGHVOHFKWHIXQFWLRQHULQJYDQKHWDSSDUDDWDOVJHYROJYDQGHYHUYDQJLQJ
PRQWDJHHQRIZLM]LJLQJHQGLHQLHWGRRU(',/.$0,1SHUVRQHHO]RQGHUGHWRHVWHPPLQJKLHUYDQXLWJHYRHUG]LMQ
- 117 -
FUNCTIONERINGSPRINCIPE 9(,/,*+(,'6,1)250$7,(
'HNDFKHOVYHUZDUPHQOXFKWPHWEHKXOSYDQKRXWSHOOHWV'H 'HNDFKHOLVRQWZRUSHQYRRUKHWYHUZDUPHQYDQGHLQVWDOODWLH-
YHUEUDQGLQJKLHUYDQZRUGWRSHOHNWURQLVFKHZLM]HDDQJHVWXXUG ruimte door middel van de automatische verbranding van pel-
+LHURQGHUZRUGWGHIXQFWLRQHULQJEHVFKUHYHQ 'HOHWWHUV lets in de vuurhaard aan de hand van uitstraling en de beweging
YDQGHOXFKWGLHDDQGHYRRUNDQWQDDUEXLWHQVWURRPW
YHUZLM]HQDOOHQQDDUGHDIEHHOGLQJ 
'HEUDQGVWRI KRXWSHOOHWV ZRUGWYDQXLWGHRSVODJWDQN $ GRRU +HWDSSDUDDWLVQLHWEHVWHPGRPWHZRUGHQJHEUXLNWGRRU
GHYXOVFKURHI % DDQJHGUHYHQGRRUGHUHGXFWLHPRWRU & QDDU personen, kinderen inbegrepen, met beperkte lichamelijke,
GHYHUEUDQGLQJVKDDUG ' YHUYRHUG'HKRXWSHOOHWVZRUGHQ zintuiglijke of mentale capaciteiten. Kinderen moeten onder
DDQJHVWRNHQPHWEHKXOSYDQZDUPHOXFKWGLHGRRUHHQHOHNWUL- toezicht worden gehouden om ervoor te zorgen dat ze niet met
het apparaat spelen.
sche weerstand (E) geproduceerd wordt.
'H]HZDUPHOXFKWZRUGWGRRUHHQURRNYHUZLMGHUDDU ) GH 'HHQLJHULVLFRVYRRUWNRPHQGXLWKHWJHEUXLNYDQGHNDFKHO
YXXUKDDUGLQJH]RJHQ'HURRNJHSURGXFHHUGGRRUGHYHUEUDQ- kunnen verbonden zijn aan een niet correcte installatie, aan
ding wordt door dezelfde centrifugaalventilator (F) uit de haard een rechtstreeks contact met elektrische onderdelen die onder
spanning (intern) staan, aan een contact met vuur en warme
YHUZLMGHUGHQGRRUGHRSHQLQJ * LQKHWODJHGHHODDQGH onderdelen (glas, buizen, uitlaat warme lucht), aan het inbren-
DFKWHUNDQWYDQGHNDFKHOXLWJHVWRWHQ0HWGH]HNDFKHOVLVKHW gen van vreemde stoffen, aan brandstoffen die niet aan te raden
PRJHOLMNGHJHSURGXFHHUGHZDUPHOXFKWWHNDQDOLVHUHQQDDU zijn, aan een niet correct onderhoud.
DDQJUHQ]HQGHUXLPWHQ2SGHDFKWHUNDQWYDQGHNDFKHOV]LMQ
WZHHRSHQLQJHQFPPDQQHOLMNDDQJHEUDFKWZDDUGHNDQDOL- $OVEUDQGPLGGHOHQNHOKRXWSHOOHWVJHEUXLNHQPHWGLDPHWHU
PPYDQXLWVWHNHQGHNZDOLWHLWHQJHFHUWLFHHUG
VDWLHYDQGHZDUPHOXFKWRSNDQZRUGHQDDQJHVORWHQ
'HNDFKHOLVYRRU]LHQYDQWZHHRSHQLQJHQRSGHDFKWHUNDQWZDDU 'HNDFKHOV]LMQYRRU]LHQYDQEHVFKHUPLQJVLQVWDOODWLHVGLH
u speciale aluminium buizen op aan moet sluiten om de warme de uitdoving van de kachel garanderen in het geval dat bepaal-
OXFKWQDDUHHQRIWZHHDDQJUHQ]HQGHUXLPWHQWHNDQDOLVHUHQ de componenten slecht functioneren. Laat dit gebeuren
zonder dat u ingrijpt.
8NXQWDSDUWGH.,7HQ.,7%LVEHVWHOOHQRPGHYHUGH-
OLQJYDQGHZDUPHOXFKWWHEHYRUGHUHQ ]LHSDJ  9RRUHHQQRUPDOHIXQFWLRQHULQJPRHWGHNDFKHOJHwQVWDOOHHUG
'HKRHYHHOKHLGEUDQGVWRIHQGHYHUZLMGHULQJYDQJDVVHQGHWR- worden in overeenstemming met de aanwijzingen van dit
evoer van verbrandingslucht worden allen aangestuurd door de blad. Voorkom de opening van de deur tijdens de functionering:
HOHNWURQLVFKHNDDUWYRRU]LHQYDQVRIWZDUHPHWKHW/HRQDUGR de verbranding wordt automatisch aangestuurd.
Ingrepen zijn dus niet noodzakelijk.
systeem waarmee een optimale verbranding, een hoog rende-
ment en een geringe uitstoot gegarandeerd worden. 9RRUNRPKHWLQYRHUHQYDQYUHHPGHYRRUZHUSHQLQGH
2SGHERYHQNDQWLVHHQV\QRSWLVFKSDQHHO 0 JHQVWDOOHHUGGDW vuurhaard of in de tank.
de besturing en de weergave van de verschillende functione-
9RRUNRPKHWJHEUXLNYDQRQWYODPEDUHSURGXFWHQYRRUGH
ULQJVIDVHVPRJHOLMNPDDNW'HEHODQJULMNVWHIDVHVNXQQHQRRN reiniging van het rookkanaal (het deel dat de opening voor
met behulp van de afstandsbediening worden aangestuurd. rookafvoer van de kachel met de schoorsteen verbindt).
'HNDFKHOLVDDQGHDFKWHUNDQWYRRU]LHQYDQHHQVHULHHOFRQWDFW
YRRUGHDDQVOXLWLQJRSUHPRWHLQVFKDNHODSSDUDWXXU PHW 'H]HRQGHUGHOHQYDQGHYXXUKDDUGHQGHWDQNNXQQHQXLWVOXL-
EHKXOSYDQKHWRSWLRQHOHNDEHOWMHFRGH ELMYWHOHIRRQ- tend bij KOUDE kachel worden uitgezogen.
VFKDNHODDURPJHYLQJVWKHUPRVWDDW'HNDFKHOVEHVWDDQ +HWJODVNDQ.28'JHUHLQLJGZRUGHQPHWHHQVSHFLDDO
YDQELQQHQYROOHGLJXLWJLHWLM]HU'HNDFKHOV]LMQYRRU]LHQYDQ product (bijv. GlassKamin Edilkamin) en een doek.
een compleet gietijzeren binnenstructuur.
9RRUPLMGGHUHLQLJLQJDOVGHKDDUGZDUPLV
&RQWUROHHURIGHNDFKHOGRRUGHHUNHQGH(GLONDPLQGHDOHU
M
1('(5/$1'6

volgens de aanwijzingen van dit blad geplaatst en ontstoken


wordt. Deze voorwaarden zijn tevens zeer belangrijk voor de
geldigheid van de garantie.
7LMGHQVGHIXQFWLRQHULQJYDQGHNDFKHOEHUHLNHQGHDIYRHUOHL-
dingen en de deur zeer hoge temperaturen (nooit zonder
de speciale handschoen aanraken).
9RRUNRPKHWSODDWVHQYDQQLHWKLWWHEHVWHQGLJHYRRUZHUSHQ
A in de nabijheid van de kachel.
0DDN122,7JHEUXLNYDQYORHLEDUHEUDQGVWRIIHQRPGH
kachel aan te steken of het houtskool aan te wakkeren.
B 6OXLWGHOXFKWRSHQLQJHQYDQGHLQVWDOODWLHUXLPWHHQGH
luchtinvoeren van de kachel nooit af.
E 0DDNGHNDFKHOQRRLWQDWHQYRRUNRPGHDDQUDNLQJYDQGH
elektrische onderdelen met natte handen.
C 9RRUNRPKHWDDQEUHQJHQYDQYHUNOHLQVWXNNHQLQGHURRNDIYR-
erleidingen.
' 'HNDFKHOPRHWJHwQVWDOOHHUGZRUGHQLQHHQEUDQGZHUHQGH
G ruimte voorzien van alle services (toevoer en afvoer) die het
apparaat voor een correcte en veilige functionering (zie de
indicaties van dit technische blad) nodig heeft.
3UREHHUGHNDFKHOQRRLWRSQLHXZDDQWHVWHNHQDOVGLW
F HHUGHUQLHWJHOXNWLV/HHJHHUVWGHYXXUKDDUG
/(723'(3(//(76',(88,7'(9885+$$5'
$IE +$$/70$*1,(7,1'(7$1.*(67237:25'(1
- 118 -
AFMETINGEN EN UITRUSTINGEN
- FANTASYVSHNVWHHQ
- FATANHUDPLHNFUPHNOHXULQJURRGOHGHUNOHXULQJ
- SIRENANHUDPLHNFUPHNOHXULQJURRGOHGHUNOHXULQJ
- STORY: grijs geverfd staal. .DQDOLVDWLHZDUPH
OXFKWPP
)5217 785(*
68
13 13

KW
V O XF
LQJri a
U D QmG a ione
c t
HUE4 PbP us
115

9 m 
104
c o U
YRH
DcIm
R N 
5R 8 PP umi

s cita f
u

39
31
7

1('(5/$1'6
.$17 3/$1

53
53
115

68

$)0(7,1*(1*(/',*9225'(02'(//(1

- 119 -
EIGENSCHAPPEN
(/(.7521,6&+($33$5$7(1
/(21$5'2 is een systeem dat de verbranding beschermt en regelt en een optimale functionering
LQHONHRPVWDQGLJKHLGZDDUERUJW'DQN]LMGHWZHHVHQVRUHQGLHKHWGUXNQLYHDXLQGHYHUEUDQGLQJVND-
PHUHQGHURRNWHPSHUDWXXURSPHWHQ+HWRSPHWHQHQGHRSWLPDOLVHULQJYDQGHWZHHSDUDPHWHUVYLQGW
FRQWLQXSODDWV]RGDWHYHQWXHOHVWRULQJHQLQGHIXQFWLRQHULQJRQPLGGHOOLMNJHFRUULJHHUGNXQQHQZRUGHQ
+HW/(21$5'2V\VWHHPJDUDQGHHUWHHQFRQVWDQWHYHUEUDQGLQJGRRUDXWRPDWLVFKGHWUHNDDQGHKDQG
van de eigenschappen van de schoorsteen (bochten, lengte, vorm, doorsnede, enz.) en de omgevin-
JVRPVWDQGLJKHGHQ ZLQGOXFKWYRFKWLJKHLGOXFKWGUXNLQVWDOODWLHRSJURWHKRRJWHHQ] DIWHVWHOOHQ'H
installatienormen moeten in acht worden genomen.
+HW/(21$5'2V\VWHHPLVWHYHQVLQVWDDWKHWVRRUWSHOOHWWHKHUNHQQHQHQDXWRPDWLVFKGHWRHYRHU
HUYDQDIWHVWHOOHQ]RGDWNHHURSNHHUKHWYHUHLVWHYHUEUDQGLQJVQLYHDXJHJDUDQGHHUGZRUGW

SCHALTPLAN
Stroomsensor

7KHUPRNRSSHO
optie

530URRN
%HGLHQLQJVSDQHHO
+ --- besturing

YDFXPPHWHU

Lithium
+
bufferbatterij
CR2032
FU

leespunten
1HWZHUN9DF
+]
1('(5/$1'6

2QWVWHNLQJVZHHUVWDQG

0RW9HUZ5RRN 9XOVFKURHI

&RQWDFWDFKWHUNDQWNDFKHO
9HQWLODWLH

=(.(5,1*
RSKHWFRQWDFWPHWVFKDNHODDUDDQGH
DFKWHUNDQWYDQGHNDFKHO]LMQWZHH]HNH-
ringen aanwezig*, eentje actief en eentje
reserve**.
SERIEPOORT
2SGH$8;SRRUWLVKHWPRJHOLMNRPGRRUGH'($/(5HHQRSWLRQDOYRRUGHFRQWUROH
YDQKHWDDQVWHNHQHQXLWGRYHQWHODWHQLQVWDOOHUHQ ELMYWHOHIRRQVFKDNHODDURPJHYLQJV-
WKHUPRVWDDW RSGHDFKWHUNDQWYDQGHNDFKHO.DQZRUGHQDDQJHVORWHQPHWGHDI]RQ-
GHUOLMNOHYHUEDUHEUXJYHUELQGLQJ FRGH 

%8))(5%$77(5,-
'HHOHNWURQLVFKHNDDUWLVYRRU]LHQYDQHHQEXIIHUEDWWHULM W\SH9ROW&5 (HQ
storing in de functionering (hetgeen niet als een storing in het product maar als nromale
slijtage moet worden beschouwd) van deze bufferbatterij wordt weergegeven met de
EHULFKWHQ%DWWHU\FKHFN1HHPYRRUYHUGHUHLQIRUPDWLHKLHURYHUFRQWDFWRSPHWGH
'HDOHUGLHGHVWHRQWVWHNLQJXLWJHYRHUGKHHIW
* **
- 120 -
EIGENSCHAPPEN
THERMOTECHNISCHE KENMERKEN volgens EN 14785
Nominaal vermogen Beperkt vermogen
Warmtedebiet kW
Thermisch vermogen 13,2 5,1 kW
Rendement / Doeltreffendheid 92,5 93,3 %
UItstoot CO 13% O2 0,019 0,038 %
Maximumtemperatuur rookgassen   C
Minimum trek 12 10 Pa
Massadebiet van de rookgassen 13,5 7,4 g/s
Verbruik brandstof 2,9 1,1 kg/h
Capaciteit reservoir 23,5 kg
Autonomie 7 18,5 uur
Voor ruimtes van / tot* 345 m3
Diameter afvoerpijp rook (mannelijk) 80 mm
Diameter luchtinlaatpijp (mannelijk) 40 mm
*HZLFKWPHWYHUSDNNLQJ)$17$6<)$7$6,5(1$6725<  kg

* +HWYHUZDUPLQJVYROXPHLVEHUHNHQGHHQLVRODWLHYDQKHWKXLVFRQIRUPGH,WDOLDDQVHZHWHQYHUGHUHZLM]LJLQJHQHQPHW
HHQZDUPWHDDQYUDDJYDQ.FDOPtSHUXXU

(/(.75,6&+((,*(16&+$33(1
9RHGLQJ 9DF+]
6FKDNHODDURQRII si
*HPLGGHOGJHDEVRUEHHUGYHUPRJHQ  W
*HDEVRUEHHUGYHUPRJHQWLMGHQVRQWVWHNLQJ  W
Frequentie afstandsbediening infrarood

1('(5/$1'6
%HYHLOLJLQJRSKRRIGYRHGLQJ* ]LHSDJ =HNHULQJ$79DF[
%HYHLOLJLQJRSHOHNWURQLVFKHNDDUW* =HNHULQJ$79DF[

NB:
 KRXGHUUHNHQLQJPHHGDWH[WHUQHDSSDUDWXXUGHIXQFWLRQHULQJYDQGHHOHNWURQLVFKHNDDUWNDQVWRUHQ
 23*(/(7/DDWKHWDDQVOXLWHQYDQRQGHUGHOHQRQGHUVSDQQLQJRQGHUKRXGHQRIQD]LFKWXLWVOXLWHQGGRRUJHVSHFLDOLVHHUGH

'HKLHUERYHQYHUPHOGHJHJHYHQV]LMQLQGLFDWLHI
(',/.$0,1VSDEHKRXGW]LFKKHWUHFKWYRRU]RQGHUPHGHGHOLQJHQQDDURQKHUURHSHOLMNRRUGHHOGHSURGXFWHQWHNXQ-
nen wijzigen.

BESCHERMINGSINSTALLATIES
7+(502.233(/
%HYLQGW]LFKRSGHURRNDIYRHUHQPHHWGHWHPSHUDWXXUYDQGHURRNRS&RQWUROHHUWPHWEHKXOSYDQLQJHVWHOGHSDUDPHWHUVGHRQW-
VWHNLQJGHIXQFWLRQHULQJHQGHXLWGRYLQJYDQGHKDDUG

9$&800(7(5
0HHWGHGUXNZDDUGH WHQRS]LFKWHYDQGHLQVWDOODWLHUXLPWH LQGHYHUEUDQGLQJVNDPHURS

/8&+76752206(1625
*HSODDWVWRSKHWDVSLUDWLHNDQDDOJULMSWLQDOVGHVWURRPYDQGHYHUEUDQGLQJVOXFKWQLHWFRUUHFWLVZDDUGRRUGXVGHSUHVVLHSUREOHPHQ
LQKHWURRNFLUFXLWYHURRU]DDNWZRUGHQ+LHUGRRU]DOGHNDFKHOZRUGHQXLWJHVFKDNHOG

9(,/,*+(,'67+(50267$$7
*ULMSWLQDOVGHWHPSHUDWXXULQGHNDFKHOWHKRRJLV%ORNNHHUWKHWODGHQYDQSHOOHWVZDDUGRRUGHNDFKHOXLWJDDW
- 121 -
0217$*(%(./(',1*)$7$6,5(1$
%,-*(6/27(10$7(5,$$/
75 VFKURHYHQ0[
VFKURHYHQ0[
33
 YHUELQGLQJVVWXNNHQLQVLOLFRQHYRRUGHERYHQVWHNHUDPLVFKH
elementen
ULQJHQ0
PRIIHQ
DIVWDQGVEORNMHVLQVLOLFRQHYRRUNHUDPLHN
NHUDPLVFKH[DWLHSODDWMHV
'(=,-7(*(/60217(5(1 $IE
75
'HPRQWHHUKHWSDQHHODDQGHDFKWHUNDQW  HQGHWZHH
SURHOHQ 
'HEHLGHSODDWMHV  YDVWPDNHQDDQGHYHU]LQNWH]LMNDQWHQ
$IE $IE
YRRUKHW)$7$PRGHO J
$IE 150 +HWOLQNHUSODDWMHPRHWYDVWJHPDDNWZRUGHQDDQGHPLGGHOVWH
150
HQERYHQVWHJDWHQWHUZLMOKHWUHFKWHUSODDWMHPRHWYDVWJHPDDNW
138 worden aan de middelste en onderste plaatjes.
 0RQWHHUGHNHUDPLVFKHWHJHOV  RSGHSODDWMHV 
VLOLFRQHQDIVWDQGKRXGHUV  RSGHDFKWHUNDQWSODDWVHQ
139 WXVVHQUKHWJLHWLM]HUHQJURQGYODNHQGHWHJHOUHFKWVRQGHU  
]LHGHHO<J 
 150 150

9RRUHHQFRUUHFWHPRQWDJHYDQGH]LMGHOLQJVHNHUDPLVFKH
138
139 WHJHOERYHQDDQUHFKWVHQYDQGH]LMGHOLQJVHNHUDPLVFKHWHJHO
RQGHUDDQOLQNVLVKHWDDQEHYROHQGHUHJHOVFKURHYHQWHJHEUXL-
NHQDDQZH]LJRSGHYHU]LQNWH]LMNDQWHQYDQGHVWUXFWXXU $IE
150
 
150
$IE SDUW<
=LMNDQWUHFKWV $IE 'H[DWLHVFKURHIUHJHOHQDDQKHW
XLWHLQGHDDQGH]LMGHOLQJVHNHUDPLVFKHWHJHOERYHQDDQUHFKWV
 
=LMNDQWOLQNV $IE 'HNHUDPLVFKHWHJHOERYHQDDQOLQNV
YHUZLMGHUHQ  HQGH[DWLHVFKURHIUHJHOHQDDQKHWXLWHLQGH
DDQGH]LMGHOLQJVHNHUDPLVFKHWHJHORQGHUDDQOLQNV 
$IE
'HNHUDPLVFKHWHJHOERYHQDDQOLQNVRSQLHXZPRQWHUHQ 

YRRUKHWPRGHO6,5(1$ J
%HLGHSODDWMHVPRHWHQYDVWJHPDDNWZRUGHQDDQGHPLGGHOVWH
en onderste gaten.
0RQWHUGHNHUDPLVFKHWHJHOV  RSGHSODDWMHV 
$IE
1('(5/$1'6

$IE
230(5.,1*$DQJH]LHQGHWHJHOVJHJRWHQ]LMQNXQQHQ
]HRQGHUOLQJHHQEHHWMHLQKRRJWHYHUVFKLOOHQ2PHYHQWXHOH
150 150 KRRJWHYHUVFKLOOHQWHFRPSHQVHUHQNXQWXDIVWDQGVEORNMHVLQ
61
VLOLFRQHJHEUXLNHQ DIE ]RQGHUDIEUHXNWHGRHQRS
GHHVWKHWLHNYDQGHNDFKHO
 61
150 'HEHLGHSURHOHQ  HQKHWDFKWHUVWHSDQHHORSQLHXZ
PRQWHUHQ  
61 150
61 0217$*(9$1+(7%29(167(9225(/(0(17
)$7$6,5(1$ $IE
61 3ODDWVKHWNHUDPLVFKYRRUSDQHHOERYHQ  UXVWHQGRSGH
150 VWHXQSODDW  JHSODDWVWERYHQDDQGHGHXU
%HYHVWLJKHWYRRUHOHPHQWPHWGHVFKURHYHQ0[
150
(met behulp van een inbussleutel) open het deurtje alvorens u
$IE $IE deze handeling verricht.
230(5.,1*
Part. Z %UHQJYRRUHHQFRUUHFWHPRQWDJHWXVVHQKHWERYHQVWH
 YRRUHOHPHQW  HQKHWPHWDOHQYRRUHOHPHQW  GHELMJHVOR-
WHQPRIDDQ]LHKHWGHWDLO= $IE 
62
62 0217$*(9$1+(721'(567(9225(/(0(17
moffen )$7$6,5(1$ $IE
'UDDLGHEHYHVWLJLQJVVFKURHYHQYDQKHWJLHWLM]HUHQURRVWHU
onderaan (4) los met behulp van de bijgesloten inbussleutel
62 HQYHUZLMGHUKHWURRVWHUYDQGHNDFKHO
24 3ODDWVKHWYRRUHOHPHQW  HQ]HWKHWYDVWPHW0[
9LVVHV
vite VFKURHYHQ PHWEHKXOSYDQHHQLQEXVVOHXWHO ]LHKHWGHWDLO;
 $IE 
$IE $IE
- 122 -
0217$*(%(./(',1*)$7$6,5(1$
'(.(5$0,(.(17230217(5(1)$7$6,5(1$
 (Afb
* 3ODDWVGHDIVWDQGVEORNMHVYRRUNHUDPLHN LQGHUHVSHF-
WLHYHRSHQLQJHQYDQGHJLHWLM]HUHQWRSHQOHJGHNHUDPLVFKHWRS
62  HURS
EUHQJLQGLHQQRRG]DNHOLMNWXVVHQKHWVLOLFRQHQDIVWDQ-
9LVVHV
n2 viti GVEORNMHHQGHJLHWLM]HUHQWRSHHQULQJDDQ
230(5.,1*
Part. X
5RRGHPDLOPHWNULVWDOOLMQSRHGHUDDQJHEUDFKWRSKHW
DDUGHZHUNFUDTXHOHHUWJHOLMNPDWLJ FUDTXHOXUHV RYHUKHHOGH
RSSHUYODNWH'LHFUDTXHOXUHV]LMQJHHQIRXWRIJHEUHNPDDUHHQ
NHQPHUNYDQHPDLOGDWRSDDUGHZHUNLVDDQJHEUDFKW
'HNHUDPLVFKHHOHPHQWHQ DDUGHZHUN ]LMQPHWGHKDQGJH-
$IE $IE JRWHQHQJHPDLOOHHUGHQNXQQHQNOHLQHLPSHUIHFWLHVYHUWRQHQ
GLHJHHQHQNHOHQHJDWLHYHLQYORHGKHEEHQRSGHNZDOLWHLWHUYDQ
NOHLQHLQNHSLQJHQRISRUHXVKHLGYDQKHWHPDLO LQWHJHQGHHO
]HWRQHQDDQGDW]HPHWGHKDQG]LMQJHPDDNW

0217$*(%(./(',1*6725<
%,-*(6/27(10$7(5,$$/
VFKURHYHQ0[
VFKURHYHQ0[

YHUELQGLQJVVWXNNHQLQVLOLFRQHYRRUGHERYHQVWHNHUDPLVFKH
elementen
62 ULQJHQ0
PRIIHQ

'HNDFKHOZRUGWJHOHYHUGPHWGHPHWDOHQ]LMNDQWHQUHHGVJH-
PRQWHHUGWHUZLMOGHNHUDPLVFKHSDQHOHQERYHQDDQHQRQGH-
UDDQ  HQGHWRS  DI]RQGHUOLMNYHUSDNW]LMQ=HPRHWHQ
als volgt gemonteerd worden:
62

$IE 0217$*(9$1+(7%29(167(9225(/(0(17
(Afb. 1-2)
3ODDWVKHWNHUDPLVFKYRRUSDQHHOERYHQ
Part. Z  UXVWHQGRSGHVWHXQSODDW  JHSODDWVWERYHQDDQGHGHXU

1('(5/$1'6
%HYHVWLJKHWYRRUHOHPHQWPHWGHVFKURHYHQ0[
62 (met behulp van een inbussleutel) open het deurtje alvorens u
62
deze handeling verricht.
moffen 9LVVHV
n2 viti
230(5.,1*
9RRUHHQFRUUHFWHLQVWDOODWLHYDQKHWERYHQVWHYRRUSDQHHO  
24 Part. X
LVKHWQRGLJWXVVHQGH]HHQKHWSDQHHO  GHPHHJHOHYHUGH
9LVVHV
vite
KXOVWHSODDWVHQ]RDOVDDQJHGXLGLQGHWDLO=LQJ

$IE $IE 0217$*(9$1+(721'(567(9225(/(0(17


$IE
0HWGHPHHJHOHYHUGHLQEXVVOHXWHOGHERUJVFKURHYHQORVGUDD-

* 
ien van de onderste gietijzeren rooster (4) en deze verwijderen.
3ODDWVKHWYRRUHOHPHQW  HQ]HWKHWYDVWPHW0[
VFKURHYHQ PHWEHKXOSYDQHHQLQEXVVOHXWHO ]LHKHWGHWDLO;
$IE 

'(.(5$0,(.(17230217(5(1 $IE
3ODDWVGHDIVWDQGVEORNMHVYRRUNHUDPLHN LQGHUHVSHF-
WLHYHRSHQLQJHQYDQGHJLHWLM]HUHQWRSHQOHJGHNHUDPLVFKHWRS
 HURS
EUHQJLQGLHQQRRG]DNHOLMNWXVVHQKHWVLOLFRQHQDIVWDQ-
GVEORNMHHQGHJLHWLM]HUHQWRSHHQULQJDDQ

$IE
- 123 -
INSTALLATIE
Tijdens de installatie en het gebruik van het apparaat moeten 522.$)92(5
de plaatselijke en nationale wetten en de Europese normen in +HWDIYRHUV\VWHHPPDJXLWVOXLWHQGGRRUGHNDFKHOJHEUXLNW
acht worden genomen. In Itali refereert men aan de norm UNI worden (het is niet toegestaan dat de schoorsteen tevens
DOVPHGHDDQGHUHJLRQDOHLQGLFDWLHVRIGHLQGLFDWLHV YRRUDQGHUHLQVWDOODWLHVJHEUXLNWZRUGW 
YDQGHSODDWVHOLMNH$6/+HWLVHFKWHUHVVHQWLHHOWHYHUZLM]HQ +HWDIYRHUHQYDQGHURRNYLQGWSODDWVGRRUHHQRSHQLQJDDQGH
naar de wetten die gelden in elk land. Vraag de beheerder om DFKWHUNDQWPHWHHQGRRUVQHGHYDQFP'HURRNDIYRHUPRHW
PHWEHKXOSYDQJHVFKLNWHVWDOHQOHLGLQJHQ(1JHFHUWLFH-
toestemming alvorens u het apparaat in een meergezinshuis HUG'HOHLGLQJPRHWKHUPHWLVFKDIJHVORWHQ]LMQ
installeert. 9RRUGHDIGLFKWLQJYDQGHOHLGLQJHQHQHHQHYHQWXHOHLVROD-
WLHKLHUYDQLVKHWQRRG]DNHOLMNPDWHULDOHQWHJHEUXLNWZRUGHQ
&21752/(&203$7,%,/,7(,70(7$1'(5( GDWEHVWDQGLVWHJHQKRJHWHPSHUDWXUHQ VLOLFRQHQRIPDVWLHN
,167$//$7,(6 JHVFKLNWYRRUKRJHWHPSHUDWXUHQ 
'HWKHUPRNDFKHOPDJ1,(7ZRUGHQJHwQVWDOOHHUGLQGH]HOIGH +HWHQLJHKRUL]RQWDOHGHHOPDJWRWPODQJ]LMQ(HQWRWDDOYDQ
kamer waar zich gasverwarmingstoestellen bevinden van het ERFKWHQPHWHHQPD[ZLMGWHYDQqLVWRHJHVWDDQ
type B (vb. gasketels, kachels en apparaten met wasemkap) +HWLVQRRG]DNHOLMN DOVGHDIYRHUQLHWQDDUHHQVFKRRUVWHHQOR-
want de thermokachel zou een depressie kunnen creren in de RSW HHQYHUWLFDDOVWXNYDQPLQVWHQVPHQHHQZLQGVFKHUP
NDPHUHQGHZHUNLQJHUYDQLQKHWJHYDDUEUHQJHQRIEHwQYOR- WHLQVWDOOHUHQ UHIHUHQWLH81, +HWYHUWLFDOHNDQDDO
eden. NDQ]RZHOLQWHUQDOVH[WHUQ]LMQ$OVKHWURRNNDQDDO]LFKLQ
de buitenlucht bevindt, moet hij op passende wijze gesoleerd
]LMQ$OVKHWURRNNDQDDOLQHHQVFKRRUVWHHQXLWNRPWPRHWGH]H
&21752/((/(.75,6&+($$16/8,7,1* JHVFKLNW]LMQYRRUYDVWHEUDQGVWRIIHQ$OVGHGRRUVQHGHJURWHU
EUHQJGHVWHNNHUGRRVRSHHQEHUHLNEDUHSOHNDDQ LVGDQPPLVKHWQRRG]DNHOLMNKHPWHYHUNOHLQHQGRRUKLHU
'HNDFKHOLVYRRU]LHQYDQHHQHOHNWULVFKHYRHGLQJVNDEHOGLH OHLGLQJHQPHWHHQMXLVWHGRRUVQHGHHQJHPDDNWYDQSDVVHQGH
RSHHQ9+]VWRSFRQWDFWKHWOLHIVWYRRU]LHQYDQHHQ materialen in aan te brengen (bijv. stalen leidingen met een
PDJQHWRWKHUPLVFKHVFKDNHODDUPRHWZRUGHQDDQJHVORWHQ GRRUVQHGHYDQPP 'HYHUVFKLOOHQGHGHOHQYDQKHWURRNND-
6SDQQLQJVYDULDWLHVYDQPHHUGDQNXQQHQGHNDFKHOQHJD- QDDOPRHWHQJHQVSHFWHHUGNXQQHQZRUGHQ'HVFKRRUVWHQHQ
tief benvloeden (we raden u aan om, als dit niet voorzien is, HQURRNNDQDOHQZDDUDSSDUDWHQYRRUGHYHUEUDQGLQJYDQYDVWH
HHQSDVVHQGHGLIIHUHQWLHHOVFKDNHODDUWHLQVWDOOHUHQ 'HHOHNWUL- brandstoffen op aangesloten zijn, moeten eenmaal per jaar
sche installatie moet aan de normen voldoen; controleer met geveegd worden (controleer of in uw land dit per wet geregeld
QDPHGHGRHOWUHIIHQGKHLGYDQGHDDUGLQJ'HYRHGLQJVOLMQ is). Een onregelmatige controle en reiniging zorgen ervoor dat
KHWJHYDDUYRRUVFKRRUVWHHQEUDQGWRHQHHPW9RHULQGLWJHYDO
PRHWHHQGRRUVQHGHKHEEHQGLHJHVFKLNWLVYRRUKHWYHUPRJHQ GHYROJHQGHKDQGHOLQJHQXLWYRRUNRPKHWEOXVVHQPHWZDWHU
YDQGHDSSDUDWXXU(GLONDPLQDFKW]LFKQLHWYHUDQWZRRUGHOLMN OHHJGHSHOOHWVWDQN1HHPQDHHQEUDQGFRQWDFWRSPHWJHVSH-
voor storingen in de functionering als gevolg van een slecht FLDOLVHHUGSHUVRQHHOYRRUGDWXKHWDSSDUDDWZHHUDDQVWHHNW De
functionerend aardecircuit. kachel werd ontworpen om te werken bij elke weersomstandigheid.
In geval van bijzondere omstandigheden, zoals sterke wind, kan
PLAATSING het veiligheidssysteem tussenkomen wat de thermokachel uitdooft.
9RRUHHQFRUUHFWHIXQFWLRQHULQJPRHWGHNDFKHOZDWHUSDVZRU- Laat in dergelijke gevallen het apparaat nooit met gedeactiveer-
GHQJHSODDWVW&RQWUROHHUKHWGUDDJYHUPRJHQYDQGHYORHU de beveiligingen functioneren. Neem contact op met uw Dealer
als het probleem aanhoudt.
9(,/,*($)67$1'(19225%5$1':(5,1*
7<3,6&+(*(9$//(1
De kachel moet in overeenstemming met de volgende veili-
1('(5/$1'6

JKHLGVYRRUZDDUGHQZRUGHQJHwQVWDOOHHUG Afb. 1 Afb. 2


- minimale afstand aan de zijkanten en achteraan: 20 cm uit de
buurt van brandbare materialen.
- vooraan de kachel mogen geen brandbare materialen gesta-
peld worden op minder dan 80 cm.
Als het niet mogelijk is de hierboven aangegeven afstanden
toe te passen, is het noodzakelijk technische en bouwkundige
voorzorgsmaatregelen te treffen om brandgevaar te voorkomen.
In het geval van de aansluiting op een houten wand of een
wand van andere ontvlambare materialen, is het noodzakelijk
de rookafvoerleiding te isoleren.

LUCHTINLAAT
'HUXLPWHZDDULQGHNDFKHOVWDDWPRHWDEVROXXWHHQOXFKWLQODDW
KHEEHQPHWHHQRSHQLQJYDQPLQVWHQVFPsRPHU]HNHUYDQ
WH]LMQGDWHUYROGRHQGHGHYHUEUDQGLQJVOXFKWLV'HNDFKHONDQ
RRNOXFKWDDQYRHUHQGRRUHHQUHFKWVWUHHNVHYHUELQGLQJQDDUEX- A: gesoleerde stalen schoorsteen
LWHQYLDHHQYHUOHQJVWXNRSGHVWDOHQEXLVPHWHHQGLDPHWHUYDQ B: PLQLPXPKRRJWHPHQLQLHGHUJHYDOERYHQGHGDNJRRW
FP,QGDWJHYDONXQQHQSUREOHPHQRQWVWDDQGRRUFRQGHQVDWLH C-E: OXFKWWRHYRHUQDDURPJHYLQJ PLQLPXPGRRUVQHGHFPs
en moet u de luchttoevoer met een netje beschermen, waarbije- 'VWDOHQURRNNDQDDOLQHHQEHVWDDQGHJHPHWVHOGHVFKRRUVWHHQ
HQPLQLPDOHYULMHGRRUJDQJYDQFPsLVJHZDDUERUJG'H
EXLVPRHWNRUWHU]LMQGDQPHWHUHQPDJJHHQERFKWHQKHEEHQ SCHOORSTEENPOT
'HEXLVPRHWHLQGLJHQPHWHHQVHJPHQWYDQqQDDUEHQHGHQ 'HIXQGDPHQWHOHHLJHQVFKDSSHQ]LMQ
JHULFKWPHWHHQZLQGEHVFKHUPLQJ,QLHGHUJHYDOKHOHPDDOOXFK- LQWHUQHGRRUVQHGHDDQGHRQGHUNDQWJHOLMNDDQGHGRRUVQHGH
WLQODDWNDQDDOPRHWHQZRUGHQPRHWHHQYULMHGRRUVQHGHYDQ van de schoorsteen
- doorsnede van de afvoer minstens tweemaal zo groot als de
PLQVWHQVFPJHZDDUERUJGZRUGHQ%HVFKHUPKHWXLWHLQGH doorsnede van de schoorsteen
van de luchtinvoer met een insectenrooster dat de nuttige do- ERYHQRSKHWGDNLQGHZLQGJHSODDWVWEXLWHQKHWEHUHLNYDQUHX[]R-
RUVQHGHYDQFPQLHWEHSHUNW QHVERYHQGHQRNEDONHQEXLWHQKHWEHUHLNYDQUHX[JHELHGHQ
- 124 -
INSTALLATIE
$IE$ &,5&8/$7,(9$1:$50(/8&+7
'HZDUPHOXFKWZRUGWQDDUGHLQVWDOODWLHUXLPWHJH]RQGHQ
GRRUKHWURRVWHUGDWRSGHYRRUNDQWERYHQDDQJHQVWDOOHHUG
is (afb. E).

'HNDFKHOLVYRRU]LHQYDQWZHHRSHQLQJHQRSGHDFKWHUNDQW
DIE$ ZDDUXVSHFLDOHDOXPLQLXPEXL]HQRSDDQPRHWVOXLWHQ
om de warme lucht naar een of twee aangrenzende ruimten te
openingen afvoer NDQDOLVHUHQ
warme lucht
8NXQWDSDUWGH.,7HQ.,7%LVEHVWHOOHQRPGHYHUGH-
ling van de warme lucht te bevorderen ]LHSDJ 
$IE%
+HWLVKHHOEHODQJULMNGDWXRQWKRXGWGHOHLGLQJYRRUGH
warme lucht op passende wijze te isoleren om warmteverlies
WHYRRUNRPHQ
3UREHHU]RYHHOPRJHOLMNERFKWHQLQGHEXLVWHYRRUNRPHQ
P
P 1%'(/(,',1*(1$$1*(6/27(123'(
23(1,1*(19225'($)92(59$1:$50(
/8&+702(7(1$$1*(6/27(1:25'(1
$/925(168'(%(./(',1*0217((57
'(0217((59225'(=(+$1'(/,1*+(7
%29(167(*,(7,-=(5(1=,-3$1((/+(7
$IE& %(*,19$1'()/(;,%(/(/(,',1*02(7
+(/(0$$/8,7*(5(.7:25'(1=2'$7
'(,17(51('22561('($$1=,(1/,-.*527(5
P :25'7',79(5((1928',*7'($$16/8,7,1*
P
8NXQWKDQGPDWLJGHGLVWULEXWLHYDQGHNDQDOLVHHUEDUH
L OXFKWDIVWHOOHQPHWEHKXOSYDQGHKHQGHOV/ DIE' 
L
9HUZLMGHUGHEHYHVWLJLQJVSODDWMHV3GRRUGHVFKURHYHQORV
WHGUDDLHQRPGHKHQGHOVWHNXQQHQYHUSODDWVHQ DIE%& 

1('(5/$1'6
$OVXGHSODDWMHVYHUZLMGHUGKHHIWNDQGHZDUPHOXFKWQDDUGH
$IE' ERYHQNDQWYRRUDDQDIE( KHQGHOKHOHPDDODFKWHUXLW]LHDIE
' RIQDDUGHDFKWHUNDQWDIE) KHQGHOKHOHPDDOYRRUXLW]LH
DIE' RIJHGHHOWHOLMNQDDUGHYRRUNDQWHQJHGHHOWHOLMNQDDU
frontale
GHDFKWHUNDQW KHQGHOKDOYHUZHJH]LHDIE' JHNDQDOLVHHUG
worden.
intermedia
1%8+2()7'(3/$$7-(6 3 1,(77(9(5-
posteriore
:,-'(5(1$/68'(.$&+(/1,(7.$1$/,6((57

$IE( $IE)

- 125 -
INSTALLATIE
q23/266,1*.,7 FRGH ((1(1.(/($$1*5(1=(1'(58,07(
1%'(/(,',1*(1$$1*(6/27(123'(23(1,1*(19225'($)92(59$1:$50(/8&+702(7(1
$$1*(6/27(1:25'(1$/925(168'(%(./(',1*0217((57'(0217((59225'(=(+$1'(-
/,1*+(7%29(167(*,(7,-=(5(1=,-3$1((/+(7%(*,19$1'()/(;,%(/(/(,',1*02(7+(/(-
0$$/8,7*(5(.7:25'(1=2'$7'(,17(51('22561('($$1=,(1/,-.*527(5:25'7',7
9(5((1928',*7'($$16/8,7,1*
%HSDDOGHSODDWVLQJYDQGHNDFKHOWHQRS]LFKWHYDQGHPXXU DIED
'HPRQWHHUGHERYHQVWHGHHODDQGHDFKWHUNDQW  HQYHUZLMGHUHHQYDQGHWZHHLQJHVQHGHQGRSSHQWHUKRRJWHYDQGHXLWYRH-
ropeningen voor warme lucht (afb. b).
$FWLYHHUGHEHGLHQLQJVKHQGHOYRRUGHNDQDOLVDWLHYDQZDUPHOXFKW  GRRUGHYHUJUHQGHOSODDWMHV   DIEE WHUYHUZLMGHUHQ
6QLMGKHWDIGHNVWXNYDQGHEXLVRSPDDW  DDQGHPXXU]LMGH DIEF
3ODDWVGHNDFKHOLQGHGHQLWLHYHVWDQG
9HUOHQJGHDOXPLQLXPEXLV  YRRUGHNDQDOLVDWLHYDQZDUPHOXFKW]RQGHUGDWXKHPRSGHRSHQLQJYDQGHNDFKHODDQVOXLW
%UHQJHHUVWGHULQJ  HQGHDIGHNNLQJYRRUGHEXLV D RSGHDOXPLQLXPEXLVDDQ]RQGHUGDWXKHPYDVW]HW DIEF 
%UHQJGHDOXPLQLXPEXLVDDQRSGHXLWYRHURSHQLQJYRRUZDUPWHOXFKWDDQGHDFKWHUNDQWYDQGHNDFKHO   DIEG 
+HUPRQWHHUKHWERYHQVWHGHHODDQGHDFKWHUNDQW  
%UHQJGHDIGHNNLQJYRRUGHEXLV  RS]LMQGHQLWLHYHSODDWVDDQHQ]HWKHPYDVWRSGHDFKWHUNDQWYDQGHNDFKHOPHWEHKXOSYDQ
GHELMJHVORWHQVFKURHYHQ   DIEG 
,QVWDOOHHUGHXLWYRHU  HQGHELMEHKRUHQGHDOXPLQLXPEXLV   DIEG 
%HYHVWLJGHULQJ  PHWEHKXOSYDQVLOLFRQHQNLWDDQGHPXXU DIEG 
$IED $IEE
23

132 1
133
5

13
4
132 7

$IEF 5 3
6 6a
8
6
6a

4 8
1('(5/$1'6

$IEG 5
88 3
4
4
8 6
7

6
6a

Qq .,7
 'RRV  
 %XLV  
4 2SHQLQJ  
 Ring  
6a $IGHNNLQJYRRUGHEXLV  
 %HYHVWLJLQJVVFKURHIDIGHNNLQJYRRUGHEXLV 4 
8 .OHPULQJEXL]HQ  
- 126 -
INSTALLATIE
q23/266,1*.,7%,6 FRGH ((1(1.(/(1,(7$$1*5(1=(1'(58,07(
1%'(/(,',1*(1$$1*(6/27(123'(23(1,1*(19225'($)92(59$1:$50(/8&+702(7(1
$$1*(6/27(1:25'(1$/925(168'(%(./(',1*0217((57'(0217((59225'(=(+$1'(-
/,1*+(7%29(167(*,(7,-=(5(1=,-3$1((/+(7%(*,19$1'()/(;,%(/(/(,',1*02(7+(/(-
0$$/8,7*(5(.7:25'(1=2'$7'(,17(51('22561('($$1=,(1/,-.*527(5:25'7',7
9(5((1928',*7'($$16/8,7,1*
%HSDDOGHSODDWVLQJYDQGHNDFKHOWHQRS]LFKWHYDQGHPXXU DIED
'HPRQWHHUGHERYHQVWHGHHODDQGHDFKWHUNDQW  HQYHUZLMGHUHHQYDQGHWZHHLQJHVQHGHQGRSSHQWHUKRRJWHYDQGHXLWYRH-
ropeningen voor warme lucht (afb. b).
$FWLYHHUGHEHGLHQLQJVKHQGHOYRRUGHNDQDOLVDWLHYDQZDUPHOXFKW  GRRUGHYHUJUHQGHOSODDWMHV   DIEE WHUYHUZLMGHUHQ
6QLMGKHWDIGHNVWXNYDQGHEXLVRSPDDW  DDQGHPXXU]LMGH DIEF
3ODDWVGHNDFKHOLQGHGHQLWLHYHVWDQG
9HUOHQJGHDOXPLQLXPEXLV  YRRUGHNDQDOLVDWLHYDQZDUPHOXFKW]RQGHUGDWXKHPRSGHRSHQLQJYDQGHNDFKHODDQVOXLW
%UHQJHHUVWGHULQJ  HQGHDIGHNNLQJYRRUGHEXLV D RSGHDOXPLQLXPEXLVDDQ]RQGHUGDWXKHPYDVW]HW DIEF 
%UHQJGHDOXPLQLXPEXLVDDQRSGHXLWYRHURSHQLQJYRRUZDUPWHOXFKWDDQGHDFKWHUNDQWYDQGHNDFKHO   DIEG 
+HUPRQWHHUKHWERYHQVWHGHHODDQGHDFKWHUNDQW  
%UHQJGHDIGHNNLQJYRRUGHEXLV  RS]LMQGHQLWLHYHSODDWVDDQHQ]HWKHPYDVWRSGHDFKWHUNDQWYDQGHNDFKHOPHWEHKXOSYDQ
GHELMJHVORWHQVFKURHYHQ   DIEG 
,QVWDOOHHUGHXLWYRHU  HQGHELMEHKRUHQGHDOXPLQLXPEXLV  EHYHVWLJKHPPHWGHULQJ  HQGHSOXJJHQPHWVFKURHYHQ 
 DDQGHPXXU DIEG 
%HYHVWLJGHULQJ  PHWEHKXOSYDQVLOLFRQHQNLWDDQGHPXXU DIEG 

$IED $IEE 2
2

132
133 1
5
7

13
4 6 6a
132

$IEF 5
9 9
8

6 10 11

1('(5/$1'6
10 9
9 4
10
8 8
$IEG 5
4 2
8
7

5
6 6

Qq .,7%,6
 'RRV  
 %XLV  
4 2SHQLQJ  
 Ring  
6a $IGHNNLQJYRRUGHEXLV  
 %HYHVWLJLQJVVFKURHIDIGHNNLQJYRRUGHEXLV 4 
8 .OHPULQJEXL]HQ  
 Ring  
 Schroeven 4 
 3OXJJHQ 4 
- 127 -
INSTALLATIE
q23/266,1*.,7 FRGH PHW.,7%,6 FRGH %(,'(58,07(6
1%'(/(,',1*(1$$1*(6/27(123'(23(1,1*(19225'($)92(59$1:$50(/8&+702(7(1
$$1*(6/27(1:25'(1$/925(168'(%(./(',1*0217((57'(0217((59225'(=(+$1'(-
/,1*+(7%29(167(*,(7,-=(5(1=,-3$1((/+(7%(*,19$1'()/(;,%(/(/(,',1*02(7+(/(-
0$$/8,7*(5(.7:25'(1=2'$7'(,17(51('22561('($$1=,(1/,-.*527(5:25'7',7
9(5((1928',*7'($$16/8,7,1*
%HSDDOGHSODDWVLQJYDQGHNDFKHOWHQRS]LFKWHYDQGHPXXU DIED
'HPRQWHHUGHERYHQVWHGHHODDQGHDFKWHUNDQW  HQYHUZLMGHUGHGRSSHQWHUKRRJWHYDQGHXLWYRHURSHQLQJHQYRRUZDUPH
lucht (afb. b).
$FWLYHHUGHEHGLHQLQJVKHQGHOVYRRUGHNDQDOLVDWLHYDQZDUPHOXFKW  GRRUGHEHYHVWLJLQJVSODDWMHVWHYHUZLMGHUHQ   DIEE 
6QLMGGHDIGHNNLQJYRRUGHEXLVRSPDDW  DDQGHPXXU]LMGH DIEF
3ODDWVGHNDFKHOLQGHGHQLWLHYHVWDQG
9HUOHQJGHDOXPLQLXPEXL]HQ  YRRUGHNDQDOLVDWLHYDQZDUPHOXFKW]RQGHUGDWX]HRSGHRSHQLQJHQYDQGHNDFKHODDQVOXLW
%UHQJHHUVWGHULQJ  HQGHDIGHNNLQJYDQGHEXL]HQ D RSGHDOXPLQLXPEXL]HQDDQ]RQGHUGDWX]HYDVW]HW DIEF 
3ODDWVGHDOXPLQLXPEXL]HQRSGHXLWYRHURSHQLQJHQYRRUZDUPWHOXFKWDDQGHDFKWHUNDQWYDQGHNDFKHO   DIEG 
+HUPRQWHHUKHWERYHQVWHGHHODDQGHDFKWHUNDQW  
'HQLWLHYHVWDQGGHDIGHNNLQJHQYRRUGHEXL]HQ  HQEHYHVWLJ]HDDQHQ]HWKHPYDVWRSGHDFKWHUNDQWYDQGHNDFKHOPHW
EHKXOSYDQGHELMJHVORWHQVFKURHYHQ   DIEG 
,QVWDOOHHUGHRSHQLQJHQ  HQGHELMEHKRUHQGHDOXPLQLXPEXL]HQ  HQEHYHVWLJ]HPHWGHULQJ  HQGHSOXJJHQPHWVFKUR-
HYHQ  DDQGHPXXU DIEG 
%HYHVWLJGHULQJHQ  DDQGHPXXUPHWEHKXOSYDQVLOLFRQHQNLW DIEG 
$IED $IEE
2

5
3 132 1
5
133 2
7
6
13 4
6a

6 6a
132
$IEF 5 3 8
9 9

6 10 11

5
1('(5/$1'6

4
8
5

10 9 4
10 9
$IEG 5
8 8
4 3 2
8
7
8 6

4 5
6 5 6

Qq .,7 .,7%,6


 'RRV   
 %XLV  - 
 %XLV   -
4 2SHQLQJ   
 Ring   
6a $IGHNNLQJYRRUGHEXLV   
 %HYHVWLJLQJVVFKURHIDIGHNNLQJYRRUGHEXLV 8  
8 .OHPULQJEXL]HQ 4  
 Ring  - 
 Schroeven 4 - 
 3OXJJHQ 4 - 
- 128 -
*(%5$8&+6$1:(,681*(1
De inbedrijfstelling moet uitgevoerd worden door de erkende
technische bijstandsdienst Edilkamin, eerste opstarten en testen
YROJHQVGH125081,

Deze norm duidt aan welke controlewerkzaamheden moeten


uitgevoerd worden om de correcte werking van het systeem
te garanderen.

*HEUXLNVDDQZLM]LQJHQ
Voor het eerste opstarten is het noodzakelijk zich te wenden tot
de technische bijstandsdients Edilkamin van uw zone, (voor in-
formatie verwijzen we naar de site www.edilkamin.com) die
de kachel zal ijken op basis van het gebruikte soort pellets en
naargelang de installatievoorwaarden die de garantie activeren.
$IE
Als het opstarten niet gebeurt door een erkende technische
bijstand kan Edilkamin geen correcte werking garanderen.

7LMGHQVGHHHUVWHRQWVWHNLQJHQLVKHWPRJHOLMNGDWXHHQOLFKWH
YHUXFKWUXLNW'LW]DOELQQHQNRUWHWLMGYHUGZLMQHQ

9RRUKHWRQWVWHNLQJLVKHWKRHGDQRRNQRRG]DNHOLMNKHWYRO-
gende te controleren:
'HFRUUHFWHLQVWDOODWLH
'HHOHNWULVFKHYRHGLQJ
'HKHUPHWLVFKHDIVOXLWLQJYDQKHWGHXUWM   
'HUHLQLJLQJYDQGHYXXUKDDUG
'HVWDQGE\ZHHUJDYHRSKHWGLVSOD\
 GDWXPYHUPRJHQRINQLSSHUHQGHWHPSHUDWXXU 

&3(//(76$$1'(7$1.72(92(*(1
'HGHNVHOYDQGHWDQNNDQPHWEHKXOSYDQHHQKDQGLJ
FOLFNFODFNV\VWHHPJHRSHQGHQJHVORWHQZRUGHQGRRUOLFKWMHV
RSGHERYHQNDQWYDQGHJLHWLM]HUHQGHNVHOWHGUXNNHQ J 

1('(5/$1'6
LETOP:
PDDNJHEUXLNYDQGHVSHFLDDOJHOHYHUGHKDQGVFKRHQDOV
XSHOOHWVDDQGHNDFKHOWRHYRHJWWHUZLMOKLMEUDQGWHQGXV
ZDUPLV

230(5.,1*EHWUHIIHQGHGHEUDQGVWRI GRRUVQHGHPLOOLPHWHU
'HNDFKHO]LMQRQWZRUSHQHQJHSURJUDPPHHUGYRRUGH PD[LPXPOHQJWHPP
verbranding van pellets houtpellets 6 mm diameter. PD[LPXPYRFKWLJKHLG
3HOOHWVLVHHQEUDQGVWRILQGHYRUPYDQNOHLQHFLOLQGHUVYHUNUH- FDORULVFKUHQGHPHQWPLQVWHQVNFDONJ
gen door het samenpersen van zaagsel, heeft hoge waarden +HWJHEUXLNYDQSHOOHWVPHWDQGHUHHLJHQVFKDSSHQYHUHLVWHHQ
HQEHYDWJHHQOLMPRIDQGHUHYUHHPGHPDWHULDOHQ+RXWSHOOHWV QLHXZHLMNLQJYDQGHNDFKHOVRYHUHHQNRPVWLJPHWGHLMNLQJ
ZRUGHQYHUNRFKWLQ]DNNHQYDQ.J2PGHIXQFWLRQHULQJ GLHGH'HDOHURSKHWPRPHQWYDQGHVWHRQWVWHNLQJXLWYRHUW
YDQGHNDFKHOVQLHWLQJHYDDUWHEUHQJHQLVKHWQRRG]DNHOLMN +HWJHEUXLNYDQRQJHVFKLNWHSHOOHWVNDQOHLGHQWRWHHQDIQDPH
GDWXKLHU*((1DQGHUHPDWHULDOHQLQYHUEUDQGW+HWJHEUXLN YDQKHWUHQGHPHQWVWRULQJHQLQGHIXQFWLRQHULQJEORNNHULQ-
YDQDQGHUHPDWHULDOHQ VDPHQJHSHUVWKRXW NDQGRRUODERUDWR- gen wegens verstoppingen, bevuild glas, onverbrande stoffen,
riumtests worden aangetoond en zorgt ervoor dat de garantie (HQHHQYRXGLJHDQDO\VHYDQGHSHOOHWVNDQYLVXHHOZRUGHQ
uitgevoerd:
WHYHUYDOOHQNRPW(GLONDPLQKHHIWGHSURGXFWHQRSGXVGDQLJH
*RHGHNZDOLWHLWJODGUHJHOPDWLJHOHQJWHQLHWHUJVWRIJ
ontworpen, getest en geprogrammeerd dat de beste prestaties
6OHFKWHNZDOLWHLWmet barsten in de lengte en overdwars, zeer
YHUNUHJHQZRUGHQGRRUKHWJHEUXLNYDQKRXWSHOOHWVPHWGH
VWRIJ]HHUYDULDEHOHOHQJWHVHQDDQZH]LJKHLGYDQYUHHPGH
volgende eigenschappen: lichamen.

- 129 -
*(%5$8&+6$1:(,681*(1
SYNOPTISCH PANEEL
VFKDNHOWKHWDSSDUDDWLQHQXLWDOVXKHPLQGUXNW

(HQNRUWHGUXNVFKDNHOWGHNDFKHORPYDQKDQGPDWLJHQDDUDXWRPDWLVFKHZHUNLQJWHUZLMOKHWLQJHGUXNWKRXGHQ
JHGXUHQGH WRHJDQJYHUVFKDIWWRWGHYHUVFKLOOHQGHSURJUDPPHHUPHQXV

voor de toename van de verschillende instellingen

voor de afname van de verschillende instellingen

%LMHONHGUXNLQIRUPHHUWKHWJHKHXJHQYDQGHHOHNWURQLVFKHNDDUWGDW.JLQKHWUHVHUYRLUJHODGHQZHUGHHQGUXNGLH
GXXUWZLVWGHRYHUEOLMYHQGHRIHHUGHULQJHYRHUGH.J

(HQNRUWHGUXNVFKDNHOWGHYHQWLODWLHYDQGHNDFKHORPYDQHHQPHHUJHOXLGORRVQLYHDX&RPIRUWJHQRHPGQDDUHHQ
PHHUHQHUJHWLVFKQLYHDX7XUERJHQRHPG

'HRYHUHHQVWHPPLQJYDQGHRYHUHHQNRPVWLJHOHGSXQWHQDDQUDNHQRPKHWJHZHQVWHZHUNYHU-
mogen te selecteren.
 $OVDOWHUQDWLHINDQGHWUDGLWLRQHOHLQVWHOOLQJZRUGHQJHEUXLNWGLHZRUGWEHNRPHQYLDKHWJHEUXLN
YDQGHWRHWVHQ
1('(5/$1'6

'HYXOVFKURHIYXOOHQ +DQGPDWLJHRQWVWHNLQJ
,QKHWJHYDOGHSHOOHWVWDQNKHOHPDDOOHHJJHUDDNWLVPRHWXGH ,QKHWJHYDOGHWHPSHUDWXXUODJHUGDQq&LVZDDUGRRUGH
YXOVFKURHIYXOOHQGRRUWHJHOLMNHUWLMGHHQDDQWDOVHFRQGHQODQJ HOHNWULVFKHZHHUVWDQGQLHWNDQJDDQJORHLHQRIDOVGHZHHU-
WHGUXNNHQRSGHWRHWVHQHQ RSGHDIVWDQGVEHGLHQLQJRI VWDQGWLMGHOLMNQLHWIXQFWLRQHHUWLVKHWPRJHOLMNRPGHKDDUGWH
RSKHWV\QRSWLVFKHSDQHHO +LHUQDPRHWRSKHWGLVSOD\GH RQWVWHNHQPHWEHKXOSYDQDDQPDDNEORNMHV3ODDWVHHQEUDQGHQG
WHNVW5,&$5,&$ZHHUJHJHYHQZRUGHQ'H]HKDQGHOLQJPRHW DDQPDDNEORNMHVLQGHYXXUKDDUGVOXLWGHGHXUHQGUXNRSKHW
ZRUGHQXLWJHYRHUGYRRUGDWXGHNDFKHODDQVWHHNWDOVKLMZHJHQV V\QRSWLVFKHSDQHHORIRSGHDIVWDQGVEHGLHQLQJRSGHWRHWV
JHEUHNDDQSHOOHWVXLWJHJDDQLV+HWLVQRUPDDOGDWLQGHWDQN
HHQNOHLQHKRHYHHOKHLGSHOOHWVDFKWHUEOLMIWGDWGHYXOVFKURHI Functioneringswijze
QLHWLQVWDDWLVRSGHQHPHQ=XLJGHWDQNHHQPDDOSHUPDDQG +DQGPDWLJGHJHEUXLNHUVWHOWKHWJHZHQVWHYHUEUDQGLQJVYHU-
KHOHPDDOXLWRPGHRSKRSLQJYDQVWRIUHVWHQWHYRRUNRPHQ PRJHQLQ YDQPLQLPXPWRWPD[LPXP 
$XWRPDWLVFKGHJHEUXLNHUVWHOWELMPLGGHOYDQGHWRHWVHQYDQ
$XWRPDWLVFKHRQWVWHNLQJ GHDIVWDQGEHGLHQLQJGHJHZHQVWHWHPSHUDWXXUYDQGHNDPHULQ
'UXNDOVGHNDFKHOLQVWDQGE\VWDDWODQJRSGHWRHWV 'HNDFKHOPRGHOOHHUWELMKHWOH]HQHUYDQKHWYHUPRJHQRPGH
RSKHWV\QRSWLVFKHSDQHHORIRSGHDIVWDQGVEHGLHQLQJ 'H LQJHVWHOGHWHPSHUDWXXUWHEHUHLNHQRPGH]HGDQWHSODDWVHQRS
RQWVWHNLQJVSURFHGXUHZRUGWQXRSJHVWDUWHQKHWEHULFKW6WDUWXS YHUPRJHQ
wordt weergegeven in combinatie met het aftellen van secon-
GHQ  9RRUGHRQWVWHNLQJVIDVHLVHFKWHUJHHQYDVWHGXXU +DQGPDWLJHIXQFWLRQHULQJRSKHWV\QRSWLVFKHSDQHHOGH
LQJHVWHOGGHGXXUKLHUYDQZRUGWDXWRPDWLVFKLQJHNRUWDOVGH afstandsbediening
NDDUWOHHVWGDWHHQDDQWDOWHVWVHHQSRVLWLHIUHVXOWDDWRSJHOHYHUG 0HWHHQNDFKHOLQZHUNLQJRILQVWDQGE\ZRUGWYLDKHWHHQPD-
KHEEHQ1DRQJHYHHUPLQXWHQYHUVFKLMQWGHYODP OLJLQGUXNNHQYDQGH0(18WRHWVYDQDIKHWEHGLHQLQJVSDQHHO
DIVWDQGVEHGLHQLQJKHWRSVFKULIW9HUPRJHQDIJHEHHOGRSKHW
GLVSOD\ PHWKHWYHUPRJHQZDDUELMGHNDFKHOZHUNW 0HW
GHSOXVWRHWVYDQDIGHDIVWDQGVEHGLHQLQJLVKHWPRJHOLMNKHW
ZHUNYHUPRJHQWHYHUKRJHQ YDQ9HUPRJHQWRW9HUPRJHQ 
- 130 -
*(%5$8&+6$1:(,681*(1
$XWRPDWLVFKHIXQFWLRQHULQJRSKHWV\QRSWLVFKHSDQHHOGH 0HWEHKXOSYDQ'DLO\SURJUDPJHOGWKHWLQJHVWHOGHSURJUDP-
afstandsbediening PDGHLQJHVWHOGHSURJUDPPDVYRRUDOOHGDJHQYDQGHZHHN
'RRUGH0(18WRHWVWZHHPDDOLQWHGUXNNHQVFKDNHOWPHQRP 'RRUYHUYROJHQVWHGUXNNHQRSGHWRHWVLVKHWPRJHOLMN
YDQKDQGPDWLJHZHUNLQJQDDUDXWRPDWLVFKHZHUNLQJGHWHPSHUD- het volgende weer te geven:
WXXULQVWHOOHQGGLHPHQZLOEHUHLNHQLQKHWORNDDO RPGHWHPSH- 1R3URJUDPV
UDWXXULQWHVWHOOHQYDQq&WRWq&GHWRHWVHQHQJHEUXLNHQ VWH3URJUDPPDGDJ HHQRQWVWHNLQJHQHHQXLWGRYLQJSHU
RSGHDIVWDQGVEHGLHQLQJ HQGHNDFKHOUHJHOWKHWZHUNYHUPRJHQ GDJ GH3URJUDPPDGDJ LGHP GH3URJUDPPDGDJ LGHP 
RPGH]HWHEHUHLNHQ$OVPHQHHQWHPSHUDWXXULQVWHOWGLHODJHULV 0DDNJHEUXLNYDQGHWRHWV0(18RPGHJHJHYHQVLQ
GDQGH]HYDQKHWORNDDOZHUNWGHNDFKHODDQ9HUPRJHQ RPJHNHHUGHYROJRUGHWHWRQHQ$OVXYRRUKHWVWHSURJUDPPD
NLHVWZRUGWKHWWLMGVWLSYRRUGHRQWVWHNLQJZHHUJHJHYHQ
2SKHWGLVSOD\YHUVFKLMQW2QWVWHNLQJWLMGVWLSPHW
Uitdoven EHKXOSYDQGHWRHWVNXQWXKHWWLMGVWLSYHUDQGHUHQ
2PHHQPD[LPDDOFRPIRUWWHJDUDQGHUHQGRRIWGHNDFKHO %HYHVWLJPHW0(182SKHWGLVSOD\YHUVFKLMQW2QWVWHNLQJ
XLWWHUZLMOGHYHQWLODWRUHQYRRUGHOXFKWRPJHYLQJPHW WLMGVWLSPHWEHKXOSYDQGHWRHWVNXQWXKHWWLMGVWLS
KHW]HOIGHYHUPRJHQEOLMYHQIXQFWLRQHUHQ YHUDQGHUHQ%HYHVWLJPHW0(182SGH]HOIGHZLM]HNXQWXKHW
'UXNODQJRSGHWRHWV RSKHWV\QRSWLVFKHSDQHHORI WLMGVWLSYDQGHXLWGRYLQJHQLQVWHOOHQ'RRUHHQGUXNRSGHWRHWV
RSGHDIVWDQGVEHGLHQLQJ DOVGHNDFKHOIXQFWLRQHHUW'HXLWGR- 0(18DOVRSKHWGLVSOD\KHWEHULFKW6DYH2.ZHHUJHJHYHQ
RISURFHGXUHZRUGWRSJHVWDUWHQKHWWHUXJWHOOHQDIKDQNHOLMN wordt, bevestigt u het programma.
YDQKHWYHUPRJHQZDDURSGHNDFKHOIXQFWLRQHHUGHRSKHW $OVX:HHNO\SURJUDPEHYHVWLJWPRHWXNLH]HQYRRUGH
moment dat de uitdooffase opgestart werd, wordt weergegeven. dag waarop u het programma wenst uit te laten voeren:
'HXLWGRRIIDVH ZHONHKHWGRHOKHHIWGHYODPWHGRYHQWHYRRU- 0D'L:R'R9U=D=R
NRPHQGDWRQYHUEUDQGHUHVWHQLQGHYXXUKDDUGDFKWHUEOLMYHQHQ 8NXQWPHWEHKXOSYDQGHWRHWVHQHQODQJVGHGDJHQ
GHNDFKHODIWHODWHQNRHOHQ YRRU]LHW ORSHQ.LHVGHJHZHQVWHGDJHQEHYHVWLJPHWEHKXOSYDQGH
'HRQGHUEUHNLQJYDQSHOOHWVWRHYRHU WRHWV0(189RHUYHUYROJHQVGHUHVWYDQGHSURJUDPPHULQJ
$FWLHYHYHQWLODWLHRSKHW]HOIGHQLYHDXDOVKHWJHHQZDDURS XLWRSGHPDQLHUGLHXRRNYRRUHHQ'DLO\SURJUDP
GHNDFKHOHHUGHUIXQFWLRQHHUGH JHEUXLNW.LHVYRRUHONHGDJYDQGHZHHNRIXHHQSURJUDPPH-
0RWRUYHUZLMGHULQJURRNDFWLHI ring wenst te activeren en geef hier het aantal handelingen
9RRUNRPGDWXWLMGHQVGHXLWGRRIIDVHGHVWHNNHUXLWKHW HQGHWLMGVWLSSHQYDQDDQ,QKHWJHYDOYDQHHQIRXWNXQW
stopcontact verwijderd. XRSHONJHZHQVWPRPHQWYDQGHSURJUDPPHULQJKHWSURJUDP-
ma verlaten zonder dat u de gegevens opslaat.
.ORNLQVWHOOHQ 'UXNKLHUYRRURSGHWRHWVZDDUQD
'RRUODQJGHWRHWV0(18LQWHGUXNNHQHQGRRUYHUYROJHQV
PHWEHKXOSYDQGHWRHWVHQHQGHDDQZLM]LQJHQYDQKHW 2SPHUNLQJRYHUGHYDULDELOLWHLWYDQGHYODP
GLVSOD\RSWHYROJHQNULMJWXWRHJDQJWRWKHW0HQX&ORFN'LW (YHQWXHOHYHUDQGHULQJHQLQGHVWDDWYDQGHYODP]LMQDIKDQNH-
PHQXPDDNWKHWPRJHOLMNRPGHLQWHUQHNORNYDQGHHOHNWUL- OLMNYDQKHWJHEUXLNWHVRRUWSHOOHWVGHQRUPDOHYDULDELOLWHLW
VFKHNDDUWLQWHVWHOOHQ'RRUYHUYROJHQVRSGHWRHWV0(18WH van de vlam tijdens de verbranding van vaste brandstoffen
GUXNNHQYHUVFKLMQHQDFKWHUHHQYROJHQVGHYROJHQGHJHJHYHQV en de regelmatige reiniging van de vuurhaard die automatisch

1('(5/$1'6
ZHONHXGXVLQNXQWVWHOOHQ'DJ0DDQG-DDU8UHQ0LQXWHQ GRRUGHNDFKHOXLWJHYRHUGZRUGW1%GHDXWRPDWLVFKHUHLQL-
'DJYDQGHZHHN+HWEHULFKW6DYH"ZHONHXPRHWEHYHVWL- JLQJGLHGRRUGHNDFKHOXLWJHYRHUGZRUGWYRUPWJHHQYHUYDQ-
JHQGRRUWHGUXNNHQRSGHWRHWV0(18PDDNWKHWPRJHOLMN JLQJYDQGHQRRG]DNHOLMNHYHUZLMGHULQJYDQDVPHWEHKXOSYDQ
om te controleren of u de handelingen op correcte wijze uitge- GHVWRI]XLJHUELMNRXGHKDDUGYRRUGDWXGHKDDUGDDQVWHHNW
voerd heeft voordat u de gegevens bevestigd (nu wordt op het
GLVSOD\KHWEHULFKW6DYH2.ZHHUJHJHYHQ  Reservesignalering pellets
'HNDFKHOV]LMQYRRU]LHQYDQHHQHOHNWURQLVFKHIXQFWLH
7LMGSURJUDPPHXURQVWHNHQHQXLWGRYHQWLMGHQVGHZHHN YRRUKHWRSPHWHQYDQGHKRHYHHOKHLGSHOOHWV'LWPHHWV\VWHHP
'RRUVHFRQGHQODQJWHGUXNNHQRSGHWRHWV0(18RSKHW GDWLQGHHOHNWURQLVFKHNDDUWJHQWHJUHHUGLVELHGWGHNDFKHOGH
DIVWDQGVEHGLHQLQJNULMJWXWRHJDQJWRWGHLQVWHOOLQJHQYDQGH PRJHOLMNKHLGRPRSHONJHZHQVWPRPHQWWLMGHQVGHIXQFWLR-
NORN'RRUYHUYROJHQVWHGUXNNHQRSGHWRHWVNULMJWX QHULQJRSWHPHWHQKRHYHHONJSHOOHWVLQGHNDFKHODDQZH]LJLV
WRHJDQJWRWGHIXQFWLHZHNHOLMNVHWLMGSURJUDPPHULQJKHWJHHQ YRRUGDWGHODGLQJRSUDDNW9RRUGHFRUUHFWHIXQFWLRQHULQJYDQ
RSKHWGLVSOD\DDQJHGXLGZRUGWPHWKHWEHULFKW3URJUDP KHWV\VWHHPLVKHWEHODQJULMNGDWRSKHWPRPHQWYDQGHVWH
212))'HSURJUDPPHULQJPDDNWKHWPRJHOLMNRPHHQ RQWVWHNLQJ GRRUGH'HDOHU GHYROJHQGHSURFHGXUHXLWJHYRHUG
DDQWDORQWVWHNLQJHQHQXLWGRYLQJHQSHUGDJLQWHVWHOOHQ WRW ZRUGW9RRUGDWXYDQKHWV\VWHHPJHEUXLNPDDNWLVKHWQRRG]D-
PD[LPDDOGULH YRRUHONHGDJYDQGHZHHN1DGDWXPHWEHKXOS NHOLMNHHQKHOH]DNKRXWSHOOHWVWHODGHQHQRSWHEUDQGHQ
YDQGHWRHWV0(18EHYHVWLJGKHHIWZRUGWRSKHWGLVSOD\HHQ 'LWLVQRGLJRPKHWYXOV\VWHHPHHQNRUWHLQORRSSHULRGH
YDQGHYROJHQGHPRJHOLMNKHGHQZHHUJHJHYHQ WHELHGHQ9RHJYHUYROJHQVNJSHOOHWVWRH'UXNYHUYRO-
1R3URJ JHHQHQNHOSURJUDPPDLQJHVWHOG JHQVHHQPDDORSGHWRHWVUHVHUYH]RGDWXDDQKHWJHKHXJHQ
'DLO\SURJUDP HHQHQNHOSURJUDPPDYRRUDOOHGDJHQ DDQJHHIWGDWXNJWRHJHYRHJGKHHIW9DQQXDIDDQZRUGHQ
:HHNO\SURJUDP YRRUHONHGDJHHQDSDUWHLQVWHOOLQJ RSKHWGLVSOD\GHUHVWHUHQGHNLORVKRXWSHOOHWVLQDIQHPHQGH
8NXQWPHWEHKXOSYDQGHWRHWVHQHQODQJVGHYHUVFKLOOHQGH KRHYHHOKHLGDDQJHJHYHQ  
LQVWHOOLQJHQORSHQ'RRUPHWEHKXOSYDQGHWRHWV0(18GH (ONHNHHUGDWXKRXWSHOOHWVWRHYRHJWPRHWXKHWJHODGHQ
RSWLH'DLO\SURJUDPWHEHYHVWLJHQNXQWXKHWDDQWDOSUR- DDQWDODDQKHWJHKHXJHQGRRUJHYHQ2PDDQKHWJHKHXJHQ
JUDPPDV RQWVWHNLQJHQXLWGRYLQJHQ SHUGDJEHSDOHQ PHHWHGHOHQGDWXNJWRHJHYRHJGKHHIWLVKHWYROGRHQGH
- 131 -
*(%5$8&+6$1:(,681*(1
RSGHWRHWVSHOOHWVODGHQWHGUXNNHQ,QGLHQ :DQQHHUGHRPJHYLQJVWHPSHUDWXXUZRUGWEHUHLNW q& 
u andere hoeveelheden toevoegt of in het geval van fouten VFKDNHOWGHNDFKHORYHURSVWDQGE\'HRPJHYLQJVWHPSHUD-
NXQWXGHKRHYHHOKHLGDDQJHYHQLQKHWPHQXUHVHUYH tuur wordt door de bijgeleverde afstandsbediening verzonden;
pellets, op de wijze die hieronder beschreven staat. de zender van de afstandsbediening dient naar de ontvanger
'UXNODQJRSGHWRHWV0(18WRWKHWEHULFKW6(77,1*6 van het synoptische paneel gericht te worden.
ZHHUJHJHYHQZRUGW'UXNYHUYROJHQVRSGHWRHWVRIKHW $OVGHDIVWDQGVEHGLHQLQJQLHWFRUUHFWJHULFKWZRUGWHQELMJH-
EHULFKW5,6(59$ZRUGWZHHUJHJHYHQ%HYHVWLJPHWGHWRHWV YROJGHWHPSHUDWXXUQLHWZRUGWYHU]RQGHQEHVOLVWGHNDFKHODX-
0(18'HDDQZH]LJHKRHYHHOKHLGSHOOHWVKHWWRHJHYRHJGH WRPDWLVFKRPGHJHQVWDOOHHUGHWHPSHUDWXXUVHQVRUWHJHEUXLNHQ
DDQWDOZRUGWZHHUJHJHYHQ GHIDXOWZDDUGHZHONHXPHW totdat de verbinding met de afstandsbediening wordt hersteld.
EHKXOSYDQGHWRHWVHQNXQWZLM]LJHQ 
'RRUKHWLQUXNNHQYDQGHSOXVWRHWVZRUGHQGHLQWHEUHQJHQ 'HWHPSHUDWXXUUHJHOHQPHWHHQH[WHUQHWKHUPRVWDDW
.JYHUPHHUGHUGGRRUKHWLQGUXNNHQYDQGHPLQWRHWVZRUGHQ HULVHHQELMNRPHQGV\VWHHPEHVFKLNEDDUGDWQDDVWGHDIVWDQ-
]HYHUPLQGHUG'RRUKHUKDDOGHOLMNGHPLQWRHWVLQWHGUXNNHQ GVEHGLHQLQJGHRPJHYLQJVWHPSHUDWXXUFRQWUROHHUW+HWLV
ZRUGWGHODGLQJ.JEHUHLNW 5RSKHWGLVSOD\ ZDWWRHODDWGH LPPHUVPRJHOLMNRPGHRPJHYLQJVWKHUPRVWDDWYDQGHZRQLQJ
resterende lading te wissen. of een andere thermostaat (uitgang met schoon contact) aan te
,QKHWJHYDOGHSHOOHWVLQGHWDQNRSUDNHQZRUGWGHNDFKHOJH- sluiten op de serile poort.
EORNNHHUGZDDUQDKHWEHULFKW6WRS)ODPHZHHUJHJHYHQZRUGW
]LHSDJ  'HNDFKHOKHUNHQWDXWRPDWLVFKGHDDQVOXLWLQJRSGHVHULOH
1%2QWKRXGGDWXWHONHQVGHVLJQDOHULQJSHOOHWUHVHUYH poort van de thermostaat in de volgende omstandigheden:
UHVHW]RGDWGH]HIXQFWLH]REHWURXZEDDUPRJHOLMNLV -Wanneer de omgevingstemperatuur lager is dan de ingestelde
1HHPYRRURYHULJHLQIRUPDWLHFRQWDFWRSPHWGH'HDOHU temperatuur op de thermostaat (gesloten contact), moduleert de
GLHGHVWHRQWVWHNLQJXLWJHYRHUGKHHIW WKHUPRNDFKHOGHEUDQGNUDFKWRSQRUPDOHZLM]HRPGHWRHYR-
Het gaat om een referentie waarnaar verwezen wordt. HUZDDUGHWHEHUHLNHQ
Een grotere nauwkeurigheid wordt bekomen via een een reset :DQQHHUGHRPJHYLQJVWHPSHUDWXXUZRUGWEHUHLNW JHRSHQG
voor het herladen. FRQWDFW VFKDNHOWGHNDFKHORYHURSVWDQGE\
Edilkamin is niet aansprakelijk voor variaties van het voorno-
emde (kan afhankelijk zijn van externe factoren). 7HPSHUDWXXU
7HPSHUDWXXU
geleverd door *HHQUHJHOLQJ
geleverd door
'HRPJHYLQJVWHPSHUDWXXUUHJHOHQ &RQJXUDWLH GHH[WHUQH IDEULHNVLQVWHO-
afstandsbedie-
omgevingsther- ling)
een handige en eenvoudige regeling die standaard voorzien is ning
mostaat
ELMGH]HUHHNVXNXQWGHEUDQGNUDFKWYDQGHNDFKHOLQVWHOOHQRS
basis van de omgevingstemperatuur. 3DUDPHWHU
1DGDWXGHIXQFWLH&RPIRUW&OLPDDFWLYHHUWYLDKHWSDUD- &RPIRUW 21 21 21
PHWHUPHQX JHOLHYHGLWDDQXZGHDOHUWHYUDJHQ NXQWXGH]H &OLPD
IXQFWLHJHEUXLNHQRPGHNDFKHOXLWWHVFKDNHOHQZDQQHHUGH
LQJHVWHOGHWHPSHUDWXXUZRUGWEHUHLNW'H]HIXQFWLHPDDNWGHHO 3DUDPHWHU
1('(5/$1'6

21 2)) 21
XLWYDQGHLQVWHOOLQJYDQGHNDFKHOLQ$8720$7,6&+(PR- 621'(,5
GXVGHZHUNLQJLQ+$1'0$7,*(PRGXVEOLMIWKRHGDQRRN
ongewijzigd. -D
$DQVOXLWLQJRS 1(( 1((
met blauwe
1DGDWGHGHDOHUGHIXQFWLH&RPIRUW&OLPDKHHIWJHDFWLYHHUG de serile poort geen verbinding geen verbinding
VHULOHNDEHO
NXQWXGHIXQFWLHLQXLWVFKDNHOHQYLDKHWJHEUXLNHUVPHQX
GUXNRSGHWRHWV6(7]RHNKHWPHQX&RPIRUW&OLPDPHWGH
WRHWVHQVHOHFWHHUKHWPHWGHWRHWV6(7VWHO212))LQPHW
GHWRHWVHQVODGHJHZHQVWHLQVWHOOLQJRSGRRUKHWPHQXWH
YHUODWHQPHWEHKXOSYDQGHWRHWV

'HWDLOVZHUNLQJ&RPIRUW&OLPD21
ZDQQHHUGHNDFKHOLQJHVWHOGLVRS$8720$7,6&+PRGXOH-
HUWKLMGHEUDQGNUDFKWWRWGHWHPSHUDWXXUEHUHLNWZRUGWGLHGRRU
GHJHEUXLNHULVLQJHVWHOG:DQQHHUGHRPJHYLQJVWHPSHUDWXXU
ZRUGWEHUHLNWZRUGWGHNDFKHOXLWJHVFKDNHOG'HNDFKHOZRUGW
DXWRPDWLVFKLQJHVFKDNHOGZDQQHHUGHWHPSHUDWXXUGDDOW

'HWHPSHUDWXXUVHOHFWHUHQ
,QGHPRGDOLWHLW&RPIRUW&OLPDZDQQHHUXRSGHWRHWVHQ
RSKHWV\QRSWLVFKHSDQHHORIGHDIVWDQGVEHGLHQLQJGUXNWNXQWX
op het display de gewenste temperatuur in de ruimte instellen;
dit leidt tot de volgende situaties:
- Wanneer de omgevingstemperatuur lager is dan de ingestel-
GHWHPSHUDWXXUZRUGWGHNDFKHODXWRPDWLVFKLQJHVFKDNHOGHQ
PRGXOHHUWKLMGHEUDQGNUDFKW
- 132 -
*(%5$8&+6$1:(,681*(1
$)67$1'6%(',(1,1*FRGH

Legenda toetsen en dispaly:


WRHWVRQWVWHNLQJXLWGRYLQJ
+ WRHWVRPKHWYHUPRJHQGHEHGULMIVWHPSHUDWXXUWRHWHODWHQQHPHQ LQHHQPHQXQHHPWGHZHHUJHJHYHQYDULDEHOHWRH
- WRHWVRPKHWYHUPRJHQGHEHGULMIVWHPSHUDWXXUDIWHODWHQQHPHQ LQHHQPHQXQHHPWGHZHHUJHJHYHQYDULDEHOHDI
A WRHWVZDDUPHHXRSGH($6<7,0(5SURJUDPPHULQJRYHUVFKDNHOW
MWRHWVZDDUPHHXYDQDXWRPDWLVFKQDDUKDQGPDWLJHQRPJHNHHUGRYHUVFKDNHOW

*HHIWGHWUDQVPLVVLHZHHUYDQJHJHYHQVYDQGHDIVWDQGVEHGLH-
QLQJQDDUGHNDDUW

WRHWVHQYHUJUHQGHOGWHUYRRUNRPLQJYDQRQJHZHQVWHDFWLYH-
ULQJHQ GUXNWHJHOLMNHUWLMGHHQDDQWDOVHFRQGHQODQJRS$HQ
0RPGHWRHWVHQWHYHUJUHQGHOHQRQWJUHQGHOHQ 
EDWWHULMRS DONDOLQHEDWWHULMHQPLQLVWLOR

,QGLFDFKHVLVWDLPSRVWDQGRXQDFFHQVLRQHVSHJQLPHQWRFRQLO
programma EASY TIMER

*HHIWGHRPJHYLQJVWHPSHUDWXXUDDQGLHGRRUGHDIVWDQGVEH-
GLHQLQJJHPHWHQLV WLMGHQVGHWHFKQLVFKHFRQJXUDWLHYDQGH
afstandsbediening geeft hij de waarde aan van de ingestelde
parameters).
*HHIWDDQGDWXGHRSGUDFKWGRRUJH]RQGHQKHHIWRPGHNDFKHO
WHRQWVWHNHQ

LQGLFDWRULQVWHOOLQJDIVWDQGVEHGLHQLQJYRRUHHQKRXWOXFKWND-
chel

automatische functionering
(op het display wordt de temperatuur weergegeven)

1('(5/$1'6
functie handmatige instelling (op het display
wordt de waarde van het bedrijfsvermogen weergegeven)

7(03(5$7885*(0(7(1'225'($)67$1'6%(',(1,1*
'HDIVWDQGVEHGLHQLQJLVXLWJHUXVWPHWHHQLQWHUQHWHPSHUDWXXUPHWHUYRRUKHWRSPHWHQYDQGHRPJHYLQJVWHPSHUDWXXU'HJHPH-
WHQZDDUGHZRUGWGLUHFWRSKHWGLVSOD\YDQGHDIVWDQGVEHGLHQLQJZHHUJHJHYHQ'HJHPHWHQWHPSHUDWXXUZRUGWUHJHOPDWLJDDQGH
HOHNWURQLVFKHNDDUWYDQGHLQERXZKDDUGNDFKHOGRRUJHJHYHQDOVGHOHG]HQGHUYDQGHDIVWDQGVEHGLHQLQJHQGHRQWYDQJVWVHQVRU
YDQKHWV\QRSWLVFKHSDQHHOYDQGHLQERXZKDDUGNDFKHOHONDDUNXQQHQ]LHQ$OVPHHUGDQPLQXWHQODQJGHWHPSHUDWXXUYDQ
GHDIVWDQGVEHGLHQLQJQLHWDDQGHHOHNWURQLVFKHNDDUWYDQGHLQERXZKDDUGNDFKHOGRRUJHJHYHQZRUGW]DOGHLQERXZKDDUGNDFKHO
JHEUXLNPDNHQYDQGHWHPSHUDWXXUGLHJHPHWHQZRUGWGRRUGHWHPSHUDWXXUPHWHUDDQJHVORWHQRSKHWV\QRSWLVFKHSDQHHO

.(8=()81&7,21(5,1*6:,-=(
0HWEHKXOSYDQHHQNRUWHGUXNRSGHWRHW0NXQWXODQJVGHYROJHQGHIXQFWLHVORSHQHQ]HLQVWHOOHQ
automatische instelling van het vermogen

handmatige instelling van het vermogen

- 133 -
*(%5$8&+6$1:(,681*(1
+(7352*5$00$($6<7,0(5*(%58,.(1
0HWEHKXOSYDQGHDIVWDQGVEHGLHQLQJNXQWXHHQLQWXWLHYHHQVQHOOHXXUSURJUDPPHULQJJHEUXLNHQ
- $OVGHNDFKHODDQVWDDWXNXQWHHQXLWGRYLQJLQVWHOOHQQDQWRWWZDDOIXXURSKHWGLVSOD\YDQKHWV\QRSWLVFKHSDQHHOZRUGWGH
resterende tijd tot de geprogrammeerde uitdoving weergegeven.
- $OVGHNDFKHOXLWVWDDWXNXQWHHQRQWVWHNLQJLQVWHOOHQQDQWRWWZDDOIXXURSKHWGLVSOD\YDQKHWV\QRSWLVFKHSDQHHOZRUGWGH
UHVWHUHQGHWLMGWRWGHJHSURJUDPPHHUGHRQWVWHNLQJZHHUJHJHYHQ

,QVWHOOLQJYRHUGHYROJHQGHSURFHGXUHXLWRPGHWLPHULQWHVWHOOHQ
D 'UXNRSGHWRHWV$2SKHWGLVSOD\ZRUGWGHLFRRQ weergegeven waarmee de toegang tot de programmering
(DV\WLPHUDDQJHJHYHQZRUGW
E 6WHOKHWJHZHQVWHDDQWDOXUHQLQPHWEHKXOSYDQGHWRHWVHQELMYRRUEHHOG

c) Richt de afstandsbediening op de ontvanger van het synoptische paneel.


G %HYHVWLJGHSURJUDPPHULQJGRRUGHWRHWV$HHQDDQWDOVHFRQGHQODQJLQJHGUXNWWHKRXGHQ+HWV\PERRO verdwijnt en op
het synoptische paneel wordt de resterende tijd tot het geprogrammeerde onderhoud weergegeven.

G %HYHVWLJGHSURJUDPPHULQJGRRUHHQDDQWDOVHFRQGHQODQJGHWRHWV$LQJHGUXNWWHKRXGHQ'HLFRRQ

9(5*5(1'(/,1*72(76(1
+HWLVPRJHOLMNRPGHWRHWVHQYDQGHDIVWDQGVEHGLHQLQJWHYHUJUHQGHOHQRPRQJHZHQVWHHQRQJHFRQWUROHHUGHRQWVWHNLQJHQ
WHYRRUNRPHQ'UXNWHJHOLMNHUWLMGRSGHWRHWVHQ$HQ0+HWVOHXWHOV\PERROZRUGWZHHUJHJHYHQWHULQGLFDWLHGDWGHWRHWVHQYHU-
JUHQGHOG]LMQ'UXNZHGHURPWHJHOLMNHUWLMGRSGHWRHWVHQ$HQ0RPGHWRHWVHQWHRQWJUHQGHOHQ

,1',&$7,(%$77(5,-(1/((*
+HWRSOLFKWHQYDQGHEDWWHULMHQLFRRQJHHIWDDQGDWGHEDWWHULMHQYDQGHDIVWDQGVEHGLHQLQJELMQDOHHJ]LMQ9HUYDQJ]H
PHWGULHVRRUWJHOLMNHEDWWHULMHQ VL]H$$$9 
9RRUNRPKHWJHFRPELQHHUGHJHEUXLNYDQQLHXZHHQJHGHHOWHOLMNJHEUXLNWHEDWWHULMHQLQXZDIVWDQGVEHGLHQLQJ
9RRUNRPKHWJHFRPELQHHUGHJHEUXLNYDQGLYHUVHPHUNHQHQVRRUWHQEDWWHULMHQRPGDWHONVRRUWHQHONPHUNYHUVFKLOOHQGH
eigenschappen heeft.
9RRUNRPKHWPHQJHQYDQQRUPDOHHQRSODDGEDUHEDWWHULMHQ
3UREHHUQRRLWRPDONDOLQHHQ]LQNNRROVWRIEDWWHULMHQRSWHODGHQ+LHUGRRUNXQQHQ]HEHVFKDGLJGUDNHQHQNDQGH
1('(5/$1'6

vloeistof naar buiten lopen.

*(%58,.(56,1)250$7,(
,QRYHUHHQVWHPPLQJPHWKHWDUWLNHOYDQKHW,WDOLDDQVHZHWVEHVOXLWMXOLQU7HQXLWYRHUOHJJLQJYDQGH5LFKWOLMQHQ
(*(*HQ(*PHWEHWUHNNLQJWRWGHEHSHUNLQJLQKHWJHEUXLNYDQJHYDDUOLMNHVWRIIHQLQHOHNWULVFKH
HQHOHNWURQLVFKHDSSDUDWXXUDOVPHGHGHDIYDOYHUZHUNLQJ+HWV\PERROPHWGHGRRUJHKDDOGHYXLOQLVWRQRSGHDSSDUDWXXURIRS
GHYHUSDNNLQJJHHIWDDQGDWKHWDSSDUDDWDDQKHWHLQGHYDQ]LMQQXWWLJOHYHQJHVFKHLGHQYDQKHWRYHULJHDIYDOYHU]DPHOGPRHW
ZRUGHQ'HJHEUXLNHUPRHWDDQKHWHLQGHYDQKHWOHYHQGHDSSDUDWXXUGXVQDDUVSHFLDOHYHU]DPHOFHQWUDYRRUGHJHVFKHLGHQ
LQ]DPHOLQJYDQHOHNWULVFKHQHOHNWURQLVFKDIYDOEUHQJHQRIPRHWKHPELMGHYHUNRSHULQOHYHUHQRSKHWPRPHQWGDWKLMVRRUWJHOLM-
NHDSSDUDWXXUDDQVFKDIWELMGHYHUNRSHU
- 134 -
21'(5+28'
.RSSHOKHWDSSDUDDWYDQGHHOHNWULVFKHYRHGLQJORVYRRUGDWXHHQZLOOHNHXULJHRQGHUKRXGVZHUN]DDPKHLGXLWYRHUW
5HJHOPDWLJRQGHUKRXGYRUPWGHEDVLVHHQJRHGHIXQFWLRQHULQJYDQXZNDFKHO

+(71$/$7(19$123=,-10,167'(6(,=2(16*(%21'(15(,1,*,1*NDQHHQVOHFKWHIXQFWLRQHULQJYHURRU]D-
NHQ'HJDUDQWLHLVQLHWODQJHUJHOGLJLQKHWJHYDOYDQHYHQWXHOHSUREOHPHQJHERQGHQDDQQDODWLJRQGHUKRXG

230(5.,1*(ONHNJZRUGWKHWEHULFKW0DLQWHQZHHUJHJHYHQWHUKHULQQHULQJGDWGHHLJHQDDUGHURRNNDQDOHQ
PRHWODWHQUHLQLJHQ+HWEHULFKWNDQJHZLVWZRUGHQGRRUVHFRQGHQRSGHWRHWV785%2WHGUXNNHQ
1DNJSHOOHWVZRUGWKHWEHULFKW0DLQWHQGHDOHUZHHUJHJHYHQ'HHLJHQDDUNDQGLWEHULFKWQLHWZLVVHQHQPRHW
]LFKGXVZHQGHQWRWGHGHDOHU'LWEHULFKWNDQLQKHWSDUDPHWHUPHQXZRUGHQJHUHVHW

1%
2QEHYRHJGHZLM]LJLQJHQ]LMQYHUERGHQ
*HEUXLNUHVHUYHRQGHUGHOHQGLHGRRUGHIDEULNDQWZRUGHQDDQEHYROHQ
- Het gebruik van niet-originele onderdelen brengt het vervallen van de garantie met zich mee.

'$*(/,-.621'(5+28'
+DQGHOLQJHQGLHELMXLWJHGRRIGHNRXGHHQYDQKHWOLFKWQHWORVJHNRSSHOGHNDFKHOYHUULFKWPRHWHQZRUGHQ
'H]HUHLQLJLQJPRHWPHWEHKXOSYDQHHQVWRI]XLJHUZRUGHQXLWJHYRHUG ]LHGHRSWLHVRSSDJ
'H]HSURFHGXUHYHUHLVWHHQDDQWDOPLQXWHQSHUGDJ
2SHQKHWGHXUWMHYHUZLMGHUGHDVODGHHQOHHJKHP J% 
*22,'(5(67(1122,7,1'(3(//(77$1.
9HUZLMGHUGHYXXUKDDUGRIPDDNKHPPHWEHKXOSYDQHHQVSDWHOWMHVFKRRQYHUZLMGHUGHHYHQWXHOHYHUVWRSSLQJHQXLWGHRSHQLQ-
JHQDDQGH]LMNDQWHQ
9HUZLMGHUGHYXXUKDDUG DIE& VFKUDDSGHZDQGHQYDQGHYXXUKDDUGPHWKHWVSDWHOWMHHQYHUZLMGHUHYHQWXHHOYXLOXLWGHVOHXYHQ
=XLJGHUXLPWHYDQGHYXXUKDDUGUHLQLJGHFRQWDFWUDQGHQ
5HLQLJKHWJODVLQGLHQQRRG]DNHOLMN ELMNRXGHKDDUG 

=XLJGHZDUPHDVQRRLWRSRPVFKDGHDDQGHVWRI]XLJHUHQEUDQGLQGHZRQLQJWHYHUPLMGHQ

1('(5/$1'6
**
$IE% $IE&
:(.(/,-.621'(5+28'
5HLQLJGHKDDUG PHWHHQERUVWHO QDGDWXGHURRNVFKRWWHQYHUZLMGHUGKHHIW J'( 
*HEUXLNGHUDJHUV DIE( 
/HHJGHWDQNHQ]XLJGHERGHPKLHUYDQOHHJ
+HIGHURRNGRSSHQ J) RSWLMGHQVKHWUHLQLJHQYDQGHYXXUKDDUGHQ]XLJGHRQGHUVWDDQGHOHLGLQJHQXLW J) 

 


* 2
2
$IE' $IE( $IE)
- 135 -
21'(5+28'
6(,=2(16*(%21'(121'(5+28' GRRUXZ'HDOHU
%HVWDDWXLW
$OJHKHOHUHLQLJLQJYDQGHELQQHQHQEXLWHQNDQW
'HZLVVHOOHLGLQJHQVFKRRQPDNHQJHSODDWVWELQQHQLQGHURRVWHUYDQGHOXFKWXLWJDQJNRXGHOXFKWGLH]LFKEHYLQGWLQKHWKRJHUH
gedeelte van de voorkant van de kachel.
=RUJYXOGLJHUHLQLJLQJHQYHUZLMGHULQJYDQGHDI]HWWLQJHQLQGHYXXUKDDUGHQGHGHVEHWUHIIHQGHUXLPWH
5HLQLJLQJYDQGHYHQWLODWRUHQPHFKDQLVFKHFRQWUROHYDQGHVSHOLQJHQHQGHEHYHVWLJLQJHQ
5HLQLJLQJURRNNDQDDO YHUYDQJLQJYDQGHSDNNLQJRSGHURRNDIYRHUOHLGLQJ
5HLQLJLQJURRNNDQDDO ]LHZHNHOLMNVHUHLQLJLQJ
5HLQLJLQJYDQGHYHQWLODWLHUXLPWHYRRUURRNYHUZLMGHULQJUHLQLJLQJVWURRPVHQVRUFRQWUROHWKHUPRNRSSHO
5HLQLJLQJFRQWUROHHQYHUZLMGHULQJYDQGHDI]HWWLQJHQ
5HLQLJLQJGHRQWVWHNLQJVZHHUVWDQG
5HLQLJLQJLQGLHQQRRG]DNHOLMNGHZHHUVWDQGYHUYDQJHQ
5HLQLJLQJFRQWUROHYDQKHW6\QRSWLVFKH3DQHHO
9LVXHOHUHLQLJLQJYDQGHHOHNWULVFKHNDEHOVGHDDQVOXLWLQJHQHQGHYRHGLQJVNDEHO
5HLQLJLQJSHOOHWVWDQNHQFRQWUROHVSHOLQJYXOVFKURHIUHGXFWLHPRWRU
'HSDNNLQJYDQKHWGHXUWMHYHUYDQJHQ
)XQFWLRQHULQJVWHVWYXOOHQYXOVFKURHIRQWVWHNLQJIXQFWLRQHULQJPLQXWHQODQJHQXLWGRYLQJ

,QKHWJHYDOX]HHUUHJHOPDWLJYDQGHNDFKHOJHEUXLNPDDNWUDGHQZHXDDQRPKHWURRNNDQDDOHHQVLQGHPDDQGHQWHUHLQLJHQ

LET OP!!!
1DGHQRUPDOHUHLQLJLQJNDQGH21-8,67(DDQVOXLWLQJYDQGHERYHQVWHYXXUKDDUG $  DIEHHOGLQJ RSGHRQGHUVWH
YXXUKDDUG %  DIEHHOGLQJ GHIXQFWLRQHULQJYDQGHNDFKHOLQJHYDDUEUHQJHQ
&RQWUROHHUDOYRUHQVXGHNDFKHORQWVWHHNWRIGHKDDUGHQRSFRUUHFWHZLM]HRSHONDDU]LMQDDQJHVORWHQ]LH DIE HQRIRS
de steunranden geen as of onverbrande producten aanwezig zijn.

A
1('(5/$1'6

$IE $IE

- 136 -
02*(/,-.(6725,1*(1
,,QGLWJHYDONRPWGHNDFKHODXWRPDWLVFKWRWVWLOVWDQGHQYRHUWGHXLWGRRIIDVHXLW2SKHWGLVSOD\ZRUGWHHQEHULFKW
PHWGHUHGHQYRRUKHWXLWGRYHQZHHUJHJHYHQ ]LHKLHURQGHUGHGLYHUVHVLJQDOHULQJHQ 

+DDOWLMGHQVKHWXLWGRYHQZHJHQVHHQEORNNHULQJGHVWHNNHUQRRLWXLWKHWVWRSFRQWDFW

%LMEORNNHULQJPRHWHHUVWGHGRRISURFHGXUHXLWJHYRHUGZRUGHQRPGHKDDUGWHNXQQHQRQWVWHNHQ VHFRQGHQPHWJHOX-
LGPHOGLQJ 'UXNYHUYROJHQVRSGHWRHWV

2QWVWHHNGHNDFKHOQRRLW]RQGHUGDWXGHRRU]DDNYDQGHEORNNHULQJYDVWJHVWHOGHQGHYXXUKDDUG*(5(,1,*'*(-
/((*'KHHIW

6,*1$/(5,1*9$1'(02*(/,-.(225=$.(19$1'(%/2..(5,1*(1,1',&$7,(6(123/266,1*(1
 6LJQDOHULQJ9HULFDLURZ(grijpt in wanneer de sensor onvoldoende brandbevorderende luchtstroming waarneemt).
6WRULQJGRYLQJGRRUJHEUHNDDQGUXNYHUODJLQJ
'HVWURRPNDQRQYROGRHQGH]LMQLQGLHQGHGHXULVJHRSHQGLQGLHQGHGHXUQLHWSHUIHFWGLFKWLV ELMYRRUEHHOG
  SDNNLQJ LQGLHQHUHHQSUREOHHPLVPHWGHDI]XLJLQJYDQGHOXFKWRIGHDIYRHUYDQURRNLQGLHQKHWKDDUGRQ
derstel vuil is.
Handelingen: &RQWUROHHU
  RIGHGHXULVJHVORWHQ
  KHWDDQ]XLJNDQDDOYDQYHUEUDQGLQJVOXFKW VFKRRQPDNHQHQGDDUELMOHWWHQRSGHRQGHUGHOHQYDQGHOXFKWVWURRPVHQVRU 
  PDDNGHOXFKWVWURRPVHQVRUVFKRRQPHWGURJHOXFKW W\SHYRRUFRPSXWHUWRHWVHQERUG 
  GHSODDWVLQJYDQGHNDFKHOGHNDFKHOPDJQLHWWHJHQHHQPXXUOHXQHQ
  RIKHWKDDUGRQGHUVWHOJRHGLVWHUXJJHSODDWVWHQUHJHOPDWLJZRUGWVFKRRQJHPDDNW IUHTXHQWLHDIKDQNHOLMNYDQ
het soort pellets);
  KHWURRNNDQDDO VFKRRQPDNHQ 
  GHLQVWDOODWLH LQGLHQGHLQVWDOODWLHQLHWFRQIRUPGHQRUPHQLVHQ]HYHUVFKLOOHQGHERFKWHQKHHIWYLQGWJHHQ
  JRHGHURRNDIYRHUSODDWV 
  ,QGLHQXGHQNWGDWGHOXFKWVWURRPVHQVRUGHIHFWLVYRHUGDQHHQNRXGHWHVWXLW,QGLHQELMYRRUEHHOGELM 
gewijzigde omstandigheden of bij het openen van de deur, de waarde op het scherm niet verandert, dan is er
een probleem met de sensor.

N.B.: +HWRQGHUGUXNDODUPNDQHYHQHHQVRSWUHGHQWLMGHQVKHWDDQVWHNHQZDQWGHOXFKWVWURRPVHQVRUEHJLQW
  VHFRQGHQQDKHWEHJLQYDQGHRQWVWHHNF\FOXVWHPHWHQ

 6LJQDOHULQJ9HULFH[WUDFW LQJUHHSZDQQHHUGHVHQVRUYDQGHWRHUHQYRRUURRNXLWVWRRWHHQDIZLMNLQJGHWHFWHHUW
6WRULQJ'RYLQJGRRUGDOLQJYDQGHURRNWHPSHUDWXXU
Handelingen: &RQWUROHHUGHZHUNLQJYDQGHURRNXLWVWRRW DDQVOXLWLQJYDQGHVHQVRUYRRUGHWRHUHQ HQGHNDDUW 'HDOHU
&RQWUROHHUGHUHLQLJLQJYDQKHWURRNNDQDDO
&RQWUROHHUKHWHOHNWULVFKHFLUFXLWHQGHDDUGLQJ
&RQWUROHHUGHHOHNWURQLVFKHNDDUW 'HDOHU

1('(5/$1'6
 6LJQDOHULQJ6WRS)ODPH LQJUHHSZDQQHHUKHWWKHUPRNRSSHOHHQNOHLQHUHURRNWHPSHUDWXXUZDDUQHHPWGDQGH
ingestelde waarde en dit interpreteert als afwezigheid van vlam)
6WRULQJ'RYLQJGRRUGDOLQJYDQGHURRNWHPSHUDWXXU
JHEUHNDDQSHOOHW
  WHYHHOSHOOHWKHHIWGHYODPJHGRRIGFRQWUROHHUGHNZDOLWHLWYDQGHSHOOHWV 'HDOHU
  GHWKHUPRVWDDWJUHHSLQ YDOW]HOGHQYRRUKLMJULMSWVOHFKWVLQELMRYHUPDWLJHURRNWHPSHUDWXXU  'HDOHU

 6LJQDOHULQJ%ORFNB),126WDUW JULMSWLQLQGLHQLQHHQPD[LPXPWLMGYDQPLQXWHQJHHQYODPYHUVFKLMQWRI
GHRQWVWHNLQJVWHPSHUDWXXUQLHWZHUGEHUHLNW 
6WRULQJ'RYLQJGRRUQLHWFRUUHFWHURRNWHPSHUDWXXUELMGHRQWVWHNLQJ
2QGHUVFKHLGGHYROJHQGHWZHHJHYDOOHQ
(ULV*((1YODP
Handelingen: &RQWUROHHUGHSRVLWLHHQQHWKHLGYDQKHWKDDUGRQGHUVWHO
GHDDQYRHUYDQYHUEUDQGLQJVOXFKWLQKHWKDDUGRQGHUVWHO 'HDOHU 
GHJRHGHZHUNLQJYDQGHZHHUVWDQG
GHRPJHYLQJVWHPSHUDWXXU LQGLHQPLQGHUGDQq&JHEUXLNGDQHHQDDQPDDNEORNMH HQGHYRFKWLKHLGVJUDDG
3UREHHUDDQWHVWHNHQPHWHHQDDQPDDNEORNMH ]LHRSSDJ
(ULVHHQYODPPDDUQDGHERRGVFKDS6WDUWYHUVFKLMQWGHERRGVFKDS6WDUW)DLOHG
Handelingen: &RQWUROHHU 'HDOHU 
GHJRHGHZHUNLQJYDQKHWWKHUPRNRSSHO
GHJHSURJUDPPHHUGHRQWVWHNLQJVWHPSHUDWXXULQGHSDUDPHWHUV
/HHJGHYXXUSRWHQKHUKDDOGHRQWVWHNLQJ

 6LJQDOHULQJ)DLOXUH3RZHU GLWLVJHHQGHIHFWYDQGHNDFKHO 
6WRULQJ8LWGRYHQGRRUJHEUHNDDQHOHNWULVFKHHQHUJLH
Handelingen: &RQWUROHHUGHHOHNWULVFKHDDQVOXLWLQJHQHYHQWXHOHVSDQQLQJVYDOOHQ

- 137 -
02*(/,-.(6725,1*(1
 6LJQDOHULQJ)DXOW5& LQJUHHSELMGHIHFWRIRQWNRSSHOGWKHUPRNRSSHO
6WRULQJ8LWGRYLQJGRRUGHIHFWRIRQWNRSSHOGWKHUPRNRSSHO
Handelingen: &RQWUROHHUKHWVRRUWSHOOHWV
  &RQWUROHHURIGHPRWRUURRNYHUZLMGHUDDUVWRULQJHQYHUWRRQW
  &RQWUROHHURIKHWURRNNDQDDOYHUVWRSWLV
  &RQWUROHHUGHFRUUHFWHLQVWDOODWLH
  &RQWUROHHUGHHYHQWXHOHGULIWYDQGHUHGXFWLHPRWRU
  &RQWUROHHURILQGHUXLPWHHHQOXFKWWRHYRHUDDQZH]LJLV

 6LJQDOHULQJVPRNHq&KLJK XLWGRYLQJGRRUWHKRJHWHPSHUDWXXUYDQGHURRN
Storing: XLWGRYHQGRRURYHUVFKULMGLQJYDQGHPD[LPXPWHPSHUDWXXUYDQGHURRN
(HQRYHUPDWLJHWHPSHUDWXXUYDQGHURRNNDQDIKDQNHOLMN]LMQYDQKHWW\SHSHOOHWDIZLMNLQJ
URRN]XLJLQJYHUVWRSWURRNNDQDDOQLHWFRUUHFWHLQVWDOODWLHDIZLMNLQJYDQKHWGULMIZHUN

8) 6LJQDOHULQJ $/$50+22*63$11,1* Doet zich voor bij een abnormaal en overdreven stroomverbruik van de
reductiemotor.
+DQGHOLQJHQ Werking controleren (technische bijstandsdienst): reductiemotor - elektrische aansluiting en elektronische kaart.
9) 6LJQDOHULQJ $/$50/$$*63$11,1* Doet zich voor bij een abnormaal en onvoldoende stroomverbruik van de
reductiemotor.
+DQGHOLQJHQ Werking controleren (technische bijstandsdienst): reductiemotor - drukregelaar - thermostaat reservoir -
elektrische aansluitingen en elektronische kaart

 6LJQDOHULQJ%DWWHU\FKHFN
6WRULQJ'HNDFKHOZRUGWQLHWXLWJHVFKDNHOGRQGDQNVGDWGLWEHULFKWRSKHWGLVSOD\ZHHUJHJHYHQZRUGW
Handelingen: 'HEXIIHUEDWWHULMRSGHLQERXZKDDUGPRHWZRUGHQYHUYDQJHQ 'HDOHU Er wordt aan herinnerd dat dit een
onderdeel is dat onderhevig is aan slijtage en dus niet gedekt is door de garantie.

 6WRULQJ$IVWDQGVEHGLHQLQJZHUNWQLHW
Handelingen: GLFKWHUELMGHRQWYDQJHUYDQGHNDFKHO
YHUYDQJPHWDQGHUHEDWWHULMHQ

 6WRULQJ8LWNRPHQGHOXFKWLVQLHWZDUP
Handelingen: UHLQLJGHZDUPWHZLVVHODDUYDQXLWGHYXXUKDDUG

 6WRULQJ7LMGHQVGHRQWVWHNLQJVIDVHVSULQJWGHGLIIHUHQWLHHOVFKDNHODDU 'HDOHU 
Handelingen: FRQWUROHHUGHYRFKWLJKHLGYDQGHRQWVWHNLQJVZHHUVWDQG

 6WRULQJ*HHQRQWVWHNLQJ
1('(5/$1'6

Handelingen: UHLQLJGHYXXUKDDUG

230(5.,1*
'HVLJQDOHULQJHQZRUGHQZHHUJHJHYHQWRWXRSKHWSDQHHOLQJULMSWGRRURSGHWRHWVWHGUXNNHQ
:HUDGHQXDDQRPGHNDFKHOQLHWLQWHVFKDNHOHQYRRUGDWXJHFRQWUROHHUGKHHIWGDWKHWSUREOHHPYHUKROSHQLV

OPMERKING:
'HVFKRRUVWHHQSRWHQKHWURRNNDQDDOZDDUPHHGHLQERXZKDDUGRSYDVWHEUDQGVWRILVDDQJHVORWHQPRHWHQHHQNHHU
SHUMDDUVFKRRQJHPDDNWZRUGHQ FRQWUROHHURILQKHWODQGYDQJHEUXLNYHUEDQGKRXGHQGHQRUPHQEHVWDDQ 

Het gevaar voor een schoorsteenbrand neemt toe als u het rookkanaal en de schoorsteen niet regelmatig laat controleren en reinigen.

BELANGRIJK !!!
0RFKW]LFKHHQEUDQGYRRUGRHQLQGHNDFKHOLQKHWURRNNDQDDORILQGHVFKRRUVWHHQGDQGLHQWPHQDOVYROJWWHZHUNWHJDDQ
- Haal de stekker uit het stopcontact
- Blus met een kooldioxide CO2-blusser
:DDUVFKXZGH%UDQGZHHU

PROBEER HET VUUR NOOIT MET WATER TE BLUSSEN!


/DDWKHWDSSDUDDWYHUYROJHQVGRRUXZ'HDOHUFRQWUROHUHQ/DDWGHKDDUGGRRUHHQHUNHQGWHFKQLFXVFRQWUROHUHQ

- 138 -
&+(&./,67
7HLQWHJUHUHQPHWHHQFRPSOHWHEHVWXGHULQJYDQKHWWHFKQLVFKHEODG
Plaatsing en installatie
'HLQEHGULMIVWHOOLQJGRRUHHQHUNHQGH'HDOHUGLHKHWJDUDQWLHEHZLMV
9HQWLODWLHYDQGHLQVWDOODWLHUXLPWH
+HWURRNNDQDDOGHVFKRRUVWHHQZRUGHQXLWVOXLWHQGYRRUGHNDFKHOJHEUXLNW
+HWURRNNDQDDOKHHIWPD[LPDDOERFKWHQ
 HQLVPD[LPDDOPHWHUODQJKRUL]RQWDDO
GHVFKRRUVWHHQVWHHNWERYHQGHUHX[]RQHXLW
GHURRNDIYRHUEXL]HQ]LMQJHPDDNWYDQSDVVHQGPDWHULDDO LQR[VWDDOLVDDQEHYROHQ 
LQKHWJHYDOYDQGHGRRUJDQJYDQPRJHOLMNEUDQGEDUHPDWHULDOHQ ELMYKRXW ]LMQDOOHYRRU]RUJVPDDWUHJHOHQWHUYRRUNRPLQJYDQ
brand getroffen.

*HEUXLN
'HJHEUXLNWHSHOOHWVKHEEHQHHQJRHGHNZDOLWHLWHQ]LMQQLHWYRFKWLJ
'HYXXUKDDUGHQGHDVUXLPWH]LMQVFKRRQHQJRHGJHSODDWVW
'HGHXULVJRHGDIJHVORWHQ
'HYXXUKDDUGEHYLQGW]LFKLQGHVSHFLDOHUXLPWH

217+28'GDWXGH9885+$$5'8,7=8,*79225'$78'(.$&+(/$$167((.7
3UREHHUGHNDFKHOQRRLWRSQLHXZDDQWHVWHNHQDOVGLWHHUGHUQLHWJHOXNWLV/HHJHHUVWGHYXXUKDDUG

OPTIES
7(/()2216&+$.(/$$5922521767(.,1*23$)67$1' FRGH 
+HWLVPRJHOLMNGHNDFKHORSDIVWDQGWHODWHQRQWVWHNHQGRRUXZ'HDOHUWHYUDJHQHHQWHOHIRRQVFKDNHODDURSGHVHULOHSRRUWRSGH
DFKWHUNDQWYDQGHNDFKHODDQWHVOXLWHQPHWEHKXOSYDQKHWNDEHOWMH FRGH 

.,7YRRUGHNDQDOLVDWLHYDQZDUPHOXFKWQDDUHHQDDQJUHQ]HQGHUXLPWHPHWHHQNDQDOLVDWLHEXLVPHWHHQOHQJWHYDQPD[
PW FRGH 

1('(5/$1'6
.,7%,6YRRUGHNDQDOLVDWLHYDQZDUPHOXFKWQDDUHHQDDQJUHQ]HQGHUXLPWHPHWHHQNDQDOLVDWLHEXLVPHWHHQOHQJWHYDQPD[
PW FRGH 

REINIGINGSACCESSOIRES
*ODVV.DPLQ $V]XLJHU
FRGH  zonder motor
FRGH
+DQGLJYRRUGHUHLQLJLQJ
YDQKHWNHUDPLHNJODV +DQGLJYRRUGH
reiniging van de haard.

- 139 -
Componenti specifici Componenti specifici
FATA 150 SIRENA
140
150
138 150
150

139
150
150 29 150
29 29
29
138

139

150 150 150


150
Componenti specifici
FANTASY

86

- 140 -
93

140 Componenti specifici


STORY

137 134

131 131
ITALIANO ENGLISH FRANAIS ESPAOL DEUTSCH NEDERLANDS pz.
2 Assieme tubo accensione/aspirazione Extraction - ignition pipe assembly Groupe tuyau allumage aspiration Conjunto tubo activacin aspiracin Rohrbaugruppe fr Zndungs-Rauchabsaugung Groep ontstekings- en afzuigleiding 1
3 Chiusura antina Door closure Fermeture porte Cierre de la puerta Ofentr-Verschluss Sluiting deur 1
4 Frontalino inferiore Lower front panel unit Faade infrieure Parte frontal inferior Baueinheit untere Blende Voorelement onder 1
5 Assieme cassetto cenere Ash pan assembly Ensemble tiroir cendres Grupo cajn cenizas Aschenladen-Einheit Aslade 1
6 Antina Door Porte Puerta Ofentr Deur 1
7 Assieme tubo canalizzazione Channelling pipe assembly Ensemble tuyau canalisation Grupo tubo canalizacin Kanalisierungsrohr-Einheit Kanalisatiebuis 2
8 Assieme contenitore pellet Pellet hopper body Corps rservoir pellet Cuerpo depsito pellet Pellet-Behlterkrper Pellettank 1
9 Assieme serranda canalizzazione Channelling damper assembly Ensemble trappe canalisation Grupo compuerta canalizacin Kanalisierungsklappen-Einheit Kanalisatieklep 2
10 Assieme leva canalizzazione destra Right channelling control lever Levier commande Canalisation droite Palanca mando Canalizacin derecha Rechte Kanalisierungs-Steuerungshebel Kanalisatie bedieningshendel rechts 1
11 Assieme leva canalizzazione sinistra Left channelling control lever Levier commande Canalisation gauche Palanca mando Canalizacin izquierda Linke Kanalisierungs-Steuerungshebel Kanalisatie bedieningshendel links 1
12 Assieme superiore contenitore pellet Upper tank assembly Ensemble rservoir suprieur Grupo depsito superior Obere Pelletbehlter-Einheit Tank boven 1
13 $VVLHPHGHVWURVVDJJLRIURQWDOLQRLQIHULRUH Lower front panel right fastening unit (QVHPEOHGURLW[DWLRQIDoDGHLQIpULHXUH *UXSRGHUHFKRMDFLyQSDUWHIURQWDOLQIHULRU Rechte Baueinheit Befestigung der unteren Blende Bevestiging voorelement rechtsonder 1
14 $VVLHPHVLQLVWURVVDJJLRIURQWDOLQRLQIHULRUH Lower front panel left fastening unit (QVHPEOHJDXFKH[DWLRQIDoDGHLQIpULHXUH *UXSRL]TXLHUGRMDFLyQSDUWHIURQWDOLQIHULRU Linke Baueinheit Befestigung der unteren Blende Bevestiging voorelement linksonder 1
15 Coperchio fumi sinistro Left fume cover Couvercle fumes gauche Tapa de humos izquierda Linker Rauchabzugsdeckel Rookdeksel links 1
16 Coperchio fumi destro Right fume cover Couvercle fumes droit Tapa de humos derecha Rechter Rauchabzugsdeckel Rookdeksel rechts 1
17 Piastra prese elettriche Electrical outlets plate Plaque prises lectriques Placa tomas elctricas Stecker-Platte Plaat elektrische contacten 1
18 Copri crogiolo Pot cover Cache creuset Cubre crisol Brenntiegel-Abdeckung Afdekplaat vuurhaard 1
19 Top ghisa Cast iron top Haut en fonte Parte superior de hierro fundido Oberteil aus Gusseisen Gietijzeren bovenstuk 1
20 Coperchio pellet ghisa Cast iron cover Couvercle en fonte Tapa de hierro fundido Deckel aus Gusseisen Gietijzeren deksel 1
21 Basamento in ghisa Cast iron base with bracket Base en fonte avec bride Base de hierro fundido con abrazadera Sockel aus Gusseisen mit Halterung *LHWLM]HUHQEDVLVPHWHQV 1
22 Assieme camera combustione ghisa Cast iron combustion chamber Chambre de combustion en fonte Cmara de combustin de hierro fundido Brennkammer aus Gusseisen Gietijzeren verbrandingskamer 1
23 Cielino metallico Metal ceiling Plafond mtallique Parte superior metlica Metall-Deckenblech Metalen bovenkant 1
24 Supporto frontalino superiore Upper front panel support Support faade suprieure Soporte parte frontal superior Obere Blendenhalterung Steun voorelement boven 1
25 Supporto frontalino inferiore Lower front panel support Support faade infrieure Soporte parte frontal inferior Untere Blendenhalterung Steun voorelement onder 1
26 Top ceramica cuoio (Sirena) Leather ceramic top (Sirena) Dessus cramique cuir (Sirena) Parte superior de cermica cuero (Sirena) Lederfarbenes Keramik-Oberteil (Sirena) Top keramiek lederkleurig (Sirena) 1
26 Top ceramica rossa (Sirena) Red ceramic top (Sirena) Haut cramique Rouge (Sirena) Parte superior de cermica roja (Sirena) Oberteil aus Keramik, rot (Sirena) Keramisch bovenstuk rood (Sirena) 1

- 141 -
26 Top ceramica bianco panna (Sirena) Cream white ceramic top (Sirena) Partie suprieure cramique couleur crme (Sirena) Parte superior de cermica blanca nata (Sirena) Cremefarbenes Keramik-Oberteil (Sirena) Top keramiek crmekleurig (Sirena) 1
27 Fianco destro zincato Right galvanised side Cot galvanis droite Lado galvanizado derecho Verzinkte rechte Seite Verzinkt zijelement rechts 1
28 Fianco sinistro zincato Left galvanised side Cot galvanis gauche Lado galvanizado izquierdo Verzinkte linke Seite Verzinkt zijelement links 1
29 Piastrina centraggio ceramiche Ceramics centering plate Plaque centrage cramiques Place para centrar las cermicas Plttchen z. Zentrieren der Keramikteile Keramische centreerplaat 2
30 Griglia inox crogiolo Stainless steel grille for combustion chamber Grille inox pour creuset Rejilla inoxidable para crisol Edelstahlgitter fr Brenntiegel Inox rooster vuurhaard 1
31 Crogiolo Combustion chamber Creuset Crisol Brennkammereinsatz Haardonderstel 1
32 6TXDGUHWWDVVDJJLRFRUQLFH Frame fastening angle joint eTXHUUHGH[DWLRQHQFDGUHPHQW (VFXDGUDMDFLyQPDUFR Befestigungswinkel Rahmen Hoekstaal bevestiging lijst 1
33 3URORVVDJJLRSDQQHOORSRVWHULRUH Rear panel fastening pin 3LYRWGH[DWLRQSDQQHDXSRVWpULHXU 3HUQRMDFLyQSDQHOSRVWHULRU Befestigungsstift rckseitige Abdeckung Bevestigingspen achterpaneel 1
34 'HHWWRUHDULDIURQWDOH )URQWDLUGHHFWRU 'pHFWHXUDLUIURQWDO 'HHFWRUDLUHIURQWDO Vorderer Luftabweiser Luchtgeleider voor 1
35 Staffe centralina Control unit fastening brackets triers de la centrale Estribos centralita Halterungsbgel Steuergert Beugels regeleenheid 1
36 Parete posteriore contenitore pellet Rear pellet hopper wall Paroi postrieure rservoir pellets Pared trasera del depsito de pellet Rckwand Pelletbehlter Achterwand pelletreservoir 1
37 Pannello posteriore inferiore Lower rear panel Panneau postrieur infrieur Panel posterior inferior Untere Rckwand Onderste achterpaneel 1
38 Divisore aria calda Hot air divider Diviseur air chaud Separador aire caliente Warmluftteiler Verdeler warme lucht 1
39 Asta serranda Shutter rod Tige trappe Varilla compuerta Klappenstab Staaf klep 1
40 Guarnizione carta Paper seal Garniture papier Empaquetadura papel Papierdichtung Papieren pakking 1
41 Guarnizione carta caricatore Loading device ceramic paper gasket Garniture papier cramique chargeur Junta en papel cermico cargador Keramikpapierdichtung der Fllvorrichtung Pakking uit keramisch papier voor lader 1
42 Pannello posteriore superiore Holder rear panel Panneau postrieur suprieur Panel posterior superior Obere Rckwand Bonveste achterpaneel 1
43 3URORVFKHGDVXSHULRUHV[LQIHULRUHG[ 8SSHUOHIWORZHUULJKWERDUGSUROH 3UROFDUWHVXSpULHXUJDXFKHLQIpULHXUGURLW 3HUOWDUMHWDVXSHULRUL]TLQIHULRUGFK 2EHUHVOLQNHVXQWHUHVUHFKWHV6WHFNNDUWHQSURO 3URHONDDUWERYHQORQGHUU 2
44 3URORVFKHGDVXSHULRUHG[LQIHULRUHV[ 8SSHUULJKWORZHUOHIWERDUGSUROH 3UROFDUWHVXSpULHXUGURLWLQIpULHXUJDXFKH 3HUOWDUMHWDVXSHULRUGFKLQIHULRUL]T 2EHUHVUHFKWHVXQWHUHVOLQNHV6WHFNNDUWHQSURO 3URHONDDUWERYHQURQGHUO 2
45 Telaio serranda canalizzazione Channelling shutter frame Chssis trappe canalisation Bastidor compuerta canalizacin Rahmen Kanalisierungsklappe Frame kanalisatieklep 1
46 Pannello posteriore Rear panel Panneau postrieur Panel posterior Rckwand Achterpaneel 1
47 3HUQRLQIHULRUHVVDJJLRDQWLQD Lower fastening pin for the door 3LYRWLQIpULHXU[DWLRQSRUWH 3HUQRLQIHULRUGHMDFLyQGHODSXHUWD Unterer ofentr-befestigungszapfen 2QGHUHVWH[DWLHDVGHXU 1
48 Fianco destro zincato Right galvanised side Cot galvanis droite Lado galvanizado derecho Verzinkte rechte Seite Verzinkt zijelement rechts 1
49 Fianco sinistro zincato Left galvanised side Cot galvanis gauche Lado galvanizado izquierdo Verzinkte linke Seite Verzinkt zijelement links 1
50 Fianco pietra Stone side Flanc en pierre Lateral de piedra Seitenteil Stein Zijkant steen 4
51 Piastra sotto top Plate beneath top Plaque sous le haut Placa debajo de encimera Platte unter Top Plaat onder top 1
ITALIANO ENGLISH FRANAIS ESPAOL DEUTSCH NEDERLANDS pz.
52 Piastra laterale sotto top Side plate beneath top Plaque latrale sous le haut Placa lateral debajo de encimera Seitenplatte unter Top Zijdelingse plaat onder top 2
53 3URORLQDOOXPLQLRSHUULYHVWLPHQWRDQWHULRUHG[ $OXPLQLXPSUROHIRUULJKWGRRUFRYHULQJ 3UROHQDOXPLQLXPUHYrWHPHQW$9'URLW 3HUOGHDOXPLQLRUHYHVWLPLHQWRGHO'HUHFKR $OXSUROIUYRUGHUH9HUNOHLGXQJUHFKWV $OXSURHOYRRUEHNOHGLQJYRRUDDQUHFKWV 1
54 3URORLQDOOXPLQLRSHUULYHVWLPHQWRDQWHULRUHV[ $OXPLQLXPSUROHIRUOHIWGRRUFRYHULQJ 3UROHQDOXPLQLXPUHYrWHPHQW$9*DXFKH 3HUOGHDOXPLQLRUHYHVWLPLHQWRGHO,]TXLHUGR $OXSUROIUYRUGHUH9HUNOHLGXQJOLQNV $OXSURHOYRRUEHNOHGLQJYRRUDDQOLQNV 1
55 3URORLQDOOXPLQLRSHUULYHVWLPHQWRSRVWHULRUL $OXPLQLXPSUROHIRUUHDUFRYHULQJ 3UROHQDOXPLQLXPUHYrWHPHQWSRVWpULHXU 3HUOGHDOXPLQLRSDUDUHYHVWLPLHQWRWUD $OXSUROIUKLQWHUH9HUNOHLGXQJ $OXSURHOYRRUEHNOHGLQJDFKWHUDDQ 2
56 Top ghisa Cast iron top Haut en fonte Parte superior de hierro fundido Oberteil aus Gusseisen Gietijzeren bovenstuk 1
57 Top pietra ollare Stone top Haut pierre Parte superior de piedra Oberteil aus Stein Keramisch bovenstuk grijs 1
58 Frontalino anteriore superiore pietra ollare Lower front panel in soapstone Frontal avant infrieur en pierre ollaire Frontal delantero inferior piedra ollar Frontseite unten aus Speckstein Onderste frontelement vooraan in serpentijnsteen 1
59 Frontalino anteriore inferiore pietra ollare Upper front panel in soapstone Frontal AV suprieur pierre ollaire Frontal delantero superior piedra ollar Frontseite oben aus Speckstein Frontelement vooraan serpentijnsteen 1
60 Fianco rivestimento in acciaio grigio (Story) Grey steel side cover (Story) )ODQFUHYrWHPHQWHQDFLHU*ULV 6WRU\ Lateral con revestimiento de acero gris (Story) Seitenverkleidung aus Stahl, grau (Story) Zijelement bekleding in grijs staal (Story) 2
61 Fianco in ceramica cuoio (Sirena) Ceramic leather side (Sirena) Flanc en cramique cuir (Sirena) Lateral de cermica cuero (Sirena) Seitenteil aus lederfarbener Keramik (Sirena) Keramische zijkant leder (Sirena) 4
61 Fianco in ceramica rosso (Sirena) Red ceramic side piece (Sirena) Flanc cramique Rouge (Sirena) Lateral de cermica roja (Sirena) 6HLWHQlFKH.HUDPLNURW 6LUHQD Keramisch zijelement rood (Sirena) 4
61 Fianco in ceramica bianco panna (Fata) Cream white ceramic side (Fata) Flanc en cramique blanc crme (Fata) 4 Lateral de cermica blanca nata (Fata) Seitenteil aus sahneweier Keramik (Fata) Keramische zijkant wit crme (Fata) 4
62 Frontalino in ceramica cuoio (Sirena) Ceramic leather front panel (Sirena) Frontal en cramique cuir (Sirena) Frontal de cermica cuero (Sirena) Frontpaneel aus lederfarbener Keramik (Sirena) Keramisch paneel leder (Sirena) 2
62 Frontalino in ceramica rosso (Sirena) Red front panel (Sirena) Frontal AV Rouge (Sirena) Frontal delantero roja (Sirena) Frontseite vorn, rot (Sirena) Frontelement keramiek rood (Sirena) 2
62 Frontalino in ceramica bianco panna (SIrena) Cream white ceramic front panel (Sirena) Frontal en cramique blanc crme (Sirena) Frontal de cermica blanca nata (Fata) Frontpaneel aus sahneweier Keramik (Sirena) Keramisch paneel wit crme (Sirena) 2
62 Frontalino in ceramica grigia (Story) Grev front panel (Story) Frontal AV Gris (Story) Frontal delantero gris (Story) Frontseite vorn, grauer (Story) Frontelement keramiek grijs (Story) 2
63 Frontalino inferiore antina Lower door front Frontal infrieur porte Frontal inferior de la puerta Untere Ofentr-Vorderseite Onderste frontelement deur 1
64 Frontalino superiore antina Upper door panel Frontal suprieur porte Frontal superior de la puerta Oberer Fronteinsatz Ofentr Bovenste frontelement deur 1
65 Supporto anteriore superiore pietra ollare Soapstone upper front support Support antrieur suprieur pierre ollaire Soporte anterior superior piedra ollar Vordere obere Topfstein-Halterung Steun voor speksteen boven 1
66 Impugnatura inox scovolo Stainless steel brush grip Poigne inox couvillon Empuadura de acero escobilln Edelstahl-Brstengriff Handvat rager inox 2
67 'HHWWRUHDULD )URQWDLUGHHFWRU 'pHFWHXUDLUIURQWDO 'HHFWRUDLUHIURQWDO Vorderer Luftabweiser Luchtgeleider voor 1
68 Asta comando scovolo Brush control rod Tige commande couvillon Varilla de mando escobilln Bedienungsstab Brste Bedieningsstaaf rager 2
69 Assieme asta destra comando scovolo Swabbing control right rod assembly Ensemble tige droite commande couvillon Grupo varilla derecha mando escobilln Rechte Brstbettigungsstangen-Einheit Bedieningsstaaf borstel rechts 1
70 Assieme asta sinistra comando scovolo Swabbing control left rod assembly Ensemble tige gauche commande couvillon Grupo varilla izquierda mando escobilln Linke Brstbettigungsstangen-Einheit Bedieningsstaaf borstel links 1
71 Scheda elettronica Electronic circuit board Carte lectronique Ficha eletrnica Schaltplan Elektronische kaart 1
72 Piastrina leva di canalizzazione dx Right channelling lever plate Plaque levier de canalisation droit Placa palanca de canalizacin derecho Rechtes plttchen des Kanalisierungshebels Plaatje kanalisatiehendel rechts 1

- 142 -
73 6WDIIDVVDJJLRFUXVFRWWR Nilo instrument panel fastening bracket eWULHUGH[DWLRQWDEOHDXGHFRPPDQGH (VWULERMDFLyQWDEOHUR Befestigungsbgel Armaturenbrett Bevestigingsbeugel instrumentenpaneel 1
74 6WDIIDVVDJJLRFUXVFRWWR )DQWDV\ instrument panel fastening bracket (Fantasy) eWULHUGH[DWLRQWDEOHDXGHFRPPDQGH )DQWDV\ (VWULERMDFLyQWDEOHUR )DQWDV\ Befestigungsbgel Armaturenbrett (Fantasy) Bevestigingsbeugel instrumentenpaneel (Fantasy) 1
75 3UROLVVDJJLRFHUDPLFKH &HUDPLFIDVWHQLQJSUROHV 3UROV[DWLRQFpUDPLTXHV 3HUOHVMDFLyQGHFHUiPLFD .HUDPLN%HIHVWLJXQJVSUROH .HUDPLVFKHEHYHVWLJLQJVSURHOHQ 2
76 3URORSRVWHULRUHODWHUDOHDPELGHVWUR ([FKDQJHDEOHUHDUVLGHSUROH 3UROSRVWpULHXUODWpUDODPELGH[WUH 3HUOSRVWHULRUODWHUDODPELGLHVWUR +LQWHUHVVHLWOLFKHVEHLGVHLWLJHV3URO 3URHO]LMNDQWDFKWHUOLQNVHQUHFKWV 2
77 Cerniera top Top hinge Charnire haut Bisagra de la parte superior Oberteil-Scharnier Bovenste scharnier 2
78 3LDVWUDVVDJJLRJULJOLDVXSHULRUH 8SSHUJULOOH[LQJSODWH 3ODTXH[DWLRQJULOOHVXSpULHXUH 3ODFDGHMDFLyQGHODUHMLOODVXSHULRU Befestigungsplatte fr oberes Gitterrost Bevestigingsplaat bovenste rooster 1
79 Rondella elastica Elastic washer Rondelle lastique Arandela elstica Federring Elastiek ring 1
80 Rondella ondulata Undulation washer Rondelle ondule Arandela ondulada Gewellte Unterlegscheibe Gegolfd rondsel 2
81 Cruscotto nero Black instrument panel Tableau de bord noir Salpicadero negro Instrumententafel schwarz 1 Instrumentenbord zwart 1
82 Adattore destro Right hand adaptor Adaptateur droit Adaptador derecho Adapter rechts 1 Verbindingsstuk rechts 1
83 Adattore sinistro Left hand adaptor Adaptateur gauche Adaptador izquierdo Adapter links 1 Verbindingsstuk links 1
84 'HHWWRUHLQIHULRUH Lower damper 'pHFWHXULQIpULHXU 'HHFWRULQIHULRU Unteres Luftleitblech Keerschot onder 1
85 'HHWWRUHVXSHULRUH Upper damper 'pHFWHXUVXSpULHXU 'HHFWRUVXSHULRU Oberes Luftleitblech Keerschot boven 1
86 Spina cerniera superiore 5x30 5 x 30 Upper hinge pin Goujon charnire suprieure 5 x30 Clavija bisagra superior 5 x30 Oberer Scharnierstift 5 x 30 Bovenste scharnierpen 5 x 30 2
87 Fermavetro Glass retainer Bloque-verre Sujetacristal Glasstopper Glaslat 2
88 Telaio antina Door frame Chssis porte Armazn puerta Ofentrrahmen Deurkader 1
89 Guarnizione artica D.10 10 Arctic seal Garniture artica 10 Junta rtica 10 Dichtung, arktikgrau, 10 Pakking Artica 10 L=1,9m
90 Vetro ceramico 610 x 404 x 4 Ceramic glass 610 x 404 x 4 Verre cramique 610 x 404 x 4 Cristal cermico 610 x 404 x 4 Glaskeramikscheibe 610 x 404 x 4 Keramisch glas 610 x 404 x 4 1
91 *XDUQL]LRQHEUD[QHUDDGHVLYD [%ODFNDGKHVLYHEUHJDVNHW *DUQLWXUHEUH[QRLUHDGKpVLYH -XQWDEUDQHJUDDGKHVLYD Karbonfaserdichtung 8 x 2, schwarz, selbstklebend Pakking vezel 8x2 zwart/zelfklevend L=1,22m
92 Perno maniglia antina Door handle pin Pivot poigne porte Perno maneta de la puerta Ofentrgriff-Zapfen As handvat deur 1
93 Grano M6x16 M6x16 nut Goujon M6x16 Tornillo prisionero M6x16 Gewindestift M6x16 Stifttap M6x16 1
94 Motoriduttore Gearmotor Motorducteur Motorreductor Getriebemotor Reductiemotor 1
95 Bussola bloccaggio motoriduttore Gearmotor locking bush Douille blocage motorducteur Manguito bloqueo motoreductor Arretierung Schneckenmotor Blokkeringsmof reductiemotor 1
96 Maniglia completa Doors handle Poigne porte Maneta completa Handgriff komplett Volledig handvat 1
97 Corpo caricatore Loader body Corps chargeur Cuerpo cargador Frderschneckekorpus Behuizing lader 1
98 Semiguscio di chiusura coclea Screw feeder half cover 'HPLFRTXLOOHGHIHUPHWXUHYLVVDQVQ Semi-caparazn de cierre cclea Schliessdeckel Frderschnecke Halve dekkap wormschroef 1
ITALIANO ENGLISH FRANAIS ESPAOL DEUTSCH NEDERLANDS pz.
99 %RFFRODWHRQDWDSHUFDULFDWRUH 7HRQFRDWHGEXVKIRUVFUHZIHHGHU 'RXLOOHWpRQLVpHSRXUYLVVDQVQ 0DQJXLWRGHWHyQSDUDFyFOHD 7HRQDEVWDQGVKDOWHUIU)|UGHUVFKQHFNH Hittebestendige koker voor wormschroef 2

100 Albero caricatore Screw feeder shaft $UEUHYLVVDQVQ rbol cclea Frderschnecke As wormschroef 1

101 Guarnizione carta ceramica caricatore Ceramic paper gasket for loader Garniture papier cramique chargeur Junta papel cermica cargador Dichtung aus Keramikpapier der Frderschnecke Pakking van keramisch papier voor lader 1

102 Chiusura superiore caricatore Upper loader cover Fermeture suprieure chargeur Cierre superior cargador Obere Abdeckung Frderschnecke Bovenste sluiting lader 1

103 Griglia protezione serbatoio pellet Pellet hopper protection grille Grille protection rservoir pellets Rejilla de proteccin depsito de pellet Schutzgitter Pelletbehlter Beschermingsrooster pelletreservoir 1

104 Chiusura top Top closure Fermeture haut Cierre de la parte superior Oberteil-Verschluss Sluiting bovenaan 1

105 Cricchetto per apertura coperchio Cover opening ratchet Cliquet pour ouverture couvercle Trinquete para apertura de la tapa Ratschenhebel fr Deckelffnung Knop voor opening deksel 1

106 Gommino antivibrante Fan fastening bracket %ULGH[DWLRQYHQWLODWHXUV $EUD]DGHUDMDFLyQYHQWLODGRUHV Tangentialventilator trillingdempend rubbertje 4

107 Ventilatore estrazioni fumi Smoke extractor fan Ventilateur extraction fumes Ventilador extractor humos Ventilator Rauchabzug Rookafvoerventilator 1

108 Frontalino superiore in ghisa Cast iron upper front panel Faade suprieure en fonte Parte frontal superior en fundicin Oberes Frontteil aus Gusseisen Gietijzeren voorelement boven 1

109 Guarnizione 10x10 adesiva 10 x 10 adhesive gasket Garniture 10 x 10 adhsive Junta adhesiva 10 x 10 Dichtung 10 x 10, selbstklebend Pakking 10x10 zelfklevend L=0,95m

110 Tubo uscita fumi Smoke outlet pipe Tuyau sortie fumes Tubo salida humos Rauchauslassrohr Rookafvoerbuis 1

111 Staffa supporto ventilatore Fan support bracket Etrier support ventilateur Estribo soporte ventilador Geblsehalterungsbgel Steunbeugel ventilator 1

112 Staffa supporto ventilatore Fan support bracket Etrier support ventilateur Estribo soporte ventilador Geblsehalterungsbgel Steunbeugel ventilator 1

113 Ventilatore aria canalizzazione Air channelling fan Ventilateur air canalisation Ventilador aire canalizacin Kanalisierungsluft-Geblse Ventilator kanalisatielucht 1

114 Cablaggio condensatore/ventilatore 800 mc Fan / capacitor wiring 800mc Cablage condensateur/ventilateur 800mc Cableado condensador / ventilador 800mc Verkabelung Kondensator / Geblse 800 mc Bekabeling condensator / ventilator 800mc 1

115 Guarnizione carta per motore Paper seal for motor Garniture papier pour moteur Junta papel para motor Papierdichtung fr Motor Papieren dichting voor motor 1

116 Gommino termocoppia Thermocouple pad Bouchon en caoutchouc thermocouple Tapn de goma termopar Thermoelement-Gummi Pakking thermokoppel 2

117 Termocoppia tipo J J type thermocouple Thermocouple Type "J" Termocopia de Tipo J Temperaturfhler Typ "J" Thermokoppel type J 1

118 Piastrina vacuometro Vacuum gauge plate Plaque vacuomtre Placa vacumetro Unterdruckmesser-Plttchen Plaatje vacummeter 1

119 &DYRDW Flat cable Cble Flat &DEOHDW Flachkabel Platte kabel 1

120 Supporto cricchetto Ratchet support Support cliquet Soporte trinquete Sperrklinkenhalterung Steun krikje 1

121 Cavo alimentazione rete Mains power supply cable Cble alimentation rseau Cable de alimentacin de red Netzkabel Netsnoer 1

122 Presa di rete con interruttore Mains socket with switch Prise rseau avec interrupteur Toma de red con interruptor Netzstromanschluss mit Schalter Netstekker met schakelaar 1

123 Porta sonda temperatura ambiente Room temperature sensor holder Porte sonde temprature ambiante Porta sonda temperatura ambiente Raumtemperatur-Sondenhalter Meterdrager omgevingstemperatuur 1

- 143 -
124 3UHVDVHULDOHFRQFDYRDW 6HULDOSRUWZKLWDWFDEOH )LFKHGHVpULHDYHFFDEOHDW 7RPDVHULDOFRQFDEOHDW Serieller Anschluss mit Flachkabel Een serieel sleutel met omzetting van vlakke zending 1

125 Vacuometro Vacuum gauge Vacuomtre Vacumetro Unterdruckmesser Vacummeter 1

126 Guanto Glove Gant Guante Schutzhandschuh Handschoen 1

127 Sali antiumidit Desiccant crystals Sels hygroscopiques Sales antihumedad Salz zum Schutz vor Feuchtigkeit Vochtabsorberende korrels 1

128 Telecomando Remote control Tlcommande Mando a distancia Fernbedienung Afstandsbediening 1

129 Spatola Scraper Spatule Esptula Spachtel Spatel 1

130 Griglia sfogo aria ghisa Cast iron air outlet grille Grille vent air en fonte Rejilla salida aire de hierro fundido Luftauslass-Rost aus Gusseisen Gietijzeren rooster luchtkoker 1
131 3LDVWULQDVVDJJLRDQFKL 6WRU\ 6LGHV[LQJSODWH 6WRU\ 3ODTXHGH[DWLRQDQFV 6WRU\ 3ODFDGHMDFLyQSDUDODWHUDOHV 6WRU\ Befestigungsplttchen Seitenteile (Story) Fixatieplaat zijkanten (Story) 2

132 Supporto anteriore inferore pierta ollare Soapstone lower front support Support antrieur infrieur pierre ollaire Soporte anterior inferior piedra ollar Vordere untere Topfstein-Halterung Steun voor speksteen onder 1

133 Piastrina leva di canalizzazione sx Left channelling lever plate Plaque levier de canalisation gauche Placa palanca de canalizacin izquierdo Linkes plttchen des Kanalisierungshebels Plaatje kanalisatiehendel links 1

134 3LDVWULQDVVDJJLRDQFKLG[ 6WRU\ 5LJKWKDQGVLGHV[LQJSODWH 6WRU\ 3ODTXHGH[DWLRQDQFVGURLWH 6WRU\ 3ODFDGHMDFLyQSDUDODWHUDOHVGFK 6WRU\ Befestigungsplttchen Seitenteile re (Story) Fixatieplaat zijkanten rechts (Story) 1

135 Caricatore c/coclea C/auger Loader &KDUJHXUDYHFYLVVDQVQ Cargador c/cclea Ladevorrichtung mit Schnecke Lader met toevoerschroef 1

136 Flussostato Flowmeter Fluxostat Estado del Flujo 'XUFKXVVZlFKWHU Debietregelaar 1

137 3LDVWULQDVVDJJLRDQFKLV[ 6WRU\ /HIWKDQGVLGHV[LQJSODWH 6WRU\ 3ODTXHGH[DWLRQDQFVJDXFKH 6WRU\ 3ODFDGHMDFLyQSDUDODWHUDOHVL]T 6WRU\ Befestigungsplttchen Seitenteile li (Story) Fixatieplaat zijkanten links (Story) 1

138 Fianco ceramica inf. sx/sup dx rosso Red lower left/upper right ceramic side Flanc cramique inf. gauche/sup droit rouge Lateral de cermica inf. izq./sup. der. rojo Keramik-Seitenteil unten links/ oben rechts, rot Zijkant keramiek onder links/boven rechts rood 2

138 Fianco ceramica inf. sx/sup dx bianco panna Cream white lower left/upper right ceramic side Flanc cramique inf. gauche/sup droit crme Lateral de cermica inf. izq./sup. der. blanco nata Keramik-Seitenteil unten links/ oben rechts, cremefarben Zijkant keramiek onder links/boven rechts crmekleurig 2

138 Fianco ceramica inf. sx/sup dx cuoio Leather lower left/upper right ceramic side Flanc cramique inf. gauche/sup droit cuir Lateral de cermica inf. izq./sup. der. cuero Keramik-Seitenteil unten links/ oben rechts, lederfarben Zijkant keramiek onder links/boven rechts lederkleurig 2

139 Fianco ceramica inf. dx/sup sx rosso Red lower right/upper left ceramic side Flanc cramique inf. droit/sup gauche rouge Lateral de cermica inf. der./sup. izq. rojo Keramik-Seitenteil unten rechts/ oben links, rot Zijkant keramiek onder rechts/boven links rood 2

139 Fianco ceramica inf. dx/sup sx bianco panna Cream white lower right/upper left ceramic side Flanc cramique inf. droit/sup gauche crme Lateral de cermica inf. der./sup. izq. blanco nata Keramik-Seitenteil unten rechts/ oben links, cremefarben Zijkant keramiek onder rechts/boven links crmekleurig 2

139 Fianco ceramica inf. dx/sup sx cuoio Leather lower right/upper left ceramic side Flanc cramique inf. droit/sup gauche cuir Lateral de cermica inf. der./sup. izq. cuero Keramik-Seitenteil unten rechts/ oben links, lederfarben Zijkant keramiek onder rechts/boven links lederkleurig 2

140 Top ceramica rosso (Fata) Red ceramic top (Fata) Haut cramique rouge (Fata) Encimera de cermica roja (Fata) Keramiktop rot (Fata) Keramische top rood (Fata) 1

140 Top ceramica bianco panna (Fata) Cream white ceramic top (Fata) Partie suprieure cramique couleur crme (Fata) Parte superior de cermica blanca nata (Fata) Cremefarbenes Keramik-Oberteil (Fata) Top keramiek crmekleurig (Fata) 1

140 Top ceramica cuoio (Fata) Leather ceramic top (Fata) Dessus cramique cuir (Fata) Parte superior de cermica cuero (Fata) Lederfarbenes Keramik-Oberteil (Fata) Top keramiek lederkleurig (Fata) 1

140 Top ceramica grigio (Story) Grey ceramic top (Story) Haut cramique gris (Story) Encimera de cermica gris (Story) Keramiktop grau (Story) Keramische top grijs (Story) 1

150 Distanziali adesivi per ceramiche Spacer adhesives for ceramics Entretoises autocollantes pour cramiques Distanciadores adhesivos para cermicas Klebe-Abstandshalter fr Keramikteile Zelfklevende afstandsstukken voor keramiek 18
Z Z Z  H G L O N D P L Q  F R P FRG%
- 144 -