Sei sulla pagina 1di 13

Mecanismos de acción hormonal

Comunicación intercelular mecanismos endocrinos y neurológicos (regulación neuroendocrina)

Hormonas:

- Mensajeros químicos que se sintetizan y secretan en un lugar preciso (glándula) en respuesta a un estímulo interno o externo.

- Viajan por sangre o líquido intercelular hasta la célula diana.

- Se unen a receptores de membrana o intracelulares (proteínas) con una afinidad muy alta:

funcionan a concentraciones muy bajas (del orden nanomolar o inferiores)

- Se activa una cascada de transducción de señales:

1- Modifican la expresión génica. 2- Modifican el metabolismo (modificación de enzimas).

Funciones del sistema endocrino

1- Coordinación de la actividad metabólica y del crecimiento de los distintos tejidos 2- Mantenimiento de la homeostasis (insulina y control de los niveles de glucosa sérica) 3- Adaptación y respuesta al medio externo (adrenalina y susto o peligro) 4- Ejecución de programas cíclicos o de desarrollo (andrógenos, estrógenos y desarrollo de los caracteres sexuales secundarios)

El sistema endocrino: un mecanismo de comunicación intercelular a distancia

1- Comunicación autocrina:

2- Comunicación paracrina:

Célula productora = célula diana

Célula productora cerca de célula diana
Célula productora cerca de célula diana
= célula diana Célula productora cerca de célula diana 3- Comunicación endocrina : Célula productora le

3- Comunicación endocrina:

Célula productora lejos de célula diana

diana Célula productora cerca de célula diana 3- Comunicación endocrina : Célula productora le jos de
diana Célula productora cerca de célula diana 3- Comunicación endocrina : Célula productora le jos de
diana Célula productora cerca de célula diana 3- Comunicación endocrina : Célula productora le jos de
diana Célula productora cerca de célula diana 3- Comunicación endocrina : Célula productora le jos de

Clasificación

1. FISIOLÓGICA: consecuencia final de la acción hormonal.

2. ANATÓMICA-TOPOGRÁFICA: relaciones órgano-tejidos (eje hipotálamo-hipófisis).

3. QUÍMICA: naturaleza química de la hormona

4. BIOQUÍMICA: mecanismo molecular de acción de la hormona y su receptor

Clasificación anatómica-topográfica:

Hipotálamo Hipófisis Glándula pineal Paratiroides Tiroides Timo Corazón Tracto gastrointestinal Páncreas
Hipotálamo
Hipófisis
Glándula pineal
Paratiroides
Tiroides
Timo
Corazón
Tracto gastrointestinal
Páncreas
Corteza suprarrenal
Médula suprarrenal
Riñones
Ovarios
Placenta
Testículos

PRINCIPALES SISTEMAS ENDOCRINOS Y SUS TEJIDOS DIANA

SISTEMA NERVIOSO (estrés, fármacos, osmorreceptores, factores ambientales, etc.)
SISTEMA NERVIOSO (estrés, fármacos, osmorreceptores, factores ambientales, etc.)

SISTEMA NERVIOSO (estrés, fármacos, osmorreceptores,

factores ambientales, etc.)

factores ambientales, etc.)
factores ambientales, etc.)
HIPOTÁLAMO Somato- Somatos- Tiroliberina Cortico- Gonado- Oxitocina, liberina tatina (TSHRH) liberina
HIPOTÁLAMO
Somato-
Somatos-
Tiroliberina
Cortico-
Gonado-
Oxitocina,
liberina
tatina
(TSHRH)
liberina
liberinas
vasopresina
(GHRH
(GHIH)
(ACTHRH)
(LHRH)
(FSHRH)
H. POSTERIOR
HIPÓFISIS ANTERIOR
GH
GH
TSH
ACTH
LH
Vasopresina
FSH
oxitocina
GLÁNDULAS ENDOCRINAS
Corteza
Ovarios,
Hígado
Tiroídes
suprarrenal
testículos
Mineral
Estrógenos,
corticoides
andrógenos,
Somatomedinas
Tiroxina
Gluco-
A,B,C
progesterona
corticoides
Prolactina
Células o tejidos diana

Clasificación química:

En función de su naturaleza química.

- Aminoácidos: adrenalina, noradrenalina

Noradrenalina

Aminoácidos: adrena lina, noradrenalina ● Noradrenalina ● Adrenalina - Péptidos: oxitocina, va sopresina, MSH,

Adrenalina

lina, noradrenalina ● Noradrenalina ● Adrenalina - Péptidos: oxitocina, va sopresina, MSH, ACTH ACTH:

- Péptidos: oxitocina, vasopresina, MSH, ACTH

ACTH:

NH2-SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF-OH

- Proteínas: insulina, glucagón, calcitonina, H del crecimiento

- Lípidos: PG, glucocorticoides, mineralcorticoides, H gonadales

insulina, glucagón, ca lcitonina, H del crecimiento - Lípidos: PG, glucocorticoides, mineralcorticoides , H gonadales

Clasificación bioquímica:

Mecanismo molecular de acción del R (de membrana o intracelular).

1- Receptores Tyr quinasa:

Proteína quinasas activadas por ligando

2- Receptores acoplados a proteínas G:

Dependientes de la activación de una proteína transductora trimérica con capacidad de unión de GDP/GTP A menudo activan proteína quinasas por medio de un segundo mensajero

trimérica con capaci dad de unión de GDP/ GTP A menudo activan proteína quinasas por medio
trimérica con capaci dad de unión de GDP/ GTP A menudo activan proteína quinasas por medio

3- Receptores de hormonas esteroides:

Factores de transcripción controlados por ligando

3- Receptores de hormonas esteroides: Factores de tran scripción controlados por ligando

1- Receptores Tyr quinasa:

Proteína quinasas activadas por ligando

Cara extracelular

Proteína quinasas activadas por ligando Cara extracelular P P P P P P P P P
P P P P P P P P P Proteína Proteína Inactiva Activa
P
P
P
P
P
P
P
P
P
Proteína
Proteína
Inactiva
Activa

Membrana

plasmática

Cara citosólica

Proteínas adaptadoras

2- Receptores acoplados a proteínas G:

Recepción y transmisión de señal (ON)

Estado de reposo (OFF)

) E s t a d o d e r e p o s o (
) E s t a d o d e r e p o s o (
) E s t a d o d e r e p o s o (
) E s t a d o d e r e p o s o (
Molécula señal Enzima Proteína G activada activada
Molécula señal
Enzima
Proteína G
activada
activada

LA CASCADA DEL AMPc/PKA

M T P T S A N S G Q V A L R Q
M
T P T
S
A
N
S G Q V A
L
R Q
S
R
T Q N A A L G L Q P I
G
L L
A R
V
A
L
A G
A V
C
L
Q
E H P T
R
P
G
C
A
A
Q
V
L
L
C
C
L
G
V
L
A
C
D
L
I
E
H
F
E
L
N
V
V
L
D
I
K
L
V
L
V
T
S
L
Y
L
N
I
I
I
V
H
F
S
V
D
Y
L
N
L
E
V
F
F
F
L
Adenilato
G
T
C
I
F
G
F
D
A
T
A
M
P
L
F
L
I
L
A
F
A
L
V
S
T
L
W
L
S
N
S
S
L
C
I
L
S
M
V
V
L
N
G
G
S
V
L
I
C
L
S
S
F
V
F
I
V
V
L
S
A
F
A
ciclasa
S
L
L
A
M
G
I
L
L
C
V
L
L
I
N
L
F
A
Y
L
L
E
S
A
I
V
L
P
V
D
G
W
L
T
D
A
A
L
A
M
I
I
L
L
I
V
H
T
Y
V
C
A
A
A
V
A
T
F
V
A
I
A
V
C
D
R
R
F
Gsα
I
C
A
Y M
R
R
G K
H
A
C
L K
Y
A
L
H V
K
R
Q
Q
S Q
T
E
N
I
G
G
P
T C S
F
W
R N L H S P
P
H
E
R
R
V L
S I
L
A
L R
ATP
F
T
Q
A R L H K R Q
I
Y G
V
A I
L
S
cAMP
β
Gsα
R Y H
γ
PKA inactiva Subunidad Subunidad Complejo subunidades reguladoras-cAMP catalítica reguladora Subunidades
PKA
inactiva
Subunidad
Subunidad
Complejo subunidades
reguladoras-cAMP
catalítica
reguladora
Subunidades
inactiva
catalíticas activas
Fosforilación de dianas proteicas Efectos intracelulares
Fosforilación de dianas
proteicas
Efectos intracelulares

2º mensajero

AC ADENILATO CICLASA AC cAMP FOSFO- DIESTERASA
AC
ADENILATO
CICLASA
AC
cAMP FOSFO-
DIESTERASA
AC ADENILATO CICLASA AC cAMP FOSFO- DIESTERASA HIDRÓLISIS DE GTP INACTIVACIÓN DE SUBUNIDAD α Y

HIDRÓLISIS DE GTP INACTIVACIÓN DE SUBUNIDAD α Y DISOCIACIÓN DE PROT. DIANA

AC REASOCIACIÓN DE SUBUNIDAD α AL COMPLEJO βγ PROTEÍNA G INACTIVA AC
AC
REASOCIACIÓN DE SUBUNIDAD α AL
COMPLEJO βγ PROTEÍNA G INACTIVA
AC

LA CASCADA DEL DIACILGLICEROL/PKC

PI PI(4)P PI (4,5) P 2 Cara interna de la bicapa lipídica de la mb
PI PI(4)P PI (4,5) P 2
Cara interna de la
bicapa lipídica de la
mb plasmática
ACTIVA PROTEIN
QUINASA C (PKC)
LIBERA Ca 2+
DEL RETÍCULO
PLASMÁTICO
de la bicapa lipídica de la mb plasmática ACTIVA PROTEIN QUINASA C (PKC) LIBERA Ca 2+

Receptores intracelulares

Hormonas liposolubles:

- Secretadas en función de la demanda, no se almacenan. -Se transportan con transportador específico:

Corticosteroides y mineralcorticoides Sexuales Vitamina D Tiroideas -Tejido diana difunden a través de la membrana, se unen a R intracelulares (citoplasmáticos o nucleares) dimerización y unión a “elementos de respuesta” (HRE), que se encuentran en los promotores de genes regulado (modulación de su transcripción).

mentos de respuesta” (HRE), que se encuentran en los promotores de genes regulado (modulación de su