Sei sulla pagina 1di 146

(;,+-,:

(;,+-,:
(;,+-,:
(;,+-,:

EN INSTALLATION MANUAL 2
IT MANUALE DI INSTALLAZIONE 26
PL INSTRUKCJA MONTAU 50
SV INSTALLATIONSMANUAL 74
FI ASENNUSOPAS 98
AR 122
2 www.electrolux.com

CONTENTS
1. SAFETY INSTRUCTIONS .................................................................................... 3
2. BEFORE INSTALLATION ..................................................................................... 5
3. PRODUCT INSTALLATION .................................................................................. 8
4. TEST AND RUNNING ........................................................................................ 22

WERE THINKING OF YOU


Thank you for purchasing an Electrolux appliance. Youve chosen a product that brings
with it decades of professional experience and innovation. Ingenious and stylish, it has been
designed with you in mind. So whenever you use it, you can be safe in the knowledge that
youll get great results every time.

Welcome to Electrolux.

Visit our website to:


Get usage advice, brochures, trouble shooter, service information:
www.electrolux.com

Register your product for better service:


www.electrolux.com/productregistration

Buy Accessories, Consumables and Original spare parts for your appliance:
www.electrolux.com/shop

CUSTOMER CARE AND SERVICE


We recommend the use of original spare parts.
When contacting Service, ensure that you have the following data available.
The information can be found on the rating plate. Model, PNC, Serial Number

Warning / Caution-Safety information.


General information and tips
Environmental information.

Subject to change without notice.


ENGLISH 3

1. SAFETY INSTRUCTIONS

Before the installation and use of the in accordance with the national wiring
appliance, carefully read the supplied standards and the electricity suppliers
instructions. The manufacturer is not service rules by authorised personnel
responsible if an incorrect installation only.
anduse causes injuries and damages. s If the unit is to be moved to another
Always keep the instructions with the location or disposed of, only a suitably
appliance for future reference. TXDOLHGSHUVRQLVSHUPLWWHGWR
undertake such work.
1.1 Children and vulnerable s If you notice an unusal situation, such
people safety as a burning smell, please switch off
the power to the air conditioner and
WARNING! contact an Electrolux service agent. If
Risk of suffocation, injury or this abnormal status continues the air
permanent disability. conditioner may be damaged or even
FDXVHHOHFWULFVKRFNRUUH
s This appliance can be used by s Do not operate the air conditioner with
children aged from 8 years and above wet hands. This may cause electric
and persons with reduced physical, shock.
sensory or mental capabilities or lack of s Do not damage or cut off the power
experience and knowledge if they have cord or other wires. If this occurs,
been given supervision or instruction please have it repaired or replaced by
concerning use of the appliance in a an accredited technician.
safe way and understand the hazards s Do not connect this air conditioner to a
involved. multi outlet powerboard.
s Children shall not play with the s Please switch off the power supply to
appliance. the air conditioner if it is not to be used
s Cleaning and user maintenance shall for an extended period. Otherwise, it
not be made by children without will accumulate dust and may cause a
supervision. UH
s Before cleaning the air conditioner,
1.2 Installation and Use please disconnect the power supply
in order to eliminate the possibility of
WARNING! electric shock.
Risk of suffocation, injury or s The power supply should be matched
permanent disability. with the air conditioner according to
the installation manual. Air conditioners
s Contact an authorised installer for provided with a supply cord should
installation of this unit. be connected directly to a power
outlet with a suitable safety switch. Air
s Contact an authorised service
conditioners that are hard wired must
technician for repair or maintenance of
be connected to a suitable safety circuit
this unit.
breaker according to the installation
s The socket outlet required to supply manual.
power must be connected and
s Please ensure that the power supply
commissioned by a licenced contractor.
to the air conditioner is stable and
s If the supply cord is damaged, it must meets the requirements set out in the
be replaced by the manufacturer, its installation manual.
VHUYLFHDJHQWRUVLPLODUO\TXDOLHG
s Always ensure the product is installed
persons in order to avoid a hazard.
with appropriate earthing.
s Installation work must be performed
s For safety, be sure to turn off the
4 www.electrolux.com

circuit breaker before performing any s Do not attempt to repair the air conditioner
maintenance or cleaning or when the by yourself. Incorrect repairs may cause
product is not used for an extended electric shock or re. Please contact your
period of time. Accumulated dust may local authorised service centre.
cause re or electric shock. s Do not insert your hands or objects into
s Select the most appropriate the air inlet or outlet. It may cause injury.
temperature. It can save electricity. s Do not expose animals or plants directly
s Do not keep windows and doors open to the DLURw.
for a long time during operation. It will s Do not use the unit for any other
result in insuf cient performance. purpose, such as preserving food or
s Do not block the air inlet or outlet. It will drying clothes.
result in insuf cient performance and s Do not splash water on the air conditioner.
cause malfunctions. It may cause electric shock or malfunction.
s Keep combustible materials away from s For safety, be sure to turn off the
the units at least 1m. It may cause re. circuit breaker before performing any
s Do not step on the top of the outdoor maintenance or cleaning or when the
unit or place heavy things on it. It may product is not used for an extended
cause damage or injury. period of time. Accumulated dust may
s The outdoor handle is a little bit narrow. cause re or electric shock.
please be careful when you lift the s This air conditioner uses R410A
outdoor unit. refrigerant.
You can also get this manual through your local distributor or by
visiting our website.
Please the Electrolux web addresses to your local country from below table.
Country Website address Country Website address
Albania www.electrolux.al Netherlands www.electrolux.nl
Austria www.electrolux.at Norway www.electrolux.no
Belgium www.electrolux.be Poland www.electrolux.pl
Bulgaria www.electrolux.bg Portugal www.electrolux.pt
Croatia www.electrolux.hr Romania www.electrolux.ro
Czech Republik www.electrolux.cz Serbia www.electrolux.rs
Denmark www.electrolux.dk Slovakia www.electrolux.sk
Finland Slovenia www.electrolux.sl
France www.electrolux.fr Spain www.electrolux.es
Germany www.electrolux.de Sweden www.electrolux.se
Greece www.electrolux.gr Switzerland www.electrolux.ch
Hungary www.electrolux.hu Turkey www.electrolux.com.tr

Italy www.electrolux.it UK & Ireland www.electrolux.co.uk


Luxembourg www.electrolux.lu
Please visit www.electrolux.com for more inforamtion
ENGLISH 5

2. BEFORE INSTALLATION
All the pictures in this manual are for explanation
purposes only. The actual shape of the indoor unit
you purchased may be slight different on front panel
and display window. The actual shape shall prevail.

2.1 Tools needs for installation


1. Level gauge
2. Screw driver 10. Gas-leak detector
3. Electric drill 11. Vacuum pump
4. +ROHFRUHGULOO PPPP 12. Gauge manifold
5. Flaring tool set 13. Users manual
6. Specied torque wrenches 14. Thermometer
7. 6SDQQHU KDOIXQLRQ 15. Multimeter
8. A glass of water 16. Pipe cutter
9. +H[DJRQDOZUHQFK PP 17. Measuring tape

2.2 Accessories

Number Name of Accessories Quantity

1 Indoor unit mounting plate 1


2 Clip anchor Not supplied
3 Self-tapping screw A ST3.9X25 5-8
4 Remote control 1
5 5HPRWHFRQWUROKROGHU 2SWLRQDO 1
6 6FUHZIRUUHPRWHKROGHU67; 2SWLRQDO 2
7 %DWWHU\ $$$9 2
8 Insulation material Not supplied
9 &RQQHFWLRQSLSLQJDVVHPEO\ 2SWLRQDO Varies by country
10 Insulation hose for refrigerant piping Not supplied
11 Drain hose Not supplied
12 Wall clamp Not supplied
13 Connection power cable Not supplied
14 'UDLQFRQQHFWRU +HDW3XPSPRGHORQO\ 1
15 'UDLQSOXJ +HDW3XPSPRGHORQO\  2SWLRQDO 3
16 Thermal insulating pipe for extending drain hose 1
17 )ODUHQXW IRUVXFWLRQSLSH  2SWLRQDO 1
18 )ODUHQXW IRUOLTXLGSLSH  2SWLRQDO 1
Note: Other necessary parts for the installation, besides the above mentioned, must be
provided by the customer/installer.
66 www.electrolux.com
www.electrolux.com

2.3 Product Description

1 3 2

15cm above
Space to the ceiling

Indoor
Unit
Space to the wall
15cm above
Space to the wall 15cm above

8
bove

9
3m a

10
Air outlet side

4
11

6
Space to obstruction
50cm above

18
Air inlet side
Space to the wall e
ov
17 30cm above ab
cm
30
e 50cm above
16 ov
ab
m Space to the wall
2
Air outlet side
12
15

14
13

NOTE
All the pictures in this manual are for explanation purposes only. The actual
shape of the indoor unit you purchased may be slight different on front panel
and display window.The actual shape shall prevail.
ENGLISH 7

2.4 Installation site


s Do not install the unit in areas with: s Install the outdoor unit where there is
strong heat sources; VXIFLHQWYHQWLODWLRQ
YDSRXUVRUDPPDEOHJDVVHV s Install the outdoor unit where produced
contamination with oil particles; QRLVHDQGDLURZZLOOQRWGLVWXUE
neighbors or animals.
high frequency electromagnetic
equipment (e.g. welding equipment s Install the outdoor unit in a dry place.
RUPHGLFDOGHYLFHV  s Install the outdoor unit in a place not
high salinity (e.g. close to coastal exposed to direct sunlight or strong
DUHDV  wind.
VXOSKXULFJDV HJKRWZDWHUVSULQJV  s Install the outdoor unit in a place not
supports the weight and vabration of
poor air quality. the unit.
s The height difference between the
Indoor unit indoor unit and the outdoor unit must
s Maintain the minimum installation be less than 10 m.
GLVWDQFHVVSHFLHGLQWKLVGRFXPHQW s The height of the connecting pipes
Do not block the air inlet or the air must be less than 25 m.
outlet. s /HDYHVXIFLHQWVSDFHIRUFOHDQLQJDQG
s Do not use the unit in places with maintenance.
extremely high humidity. s The outdoor unit is powered by the
s Install the indoor unit out of reach of indoor unit.
children.
s The wall must be strong enough to Safety precautions for electrical
support the weight and vibration of the appliances
unit.
s Use a dedicated mains circuit.
s Install the indoor unit at least 230 cm
DERYHWKHRRUVXUIDFH s The unit must be properly grounded.
s /HDYHVXIFLHQWVSDFHIRUFOHDQLQJDQG s ,QVWDOOD5HVLGXDOFXUUHQWGHYLFH 5&' 
maintenance. to protect against personal injury in
case of leakage currents.
s 7KHDLUOWHUVKRXOGUHPDLQDFFHVVLEOH
s Use an all pole disconnection switch
s Leave at least 1 m distance between with a contact separation of at least
the unit and other electrical appliances. PPLQDOOSROHVLQ[HGZLULQJ)RU
s Install the indoor unit in a place where models with a mains plug, make sure
the condensate water can be easily that the mains plug is within reach after
drained. installation.
s Install at a location protected from s The installation must comply with local
direct sunlight. electrical safety regulations and with
other relevant local regulations.
Outdoor unit s The unit must be installed in
accordance with national wiring
s Maintain the minimum installation regulations.
GLVWDQFHVVSHFLHGLQWKLVGRFXPHQW
s Do not subject the mains cable to
s Do not block the air inlet or the air force.
outlet.
s The distance between the unit and
s Install the outdoor unit out of reach of heat sources is at least 1.5 m.
children.
8 www.electrolux.com

NOTE s The yellow-green wire is the ground


s Make sure that the live wire, the neutral wire that cannot be used for other
wire and the ground wire in the mains purposes. Improper grounding can
socket are properly connected. cause electric shock.
s Inadequate or incorrect electrical s The ground resistance must comply
connections can cause electric shock with local regulations.
RUUH s The mains supply must have reliable
ground terminal. Do not connect the
ground wire to water pipes, gas pipes,
Grounding requirements
contamination pipes or other possible
s The unit is a type I electrical appliance. unsafe places.
Make sure that the unit is properly
s Fuses must comply with the prescribed
grounded.
model and rating printed on the fuse
cover or circuit board.

3. PRODUCT INSTALLATION
3.1 Indoor unit installation
3.1.1 Type of the mounting plate

150mm or more to ceiling Indoor unit outline

150mm or 150mm or
more to wall more to wall

Left rear side Right rear side


refrigerant refrigerant
pipe hole pipe hole
55 55

Indoor unit 9000Btu/h models

150mm or more to ceiling Indoor unit outline

150mm or 150mm or
more to wall more to wall

Left rear side Right rear side


refrigerant refrigerant
pipe hole pipe hole
55 55

Indoor unit 12000Btu/h models


ENGLISH 9

150mm or more to ceiling Indoor unit outline

150mm or 150mm or
more to wall more to wall

Left rear side Right rear side


refrigerant refrigerant
pipe hole pipe hole
55 55

Indoor unit 18000Btu/h models

150mm or more to ceiling Indoor unit outline

150mm or 150mm or
more to wall more to wall

Left rear side Right rear side


refrigerant refrigerant
pipe hole pipe hole
70 70

Indoor unit 24000Btu/h models

150mm or more to ceiling Indoor unit outline

150mm or 150mm or
more to wall more to wall

Left rear side Right rear side


refrigerant refrigerant
pipe hole pipe hole
70 70

Indoor unit 28000Btu/h models


10 www.electrolux.com

3.1.2 Installing the Wall Mounting 3.1.4 Connective pipe


Bracket
1. For the left-hand and right-hand piping,
1. Install the wall mounting bracket remove the pipe cover from the side
horizontally over the structural parts on panel. The pipe cover can be kept as
the wall using the spaces indicated on it may be used when relocating the air
the bracket, as shown in Fig.1. conditioner to any other place.
2. In the case of tiled, concrete or 2. For the rear-right-hand and rear-left-
similar walls, create 5mm diameter hand piping, install the piping as shown
holes. Place anchor supports for in Fig 3. Bend the connective pipe to
the appropriate assembly screws. be laid at a height of 43mm or less from
connection piping and wiring. the wall. Fix the end of the connective
pipe.
3. Install the wall mounting bracket to the
wall with eight A type screws. Fig.3
4. At all times securing to the wall studs is Pipe Cover Pipe Holder Pipe Cover
recommended. ULJKW OHIW
Fig.1

Right Reer Right Reer Left


NOTE: Piping Piping Piping
s Fit the wall mounting bracket and drill
holes in the wall according to the wall Fig.4
structure and corresponding mounting Indoor Unit Connective Pipe
points on the wall mounting bracket Ourline
(Dimensions are in mm unless
RWKHUZLVHVWDWHG 

43mm
3.1.3 Drilling the Hole
1. Determine the position of the hole
for the pipes using the wall mounting
bracket and drill the pipe hole so that it 3.1.5 Drainage
is tilted slightly downward.
1. Run the drain hose sloping downward.
2. Always use a pipe cover with an Do not install the drain hose as
opening when drilling. illustrated in Fig 5.
Fig.2 Fig.5
Wall
Outdoor
Indoor

'RQRWEORFNZDWHURZE\DULVHRU
5-7mm

put the end of drain hose into water.


ENGLISH 11

2. When connecting extension drain 3.1.7 Piping and wrapping


hose, insulate the connecting part of
extension drain hose with a shield pipe, 1. Bundle the tubing, connecting cable,
do not let the drain hose slack. and drain hose with tape securely and
HYHQO\DVVKRZQLQWKHVLGHZDUGJXUH
3.1.6 Fastening the Indoor Unit 2. Because the condensed water from
rear of the indoor unit is gathered in
1. Pass the piping through the hole in the ponding box and is piped out of room,
wall. do not put anything else in the box.
2. Put the upper claw at the back of the Fig.8
indoor unit on the upper hook of the
wall mounting bracket, move the indoor
unit from side to side to see that it is
securely hooked. Ponding
Box
Fig.6
Cable Pipe
Connection Room
Upper Hook
Connective
Pipe
Drain Wrapping
Hose Belt

NOTE:
s &RQQHFWWKHLQGRRUXQLWUVWWKHQWKH
outdoor unit.
Lower Hook
s Be careful not to let the drain hose
slack.
3. Piping can easily be made by lifting the
s Both of the auxiliary piping should be
indoor unit with a cushioning material
heat insulated.
between the indoor unit and the wall.
s Be sure that the drain hose is located at
Fig.7
the lowest side of the bundle. Locating
at the upper side may cause drain pan
WRRYHURZLQVLGHWKHXQLW
s Never intercross nor intertwist the
power wire with any other wiring.
s Run the drain hose sloped downward
to drain out the condensed water
smoothly.

3.2 Outdoor unit installation


Cushioning material 3.2.1 Securing of Outdoor Unit
4. Push the lower part of the indoor unit 1. Install the outdoor part of the unit on
up on the wall, Then move the indoor DDWVXUIDFHWRDYRLGH[FHVVQRLVH
unit from side to side, up and down to and vibration. A condenser pad is
check if it is hooked securely. recommended.
2. Direct the air vent toward an area
12 www.electrolux.com

without obstacles. 3.2.2 Condensate drainage of


3. Install the unit at the site where it is outdoor unit (only for heat pump
exposed to as little wind as possible, PRGHO
especially in areas where it is frequently
windy. 1. During heating operation, the
4. If the installation site is exposed to condensate and defrosting water
heavy winds, such as in coastal areas, should be drained out reliably through
place the unit along the widest part of the drain hose.
the wall or use protective plates. 2. Install the outdoor drain connector in
5. Be sure there is no obstacle which the drain-water hole on the chassis of
blocks exhausting air, including schrubs outdoor unit, and attach the drain hose
or bushes. to the connector so that the waste
Fig.10 water formed in the outdoor unit can be
drained out.
3. The drain-water hole must be plugged.
Whether to plug other holes will be
determined by the installer according to
actual conditions.
4. In case of a drain hose, the unit must
be installed on a base more than 3cm
height.
Fig.12

Drain-water
hole

Strong Wind Chassis

Drain
NOTE: connecter
s Settlement of outdoor unit. Anchor the
outdoor unit tightly and horizontally on Hose of inner
DFRQFUHWHRUDWPRXQWZLWKDEROW dia. 16mm
and nut 10mm diameter (Purchased QRWSURYLGHG
VHSDUDWHO\ 
Fig.11 3.3 Refrigerant piping
Air Inlet connection
NOTE:
Air Inlet s Unit comes with 7.5m tubing bundle. It
is not recommended to cut. If too long,
loop for excess.
s Keep original bend so not kinking of the
tube occurs.
Air Outlet
ENGLISH 13

3.3.1 Flaring work 3. Put nut on


s 5HPRYHDUHQXWVDWWDFKHGWRLQGRRU
Main cause for refrigerant leakage is due and outdoor unit, then put them on
WRGHIHFWLQWKHDULQJZRUN pipe/tube having completed burr
&DUU\RXWFRUUHFWDULQJZRUNXVLQJWKH removal. (It is not possible to put them
following procedure: RQDIWHUDULQJZRUN
Fig.15
1. Cut the pipes and the cable.
s Use the piping kit accessory or pipes Flare Nut
purchased locally.
s Measure the distance between the
indoor and the outdoor unit. Cooper Tube
s Cut the pipes a little longer than the
measured distance.
s Cut the cable 1.5m longer than the pipe 4. Flaring work
length.
s &DUU\RXWDULQJZRUNXVLQJDULQJWRRO
Fig.13 ashown below.
Pipe Fig.16

"A"
Bar
Cooper
Pipe
Oblique Roughness Burr

Handle

Bar Yoke

Cone
2. Burr removal
s Completely remove all burrs from the
cut cross section of pipe/tube. Red arrow
s Put the end of the copper tube/pipe in Clamp Handle mark
a downward direction as you remove
burrs in order to avoid dropping burrs s Firmly hold copper pipe in a die
into the tubing. according to the dimension shown in
Fig.14 the table below.
Tab.1
Pipe
A (mm)
Reamer Outer diam. (mm)
Max. Min.
6.35 (1/4) 1.3 0.7
Face Down 9.52 (3/8) 1.6 1.0
12.70 (1/2) 1.8 1.0
15.88 (5/8) 2.4 2.2
14 www.electrolux.com

3.4 Piping Connection Fig.19


Cable Ties Insulation
3.4.1 Indoor Unit Material

1. Connecting the indoor unit tubing to the


connection piping:
s Align the centers of the pipes and
VXIFLHQWO\WLJKWHQWKHDUHQXWZLWK\RXU
KDQGVUVW s Ensure to Isolate separately the suction
Fig.17 pipe from the liquid pipe.
Fig.20
Heat Insulation

Indoor unit tubing Flare nut Pipings

Suction line pipe Liquid line pipe


Spanner Torque wrench s Wrap the insulated pipes with vinyl tape
in the rear section for pipe housing.
Fasten the power cable to the pipes
Fig.18 with vinyl tape.
Fig.21
6SDQQHU [HG Connection pipe
Indoor
Unit pipe
Flare nut
9LQ\OWDSH ZLGH Wrap with vinyl tape
Pipings
Wrench Torque Fig.22

Pipe
Indoor unit tubing
s 7KHQWLJKWHQWKHDUHQXWZLWKVSDQQHU Vinyl tape
andtorque wrench by referring the QDUURZ
Connection
following: cable
Tab.2
Outer diam. Torque Additional
(mm) (N.m) Torque (N.m) s Wrap the piping, drain hose and power
6.35 (1/4) 15.7 (1.6kg.m) 19.6 (2.0kg.m)
cable tightly with vinyl tape so that
WKH\FDQWLQWRWKHUHDUSLSLQJKRXVLQJ
9.52 (3/8) 29.4 (3.0kg.m) 34.3 (3.5kg.m) section.
12.70 (1/2) 49.0 (5.0kg.m) 53.9 (5.5kg.m) Fig.23
15.88 (5/8) 73.6 (7.5kg.m) 78.6 (8.0kg.m)
Pipe
2. Wrap the insulation material around the Drain
connecting portion: hose Vinyl tape
QDUURZ
s Cover the indoor unit pipe and the
connection pipe with the heat insulation Connection
power Wrap with
material. Bind them together with vinyl vinyl tape
tape so that there is no gap. cable
ZLGH
ENGLISH 15

3. Connecting the indoor unit tubing to the Fig.26


connection piping:
s Remove the spacer.
s Hook the indoor unit onto the upper
portion of the mounting plate (Engage
the hooks of the mounting plate into the
openings at the rear top of the indoor
XQLW 
s Ensure that the hooks are properly
seated on the mounting plate by
moving the indoor unit in all directions.
2. 7KHQWLJKWHQWKHDUHQXWZLWKWRUTXH
Fig.24 wrenchuntil the wrench clicks.
Upper hook Fig.27
Outdoor Unit
Mounting
plate Liquid
pipe
Spacer 2-way
Suction
valve
pipe

s Press the lower left and right sides of 3-way valve


the unit against the mounting plate
until the hooks engage into their slots
FOLFNLQJVRXQG 
s Make sure to follow the torque table
Fig.25 value as below:
Upper hook Tab.3
Outer diam. Torque Additional
Connecting (mm) (N.m) Torque (N.m)
cable 6.35 (1/4) 15.7 (1.6kg.m) 19.6 (2.0kg.m)
9.52 (3/8) 29.4 (3.0kg.m) 34.3 (3.5kg.m)
12.70 (1/2) 49.0 (5.0kg.m) 53.9 (5.5kg.m)

Drain hose 15.88 (5/8) 73.6 (7.5kg.m) 78.6 (8.0kg.m)

Mounting plate
3.4.3 Piping Formation
Fixing lower hook
1. Form the piping by wrapping the
connecting portion of the indoor unit
with insulation material and secure it
3.4.2 Outdoor Unit with narrow vinyl tape and wide vinyl
tape.
1. Align the centers of the pipes and s If you want to connect an additional
VXIFLHQWO\WLJKWHQWKHDUHQXWZLWK\RXU drain hose, the end of the drain
hands. hose outlet should be routed above
the ground. Secure the drain hose
appropriately.
2. In cases where the outdoor unit is
installed below the indoor unit level:
16 www.electrolux.com

s Wrap the piping, drain hose and 3.4.4 Checking the Drainage
connecting cable from the down to up.
s Secure the wrapped piping along the 1. Open and lift the indoor unit front panel.
exterior wall using saddle or equivalent. s Hold the lower part of the left and right
Fig.28 sides of the panel, pull it against you
and lift it stops with a full support from
Seal small openings the bracket.
around piping with Fig.30
a gum type sealer Wrapping

Pipe

Drain
hose
Panel bracket
Connection
cable
2. Check the drainage
Drain hose s Carefully pour a glass of water on the
evaporator.
s (QVXUHWKHZDWHURZVWKURXJKWKH
Trap is required to prevent water drain hose of the indoor unit without
from entering into electrical parts any leakage and goes out the drain exit.
3. In cases where the outdoor unit is Fig.31
installed above the indoor unit level:
s Wrap the piping and connecting cable
from the down to up.
s Form a trap to prevent water from
entering the room.
s Secure the wrapped piping along the
exterior wall using saddle or equivalent.
Fig.29

Seal small openings


around piping with
a gum type sealer

Trap
Drain hose

3. Dain piping
s The drain hose should point downward
Trap IRUHDV\GUDLQRZ

Drain hose
ENGLISH 17

Fig.32 Fig.33
Accumulated
Downward Do not rise drain water
slope Air

Water leakage Water leakage


Tip of drain Space less
hose dipped than 50mm
s Do not place drain piping as indicated in water
below:

Water leakage Ditch

3.5 Electrical Installation


3.5.1 Safety Precautions
tripping to prevent short circuit and
Electrical safety rules before starting the overload.
installation: 3. The appliance shall be installed in
1. A dedicated power supply circuit and accordance with national wiring
breaker should be provided for the regulations.
products which are not supplied with 4. A circuit breaker with proper capacity
a service cord and plug in accordance must be installed according to the table
with local electrical safety regulations. below.
2. The circuit breaker must have the
functions of magnetic tripping and heat
Tab.4
Connecting Circuit
Capacity System Voltage Power Cord Fuse Type
Cable Breaker
Watts (BTU/h) /Frequence Gauge (mm2) (A)
Gauge (mm2) (A)

2500 (9K) 220-240V/50Hz 1.0 1.0 3.15 10

3200 (12K) 220-240V/50Hz 1.5 1.5 3.15 16

4600 (18K) 220-240V/50Hz 2.5 2.5 3.15 25

6700 (24K) 220-240V/50Hz 2.5 2.5 3.15 25

8000 (30K) 220-240V/50Hz 4.0 4.0 3.15 32

9700 (36K) 220-240V/50Hz 4.0 4.0 3.15 32


18 www.electrolux.com

5. In case of problems in power supply, 2. Route the power connection cable


the air conditioner must not be installed and signal control wire (for heap pump
EHIRUHWKHFXVWRPHU[HVWKHSUREOHP PRGHORQO\ IURPEDFNRIWKHLQGRRUXQLW
6. Be sure the power supply matches the and pull it toward the front through the
air conditioner. wiring hole for connection.
7. Ensure the live wire, neutral wire and 3. Connect and screw the wires onto the
earth wire in the power socket are WHUPLQDOEORFNDVLGHQWLHGE\WKHLU
properly connected. colors.
8. Inadequate or incorrect electrical 4. Wrap wires that are not connected
connections may cause electric with insulating tape so that they do not
VKRFNUHRUVRPHHOHFWULFDOSDUWVWR touch any electrical or metal parts.
malfunction. 5. 6HFXUHWKHZLUHVUPO\ZLWKWKHFDEOH
9. Before performing any electrical work, clamp.
turn off the main power to the system. 6. Put the wiring cover back and screw it.
7. Reinstall the front panel.
3.5.2 Safety Precautions Fig.35

Earthing Requirements 1300~2200 Watts (5K&7K)


Cooling Only Type
1. The unit must be reliably earthed and
connected to the special earth device N(1) 2
E\WKHTXDOLHGHOFWULFLDQ
2. The yellow-green wire in air conditioner blue black yellow-
is the earthing wire which can not be green
used for other purposes. Improper
earthing may cause electric shock.
3. The earth resistance should accord to Outdoor Unit Connection
the national wiring regulation.
Fig.36
4. The users power must have reliable
earthing terminal. Do not connect the 2500~3600 Watts (9K&12K)
earthing wire with the following: Cooling Only Type
s Water pipe
N(1) 2
s Gas pipe
s Contamination pipe
blue black yellow-
green
3.5.3 Installation of Indoor
Electric Wires
1. Open the front panel and remove the Outdoor Unit Connection
wiring cover by loosening the screw. Fig.37
Fig.34
5200~6600 Watts (18K&24K)
Wiring cover Cooling Only Type
N(1) 2 3

blue black brown yellow-


green

Outdoor Unit Connection


ENGLISH 19

Fig.38 Fig.42
8600~11000 Watts (30K&36K) 8600~11000 Watts (30K&36K)
Cooling Only Type Heat Pump Type
N(1) 2 3 N(1) 2 3

blue black brown yellow- blue black brown yellow-


green green

Outdoor Unit Connection Outdoor Unit Connection


Fig.39 NOTE:
s $OOZLrHVEHWZHHQLQGRRUDQGRXWGRRU
1300~2200 Watts (5K&7K)
XQLWVPXVWEHFRQQHFWHGE\D 
Heat Pump Type
HOHFWULFFRQWUDFWRr
N(1) 2 4 5 s ,IWKHOHQJWKRIWKHSRZHUFRrGLVQRW
HQRXJKSOHDVHFRQWDFW\RXUVXSSOLHU
blue black violet orange IRUQHZSRZHUFRrG/HQJWKHQWKH
SRZHUFRrGE\\RXUVHOILVQRWDOORZHG
yellow-
green s $IWHUWLJKWHQLQJWKHVFrHZVSXOOWKH
ZLreVOLJKWO\WR ZKHWKHULWs 
Outdoor Unit Connection RUQRW
s 'RQRWFRQQHFWWZRSRZHUFDEOHV
Fig.40 WRJHWKHUWRVXSSO\SRZHUWRWKHDLU
FRQGLWLRQHr.
2500~3600 Watts (9K&12K)
Heat Pump Type s 'RQRWH[WHQGWKHSRZHUFDEOH
FRQGXFWRUE\FXWWLQJ
N(1) 2 3

blue black brown yellow-


3.5.4 ,QVWDOODWLRQRI2XWGRRU
green (OHFWULFWires
1. 5HPRYHWKHKDQGOHRQWKHULJKWVLGH
SODWHRIRXWGRRUXQLWE\ORRVHQLQJWKH
Outdoor Unit Connection screZ.
Fig.43
Fig.41
4500~6800 Watts (18K&24K)
Heat Pump Type
+DQGOH
N(1) 2 3

blue black brown yellow-


green

THUPLQDO
Outdoor Unit Connection EORFN
20 www.electrolux.com

2. Take off wire cable clamp. Connect Fig.47


and screw the power connection cable
and signal control wire (for heap pump 8700~11000 Watts (30K&36K)
Cooling Only Type
model only) onto the terminal block
following corresponding N(1) 2 3
numbers and colors on the terminal
blocks of indoor and outdoor units.
blue black brown yellow-
3. To prevent water from entering, make a green
trap (U) in the connection wires (see
page 22).
4. Wrap wires that are not connected Indoor Unit Connection
with insulating tape so that they do not
touch any electrical or metal parts. Fig.48
5. Fix the power connection wires with 1300~2200 Watts (5K&7K)
wire clamps. Heat Pump Type
6. Reinstall the handle. N(1) 2 4 5
Fig.44
1300~2200 Watts (5K&7K) blue black violet orange
Cooling Only Type yellow-
green
N(1) 2
Indoor Unit Connection
blue black yellow-
green Fig.49
2500~3600 Watts (9K&12K)
Heat Pump Type
Indoor Unit Connection
N(1) 2 3
Fig.45
2500~3600 Watts (9K&12K) blue black brown yellow-
Cooling Only Type green

N(1) 2
Indoor Unit Connection
blue black yellow-
green Fig.50
4500~6800 Watts (18K&24K)
Heat Pump Type
Indoor Unit Connection
N(1) 2 3
Fig.46
5200~6600 Watts (18K&24K) blue black brown yellow-
Cooling Only Type green

N(1) 2 3
Indoor Unit Connection
blue black brown yellow-
green

Indoor Unit Connection


ENGLISH 21

Fig.51 s Cooling or heating (only for models with


KHDWLQJIXQFWLRQ HIFLHQF\GURSV
8700~11000 Watts (30K&36K)
Heat Pump Type s Moisture in the refrigerant circuit may
freeze and block capillary tubing.
N(1) 2 3 s Water may lead to corrosion of parts in
the refrigeration system.
blue black brown yellow-
Therefore, the indoor unit and tubing
green
between the indoor and outdoor unit must
apply leakage test and be evacuated
to remove any noncondensables and
Indoor Unit Connection moisture from the system.
NOTE:
$IWHUFRQUPLQJWKHDERYHFRQGLWLRQV 3.6.1 Air Purging With Vacuum
prepare the wiring as follows: Pump
s The screws which fasten the wiring
1. Check that each tube (both liquid and
to the terminal block may come loose
JDVVLGHWXEHV EHWZHHQWKHLQGRRU
from vibrations during transportation.
and outdoor units have been properly
s Check and make sure all screws are connected and all wiring for the test
ZHOO[HG2WKHUZLVHLWFRXOGEXUQRXW run has been completed. Remove the
of the wires. service valve caps from both the gas
s %HVXUHWKHFLUFXLWFDSDFLW\LVVXIFLHQW and the liquid side on the outdoor unit.
s Ensure the starting voltage is Note that both the liquid and the gas
maintained at over 90% of the rated side service valves on the outdoor unit
voltage marked on the nameplate. are kept closed at this stage.
s &RQUPWKDWWKHFDEOHWKLFNQHVVLV 2. When relocating the unit to another
DVVSHFLHGLQWKHSRZHUVRXUFH place, perform evacuation using
VSHFLFDWLRQ vacuum pump.
s Always install a Residual Current Device 3. Make sure the refrigerant added into
5&' LQZHWRUPRLVWDUHD the air conditioner is in liquid form in any
case.
s The following may be caused by
voltage drop: Vibration of a contactor, 4. Oil trap should be installed every 5-7m
which will damage the contact point, (no oil trap needed when outdoor unit
fuse blowing, disturbance of the normal installed at a lower place than indoor
function of the overload. XQLW 
s The means for disconnection from a 5. Pipe length and refrigerant amount for
power supply shall be incorporated in split type air conditioner. (see below
WKH[HGZLULQJDQGKDYHDQDLUJDS WDEOH
contact separation of at least 3mm in
HDFKDFWLYH SKDVH FRQGXFWRU

3.6 Air Purging and Leakage


Test
Air and moisture in the refrigeration system
have undesirable effects as indicated
below:
s Pressure in the system rises.
s Operating current rises.
22 www.electrolux.com

Outdoor unit Outdoor unit

(A)
Oil trap

(A)
(B)
(B)

Indoor unit Indoor unit


Piping length under 5m Piping length 5m or more

Tab.5
Maximum Maximum Additional Refrigerant
Capacity Discharge Pipe Standard (g/m)
Length (m) Height (m)
Watts (BTU/h) Diameter (mm) Length (m)
(A) (B) Cooling Only Heat Pump
2500 (9K) 9.52 (3/8") 5 15 10 15 20

3200 (12K) 9.52 (3/8") 5 20 10 15 20


4600 (18K) 9.52 (3/8") 5 20 10 15 20

6700 (24K) 15.88 (5/8") 5 25 10 15 50


8000 (30K) 15.88 (5/8") 5 30 10 15 50
9700 (36K) 15.88 (5/8") 5 30 10 15 50

3.6.2 Caution in handling the Fig.52


packed valve integrated in the
outlets of outdoor unit Refrigerant
1. Operation of opening packed valve: Lo stop valve Indoor
Open the valve stem until it hits against Outdoor (3-way valve) Unit
the stopper. Do not try to open it Unit
Gas side
further.
Liquid side
2. Operation of closing packed valve:
Securely tighten the valve stem with a
special tool. Then securely tighten the Hi stop valve Half union
valve stem cap with a spanner or the (2-way valve)
like. Refer to the table on page 17 for
valve cap tightening torque.
ENGLISH 23

NOTE: entering (Operation noise of the vacuum


pump changes and a compound meter
s There is a charging port integrated in
LQGLFDWHVLQVWHDGRIPLQXV WKHQ
the low side outlet, but not in the high
WLJKWHQWKHDUHQXW7KHSURFHGXUH
side outlet. The low side outlet is shown
YHULHVLIWKHUHDUHEORFNVLQVLGHWKH
in the sketch map below.
tubes.
Fig.53
5. Make evacuation for 15 minutes or
more and check that the compound
Flare nut meter indicates -7-3/5 x 10 Microns
+J [3D $IWHUWKHHYDFXDWLRQLV
Valve body
completed, fully close the Low Side
handle of the manifold valve and stop
Cap the operation of the vacuum pump.
6. Turn the stem of the packed valve B
about 45o counterclockwise for 6~7
Charge port seconds after the gas comes out, then
Valve stem WLJKWHQWKHDUHQXWDJDLQ0DNHVXUH
Stopper
the pressure display in the pressure
indicator is a little higher than the
atmospheric pressure. This procedure
YHULHVLIWKHUHIULJHUDQWJRHVWKURXJK
3.6.3 When using the vacuum the tubes correctly.
pump 7. Close the schrader valve, then remove
the valve core tool. Replace the
For method of using a manifold valve, refer charging port cap.
to its operation manual. 8. Fully open the packed valve stems B
1. &RPSOHWHO\WLJKWHQWKHDUHQXWV and A.
at connection point A, B, C and D. 9. Securely tighten the cap of the packed
Connect valve core removal tool to the valve.
charging port, then connect vacuum
Fig.54
hose to valve core tool. Open the
schrader valve.
Outdoor Unit
NOTE: Manifold
valve
s The schrader valve is inside the Multimeter
charging port. -76cmHg
Lo Handle Hi Handle
2. Connect the other charge hose of Charging hose
manifold valve to the vacuum pump. Low pressure
Charging
valve
hose
3. Fully open the Low Side handle of the
manifold valve.
4. Operate the vacuum pump to evacuate. Vacuum Pump

After starting evacuation, slightly loose


WKHDUHQXWRIWKH/RZ6LGHYDOYHRQ
the gas pipe side and check if the air is
24 www.electrolux.com

4. TEST AND RUNNING

4.1 Gas Leakage Check 4.3 Operation Test


1. Soap water method 1. Before Operation Test
s Apply a soap water or a liquid neutral s Do not switch on power before
detergent on the indoor unit connection LQVWDOODWLRQLVQLVKHGFRPSOHWHO
or outdoor unit connections (A: Low s Electric wiring must be connected
side valve, B: High side valve valve correctly and securely.
C and D are ends of indoor unit s Stop valves of the connection pipes
FRQQHFWLRQ E\DVRIWEUXVKWRFKHFNIRU should be fully opened.
leakage of the connecting points of the
piping. If bubbles come out, the pipes s All the impurities such as scraps and
have leakage point. waste must be cleared from the unit.
Fig.55 2. Operation Test Method
s Switch on power and press ON/OFF
Indoor unit
check points D
button on the remote controller to start
Liquid pipe the operation.
C s Press MODE button to select the
Gas pipe
Outdoor
&22/+($7 LIDSSOLFDEOH )$1WR
Unit
B
Outdoor unit
check if all the functions work well.
2-way
valve A
check points
s When the ambient temperature is lower
3-way
WKDQ& WKHXQLWFDQQRWEHVHWRQ
valve the remote control to work in COOL
mode. Please use the Emergency
Operation mode which is used only
when the remote is unavailable or in
case of maintenance.
2. Leak detector Fig.56
s Use the leak detector to check for
leakage.

4.2 Electrical Safety Check


Manual control
button
Perform the electric safety check after
completing installation:
1. Earthing work
s $IWHUQLVKLQJHDUWKLQJZRUNPHDVXUH
the earthing resistance by visual
detection and earthing resistance tester.
Manual control button
2. Electrical leakage check (performing
GXULQJWHVWUXQQLQJ
s 'XULQJWHVWRSHUDWLRQDIWHUQLVKLQJ 4.4 Pump Done
installation,the service person can
When relocating or disposing of the air
use the electric probe and multimeter
conditioner, pump down the system
to perform the electrical leakage
following the procedure below so that no
check. Turn off the unit immediately if
refrigerant is released into the atmosphere.
refrigerant leakage happens. Check
DQGQGRXWWKHVROXWLRQZD\VWLOOWKHXQLW s Connect the hose of manifold valve to
operate properly. the charge port of stop valve on the gas
pipe side of the outdoor unit.
ENGLISH 25

s Close the stop valve on the gas pipe


side almost completely.
s Fully close the stop valve on the liquid
pipe side.
s Turn on the unit in COOL mode.
s Fully close the stop valve on the gas
pipe side when the pressure gauge
VKRZVNJIFP aN3D 
s Stop the test run operation by turn the
unit off and all the refrigerant gas have
been collected in the outdoor unit.

4.5 Check After Installation


Items to be checked Possible malfunction

The unit may drop, shake or


emit noise.
Have you done the
refrigerant leakage test? cooling (heating)

Is thermal insulation It may cause condensation.

Is water drainage It may cause water leakage.


satisfactory?
Is the voltage in It may cause electric
accordance with the malfunction or damage the
rated voltage marked on unit.
the nameplate?
Is the electric wiring It may cause electric
or piping connection malfunction or damage the
installed correctly and parts.
securely?
Has the unit been It may cause electrical
securely earthed? leakage.
Is the power cord It may cause electric
malfunction or damage the
parts.
Is the inlet or outlet
blocked? cooling (heating)
Is the length of The refrigerant capacity is
connection pipes and not accurate.
refrigerant capacity
recorded?
26 www.electrolux.com

INDICE
1. NORME DI SICUREZZA .................................................................................... 27
2. PRIMA DELLINSTALLAZIONE ........................................................................... 29
3. INSTALLAZIONE DEL PRODOTTO .................................................................... 32
4. TEST E FUNZIONAMENTO ............................................................................... 48

STIAMO PENSANDO A TE
Grazie per aver acquistato un apparecchio Electrolux. Hai scelto un prodotto che porta
con s decenni di esperienza professionale e innovazione. Ingegnoso e alla moda, stato
creato pensando a te. Quindi ogni volta che lo usi, puoi essere sicuro che avrai grandi
risultati ogni volta.

Benvenuti a Electrolux.

Visita il nostro sito web su:


Ottieni consigli sulluso, brochure, risoluzioni dei problemi, informazioni sulla
manutenzione:
www.electrolux.com

Registra il tuo prodotto per un servizio migliore:


www.electrolux.com/productregistration

Compra Accessori, Consumabili e pezzi di ricambio originali per il tuo apparecchio:


www.electrolux.com/shop

SERVIZIO CLIENTI E MANUTENZIONE


Consigliamo lutilizzo di pezzi di ricambio originali.
Quando contatti la Manutenzione, assicurati di avere i seguenti dati disponibili.
,GDWLVLSRVVRQRWURYDUHVXOODWDUJKHWWDGLLQGHQWLFD]LRQH0RGHOOR31&1XPHURVHULDOH

Avvertimento / Attenzione-Norme di sicurezza.


Informazioni generali e consigli
Informazioni ambientali.

6RJJHWWRDPRGLFKHVHQ]DSUHDYYLVR
ITALIANO 27

1. NORME DI SICUREZZA

Prima dellinstallazione e dellutilizzo fornitori di elettricit esclusivamente da


dellapparecchio, leggere attentamente personale autorizzato.
le informazioni fornite. Il produttore non s Se lunit deve essere spostata in un
responsabile se uninstallazione e un altro luogo o smaltita, permesso
utilizzo scorretti causa lesioni e danni. effettuare questo lavoro solo a
Conserva sempre le istruzioni con SHUVRQDOHTXDOLFDWR
lapparecchio per una consultazione futura.
s Se si nota una situazione insolita,
come un odore di bruciato, spegnere
1.1 Sicurezza delle persone il condizionatore daria e contattare
vulnerabili e dei bambini il personale di manutenzione della
Electrolux. Se questo stato anomalo
ATTENZIONE! continua il condizionatore daria
Rischio di soffocamento, lesioni o potrebbe essere danneggiato o anche
disabilit permanente. causare scosse elettriche o un incendio.
s Non mettere in funzione il condizionatore
s Questapparecchio pu essere usato daria con le mani bagnate. Questo
dai bambini di 8 anni e oltre e da potrebbe causare una scossa elettrica.
SHUVRQHFRQULGRWWHFDSDFLWVLFKH s Non danneggiare o tagliare il cavo di
mentali o sensoriali o con mancanza DOLPHQWD]LRQHRDOWULOL6HVXFFHGH
di esperienza e conoscenza se sono riparalo o fallo sostituire da un tecnico
supervisionati o istruiti riguardo luso accreditato.
dellapplicazione in modo sicuro e
s Non collegare il condizionatore daria a
consapevole dei pericoli.
una ciabatta multi presa.
s I bambini non devono giocare con
s Spegnere lalimentazione del
lapparecchio.
condizionatore daria se non usato
s La pulizia e la manutenzione dellutente per un lungo periodo di tempo. In
non possono essere effettuate dai caso contrario, accumuler polvere e
bambini senza supervisione. potrebbe causare un incendio.
s Prima di pulire il condizionatore daria,
1.2 Installazione e Utilizzo scollegare lalimentazione per eliminare
la possibilit di scossa elettrica.
ATTENZIONE! s Lalimentazione deve essere abbinata
Rischio di soffocamento, lesioni o al condizionatore daria secondo il
disabilit permanente. manuale di installazione. I condizionatori
daria forniti di un cavo di alimentazione
s Contatta un installatore autorizzato per devono essere collegati direttamente
linstallazione di questunit. alla corrente elettrica con un interruttore
s Contatta un tecnico di manutenzione di sicurezza adatto. I condizionatori
autorizzato per la riparazione o la daria che sono fortemente cablati
manutenzione di questunit. devono essere collegati a un
s La presa di corrente richiesta per interruttore adatto secondo il manuale
lalimentazione deve essere collegata e di installazione.
commissionata da un terzista licenziato. s Assicurati che lalimentazione al
s Se il cavo di alimentazione condizionatore daria sia stabile e che
danneggiato, deve essere sostituito VRGGLVLUHTXLVLWLPSRVWDWLQHOPDQXDOH
dal produttore, da un suo agente di di installazione.
manutenzione o da persone parimente s Assicurarsi sempre che il prodotto sia
TXDOLFDWHSHUHYLWDUHSHULFROL installato con una corretta messa a terra.
s Il lavoro di installazione deve essere s Per sicurezza, assicurarsi di spegnere
eseguito secondo gli standard di linterruttore prima di eseguire qualsiasi
cablaggio nazionali e le regole dei manutenzione o pulizia o quando il
28 www.electrolux.com

prodotto non in uso per un periodo o incendi. Contatta il tuo centro di


di tempo prolungato. La polvere manutenzione autorizzato locale.
accumulata pu causare incendio s Non inserire le mani o oggetti nelle
o scosse elettriche. prese o nelle valvole daria. Pu
s Selezionare la temperatura pi causare lesioni.
appropriata. Pu risparmiare elettricit. s Non esporre animali o piante
s 1RQWHQHUHOHQHVWUHHOHSRUWHDSHUWH GLUHWWDPHQWHDOXVVRGpDULD
per un lungo periodo durante lutilizzo. s Non usare lunit per qualsiasi altro
&DXVHUDXQDSUHVWD]LRQHLQVXIFLHQWH scopo, come la conservazione dei cibi
s Non bloccare le prese e le valvole o asciugare i panni.
daria. Causer una prestazione s Non schizzare acqua sul condizionatore.
LQVXIFLHQWHHPDOIXQ]LRQDPHQWL Pu causare scosse elettriche o
s Tieni lontano il materiale combustibile malfunzionamento.
lontano almeno 1m dalle unit. Pu
s Per sicurezza, assicurarsi di spegnere
causare incendi.
linterruttore prima di eseguire qualsiasi
s Non salire sullunit esterna o manutenzione o pulizia o quando il
posizionare sopra cose pesanti. Pu prodotto non in uso per un periodo
causare danni o lesioni. di tempo prolungato. La polvere
s La maniglia esterno un po stretto, accumulata pu causare incendio o
attendo quando sollevi lunit esterna. scosse elettriche.
s Non cercare di riparare il condizionatore s Il condizionatore daria usa gas refrigeranti
daria da solo. Riparazioni scorrette R410A.
possono provocare scosse elettriche

Puoi anche avere questo manuale attraverso il tuo distributore locale


o visitando il nostro sito web.
Trova gli indirizzi web di Electrolux per il tuo paese dalla tabella seguente.
Paese Indirizzo del sito web Paese Indirizzo del sito web
Albania www.electrolux.al Paesi Bassi www.electrolux.nl
Austria www.electrolux.at Norvegia www.electrolux.no
Belgio www.electrolux.be Polonia www.electrolux.pl
Bulgaria www.electrolux.bg Portogallo www.electrolux.pt
Croazia www.electrolux.hr Romania www.electrolux.ro
Repubblica Ceca www.electrolux.cz Serbia www.electrolux.rs
Danimarca www.electrolux.dk Slovacchia www.electrolux.sk
Finlandia ZZZHOHFWUROX[ Slovenia www.electrolux.sl
Francia www.electrolux.fr Spagna www.electrolux.es
Germania www.electrolux.de Svezia www.electrolux.se
Grecia www.electrolux.gr Svizzera www.electrolux.ch
Ungheria www.electrolux.hu Turchia www.electrolux.com.tr
Italia www.electrolux.it Regno Unito e www.electrolux.co.uk
Irlanda
Lussemburgo www.electrolux.lu
Visita www.electrolux.com per ulteriori informazioni
ITALIANO 29

2. PRIMA DELLINSTALLAZIONE
Tutte le immagini di questo manuale sono usate esclusivamente a scopo illustrativo.
La forme reale dellunit interna da te acquistata pu differire leggermente sul
SDQQHOORDQWHULRUHHVXOODQHVWUDGHOGLVSOD\3UHYDOHODIRUPDUHDOH

2.1 Strumenti necessari per linstallazione


1. Livella 9. Chiave a testa esagonale (4mm)
2. Cacciavite 10. Rilevatore fughe di gas
3. Trapano elettrico 11. Pompa a vuoto
4. Punta da trapano cava (55mm / 12. Collettore calibrato
70mm) 13. Manuale per lutente
5. Set strumenti di svasatura 14. Termometro
6. &KLDYLWRUVLRPHWULFKHVSHFLFDWH 15. Multimetro
7. Chiave (unione parziale) 16. Tagliatubi
8. Un bicchiere di acqua 17. Nastro di misurazione

2.2 Accessori
Numero Denominazione degli accessori Quantit
1 3LDVWUDGLVVDJJLRLQWHUQD 1
2 Tasselli di ancoraggio Non in dotazione
3 9LWHDXWROHWWDQWH$67; 5-8
4 TELECOMANDO 1
5 Supporto telecomando (Opzionale) 1
6 9LWHSHUVXSSRUWRWHOHFRPDQGR67; 2S]LRQDOH 2
7 Batteria (AAA 1,5V) 2
8 Materiale isolante Non in dotazione
9 Gruppo collegamento tubazioni (Opzionale) Varie per paese
10 7XERHVVLELOHGLLVRODPHQWRSHUWXED]LRQHUHIULJHUDQWH Non in dotazione
11 7XERHVVLELOHGLVFDULFR Non in dotazione
12 6LVWHPDGLVVDJJLRDSDUHWH Non in dotazione
13 Cavo di collegamento elettrico Non in dotazione
14 Connettore di scarico (solo modello con pompa di calore) 1
15 Presa di scarico (solo modello con pompa di calore) 3
(Opzionale)
16 Tubo di isolamento termico per estensione del tubo 1
HVVLELOHGLVFDULFR
17 Dado svasato (per condotto di aspirazione) (Opzionale) 1
18 Dado svasato (per condotto liquidi) (Opzionale) 1

Nota: Altre componenti necessarie per l'installazione, oltre a quelle indicate, devono
essere fornite dal cliente/installatore.
30
30 www.electrolux.com
www.electrolux.com

2.3 Descrizione del prodotto

1 3 2

15 cm al di sopra
Spazio fino
al soffitto

Unit
interna
Spazio fino alla parete
15 cm al di sopra
Spazio fino alla parete 15 cm al di sopra

8
di sopra

9
3 m al

10
Lato di uscita dellaria

4
11

6
Spazio fino allostruzione
50 cm al di sopra

18 Ingresso
Spazio fino aria laterale
alla parete pra
so
17 30 cm al di sopra al
di
cm
30
pra 50 cm al di sopra
16 so
di
al Spazio fino
2m alla parete
Lato di uscita
12
15 dellaria

14
13

NOTA
Tutte le immagini di questo manuale sono usate esclusivamente a scopo
illustrativo. La forma reale dellunit interna che hai acquistato pu differire
leggermente nel pannello anteriore e nella finestra del display. Prevarr la
forma reale.
ITALIANO 31

2.4 Luogo dellinstallazione


s Non installare in aree con: s Installare lunit esterna dove c una
Forti fonti di calore; YHQWLOD]LRQHVXIFLHQWH
9DSRULRJDVLQDPPDELOL s Installare lunit esterna dove il rumore
HLOXVVRGpDULDSURGRWWRQRQDUUHFKHU
Contaminazione con oli industriali; disturbo a vicini o animali.
Attrezzature elettromagnetiche ad s Installare lunit esterna in un luogo
alta frequenza (ad es. saldatrici o asciutto.
dispositivi medicali);
s Installare lunit esterna in un luogo
Alta salinit (ad es. vicino alle zone non esposto alla luce solare diretta o a
costiere); forte vento.
Gas solforoso (ad es. fonti di acqua s Installare lunit esterna in un posto
calda); che pu sopportare il peso e la
qualit dellaria scadente. vibrazione dellunit.
s La differenza daltezza tra lunit
Unit interna interna e quella esterna deve essere
minore di 10 m.
s Mantenere le distanze minime di
LQVWDOOD]LRQHVSHFLFDWHLQTXHVWR s Laltezza dei tubi di collegamento deve
documento. Non bloccare lentrata e essere minore di 25 m.
luscita dellaria. s /DVFLDUHVSD]LRVXIFLHQWHSHUODSXOL]LD
s Non usare lunit in luoghi e la manutenzione.
estremamente umidi. s Lunit esterna alimentata dallunit
s Installare lunit interna fuori dalla interna.
portata dei bambini.
s Il muro deve essere abbastanza Precauzioni di sicurezza per gli
resistente da sopportare il peso e la apparecchi elettrici
vibrazione dellunit. s Usare un circuito di rete dedicato.
s Installare lunit interna almeno 230 cm s Lunit deve essere correttamente
VRSUDODVXSHUFLHGHOSDYLPHQWR messa a terra.
s /DVFLDUHVSD]LRVXIFLHQWHSHUODSXOL]LD s Installare un dispositivo a corrente
e la manutenzione. residuale (RCD) per proteggerti contro
s ,OOWURGHOOpDULDGHYHUHVWDUHDFFHVVLELOH le lesioni personali in caso di perdita di
s Lasciare almeno 1 m di distanza tra lunit corrente.
e qualsiasi altro apparecchio elettrico. s Usare un interruttore di disconnessione
s Installare lunit interna in un luogo per tutti i poli con una separazione di
in cui si possa scaricare facilmente contatto di almeno 3 mm in tutti i poli
lacqua di condensa. QHOFDEODJJLRVVDWR3HULPRGHOOLFRQ
una presa di corrente, assicurarsi che
s Installare in un luogo protetto dalla luce
la presa di corrente sia raggiungibile
solare diretta.
dopo linstallazione.
s Linstallazione deve essere conforme
Unit esterna alle norme di sicurezza locale e ad altre
s Mantenere le distanze minime di rilevanti norme locali.
LQVWDOOD]LRQHVSHFLFDWHLQTXHVWR s Lunit deve essere installata secondo
documento. le norme di cablaggio nazionale.
s Non bloccare lentrata e luscita dellaria. s Non esercitare forza sul cavo di rete.
s Installare lunit esterna fuori dalla s La distanza tra lunit e le fonti di
portata dei bambini. calore deve essere di almeno 1.5 m.
32 www.electrolux.com

NOTA s ,OORJLDOORYHUGHLOORGLPHVVDDWHUUD
s Assicurarsi che il cavo di corrente, il che non pu essere usato per uno scopo
cavo neutro e il cavo di messa a terra diverso. Una messa a terra scorretta pu
nella presa elettrica siano collegati causare una scossa elettrica.
correttamente. s La resistenza a terra deve essere
s Collegamenti elettrici scorretti o conforme alle norme locali.
inadeguati possono causare scosse s Lalimentazione deve avere un terminale
elettriche o incendi. DWHUUDDIGDELOH1RQFROOHJDUHLOORD
terra per i tubi dellacqua, i tubi del gas,
i tubi di contaminazione o altri possibili
Requisiti per la messa a terra
luoghi non sicuri.
s Lunit un apparecchio elettrico
s I fusibili devono essere conformi al
di tipo I. Assicurati che lunit sia
modello prescritto e alla valutazione
correttamente messa a terra.
stampati sul coperchio del fusibile o
sulla scheda del circuito.

3. INSTALLAZIONE DEL PRODOTTO


3.1 Installazione unit interna
3.1.1 7LSRGHOODSLDVWUDGLVVDJJLR

PPRSLGDOVRIWWR Forma dellunit


interna
150mm o pi 150mm o pi
dalla parete dalla parete

Foro tubazione Foro tubazione


refrigerante refrigerante
lato posteriore lato posteriore
sinistro 55 destro 55

Modelli unit interna da 9000Btu/h

PPRSLGDOVRIWWR Forma dellunit


interna
150mm o pi 150mm o pi
dalla parete dalla parete

Foro tubazione Foro tubazione


refrigerante refrigerante
lato posteriore lato posteriore
sinistro 55 destro 55

Modelli unit interna da 12000Btu/h


ITALIANO 33

PPRSLGDOVRIWWR Forma dellunit


interna

150mm o pi 150mm o pi
dalla parete dalla parete

Foro tubazione Foro tubazione


refrigerante refrigerante
lato posteriore lato posteriore
sinistro 55 destro 55

Modelli unit interna da 18000Btu/h

PPRSLGDOVRIWWR Forma dellunit


interna
150mm o pi 150mm o pi
dalla parete dalla parete

Foro tubazione Foro tubazione


refrigerante refrigerante
lato posteriore lato posteriore
sinistro 70 destro 70

Modelli unit interna da 24000Btu/h

PPRSLGDOVRIWWR Forma dellunit


interna
150mm o pi 150mm o pi
dalla parete dalla parete

Foro tubazione Foro tubazione


refrigerante refrigerante
lato posteriore lato posteriore
sinistro 70 destro 70

Modelli unit interna da 28000Btu/h


34 www.electrolux.com

3.1.2 Installazione del supporto 3.1.4 Tubo di collegamento


GLVVDJJLRDOODSDUHWH
1. Per la tubatura a sinistra e a destra,
1. ,QVWDOODUHLOVXSSRUWRGLVVDJJLRDOODSDUHWH rimuovere il coperchio per la tubatura
orizzontalmente sulle parti strutturali dal pannello laterale. Il coperchio per la
sulla parete usando gli spazi indicati sul tubatura pu essere tenuto perch pu
supporto, come mostrato in Fig.1. essere usato nel riposizionamento del
2. In caso di pareti con mattonelle, condizionatore in qualsiasi altro luogo.
calcestruzzo o simili, creare fori del 2. Per la tubazione posteriore a sinistra
diametro di 5mm. Posizionare i blocchi di e a destra, installa la tubazione come
supporto per le corrette viti di montaggio, mostrato nella Fig.3. Piega il tubo
connessione di tubi e cablaggio. di collegamento per essere posto
3. ,QVWDOODUHLOVXSSRUWRGLVVDJJLRDOOD a un altezza di 43 mm o meno dal
parete con otto viti di tipo A. muro. Fissare lestremit del tubo di
collegamento.
4. Si consiglia di assicurare sempre i
chiodi alla parete. Fig.3
Fig.1 Coperchio Supporto Coperchio
tubo (destra) tubo tubo (sinistra)

NOTA: Tubazione Tubazione


Tubazione posteriore posteriore
s $GDWWDLOVXSSRUWRGLVVDJJLRDOODSDUHWH
destra destra sinistra
e fare i buchi nel muro secondo la
struttura dello stesso e in corrispondenza
GHLSXQWLVXOVXSSRUWRGLVVDJJLRDOOD Fig.4
parete (Le dimensioni sono in mm Aspetto unit Tubo di
VHQRQVSHFLFDWRGLYHUVDPHQWH  interna collegamento

3.1.3 Foro per tubazione


43mm
1. Determinare la posizione del foro per i
WXELXVDQGRLOVXSSRUWRGLVVDJJLRDO
muro e trapanare il foro per la tubazione
in modo che sia inclinato leggermente
verso il basso. 3.1.5 Scarico
2. Usare sempre un coperchio per la
tubatura con unapertura quando viene 1. $YYLDUHLOWXERHVVLELOHGLVFDULFRYHUVR
eseguito il foro. LOEDVVR1RQLQVWDOODUHLOWXERHVVLELOH
di scarico come illustrato nella Fig.5.
Fig.2
Fig.5
Parete
Esterno
Interna

1RQEORFFDUHLOXVVRGHOOpDFTXD
5-7mm

alzando o mettendo un estremit del


tubo di scarico in acqua.
ITALIANO 35

2. Quando si collega la prolunga di un 3.1.7 Tubazioni e rivestimento


WXERHVVLELOHGLVFDULFRLVRODODSDUWH
collegabile della prolunga del tubo 1. Lega insieme la tubazione, il cavo di
di scarico con un tubo a scudo, non collegamento e il tubo di scarico con
lasciare lento il tubo di scarico. il nastro in sicurezza e come mostrato
QHOODJXUDDODWR
3.1.6 Avvitamento dellunit 2. Poich lacqua di condensa della
interna parte posteriore dellunit interna
raccolta nella relativa vaschetta ed
1. Passare la tubazione attraverso il foro pompata fuori dalla stanza, non mettere
nella parete. nientaltro nella vaschetta.
2. Mettere la tenaglia sul retro dellunit Fig.8
interna sul gancio superiore del
VXSSRUWRGLVVDJJLRDOODSDUHWH
spostare lunit interna da un lato Vaschetta
liquido
allaltro che sicuramente agganciato.
Cavo di Capienza
Fig.6 connessione del tubo
Gancio superiore Tubo di
collegamento
Cinghia di
7XERHVVLELOH avvolgimento
di scarico
NOTA:
s Collegare prima lunit interna, poi
quella esterna.
s Attenzione a non lasciar allentare il tubo
Gancio inferiore di scarico.
s Entrambe le tubazioni ausiliarie devono
3. La tubazione pu essere facilmente essere isolate termicamente.
creata sollevando lunit interna con s Assicurarsi che il tubo di scarico sia
unimbottitura tra lunit interna e la posizionato al lato pi inferiore del
parete. raggruppamento. Posizionarlo al lato
Fig.7 superiore pu causare lo straripamento
allinterno dellunit.
s Non incrociare n attorcigliare mai il
FDEODJJLRHOHWWULFRFRQTXDOVLDVLDOWUROR
s Avvia il tuo di scarico inclinato verso il
EDVVRSHUXQRVFDULFRXLGRGHOOpDFTXD
di condensa.

3.2 Installazione unit esterna


3.2.1 Messa in sicurezza
Imbottitura
dellunit esterna
4. Spingere la parte inferiore su per il 1. Installare la parte esterna dellunit su
muro, spostare lunit interna da lato a XQDVXSHUFLHSLDQDSHUHYLWDUHUXPRUH
lato, sopra e sotto per controllare se e vibrazione eccessivi. Si consiglia un
agganciata in sicurezza. condensatore a cuscino.
36 www.electrolux.com

2. Dirigere la ventola dellaria verso una 3.2.2 Scarico condensato


zona senza ostacoli.
dellunit esterna (solo per
3. Installa lunit sul sito in cui esposta a modello con pompa di calore)
meno vento possibile, specialmente in
zone in cui spesso ventoso. 1. Durante le operazioni di riscaldamento,
4. Se il luogo dellinstallazione esposto la condensa e lacqua di scongelamento
a forti venti, come nelle zone costiere, devono essere scaricate in modo
posizionare lunit lungo la parte pi ampia DIGDELOHFRQLOWXERGLVFDULFR
della parete o usare piastre protettive. 2. Installare il connettore di scarico
5. Assicurati che non ci sia alcun ostacolo esterno nel foro dello scarico dellacqua
che blocca lo scarico dellaria, incluso i sul telaio dellunit esterna e attaccare
cespugli. il tubo di scarico al connettore in
Fig.10 modo che lacqua di scarico formatasi
nellunit esterna possa essere
scaricata.
3. Il foro dello scarico dellacqua deve
essere collegato. Leventuale necessit
di collegare altri fori verr stabilita
dallinstallatore in linea con le condizioni
del momento.
4. In caso di un tubo di scarico, lunit
deve essere installata su una base alta
pi di 3cm.
Fig.12
Foro per
lo scarico
dellacqua

Vento forte

NOTA: Telaio
s Sistemazione dellunit esterna. Connettore
Ancorare lunit esterna su una di scarico
VXSHUFLHSLDQDGLFHPHQWRPROWRULJLGD
Tubo dal diam.
con un dado e un bullone di 10 mm di Interno di
diametro (Acquistati separatamente). 16mm (non in
Fig.11 dotazione)
Ingresso aria 3.3 Tubazione di collegamento
Ingresso
refrigerante
aria NOTA:
s Lunit ha un gruppo di tubazione da
7.5m. Non si consiglia di tagliare. Se
troppo lungo, avvolgi ci che eccede.
Presa s Mantenere le pieghe originali in modo
daria che non ci siamo imperfezioni nel tubo.
ITALIANO 37

3.3.1 Svasatura 3. Inserimento di un dado svasato


s Svitare i dadi svasati forniti con lunit
La principale causa delle fughe di gas interna ed esterna e montarli sul tubo
refrigerante dovuta a difetti nella svasatura. dopo aver rimosso le bave. (Non
Eseguire una corretta svasatura possibile metterli dopo il lavoro di
procedendo nel modo seguente: svasatura.)
Fig.15
1. Tagliare i tubi e il cavo.
s Usare il kit di accessori o tubi acquistati Dado
localmente. svasato
s Misurare la distanza tra lunit interna
ed esterna. Tubo in rame
s Tagliare i tubi leggermente pi lunghi
della distanza misurata.
s Tagliare il cavo di una lunghezza maggiore 4. Svasatura
di 1.5m rispetto alla lunghezza del tubo.
s Eseguire una corretta svasatura
Fig.13 utilizzando gli strumenti appositi
Tubo descritti di seguito.
Fig.16

"A"
Sbarra

Obliquo Ruvidit Bave Tubazione


in rame

Maniglia
Sbarra
Giogo

2. Eliminazione delle bave Cono


s Rimuovere completamente le bave
dallestremit del tubo tagliato.
s Rivolgere verso il basso lestremit Impugnatura
del tubo in rame man mano che si morsetto Freccia rossa
eliminano le bave per evitare che alcune
scivolino nel tubo. s Tenere saldamente il tubo di rame sul
Fig.14 dado in base alle dimensioni riportate
nella tabella seguente.
Tubo Tab.1
Alesatore Diam. Esterno. A (mm)
(mm) Max. Min.
6,35 (1/4) 1,3 0,7
Lato rivolto
9,52 (3/8) 1,6 1,0
verso il
basso 12,70 (1/2) 1,8 1,0
15,88 (5/8) 2,4 2,2
38 www.electrolux.com

3.4 Collegamento tubazioni Fig.19


Fermacavi Materiale
3.4.1 Unit interna isolante
1. Collegamento delle tubazioni dellunit
interna alla tubazione di collegamento:
s Allineare come prima cosa centralmente
i tubi e unirli serrando manualmente il
dado svasato. s 9HULFDUHGLLVRODUHVHSDUDWDPHQWHLO
Fig.17 tubo di aspirazione dal tubo liquido.
Fig.20
Isolamento dal calore

Tubatura Dado Tubazioni


dellunit interna svasato

Tubazione linea Tubazione


di aspirazione linea liquido
Chiave Chiave
torsiometrica s Avvolgere i tubi isolati con nastro
vinilico nella sezione posteriore per
l'alloggiamento del tubo. Fissare il cavo di
Fig.18 alimentazione ai tubi con nastro vinilico.
Fig.21
&KLDYH VVD
Tubo di collegamento Tubatura
dellunit
Dado svasato interna
Nastro
Chiave Tubazioni vinilico (largo) Avvolgere con nastro vinilico
torsiometrica
Fig.22
Tubatura dellunit interna
Tubo
Nastro
s Quindi, serrare il dado svasato con vinilico
una chiave e una chiave torsiometrica (stretto)
Cavo di
facendo riferimento a quanto segue:
collegamento
Tab.2
Coppia di
Diam. Esterno. Coppia di
(mm) serraggio (N.m)
serraggio s $YYROJHUHODWXED]LRQHLOWXERHVVLELOH
aggiuntiva (N.m) di scarico e il cavo di alimentazione
6,35 (1/4) 15,7 (1,6kg.m) 19,6 (2,0kg.m) con nastro vinilico di modo che entrino
9,52 (3/8) 29,4 (3,0kg.m) 34,3 (3,5kg.m) nella sezione di alloggiamento della
tubazione posteriore.
12,70 (1/2) 49,0 (5,0kg.m) 53,9 (5,5kg.m)
Fig.23
15,88 (5/8) 73,6 (7,5kg.m) 78,6 (8,0kg.m)
Tubo
7XERHVVLELOH
2. Avvolgere il materiale isolante attorno di scarico Nastro vinilico
alla parte di collegamento: (stretto)
s Coprire il tubo dellunit interna e il tubo Cavo di
di collegamento col materiale isolante collegamento Avvolgere di
dal calore. Unirli con del nastro vinilico elettrico nastro vinilico
in modo tale che non vi siano interstizi. (largo)
ITALIANO 39

3. Collegamento delle tubazioni dellunit Fig.26


interna alla tubazione di collegamento:
s Rimuovere il distanziale.
s Agganciare lunit interna alla parte
VXSHULRUHGHOODSLDVWUDGLVVDJJLR
(incastrare i ganci della piastra di
VVDJJLRQHOOHIHULWRLHQHOODSDUWH
posteriore in alto dellunit interna).
s Assicurarsi che i ganci siano ben inseriti
QHOODSLDVWUDGLVVDJJLRPXRYHQGR
2. Quindi, serrare il dado svasato con una
lunit interna in tutte le direzioni.
FKLDYHWRUVLRPHWULFDQRDTXDQGRQRQ
Fig.24 fa un clic.
Gancio Fig.27
superiore
Piatto di Unit
VVDJJLR esterna Tubo liquido
Valvola Tubo di
Distanziatore a 2 vie aspirazione

s Esercitare una pressione nella Valvola a 3 vie


parte inferiore sinistra e destra
dellapparecchiatura in direzione della
SLDVWUDGLVVDJJLRQRDTXDQGRL s Accertarsi di seguire il valore della
ganci si incastrano nelle loro sedi tabella torsiometrica secondo quanto
(si sentir un clic). qui di seguito indicato:
Fig.25 Tab.3
Gancio
Coppia di
superiore Diam. Esterno. Coppia di
serraggio
(mm) serraggio (N.m)
Cavo di aggiuntiva (N.m)
collegamento 6,35 (1/4) 15,7 (1,6kg.m) 19,6 (2,0kg.m)
9,52 (3/8) 29,4 (3,0kg.m) 34,3 (3,5kg.m)
12,70 (1/2) 49,0 (5,0kg.m) 53,9 (5,5kg.m)
Tubo 15,88 (5/8) 73,6 (7,5kg.m) 78,6 (8,0kg.m)
HVVLELOH
di scarico 3.4.3 Assemblaggio della
3LDWWRGLVVDJJLR tubazione
Fissaggio del gancio inferiore 1. Assemblare la tubazione avvolgendo la
parte di collegamento dellunit interna
FRQPDWHULDOHLVRODQWHHVVDQGRODFRQ
nastro vinilico stretto e nastro vinilico largo.
3.4.2 Unit esterna s Se si desidera collegare un altro tubo
HVVLELOHGLVFDULFROpHVWUHPLWGHOOpXVFLWD
1. Allineare i centri dei tubi e unirli GHOWXERHVVLELOHGLVFDULFRGHYHHVVHUH
serrando manualmente il dado svasato. orientata sopra al terreno. Fissare il tubo
HVVLELOHGLVFDULFRFRUUHWWDPHQWH
2. Qualora lunit esterna sia installata pi
in basso dellunit interna:
40 www.electrolux.com

s Avvolgere con nastro la tubazione, il 3.4.4 9HULFDGHOORVFDULFR


WXERHVVLELOHGLVFDULFRHLOFDYRGL
collegamento dal basso verso lalto. 1. Aprire e sollevare il pannello anteriore
s Fissare la tubazione avvolta nel nastro dell'unit interna.
lungo la parete esterna mediante un s Tenere la parte inferiore dei lati sinistro e
dispositivo a sella o equivalente. destro del pannello, tirarli verso di se' e
Fig.28 VROOHYDUOLSHUSRLVVDUOLFRQODVWDIID
Sigillare le piccole Fig.30
aperture attorno
alla tubazione con
sigillante di gomma Avvolgere

Tubo

Tubo Staffa pannello


HVVLELOH
di scarico

Cavo di
collegamento 2. 9HULFDGHOORVFDULFR
7XERHVVLELOH s Versare un bicchiere di acqua
di scarico sullevaporatore.
s Assicurarsi che lacqua scorra
necessaria una trappola per impedire DWWUDYHUVRLOWXERHVVLELOHGLVFDULFR
che lacqua entri nelle parti elettriche dellunit interna senza nessuna perdita
e che fuoriesca dalluscita di scarico.
3. Qualora lunit esterna sia installata pi Fig.31
in alto dellunit interna:
s Avvolgere con nastro la tubazione di
collegamento e il cavo di collegamento
dal basso verso lalto.
s Formare una trappola per impedire che
lacqua entri nella stanza.
s Fissare la tubazione avvolta nel nastro
lungo la parete esterna mediante un
dispositivo a sella o equivalente.
Fig.29
Sigillare le piccole aperture
attorno alla tubazione con
sigillante di gomma Tubo
Trappola HVVLELOH
di scarico

3. Tubo di scarico
s ,OWXERHVVLELOHGLVFDULFRGRYUHEEH
Trappola puntare verso il basso per facilitare il
XVVRGLVFDULFR
7XERHVVLELOHGLVFDULFR
ITALIANO 41

Fig.32 Fig.33
Acqua di scarico
Non sollevare accumulata
Pendenza
Aria
verso il basso

Perdita dacqua Perdita dacqua


Estremit del tubo
HVVLELOHGLVFDULFR
s Non posizionare la tubazione di scarico immersa in acqua Spazio inferiore
a 50mm
come di seguito indicato:

Perdita dacqua Ristagno

3.5 Installazione elettrica


3.5.1 Precauzioni di sicurezza
Regole di sicurezza elettrica prima di e interruttore di calore per evitare
iniziare l'installazione: cortocircuiti e sovraccarichi.
1. Per i prodotti non dotati di un cavo 3. L apparecchiatura dovr essere
di servizio e di una presa in linea con installata in linea con le disposizioni
le normative sulla sicurezza elettrica nazionali in materia di cablaggio.
locale opportuno fornire un circuito di 4. Sar necessario installare un interruttore
alimentazione e un interruttore dedicati. della capacit giusta attenendosi alla
2. Linterruttore deve disporre delle seguente tabella.
funzioni di interruttore magnetico

Tab.4
Calibro del
Voltaggio Calibro del cavo
Watt Capacit cavo di Tipo di Ylivirtasuoja
di sistema/ di collegamento
(BTU/h) alimentazione fusibile (A) (A)
Frequenza (mm2)
(mm2)
2500 (9K) 220-240V/50Hz t1,0 t1,0 3,15 10
3200 (12K) 220-240V/50Hz t1,5 t1,5 3,15 16
4600 (18K) 220-240V/50Hz t2,5 t2,5 3,15 25
6700 (24K) 220-240V/50Hz t2,5 t2,5 3,15 25
8000 (30K) 220-240V/50Hz t4,0 t4,0 3,15 32
9700 (36K) 220-240V/50Hz t4,0 t4,0 3,15 32
42 www.electrolux.com

5. In caso di problemi a livello di 2. Far passare il cavo di collegamento e il


alimentazione suggeriamo di non cavo di controllo del segnale (solo per
LQVWDOODUHLOFRQGL]LRQDWRUHQRDFKHLO i modelli con pompa di calore) dalla
cliente non ha risolto il problema. parte posteriore dellunit interna e farlo
6. 9HULFDUHFKHOpDOLPHQWD]LRQHGHOOpLPSLDQWR passare sul davanti tramite il foro di
corrisponda a quella del condizionatore. cablaggio per eseguire il collegamento.
7. 9HULFDUHFKHLFDYLGLFRUUHQWHTXHOOL 3. Collegare e avvitare i cavi sul blocco
neutri e quelli di messa a terra nella terminali seguendo la corrispondenza
presa di corrente siano stati collegati in dei colori.
modo giusto. 4. Avvolgere i cavi che non sono collegati
8. Dei collegamenti inadeguati o con del nastro isolante in modo tale che
eseguiti in modo sbagliato possono essi non tocchino alcuna parte elettrica
provocare scosse elettriche, incendi o metallica.
o malfunzionamento di alcune 5. Fissare saldamente i cavi con una
componenti elettriche. morsettiera.
9. Prima di eseguire qualsiasi lavoro 6. Riposizionare il coperchio del cablaggio
di natura elettrica, disattivare e avvitare.
lalimentazione dal sistema. 7. Reinstallare il pannello anteriore.
3.5.2 Precauzioni di sicurezza Fig.35
1300~2200 Watt (5K&7K)
Requisiti di messa a terra
Solo per tipo di raffreddamento
1. L unit deve essere messa a terra e
collegata al dispositivo speciale di messa N(1) 2
DWHUUDGDXQHOHWWULFLVWDTXDOLFDWR
2. Il cavo giallo-verde nel condizionatore blu Nero giallo-
dellaria il cavo di massa che non pu verde
essere usato per altri scopi. Una messa
a terra in modo sbagliato pu essere
causa di scosse elettriche.
3. La resistenza di terra dovrebbe essere Collegamento unit esterna
in linea con le normative nazionali sul Fig.36
cablaggio.
4. La potenza dellutente deve disporre di 2500~3600 Watt (9K&12K)
un terminale adeguato di messa a terra. Solo per tipo di raffreddamento
Non collegare il cavo di messa a terra ai
N(1) 2
seguenti elementi:
s Tubo dellacqua
s Tubo del gas blu Nero giallo-
s Tubo di contaminazione verde

3.5.3 Installazione dei cavi


elettrici interni Collegamento unit esterna
1. Aprire il pannello anteriore e togliere il Fig.37
coperchio del cablaggio allentando la vite.
5200~6600 Watt (18K&24K)
Fig.34 Solo per tipo di raffreddamento
Copertura
cablaggio N(1) 2 3

blu Nero Marrone giallo-


verde

Collegamento unit esterna


ITALIANO 43

Fig.38 Fig.42
8600~11000 Watt (30K&36K) 8600~11000 Watt (30K&36K)
Solo per tipo di raffreddamento Tipo di pompa di calore
N(1) 2 3 N(1) 2 3

blu Nero Marrone giallo- blu Nero Marrone giallo-


verde verde

Collegamento unit esterna Collegamento unit esterna


Fig.39 NOTA:
1300~2200 Watt (5K&7K) s Tutti i cavi fra lunit interna e quella
Tipo di pompa di calore esterna devono essere collegati da un
HOHWWULFLVWDTXDOLFDWR
N(1) 2 4 5
s Ne caso in cui la lunghezza del cavo
blu Nero viola arancione
GLDOLPHQWD]LRQHQRQVLDVXIFLHQWH
contattare il fornitore per ricevere del
giallo- cavo in pi. Non consentito cercare
verde di allungare il cavo di alimentazione da
soli.
Collegamento unit esterna
s Dopo aver serrato le viti, tirare
Fig.40 OHJJHUPHQWHLOFDYRSHUYHULFDUHFKH
VLDHIIHWWLYDPHQWHVVDWRLQPRGRVDOGR
2500~3600 Watt (9K&12K) s Non utilizzare due prolunghe per
Tipo di pompa di calore alimentare il condizionatore.
N(1) 2 3 s Non allungare il cavo tagliandolo e
facendo aggiunte.
blu Nero Marrone giallo-
verde 3.5.4 Installazione dei cavi
elettrici esterni
1. Rimuovere la maniglia sul lato destro
Collegamento unit esterna dellunit interna allentando la vite.
Fig.43
Fig.41
4500~6800 Watt (18K&24K)
Tipo di pompa di calore
Maniglia
N(1) 2 3

blu Nero Marrone giallo-


verde

Blocco
Collegamento unit esterna terminale
44 www.electrolux.com

2. Estrarre la morsettiera. Collegare e Fig.47


avvitare il cavo di collegamento elettrico
8700~11000 Watt (30K&36K)
e il cavo di controllo del segnale (solo
Solo per tipo di raffreddamento
per i modelli con pompa di calore) al
blocco terminali seguendo i numeri N(1) 2 3
HLFRORULGLLGHQWLFD]LRQHVXLEORFFKL
terminali delle unit interne ed esterne.
blu Nero Marrone giallo-
3. Per evitare che entri acqua, realizzare verde
una trappola (U) nei cavi di
collegamento (vedere pagina 40).
4. Avvolgere i cavi che non sono collegati Collegamento unit interna
con del nastro isolante in modo tale che
essi non tocchino alcuna parte elettrica Fig.48
o metallica. 1300~2200 Watt (5K&7K)
5. Fissare il collegamento elettrico con dei Tipo di pompa di calore
morsetti.
N(1) 2 4 5
6. Reinstallare la maniglia.
Fig.44
blu Nero viola arancione
1300~2200 Watt (5K&7K) giallo-
Solo per tipo di raffreddamento verde
N(1) 2
Collegamento unit interna
blu Nero giallo- Fig.49
verde
2500~3600 Watt (9K&12K)
Tipo di pompa di calore
Collegamento unit interna N(1) 2 3
Fig.45
blu Nero Marrone giallo-
2500~3600 Watt (9K&12K) verde
Solo per tipo di raffreddamento
N(1) 2
Collegamento unit interna
blu Nero giallo-
Fig.50
verde
4500~6800 Watt (9K&12K)
Tipo di pompa di calore
Collegamento unit interna N(1) 2 3
Fig.46
blu Nero Marrone giallo-
5200~6600 Watt (18K&24K) verde
Solo per tipo di raffreddamento
N(1) 2 3
Collegamento unit interna
blu Nero Marrone giallo-
verde

Collegamento unit interna


ITALIANO 45

Fig.51 s Aumento della pressione del sistema.


8700~11000 Watt (30K&36K) s Aumento della corrente operativa.
Tipo di pompa di calore s &DORGHOOpHIFLHQ]DGLUDIIUHGGDPHQWR
o riscaldamento (solo modelli con
N(1) 2 3 funzione riscaldamento).
s Lumidit nel circuito refrigerante pu
blu Nero Marrone giallo-
verde
congelare e bloccare i tubi capillari.
s Lacqua pu causare la corrosione di
parti del sistema refrigerante.
Collegamento unit interna Pertanto, lunit interna e i tubi tra lunit
interna e quella esterna devono essere
NOTA: FRQWUROODWLSHUYHULFDUHHYHQWXDOLSHUGLWHH
Dopo avere confermato le condizioni svuotati per eliminare dal sistema eventuali
precedenti, preparare i cavi nel modo sostanze non condensabili e umidit.
seguente:
s Le viti che serrano il cablaggio alla 3.6.1 Evacuazione dellaria
morsettiera si potrebbero allentare a mediante pompa a vuoto
causa di vibrazioni in fase di trasporto.
s 9HULFDUHFKHWXWWHOHYLWLVLDQR 1. Controllare che ogni tubo (sia quelli
VDOGDPHQWHVVDWH,QFDVRFRQWUDULRVL della linea del liquido che quelli del gas)
potrebbero bruciare dei cavi. tra le unit interna ed esterna sia stato
correttamente collegato e che tutti i
s Accertarsi che la capacit del circuito
cablaggi per la prova di funzionamento
VLDVXIFLHQWH
siano stati completati. Togliere i coperchi
s 9HULFDUHFKHODWHQVLRQHGLSDUWHQ]DVLD della valvola di servizio della linea del
mantenuta a pi del 90% della tensione gas e del liquido sullunit esterna. Si
nominale indicata sulla piastra. noti che le valvole di servizio sulla linea
s 9HULFDUHFKHORVSHVVRUHGHOFDYRVLD del liquido e del gas sullunit esterna
FRPHTXHOORLQGLFDWRQHOOHVSHFLFKHGL sono generalmente chiuse in questa
alimentazione. fase.
s Installare sempre un interruttore 2. Quando lunit viene spostata in un
differenziale (RCD) nelle aree bagnate altro luogo, eseguire unoperazione di
o umide. evacuazione servendosi di una pompa
s Un calo di tensione pu causare quanto a vuoto.
segue: Vibrazione di un contattore, che 3. 9HULFDUHFKHLOUHIULJHUDQWHDJJLXQWRDO
danneggia il punto di contatto, scoppio condizionatore sia comunque in forma
del fusibile, disturbi della funzione liquida.
normale di sovraccarico. 4. ,OOWURGHOOpROLRYDLQVWDOODWRRJQLP
s I dispositivi di interruzione della QHVVXQOWURGHOOpROLRQHFHVVDULR
corrente di alimentazione devono quando lunit esterna installata pi in
HVVHUHLQFRUSRUDWLQHOFDEODJJLRVVR basso rispetto allunit interna).
e prevedere una distanza di almeno 5. La lunghezza del tubo e la quantit
3 mm che eviti il contatto in ciascun di refrigerante per il tipo diviso di
conduttore attivo (fase). condizionatore daria. (Vedere in basso
la tabella 5)
3.6 Spurgo aria e test perdite
Laria e lumidit del sistema refrigerante
hanno i seguenti effetti indesiderati:
46 www.electrolux.com

Unit esterna Unit esterna

(A)
Blocco dellolio

(A)
(B)
(B)

Unit interna Unit interna


Lunghezza tubazione inferiore a 5 m Lunghezza tubazione 5 m o pi

Tab.5

Diametro Lunghezza Ulteriore refrigerante(g/m)


Capacit Lunghezza Altezza massima
tubo di standard
Watt (BTU/h) massima (m)(A) (m)(B) Solo Pompa di
scarico (mm) (m)
raffreddamento calore

2500 (9K) 9,52 (3/8) 5 15 10 15 20

3200 (12K) 9,52 (3/8) 5 20 10 15 20

4600 (18K) 9,52 (3/8) 5 20 10 15 20

6700 (24K) 15,88 (5/8) 5 25 10 15 17

8000 (30K) 15,88 (5/8) 5 30 10 15 50

9700 (36K) 15,88 (5/8) 5 30 10 15 50

3.6.2 Precauzione nelluso della Fig.52


valvola di stop integrata nelle
prese dellunit esterna Refrigerante
1. Apertura della valvola di stop: Aprire lo Valvola di stop
bassa pressione
VWHORYDOYRODQRDTXDQGRXUWDFRQLO Unit
Unit (Valvola a 3 vie)
interna
dispositivo di arresto. Non cercare di esterna
aprirlo ulteriormente. Lato gas

2. Chiusura della valvola di stop: Serrare Lato liquido


saldamente lo stelo della valvola con
XQRVWUXPHQWRVSHFLDOH4XLQGLVVDUH Valvola di stop Semigiunto
saldamente il coperchio dello stelo della alta pressione
valvola usando una chiave per dadi o (Valvola a 2 vie)
altro attrezzo simile. Consultare la tavola
a pagina 17 per il valore di coppia del
serraggio del tappo della valvola.
ITALIANO 47

NOTA: YDOYRODDEDVVDSUHVVLRQHSHUYHULFDUH
la presenza di aria allinterno (se il
s C una porta di caricamento integrata
rumore di funzionamento della pompa
nel lato inferiore della presa eletrica, ma
a vuoto cambiato, la lettura del
non in quello superiore. Il lato inferiore
multimetro 0 anzich meno). Quindi,
della presa elettrica mostrato nella
serrare il dado svasato. Il procedimento
seguente mappa schizzata.
YHULFDVHFLVRQREORFFKLDOOpLQWHUQRGHL
Fig.53 tubi.
5. Continuare lestrazione per pi di 15
PLQXWLHYHULFDUHFKHODOHWWXUDGHO
Corpo della Dado svasato
valvola
multimetro indichi -7-3/5 x 10 Micron
Hg (-1x10 Pa). Dopo aver completato
levacuazione, chiudere completamente
Coperchio la maniglia a bassa pressione della
valvola del collettore e interrompere il
funzionamento della pompa a vuoto.
Porta di caricamento 6. Ruotare lo stelo della valvola di stop
Stelo valvola B di circa 45 in senso antiorario
6 - 7 secondi dopo luscita del gas,
Dispositivo di arresto quindi serrare nuovamente il dado
VYDVDWR9HULFDUHFKHOpLQGLFDWRUH
della pressione sia leggermente
3.6.3 Quando si usa la pompa a pi alto di quello della pressione
vuoto atmosferica. Questo procedimento
YHULFDVHLOUHIULJHUDQWHDWWUDYHUVDLWXEL
Per il metodo duso di una valvola del correttamente.
collettore, consultare questo manuale di 7. Chiudere la valvola, poi rimuovere lo
funzionamento. strumento della valvola. Sostituire il
1. Serrare completamente i dadi svasati, tappo della porta di caricamento.
A, B,C, D. Collegare il tubo di carico 8. Aprire completamente gli steli della
della valvola del collettore a una presa valvola a 3 vie B e A.
di carico della valvola di riempimento, 9. Serrare saldamente il coperchio della
poi collegare il tubo a vuoto allo valvola a 3 vie.
strumento della valvola collettore.
Fig.54
Aprire la valvola del collettore.
NOTA:
Unit esterna
s Aprire la pompa a vuoto per Valvola
manicotto
loperazione di estrazione aria. Multimetro-76cmHg
Maniglia
2. Collegare laltro tubo di carico della Maniglia bassa
pressione
alta
valvola del collettore alla pompa a Tubo di caricamento
pressione

vuoto. Valvola pressione Tubo di


bassa caricamento
3. Aprire completamente la maniglia del
Lato inferiore della valvola del collettore.
4. Mettere in funzione la pompa a vuoto Pompa a vuoto

da evacuare. Allinizio, allentare


leggermente il dado svasato della
48 www.electrolux.com

4. TEST E FUNZIONAMENTO

4.1 Test fughe di gas qualora si riscontri una perdita di


refrigerante. Controllare e trovare una
1. Metodo con acqua insaponata soluzione in modo che lunit funzioni
s Applicare acqua saponata o detergente correttamente.
liquido naturale su tutte le valvole e
tutti i collegamenti dei tubi dellunit 4.3 Test di funzionamento
interna o delluniit esterna (A: Valvola
a 3 vie, B: Valvola a 2 vie C e D sono le 1. Prima del test di funzionamento
estremit della connessione dellunit
interna) con una spazzola morbida s Non accendere prima di aver
SHUYHULFDUHODSUHVHQ]DGLHYHQWXDOL completato l'installazione.
perdite. Se si formano delle bolle, vi s Il cablaggio elettrico deve essere
sono fughe dai tubi. collegato in modo giusto e sicuro.
Fig.55 s Le valvole di stop sui tubi di
collegamento devono essere
Unit interna
Punti di controllo completamente aperte.
D
Tubo liquido s Tutte le impurit, come ad esempio
C EULFLROHHULXWLGRYUDQQRHVVHUHWROWH
Tubo del gas
dall'unit.
Unit
esterna Valvola
B
Unit esterna 2. Metodo del test di funzionamento
Punti di controllo
a 2 vie A s Scollegare lalimentazione e premere il
Valvola tasto ON/OFF sul telecomando per
a 3 vie avviare il funzionamento.
s Mediante il tasto MODE selezionare
COOL, HEAT (ove presente), FAN per
controllare che tutte le funzioni operino
correttamente.
2. Rilevatore di perdite
s Quando la temperatura ambiente
s Usando il rilevatore di perdite controllare
inferiore a 16C, non sar possibile, dal
che non vi siano fughe.
telecomando, impostare lunit perch
funzioni in modalit COOL. Servirsi
4.2 Controllo sicurezza elettrica della modalit di funzionamento di
emergenza, usata unicamente quando
Eseguire i controlli elettrici di sicurezza al il telecomando non disponibile o in
termine dell'installazione: caso di manutenzione.
1. Messa a terra Fig.56
s 'RSRDYHUHQLWRODPHVVDDWHUUD
misurare la resistenza mediante
rilevamento visivo e un dispositivo di
misurazione della resistenza di messa
a terra. Controllo manuale
pulsante
2. Controllo di perdite elettriche (eseguire
durante la prova di funzionamento)
s Durante la prova di funzionamento
dopo linstallazione, la persona addetta
alla manutenzione pu utilizzare
elettrosonda e multimetro per eseguire
il controllo delle perdite elettriche. Tasto controllo manuale

Spegnere immediatamente lunit


ITALIANO 49

4.4 Pompaggio 4.5 9HULFKHGRSROpLQVWDOOD]LRQH


In fase di spostamento o riposizionamento Elementi da Possibile
YHULFDUH malfunzionamento
del condizionatore, svuotare il sistema
con la seguente procedura di modo /pXQLWVWDWDVVDWD Lunit potrebbe cadere,
che non venga rilasciato del refrigerante saldamente? muoversi o emettere rumori.
nell'atmosfera. stato eseguito il test di Potrebbe provocare un
perdita refrigerante? UDIIUHGGDPHQWRLQVXIFLHQWH
s &ROOHJDUHLOWXERHVVLELOHGHOODYDOYROD (riscaldamento).
del collettore alla porta di carico della
valvola di stop sul lato tubo del gas Lisolamento termico Potrebbe provocare
VXIFLHQWH" condensa.
dell'unit esterna.
Lo scarico dellacqua Potrebbe provocare perdite
s Chiudere la valvola di stop sul lato tubo soddisfacente? dacqua.
del gas quasi completamente.
La tensione in linea Potrebbe provocare
s Chiudere completamente la valvola di con la tensione nominale malfunzionamenti elettrici o
stop sul lato del tubo liquido. indicata sulla targhetta? danneggiare lunit.
s Accendere l'unit in modalit COOL. Il cablaggio elettrico Potrebbe provocare
o le tubazioni sono malfunzionamenti elettrici o
s Chiudere completamente la valvola di
state installate in modo danneggiare le componenti.
stop sul lato tubo del gas quando il corretto e sicuro?
manometro indica 1 - 0,5 kgf/cm2
Lunit stata messa a Potrebbe provocare perdite
(100 ~ 50 kPa). terra in modo sicuro? elettriche.
s Interrompere lesecuzione del test Il cavo di alimentazione Potrebbe provocare
spegnendo l'unit. Tutti i gas refrigeranti VWDWRVSHFLFDWR" malfunzionamenti elettrici o
sono stati raccolti nell'unit esterna. danneggiare le componenti.

Lentrata o luscita sono Potrebbe provocare un


bloccate? UDIIUHGGDPHQWRLQVXIFLHQWH
(riscaldamento)

La lunghezza dei tubi La capacit del refrigerante


di collegamento e la non accurata.
capacit refrigerante
sono state registrate?
50 www.electrolux.com

TRE UMOWY
1. INSTRUKCJE BEZPIECZESTWA ..................................................................51
2. PRZED ROZPOCZCIEM INSTALACJI ...........................................................53
3. MONTA PRODUKTU ......................................................................................56
4. KONTROLA I URUCHOMIENIE ........................................................................72

MYLIMY O TOBIE
Dzikujemy za zakup urzdzenia Electrolux. Wybrali Pastwo produkt, ktry powsta
na bazie lat naszego dowiadczenia zawodowego i innowacji. Pomysowa i stylowa
konstrukcja zaprojektowana z myl o Was. A zatem mona by pewnym, e podczas
uytkowania niniejszego produktu zawsze uzyska si wspaniae rezultaty.

Electrolux wita.

Odwied nasz stron, aby:


Uzyskaj porady dotyczce obsugi, broszury, informacje o rozwizywaniu pro-
blemw i informacje serwisowe:
www.electrolux.com

Zarejestruj swj produkt, w celu uzyskania lepszej obsugi:


www.electrolux.com/productregistration

Kupuj akcesoria, materiay eksploatacyjne i oryginalne czci zapasowe dla


Twojego urzdzenia:
www.electrolux.com/shop

OBSUGA KLIENTA I SERWIS


Zalecamy stosowanie oryginalnych czci zamiennych.
Przed skontaktowaniem si z serwisem upewnij si, czy posiadasz ponisze informacje.
Informacje te znajduj si na tabliczce znamionowej: model, PNC, nr seryjny.

Ostrzeenie / Uwaga - Informacje dotyczce bezpieczestwa


Porady i informacje oglne
Informacje dotyczce rodowiska

Informacje te mog ulec zmianie bez uprzedzenia.


POLSKI 51

1. INSTRUKCJE BEZPIECZESTWA

Przed montaem i eksploatacj urzdzenia wprowadzonymi przez dostawcw


naley dokadnie przeczyta niniejsze energetycznych.
instrukcje. Producent nie odpowiada za Przenoszenie do innej lokalizacji lub
ewentualne szkody i obraenia poniesione wyrzucenie urzdzenia moe zosta
w wyniku nieprawidowego montau lub wykonane jedynie przez osob
uytkowania. Instrukcje naley zawsze posiadajc odpowiednie kwalifikacje.
przechowywa w pobliu urzdzenia. W przypadku dostrzeenia
nieprawidowego dziaania, takiego jak
1.1 Bezpieczestwo dzieci i osb zapach spalenizny, naley wyczy
zasilanie klimatyzatora i skontaktowa
szczeglnie naraonych si z agentem serwisowym firmy
Electrolux. Utrzymywanie si takiego
OSTRZEENIE! nietypowego stanu oznacza, e
Ryzyko uduszenia, uszkodzenia klimatyzator moe by uszkodzony
ciaa lub trwaego kalectwa. lub nawet doprowadzi do poraenia
prdem, lub poaru.
Urzdzenie moe by uytkowane przez
dzieci powyej 8 roku ycia i osoby o Nie naley pracowa z urzdzeniem
jeli ma si mokre rce. Moe to
ograniczonych zdolnociach fizycznych,
spowodowa poraenie prdem.
czuciowych oraz psychicznych
Naley uwaa, aby nie uszkodzi lub
lub posiadajcych ograniczone
przeci przewodu zasilajcego, lub
dowiadczenie i wiedz, jeeli s one innych przewodw. Jeli dojdzie do
nadzorowane lub zostay odpowiednio takiej sytuacji, naley skontaktowa si
poinstruowane w kwestii bezpiecznego z akredytowanym technikiem w celu
uytkowania i rozumiej zagroenia z dokonania naprawy lub wymiany.
nim zwizane. Zabrania si podczania niniejszego
Dzieci nie powinny bawi si klimatyzatora do wielowyjciowej tablicy
urzdzeniem. zasilajcej.
Czyszczenie i czynnoci konserwacyjne Jeli klimatyzator nie bdzie uywany
nie mog by wykonywane przez dzieci przez duszy okres czasu, to naley go
pozbawione nadzoru. odczy od zasilania. W przeciwnym
wypadku bdzie si na nim zbiera kurz i
moe powsta poar.
1.2 Monta i uytkowanie Przed przystpieniem do czyszczenia
klimatyzatora naley odczy zasilanie
OSTRZEENIE! w celu wyeliminowania moliwoci
Ryzyko uduszenia, uszkodzenia poraenia prdem.
ciaa lub trwaego kalectwa. Zasilanie powinno zosta dopasowane
W celu zamontowania urzdzenia naley do klimatyzatora zgodnie z instrukcj
skontaktowa si z autoryzowanym montaow. Klimatyzatory wyposaone
montayst. w przewd zasilajcy naley podczy
bezporednio do gniazda zasilajcego
W celu dokonania naprawy lub z odpowiednim wycznikiem
konserwacji naley skontaktowa si z bezpieczestwa. Klimatyzatory z obsug
autoryzowanym serwisantem. sprztow musz by podczone
Gniazdo zasilajce musi zosta do odpowiedniego wycznika
podczone i zarejestrowane przez bezpieczestwa, zgodnie z instrukcj
licencjonowane przedsibiorstwo. montaow.
Jeli przewd zasilajcy jest uszkodzony, Prosz sprawdzi, czy zasilanie
to w celu uniknicia potencjalnych klimatyzatora jest stabilne, oraz czy
zagroe, powinien zosta wymieniony spenia wymagania opisane w instrukcji
przez producenta, jego agenta montaowej.
serwisowego lub osoby posiadajce Naley zawsze sprawdza, czy produkt
podobne kwalifikacje. zosta zamontowany z zastosowaniem
Prace montaowe mog by odpowiedniego uziemienia.
wykonywane wycznie przez Dla bezpieczestwa, naley wyczy
upowanione do tego osoby, zgodnie wycznik bezpieczestwa przed
z krajowymi normami dotyczcymi przystpieniem do konserwacji,
okablowania oraz zasadami czyszczenia lub w przypadku, gdy
52 www.electrolux.com

urzdzenie nie pracuje przez duszy skutkowa poarem lub poraeniem


okres czasu. Nagromadzony kurz moe prdem. Prosz si skontaktowa z
spowodowa poar lub doprowadzi do autoryzowanym centrum serwisowym.
poraenia prdem. Zabrania si wkadania doni lub innych
Prosz wybra odpowiedni warto obiektw do wntrz wlotw lub wylotw
temperatury. Moe to zmniejszy zuycie powietrza. Moe to spowodowa
energii. odniesienie obrae.
W trakcie pracy nie powinno si Nie wystawia zwierzt ani rolin na
pozostawia otwartych drzwi i okien bezporedni kontakt z wylatujcym
przez duszy okres czasu. Moe to powietrzem.
skutkowa ograniczeniem wydajnoci Zabrania si wykorzystywania
urzdzenia. urzdzenia w sposb niezgodny z jego
Zabrania si blokowania wlotw i przeznaczeniem (jak np. konserwacja
wylotw powietrza. Moe to skutkowa ywnoci lub suszenie ubra).
ograniczeniem wydajnoci urzdzenia i Zabrania si polewania urzdzenia
doprowadzi do jego uszkodzenia. wod. Moe to skutkowa poraeniem
Urzdzenie powinno si znajdowa z prdem lub usterk urzdzenia.
dala od materiaw atwopalnych (co Dla bezpieczestwa, naley wyczy
najmniej w odlegoci 1m). Moe to wycznik bezpieczestwa przed
spowodowa poar. przystpieniem do konserwacji,
Zabrania si stawania lub umieszczania czyszczenia lub w przypadku, gdy
cikich przedmiotw na wierzchu urzdzenie nie pracuje przez duszy
jednostki zewntrznej. Moe to okres czasu. Nagromadzony kurz moe
skutkowa uszkodzeniem urzdzenia lub spowodowa poar lub doprowadzi do
odniesieniem obrae. poraenia prdem.
Uchwyt jednostki zewntrznej jest Niniejszy klimatyzator wykorzystuje
nieco wski. Naley uwaa podczas chodziwo R410A.
podnoszenia jednostki zewntrznej.
Zabrania si podejmowania prby
samodzielnej naprawy klimatyzatora.
Nieprawidowo wykonane naprawy mog

Niniejsz instrukcj mona uzyska od naszego lokalnego


dystrybutora lub pobra z naszej strony internetowej.
W poniszej tabeli zamieszczono adresy internetowe firmy Electrolux dla poszczeglnych
krajw.
Pastwo Adres strony Pastwo Adres strony
Albania www.electrolux.al Holandia www.electrolux.nl
Austria www.electrolux.at Norwegia www.electrolux.no
Belgia www.electrolux.be Polska www.electrolux.pl
Bugaria www.electrolux.bg Portugalia www.electrolux.pt
Chorwacja www.electrolux.hr Rumunia www.electrolux.ro
Czechy www.electrolux.cz Serbia www.electrolux.rs
Dania www.electrolux.dk Sowacja www.electrolux.sk
Finlandia www.electrolux.fi Sowenia www.electrolux.sl
Francja www.electrolux.fr Hiszpania www.electrolux.es
Niemcy www.electrolux.de Szwecja www.electrolux.se
Grecja www.electrolux.gr Szwajcaria www.electrolux.ch
Wgry www.electrolux.hu Turcja www.electrolux.com.tr
Wochy www.electrolux.it Wielka Brytania i Irlandia www.electrolux.co.uk
Luksemburg www.electrolux.lu
Wicej informacji mona uzyska pod adresem www.electrolux.com.
POLSKI 53

2. PRZED ROZPOCZCIEM INSTALACJI

Wszystkie rysunki zamieszczone w niniejszej instrukcji s przeznaczone wycznie do


celw demonstracyjnych. Ksztat faktyczny zakupionej jednostki wewntrznej moe si
nieco rni (panel przedni i wywietlacz). Ksztat faktyczny ma pierwszestwo.

2.1 Narzdzia potrzebne do instalacji


1. Poziomica 10. Wykrywacz nieszczelnoci instalacji
2. rubokrt gazowych
3. Wiertarka elektryczna 11. Pompa prniowa
4. Otwornica (55 mm / 70 mm) 12. Zestaw manometrw
5. Kielichownica 13. Instrukcja obsugi
6. Klucze dynamometryczne 14. Termometr
7. Klucz paski (do prubunku) 15. Multimetr
8. Szklanka wody 16. Obcinak do rurek
9. Klucz imbusowy (4 mm) 17. Tama miernicza

2.2 Akcesoria
Liczba Nazwa elementu Ilo

1 Uchwyt do montau jednostki wewntrznej 1


2 Koki rozporowe Do zakupienia osobno
3 Wkrt samogwintujcy A ST3.9X25 5-8
4 Pilot zdalnego sterowania 1
5 Uchwyt pilota zdalnego sterowania (opcjonalnie) 1
Wkrt do zamocowania uchwytu pilota zdalnego
6 2
sterowania ST2.9X10 (opcjonalnie)
7 Bateria (AAA 1,5 V) 2
8 Materia izolacyjny Do zakupienia osobno
9 Zestaw rurek poczeniowych (opcjonalnie) Zalenie od kraju
Przewd izolacyjny do rurek obiegu czynnika chod-
10 Do zakupienia osobno
niczego
11 W odpywowy Do zakupienia osobno
12 Uchwyt cienny Do zakupienia osobno
13 Poczeniowy kabel zasilajcy Do zakupienia osobno
cznik wa odpywowego (tylko model z pomp
14 1
ciepa)
Korek spustowy (tylko model z pomp ciepa) (opcjo-
15 3
nalnie)
Rurka z izolacj termiczn do przeduenia wa
16 1
odpywowego
Nakrtka kielichowa (do przewodu ssawnego) (opcjo-
17 1
nalnie)
Nakrtka kielichowa (do przewodu cieczy) (opcjonal-
18 1
nie)
Uwaga: Pozostae czci potrzebne do instalacji (oprcz wymienionych) powinny zosta
dostarczone przez uytkownika/instalatora.
54 www.electrolux.com

2.3 Opis urzdzenia

1 3 2

min. 15 cm
Odlego od sufitu

Jednostka
wewntrzna
Odlego od ciany
min. 15 cm
Odlego od ciany min. 15 cm

8
m 3

9
min.

10
Strona wylotu powietrza

4
11

6
Odlego od przeszkody

7
min. 50 cm

18 Strona wlotu
powietrza
Odlego od ciany
cm
17 min. 30 cm .3
0
in
m

m min. 50 cm
16 in
.2
m Odlego od
ciany
Strona wylotu powietrza 12
15

14
13
UWAGA
Wszystkie rysunki zamieszczone w niniejszej instrukcji s przeznaczone
wycznie do celw demonstracyjnych. Ksztat faktyczny zakupionej jednostki
wewntrznej moe si nieco rni (panel przedni i wywietlacz). Ksztat
faktyczny ma pierwszestwo.
POLSKI 55

2.4 Miejsce instalacji Jednostk zewntrzn naley


zamontowa tak, aby bya ona poza
Zabrania si montowania jednostki w zasigiem dzieci.
obszarach, w ktrych obecne s/jest : Jednostk zewntrzn naley
rda intensywnego ciepa zamontowa w miejscu zapewniajcym
opary lub gazy atwopalne odpowiedni wentylacj.
zanieczyszczenia czsteczkami oleju Jednostk zewntrzn naley
zamontowa w takim miejscu, aby
wyposaenie elektromagnetyczne
haas i przepyw powietrza nie zakca
pracujce z wysok czstotliwoci
spokoju ssiadw i zwierzt.
(np. wyposaenie spawalnicze lub
urzdzenia medyczne) Jednostk zewntrzn naley
zamontowa w suchym miejscu.
wysokie zasolenie (np. obszary
przybrzene) Jednostk zewntrzn naley
zamontowa w miejscu nie
gaz siarkowy (np. gorce rda)
wystawionym na bezporednie
kiepska jako powietrza oddziaywanie promieni soca i silnych
Jednostka wewntrzna wiatrw.
Naley zachowa minimalne odlegoci Jednostk naley zamontowa
montaowe zawarte w niniejszym w miejscu, ktre bdzie w stanie
dokumencie. Zabrania si blokowania wytrzyma ciar i wibracje
wlotw i wylotw powietrza. powodowane przez jednostk.
Zabrania si uywania jednostki w Rnica wysokoci midzy jednostk
miejscach o ekstremalnie wysokiej wewntrzn i zewntrzn nie moe by
wilgotnoci powietrza. wiksza ni 10 m.
Jednostk wewntrzn naley Rury czce nie mog znajdowa si
zamontowa tak, aby bya ona poza na wysokoci przekraczajcej 25 m.
zasigiem dzieci. Naley zachowa troch wolnej
ciana musi by na tyle mocna, aby bya przestrzeni, aby moliwe byo
w stanie wytrzyma ciar i wibracje czyszczenie i wykonywanie konserwacji
powodowane przez jednostk. urzdzenia.
Jednostk wewntrzn naley Jednostka zewntrzna jest zasilana
zamontowa min. 230 cm nad poprzez jednostk wewntrzn.
powierzchni podogi. rodki bezpieczestwa dla urzdze
Naley zachowa troch wolnej elektrycznych
przestrzeni, aby moliwe byo Uyj dedykowanego obwodu
czyszczenie i wykonywanie konserwacji zasilajcego.
urzdzenia.
Jednostka musi zosta odpowiednio
Naley zapewni dostp do filtra uziemiona.
powietrza.
Zainstaluj wycznik rnicowoprdowy
Midzy jednostk a innym (RCD) w celu zapewnienia odpowiedniej
wyposaeniem elektrycznym naley ochrony przed obraeniami
zachowa odlego co najmniej 1 m. spowodowanymi prdem upywu.
Jednostk wewntrzn naley Naley korzysta z rozcznika dla
zamontowa w miejscu, w ktrym wszystkich biegunw, z minimalnym
moliwe bdzie atwe odprowadzenie odstpem stykw 3 mm i ze staym
skroplonej wody. przyczem. W przypadku modeli
Monta naley wykona w miejscu wyposaonych we wtyczk sieciow,
nie wystawionym na bezporednie naley sprawdzi po instalacji czy
oddziaywanie promieni soca. znajduje si ona w zasigu.
Jednostka zewntrzna Instalacja musi by zgodna z
Naley zachowa minimalne odlegoci lokalnymi wymogami bezpieczestwa
montaowe zawarte w niniejszym elektrycznego oraz z innymi
dokumencie. powizanymi lokalnymi przepisami.
Zabrania si blokowania wlotw i
wylotw powietrza.
56 www.electrolux.com

Urzdzenie musi by zainstalowane Wymagania dotyczce uziemienia


zgodnie z krajowymi przepisami Jednostka jest elektronarzdziem typu I.
instalacyjnymi. Naley sprawdzi, czy jednostka zostaa
Nie naley napina przewodu odpowiednio uziemiona.
zasilajcego. to-zielony przewd jest przewodem
Odlego midzy jednostk a rdami uziemiajcym, ktrego nie mona
ciepa nie moe by mniejsza ni 1,5 m. wykorzystywa do innych celw.
UWAGA Niewaciwe uziemienie moe
Naley sprawdzi, czy prawidowo powodowa poraenie prdem
podczono w gniedzie elektrycznym elektrycznym.
przewd fazowy, zerowy i uziemiajcy. Oporno uziemienia musi by zgodna z
Niewystarczajce lub bdne poczenia lokalnymi przepisami.
elektryczne mog spowodowa rdo zasilania sieciowego musi
poraenie prdem lub poar. posiada solidny zacisk uziemiajcy.
Zabrania si podczania przewodu
uziemienia do rur wodocigowych,
gazowych, rur na zanieczyszczenia lub
3. MONTA PRODUKTU innych potencjalnie niebezpiecznych
miejsc.
Bezpieczniki musz by zgodne
z wyznaczonym modelem oraz
klasyfikacj przedstawion na obudowie
3.1 Monta jednostki wewntrznej bezpiecznika lub pytki drukowanej.

3.1.1 Rodzaj uchwytu montaowego

Zarys jednostki
Co najmniej 150 mm od sufitu
wewntrznej

Co najmniej Co najmniej
150 mm od 150 mm od
ciany ciany

Otwr 55 Otwr 55 na
na chodziwo chodziwo po
po lewej prawej tylnej
tylnej stronie stronie

Jednostka wewntrzna modele 9000Btu/h

Co najmniej 150 mm od sufitu Zarys jednostki


wewntrznej
Co najmniej Co najmniej
150 mm od 150 mm od
ciany ciany

Otwr 55 Otwr 55 na
na chodziwo chodziwo po
po lewej prawej tylnej
tylnej stronie stronie

Jednostka wewntrzna modele 12000Btu/h


POLSKI 57

Co najmniej 150 mm od sufitu Zarys jednostki


wewntrznej

Co najmniej Co najmniej
150 mm od 150 mm od
ciany ciany

Otwr 55 Otwr 55 na
na chodziwo chodziwo po
po lewej prawej tylnej
tylnej stronie stronie

Jednostka wewntrzna modele 18000Btu/h

Zarys jednostki
Co najmniej 150 mm od sufitu
wewntrznej

Co najmniej Co najmniej
150 mm od 150 mm od
ciany ciany

Otwr 70 Otwr 70 na
na chodziwo chodziwo po
po lewej prawej tylnej
tylnej stronie stronie

Jednostka wewntrzna modele 24000Btu/h

Zarys jednostki
Co najmniej 150 mm od sufitu wewntrznej

Co najmniej Co najmniej
150 mm od 150 mm od
ciany ciany

Otwr 70 Otwr 70 na
na chodziwo chodziwo po
po lewej prawej tylnej
tylnej stronie stronie

Jednostka wewntrzna modele 28000Btu/h


58 www.electrolux.com

3.1.2 Mocowanie uchwytu 3.1.4 Rura poczeniowa


ciennego
1. Dla orurowania prawostronnego i
1. Uchwyt cienny naley zamocowa lewostronnego naley zdj oson rury
na cianie poziomo nad elementami z panelu bocznego. Oson rury mona
konstrukcyjnymi, korzystajc z przerw zachowa na potrzeb ewentualnej
zaznaczonych na uchwycie (rys. 1). pniejszej relokacji klimatyzatora.
2. W przypadku cian pokrytych kafelkami, 2. Tylne orurowanie lewo- i prawostronne
cian betonowych lub innych podobnych, naley zamontowa zgodni z rys. 3.
naley wywierci otwory o rednicy 5 Rur poczeniow naley zgi tak, aby
mm. Dla wszystkich rub montaowych mona j byo uoy w odlegoci co
naley umieci odpowiednie wsporniki najwyej 43 mm od ciany. Koniec rury
kotwiczce orurowanie i okablowanie. naley odpowiednio zamocowa.
3. Uchwyt montaowy naley zamocowa Rys. 3
na cianie przy pomocy omiu rub typu Osona rury Uchwyt rury Osona rury
A. (lewa)
(prawa)
4. W kadym przypadku zaleca si
korzystanie z zabezpieczajcych kokw
ciennych.
Rys. 1

Prawe Tylne prawe Tylne lewe


orurowanie orurowanie orurowanie
UWAGA: Rys. 4
Zamontowa uchwyt cienny i wywierci
w cianie otwory uwzgldniajc jej Zarys jednostki Rura poczeniowa
struktur oraz punkty montaowe wewntrznej
samego uchwytu (wymiary zostay

43 mm
podane w mm, chyba e zaznaczono
inaczej).

3.1.3 Wywiercanie otworu


1. Okreli pooenie otworu do rur za
pomoc uchwytu ciennego i wywierci 3.1.5 Odpyw
otwr dla rury, tak aby schodzia ona
lekko ku doowi. 1. Uoy w odpywowy tak, aby by on
2. Podczas wiercenia naley zawsze pochylony do dou. Prosz nie instalowa
korzysta z osony z otworem. wa odpywowego zgodnie z rys. 5.
Rys. 2 Rys. 5
ciana
Przestrze
Przestrze zewntrzna
wewntrzna

Nie blokowa przepywu wody poprzez


5-7mm

przepukiwanie lub zanurzanie koca


wa odpywowego w wodzie.
POLSKI 59

2. Podczas podczania przeduenia 3.1.7 Orurowanie i owijanie


wa odpywowego naley odpowiednio
uszczelni element czcy przeduenie 1. Bezpiecznie i rwnomiernie zawin
wa z rur osaniajc. W odpywowy przewd, kabel poczeniowy oraz w
nie moe si poluzowa. odpywowy przy pomocy tamy jak
pokazano na rysunku.
3.1.6 Mocowanie jednostki 2. Skondensowana woda z tylnej
wewntrznej czci jednostki wewntrznej zbiera
si w zasobniku wody skroplonej
i jest odprowadzana na zewntrz
1. Przecign orurowanie przez cian. pomieszczenia. Zabrania si
2. Zaczepi grny uchwyt znajdujcy umieszczania dodatkowych elementw
si z tyu jednostki wewntrznej o w zasobniku.
grny zaczep uchwytu ciennego. Rys. 8
Porusza urzdzeniem na boki w
celu sprawdzenia, czy udao si je
bezpiecznie zamocowa.
Rys. 6 Zasobnik
wody
skroplonej
Grny zaczep
Przestrze
Poczenia na kable
kabli
Rura
poczeniowa
Pasek
W owijajcy
odpywowy

UWAGA:
Podczy najpierw jednostk
Dolny zaczep wewntrzn, a nastpnie jednostk
zewntrzn.
3. Orurowanie mona atwo zamocowa Uwaa, aby w odpywowy nie uleg
poprzez uniesienie jednostki poluzowaniu.
wewntrznej przy pomocy materiau Cae orurowanie pomocnicze musi by
amortyzujcego umieszczonego midzy izolowane termicznie.
t jednostk a cian. Upewni si, e w odpywowy
Rys. 7 znajduje si w dolnej czci wizki.
Umieszczenie go w grnej czci wizki
mogoby spowodowa przelanie si
wody z rynienki odpywowej do wntrza
urzdzenia.
Nigdy nie czy ani nie zwija przewodu
zasilajcego z innymi przewodami.
Poprowadzi w odpywowy ku doowi
w celu zapewnienia prawidowego
odprowadzania skroplonej wody.

3.2 Monta jednostki zewntrznej


Materia amortyzujcy 3.2.1 Mocowanie jednostki
zewntrznej
4. Teraz naley docisn doln cz
jednostki wewntrznej na cianie, a 1. Cz zewntrzn urzdzenia naley
nastpnie porusza jednostk na boki, zamocowa na paskiej powierzchni
do gry i do dou w celu sprawdzenia, w celu uniknicia generowania
czy monta zosta prawidowo wykonany.
60 www.electrolux.com

nadmiernego haasu i wibracji. Zaleca Rys. 11


si zastosowanie podkadki skraplacza.
Wlot powietrza
2. Poprowadzi otwr wentylacyjny w
kierunku obszaru bez przeszkd.
3. Jednostk naley zainstalowa Wlot
w miejscu, w ktrym bdzie ona powietrza
wystawiona na moliwie may wiatr.
Dotyczy to zwaszcza obszarw
szczeglnie wietrznych.
4. Jeli miejsce przeprowadzania instalacji
jest wystawione na dziaanie silnych Wylot
wiatrw (np. obszary przybrzene), powietrza
to jednostk naley umieci na
najszerszej czci ciany lub zastosowa
odpowiednie pyty ochronne. 3.2.2 Odprowadzenie skroplin z
5. Prosz pamita o sprawdzeniu, czy jednostki zewntrznej (tylko model
adne elementy nie przeszkadzaj w z pomp ciepa)
wentylacji (wliczajc wszelkiego rodzaju
krzaki). 1. Podczas czynnoci ogrzewania
Rys. 10 niezbdne jest zapewnienie skutecznego
odpywu przez w odpywowy skroplin i
wody z roztopionego szronu.
2. W tym celu naley zamontowa
cznik wa odpywowego w otworze
odpywowym w podstawie jednostki
zewntrznej, a nastpnie podczy
do niego w odpywowy, ktry bdzie
odprowadza wod gromadzc si w
jednostce zewntrznej.
3. Otwr odpywowy musi by zalepiony.
Decyzj o zalepieniu pozostaych
otworw powinien podj instalator
zalenie od rzeczywistych warunkw.
4. W przypadku stosowania wa
odpywowego jednostka zewntrzna
musi by zainstalowana na podstawie o
wysokoci przekraczajcej 3 cm.
Rys. 12

Otwr
odpywowy
Silny wiatr
UWAGA:
Ustawienie jednostki zewntrznej.
Jednostk zewntrzn przymocowa
mocno i w orientacji poziomej na
powierzchni betonowej lub paskim
mocowaniu z rub i nakrtk o rednicy
10 mm (do zakupienia osobno). Podstawa
cznik wa
odpywowego

W o wewn.
redn. 16mm
(do zakupienia
osobno)
POLSKI 61

3.3 Instalacja orurowania Rys. 14


poczeniowego Rurka

UWAGA: Rozwiertak
Urzdzenie posiada zestaw rur o
dugoci 7,5 m. Cicie elementw nie
jest zalecane. Jeli element jest za dugi
to lepiej zrobi ptl. Rurka
skierowana
Naley zachowa oryginalne zgicie, aby w d
nie doszo do skrcenia rury.

3.3.1 Kielichowanie
3. Naoy nakrtk
Gwn przyczyn wyciekw czynnika Odkrci nakrtki kielichowe znajdujce
chodniczego jest nieprawidowo wykonane si przy jednostce wewntrznej i
kielichowanie. zewntrznej, a nastpnie zaoy je na
Wykona kielichowanie zgodnie z rurk po usuniciu z niej zadziorw. (Nie
nastpujc procedur: jest moliwe ich zaoenie po wykonaniu
kielichowania.)
1. Przyci rurki i kabel. Rys. 15
Uy akcesoryjnego zestawu rurek lub Nakrtka
rurek zakupionych lokalnie. kielichowa
Zmierzy odlego midzy jednostk
wewntrzn a jednostk zewntrzn.
Przyci rurki o nieco wikszej dugoci Rurka miedziana
ni zmierzona odlego.
Przyci kabel o 1,5 m duszy ni rurki.
Rys. 13
4. Kielichowanie
Rurka
Wykona kielichowanie za pomoc
kielichownicy, jak pokazano poniej.
Rys. 16
A

Listwa

Skos Nierwno Zadzior


Rurka
miedziana

Uchwyt

2. Usunicie zadziorw Listwa


Jarzmo
Cakowicie usun wszystkie zadziory z
krawdzi rurki. Stoek
Aby zapobiec wpadaniu zadziorw
do wntrza rury, naley w trakcie
ich usuwania skierowa koniec rurki
miedzianej ku doowi.
Uchwyt zacisku Czerwona
strzaka
Pewnie uchwyci rurk miedzian w
matrycy odpowiednio do wymiarw
podanych w poniszej tabeli.
62 www.electrolux.com

Tab.1 Tab.2
A (mm) Dodatkowy
redn. zewn. Moment
(mm) redn. zewn. moment
Max. Min. obrotowy
(mm) obrotowy
(Nm)
6,35 (1/4) 1,3 0,7 (Nm)
15,7 19,6
9,52 (3/8) 1,6 1,0 6,35 (1/4)
(1,6 kg.m) (2,0 kg.m)
12,70 (1/2) 1,8 1,0 29,4 34,3
9,52 (3/8)
15,88 (5/8) 2,4 2,2 (3,0 kg.m) (3,5 kg.m)
49,0 53,9
12,70 (1/2)
(5,0 kg.m) (5,5 kg.m)
73,6 78,6
3.4 Podczanie przewodw 15,88 (5/8)
(7,5 kg.m) (8,0 kg.m)

3.4.1 Jednostka wewntrzna 2. Owin miejsce poczenia materiaem


izolacyjnym:
1. czenie rurek jednostki wewntrznej z Przykry materiaem izolacyjnym
rurkami poczeniowymi: rurk jednostki wewntrznej i rurk
Wyrwna rurki wzgldem siebie i poczeniow. Oklei je razem tam
najpierw odpowiednio dokrci nakrtk winylow, aby nie byo przerwy.
kielichow rk. Rys. 19
Rys. 17 Opaski przewodw Materia izolacyjny

Rurka jednostki Nakrtka Rurka


wewntrznej kielichowa
Zaizolowa oddzielnie przewd ssawny i
przewd cieczowy.
Rys. 20
Klucz Klucz Izolacja termiczna
paski dynamometryczny
Rys. 18

Klucz paski
(nieruchomy)
Nakrtka Przewd ssawny Przewd cieczowy
kielichowa
Owin zaizolowane przewody w tylnej
Klucz Rurka czci obudowy przewodw tam
dynamometryczny winylow. Przymocowa do przewodw
kabel zasilajcy za pomoc tamy
winylowej.
Rurka jednostki wewntrznej
Rys. 21
Nastpnie dokrci nakrtk Rurka poczeniowa
kielichow kluczem paskim i kluczem Rurka
dynamometrycznym, uwzgldniajc jednostki
ponisze wartoci: Tama wewntrznej
winylowa Owin tam
(szeroka) winylow
POLSKI 63

Rys. 22 Rys. 25
Grny zaczep
Rurka

Tama Kabel
winylowa poczeniowy
Kabel
(wska)
poczeniowy

Owin cile przewody, w odpywowy W


i kabel zasilajcy tam winylow, odpywowy
tak aby zmieciy si w tylnej czci
obudowy przewodw. Uchwyt montaowy
Rys. 23 Mocowanie dolnego
Rurka zaczepu
W Tama
odpywowy winylowa
(wska) 3.4.2 Jednostka zewntrzna
Poczeniowy Owin
kabel 1. Wyrwna rurki wzgldem siebie
tam i odpowiednio dokrci nakrtk
zasilajcy winylow kielichow rk.
(szerok)
Rys. 26
3. czenie rurek jednostki wewntrznej z
rurkami poczeniowymi:
Wyj element dystansowy.
Zawiesi jednostk wewntrzn na
grnej czci uchwytu montaowego
(umieci zaczepy uchwytu
montaowego w otworach w grnej
czci jednostki wewntrznej).
Upewni si, e zaczepy s prawidowo
osadzone na swoim miejscu, poruszajc
jednostk wewntrzn we wszystkich
kierunkach.
2. Nastpnie dokrci nakrtk kielichow
Rys. 24
kluczem dynamometrycznym, a do
usyszenia kliknicia.
Grny zaczep
Rys. 27
Jednostka
Uchwyt zewntrzna Przewd
montaowy
cieczy
Element
Przewd
dystansowy
ssawny

Docisn lew i praw stron jednostki


wewntrznej do uchwytu montaowego,
a zaczepy zablokuj si w gniazdach Zawr trjdrony
(odgos kliknicia).

Naley przestrzega wartoci momentu


obrotowego podanych w poniszej tabeli:
64 www.electrolux.com

Tab.3 3. W przypadku gdy jednostka zewntrzna


instalowana jest powyej poziomu
Dodatkowy jednostki wewntrznej:
Moment
redn. zewn. moment
obrotowy Owin przewody i kabel poczeniowy
(mm) obrotowy
(Nm) od dou do gry.
(Nm)
Uformowa syfon, aby zapobiec
15,7 19,6
6,35 (1/4) przedostawaniu si wody do
(1,6 kg.m) (2,0 kg.m)
pomieszczenia.
29,4 34,3 Przymocowa owinite przewody wzdu
9,52 (3/8)
(3,0 kg.m) (3,5 kg.m) zewntrznej ciany za pomoc obejm lub
12,70 (1/2)
49,0 53,9 podobnych mocowa.
(5,0 kg.m) (5,5 kg.m) Rys. 29
73,6 78,6
15,88 (5/8)
(7,5 kg.m) (8,0 kg.m) Uszczelni niewielkie
otwory wok przewodw
za pomoc elastycznej
masy uszczelniajcej.
3.4.3 Formowanie przewodw
Syfon
1. Uformowa przewody, owijajc
poczeniow cz przewodw
jednostki wewntrznej materiaem
izolacyjnym, a nastpnie zabezpieczajc
go wsk i szerok tam winylow.
W przypadku podczania dodatkowego
wa odpywowego jego koniec
powinien by poprowadzony nad
ziemi. Odpowiednio zabezpieczy w
odpywowy.
2. W przypadku gdy jednostka zewntrzna Syfon
instalowana jest poniej poziomu
jednostki wewntrznej:
W odpywowy
Owin przewody, w odpywowy i
kabel poczeniowy od dou do gry.
Przymocowa owinite przewody wzdu 3.4.4 Kontrola odpywu
zewntrznej ciany za pomoc obejm lub
podobnych mocowa. 1. Otworzy i unie przedni panel
Rys. 28 jednostki wewntrznej.
Uszczelni niewielkie Przytrzyma po obu stronach za doln
otwory wok cz panelu, pocign go do siebie
przewodw za
pomoc elastycznej i unie, a cakowicie oprze si na
masy uszczelniajcej. Otulina wsporniku.
Rys. 30
Rurka

W
odpywowy

Kabel Wspornik
poczeniowy panelu
W
odpywowy

Konieczne jest wykonanie syfonu, aby


zapobiec przedostaniu si wody do
podzespow elektrycznych.
POLSKI 65

2. Kontrola odpywu 3. Przewody odpywowe


Ostronie wyla szklank wody na W odpywowy powinien by
parownik. skierowany w d, aby zapewni atwy
Sprawdzi, czy woda wypywa przez w odpyw.
odpywowy jednostki wewntrznej i czy Rys. 32
nie ma adnej nieszczelnoci.
Rys. 31 Skierowane ku
doowi

Nie umieszcza wa odpywowego w


nastpujcy sposb:
Rys. 33
Nagromadzona
Nie puka woda
Powietrze

W
odpywowy Wyciek wody Wyciek wody
Kocwka wa
odpywowego Odstp
zanurzona w mniejszy ni
wodzie 50 mm

Wyciek wody Zagbienie

3.5 Instalacja elektryczna


3.5.1 rodki bezpieczestwa
Zasady bezpieczestwa elektrycznego 2. Wycznik obwodu musi posiada
przed instalacj: funkcje wyzwalania magnetycznego i
1. Urzdzenia, ktre nie s wyposaone termicznego, aby zapobiega zwarciu i
w przewd serwisowy i wtyczk, przecieniu.
naley podczy do wydzielonego 3. Urzdzenie naley zainstalowa zgodnie
obwodu zasilania z wycznikiem z krajowymi przepisami dotyczcymi
automatycznym, zgodnie z lokalnymi instalacji elektrycznych.
przepisami dotyczcymi bezpieczestwa 4. Naley zainstalowa wycznik obwodu
elektrycznego. o parametrach zgodnych z ponisz
tabel.
66 www.electrolux.com

Tab.4
Rozmiar Rozmiar
Napicie Rodzaj
Pojemno przewodu przewodu Wycznik
systemowe/ bezpiecznika
wat (BTU/h) zasilajcego poczeniowego obwodu (A)
Czstotliwo (A)
(mm2) (mm2)
2500 (9 K) 220-240 V/50 Hz   3,15 10
3200 (12 K) 220-240 V/50 Hz   3,15 16
4600 (18 K) 220-240 V/50 Hz   3,15 25
6700 (24 K) 220-240 V/50 Hz   3,15 25
8000 (30 K) 220-240 V/50 Hz   3,15 32
9700 (36 K) 220-240 V/50 Hz   3,15 32

5. W przypadku wystpowania problemw 3.5.3 Instalacja wewntrznych


z zasilaniem nie mona instalowa
klimatyzatora zanim nie zostan one przewodw elektrycznych
rozwizane przez klienta.
1. Otworzy przedni panel i wymontowa
6. Upewni si, e parametry zasilania s
oson przewodw, poluzowujc rub.
odpowiednie dla klimatyzatora.
Rys. 34
7. Upewni si, e prawidowo podczono
w gniedzie elektrycznym przewd Osona
fazowy, neutralny i uziemiajcy. przewodw
8. Nieodpowiednie lub nieprawidowe
poczenia elektryczne mog
spowodowa poraenie prdem, poar
lub nieprawidowe dziaanie niektrych
podzespow elektrycznych.
9. Przed rozpoczciem jakichkolwiek prac
elektrycznych naley wyczy gwne
zasilanie.
2. Przeprowadzi kabel zasilajcy i
przewd sygnaowy (tylko w modelach
3.5.2 rodki bezpieczestwa z pomp ciepa) z tylnej czci jednostki
wewntrznej i pocign go do przodu
Wymagania dotyczce uziemienia przez otwr na przewody w celu
1. Urzdzenie musi by prawidowo podczenia.
uziemione i podczone do specjalnej 3. Podczy i przykrci przewody do
instalacji uziemiajcej przez listwy zaciskowej zgodnie z ich kolorami.
wykwalifikowanego elektryka. 4. Zabezpieczy niepodczone przewody
2. to-zielony przewd w klimatyzatorze tam izolacyjn, aby nie dotykay
jest przewodem uziemiajcym i nie moe adnych elektrycznych ani metalowych
by uyty to innych celw. Nieprawidowe czci.
uziemienie moe skutkowa poraeniem 5. Dobrze zamocowa przewd w zacisku
prdem elektrycznym. przewodu.
3. Rezystancja uziemienia powinna 6. Zaoy oson przewodw i przykrci
by zgodna z krajowymi przepisami j.
dotyczcymi instalacji elektrycznych. 7. Zamontowa przedni panel.
4. Instalacja zasilajca musi by
wyposaona w odpowiedni zacisk
uziemiajcy. Nie podcza przewodu
uziemiajcego do nastpujcych
elementw:
rury wodnej
przewodu gazowego
rury ciekowej
POLSKI 67

Rys. 35 Rys. 39
1300~2200 Wat (5K i 7K) 1300~2200 Wat (5K i 7K)
Dla urzdzenia jedynie z funkcj chodzenia Rodzaj pompy ciepa

N(1) 2 N(1) 2 4 5

niebieski czarny to- niebieski czarny fioletowy pomaraczowy


zielony to-
zielony

Poczenie z jednostk zewntrzn Poczenie z jednostk zewntrzn


Rys. 40
Rys. 36
2500~3600 Wat (9K i 12K)
2500~3600 Wat (9K i 12K) Rodzaj pompy ciepa
Dla urzdzenia jedynie z funkcj chodzenia
N(1) 2 3
N(1) 2
niebieski czarny brzowy to-
niebieski czarny to- zielony
zielony

Poczenie z jednostk zewntrzn


Poczenie z jednostk zewntrzn
Rys. 41
Rys. 37
4500~6800 Wat (18K i 24K)
5200~6600 Wat (18K i 24K) Rodzaj pompy ciepa
Dla urzdzenia jedynie z funkcj chodzenia
N(1) 2 3
N(1) 2 3
niebieski czarny brzowy to-
niebieski czarny brzowy to- zielony
zielony

Poczenie z jednostk zewntrzn


Poczenie z jednostk zewntrzn
Rys. 42
Rys. 38 8600~11000 Wat (30K i 36K)
Rodzaj pompy ciepa
8600~11000 Wat (30K i 36K)
Dla urzdzenia jedynie z funkcj chodzenia N(1) 2 3
N(1) 2 3
niebieski czarny brzowy to-
zielony
niebieski czarny brzowy to-
zielony

Poczenie z jednostk zewntrzn


Poczenie z jednostk zewntrzn
68 www.electrolux.com

UWAGA: 5. Zamocowa przewd zasilajcy w


Wszystkie przewody midzy jednostk zacisku przewodu.
wewntrzn a jednostk zewntrzn 6. Zamontowa uchwyt.
musz by podczone przez Rys. 44
wykwalifikowanego elektryka.
Jeli dugo przewodu zasilajcego nie 1300~2200 Wat (5K i 7K)
jest wystarczajca, naley skontaktowa Dla urzdzenia jedynie z funkcj chodzenia
si z dostawc w celu uzyskania
nowego przewodu. Nie jest dozwolone N(1) 2
samodzielne przeduanie przewodu.
Po dokrceniu rub lekko pocign za niebieski czarny to-
przewd, aby sprawdzi, czy jest dobrze zielony
zamocowany.
Nie czy ze sob dwch kabli
zasilajcych w celu dostarczenia
zasilania do klimatyzatora. Poczenie z jednostk wewntrzn
Nie przedua przewodw kabla
zasilajcego poprzez ich przecicie. Rys. 45

2500~3600 Wat (9K i 12K)


3.5.4 Instalacja zewntrznych Dla urzdzenia jedynie z funkcj chodzenia
przewodw elektrycznych
N(1) 2
1. Zdemontowa uchwyt po prawej stronie
jednostki zewntrznej, poluzowujc niebieski czarny to-
rub. zielony
Rys. 43

Poczenie z jednostk wewntrzn


Uchwyt
Rys. 46
5200~6600 Wat (18K i 24K)
Dla urzdzenia jedynie z funkcj chodzenia

Listwa N(1) 2 3
zaciskowa
niebieski czarny brzowy to-
zielony

Poczenie z jednostk wewntrzn


2. Zdj zacisk przewodu. Podczy i
przykrci przewody kabla zasilajcego Rys. 47
i przewodu sygnaowego (tylko modele
z pomp ciepa) do listwy zaciskowej 8700~11000 Wat (30K i 36K)
zgodnie z numerami identyfikacyjnymi Dla urzdzenia jedynie z funkcj chodzenia
i kolorami na listwach zaciskowych
jednostki wewntrznej i zewntrznej. N(1) 2 3
3. Aby zapobiec przedostawaniu si
do wntrza wody, uformowa na niebieski czarny brzowy to-
przewodach poczeniowych wygicie w zielony
ksztacie litery U (patrz str. 64).
4. Zabezpieczy niepodczone przewody
tam izolacyjn, aby nie dotykay
adnych elektrycznych ani metalowych Poczenie z jednostk wewntrzn
czci.
POLSKI 69

Rys. 48 UWAGA:
Po wykonaniu powyszych czynnoci
1300~2200 Wat (5K i 7K) naley zastosowa si do nastpujcych
Rodzaj pompy ciepa wskazwek:
N(1) 2 4 5 Wkrty mocujce przewody do listwy
zaciskowej mog si poluzowa na
skutek wstrzsw podczas transportu.
niebieski czarny fioletowy pomaraczowy Sprawdzi i upewni si, e wszystkie
to- wkrty s dobrze dokrcone. W
zielony przeciwnym razie moe doj do
przepalenia si przewodw.
Poczenie z jednostk wewntrzn Upewni si, e obwd elektryczny ma
odpowiednie parametry.
Rys. 49 Upewni si, e napicie rozruchowe
jest utrzymywane na poziomie ponad
2500~3600 Wat (9K i 12K) 90% wartoci napicia znamionowego
Rodzaj pompy ciepa podanego na tabliczce znamionowej.
Upewni si, e grubo kabla jest
N(1) 2 3 zgodna ze specyfikacj rda zasilania.
W przypadku instalacji urzdzenia
niebieski czarny brzowy to- w miejscu naraonym na dziaanie
zielony wilgoci zamontowa wycznik
rnicowoprdowy (RCD).
Spadek napicia moe mie nastpujce
skutki: drgania stycznika, ktre mog
Poczenie z jednostk wewntrzn spowodowa uszkodzenie punktu styku,
przepalenie bezpiecznika, zakcenie
Rys. 50 normalnego dziaania funkcji ochrony
przed przecieniem.
4500~6800 Wat (18K i 24K) Naley zastosowa w staej instalacji
Rodzaj pompy ciepa wycznik umoliwiajcy odczenie
zasilania przy rozwarciu stykw
N(1) 2 3 wynoszcym co najmniej 3 mm dla
kadego przewodu fazowego.
niebieski czarny brzowy to-
zielony
3.6 Odpowietrzanie i test
szczelnoci
Poczenie z jednostk wewntrzn Obecno powietrza i wilgoci w ukadzie
chodniczym powoduje nastpujce
Rys. 51 niepodane skutki:
Wzrost cinienia w ukadzie.
8700~11000 Wat (30K i 36K) Wzrost natenia prdu roboczego.
Rodzaj pompy ciepa
Spadek wydajnoci chodzenia lub
N(1) 2 3 ogrzewania (dotyczy jedynie modeli z
funkcj grzania).
Wilgo w ukadzie chodniczym moe
niebieski czarny brzowy to- zamarzn i zablokowa rurki kapilarne.
zielony
Obecno wody moe prowadzi do
korozji elementw ukadu chodniczego.
Dlatego jednostka wewntrzna i przewody
Poczenie z jednostk wewntrzn midzy jednostk wewntrzn i zewntrzn
musz by sprawdzone pod ktem
szczelnoci, a ukad oprniony z gazw
nieskraplajcych si i wilgoci.
70 www.electrolux.com

3.6.1 Odpowietrzanie za pomoc w inne miejsce naley usun


pompy prniowej czynnik chodniczy za pomoc pompy
prniowej.
1. Sprawdzi, czy wszystkie rurki (zarwno 3. Naley upewni si, e czynnik
po stronie cieczowej, jak i gazowej) chodniczy, ktrym napeniane jest
zostay prawidowo poczone, a take urzdzenie, jest w stanie pynnym.
czy podczone s wszystkie przewody 4. Oddzielacz oleju naley instalowa co
w celu przeprowadzenia testu. Odkrci 5-7 m (w przypadku zainstalowania
nakrtki zaworw serwisowych po jednostki zewntrznej poniej jednostki
stronie gazowej i cieczowej w jednostce wewntrznej oddzielacz oleju nie jest
zewntrznej. Na tym etapie zawory potrzebny).
serwisowe cieczy i gazu w jednostce 5. Dobra dugo rury i ilo chodziwa dla
zewntrznej pozostaj zamknite. klimatyzatorw typu Split. (patrz tabela
2. W przypadku przenoszenia urzdzenia 5 poniej)

Jednostka zewntrzna Jednostka zewntrzna

(A)
Oddzielacz oleju

(A)
(B)
(B)

Jednostka Jednostka
wewntrzna wewntrzna
Dugo przewodw (rurek) poniej 5 m Dugo przewodw (rurek) powyej 5 m

Tab. 5

rednica Dodatkowy czynnik


Maksymalna Maksymalna chodniczy (g/m)
Pojemno przewodu Standardowa
dugo (m) wysoko (m)
wat (BTU/h) tocznego dugo (mm) Samo
(A) (B) Pompa ciepa
(mm) chodzenie

2500 (9 K) 9,52 (3/8) 5 15 10 15 20

3200 (12 K) 9.52 (3/8) 5 20 10 15 20

4600 (18 K) 9.52 (3/8) 5 20 10 15 20

6700 (24 K) 15,88 (5/8) 5 25 10 15 17

8000 (30 K) 15,88 (5/8) 5 30 10 15 50

9700 (36 K) 15,88 (5/8) 5 30 10 15 50

3.6.2 rodki ostronoci


podczas obsugiwania zaworu 2. Czynno zamykania zaworu
dwukierunkowego: Dobrze dokrci
dwukierunkowego zintegrowanego trzpie zaworu za pomoc specjalnego
z wyjciami jednostki zewntrznej narzdzia. Nastpnie dobrze dokrci
nakrtk zaworu za pomoc klucza
1. Czynno otwierania zaworu paskiego lub podobnego narzdzia.
dwukierunkowego: Obrci trzpie Prosz odnie si do tabeli na stronie
zaworu, a zetknie si z ogranicznikiem. 17 w celu uzyskania informacji o
Nie prbowa dalej otwiera zaworu. momencie dokrcania nakrtki zaworu.
POLSKI 71

Rys. 52 3. Cakowicie otworzy dwigni niskiego


cinienia zaworu rozdzielajcego.
4. Wczy pomp prniow, aby
Czynnik chodniczy wytworzy podcinienie. Na pocztku
Zawr odcinajcy lekko poluzowa nakrtk kielichow
niskiego cinienia zaworu niskiego cinienia znajdujcego
(trjdrony) Jednostka
Jednostka si po stronie przewodu gazowego, aby
wewntrzna
zewntrzna sprawdzi, czy do rodka dostaje si
Strona gazowa
powietrze (gdy zmieni si odgos pracy
Strona cieczowa pompy prniowej, multimetr bdzie
wskazywa 0 zamiast wartoci ujemnej).
Nastpnie dokrci nakrtk kielichow.
Zawr odcinajcy Prubunek Procedura pozwala na sprawdzenie, czy
wysokiego cinienia rury s drone.
(dwudrony)
5. Utrzymywa podcinienie przez ponad
15 minut, upewniajc si, e wskazanie
UWAGA: multimetru wynosi -7-3/5 x 10-6 Hg (-1x10
W dolnym wyjciu znajduje si Pa). Nastpnie cakowicie zamkn
zintegrowany kanalik zasilajcy. Dolne dwigni niskiego cinienia zaworu
wyjcie zostao przedstawione na rozdzielajcego i wyczy pomp
rysunku poniej. prniow.
Rys. 53 6. Obrci trzpie zaworu
dwukierunkowego B o okoo 45
w kierunku przeciwnym do ruchu
Nakrtka wskazwek zegara na 6-7 sekund
Korpus zaworu kielichowa po ulotnieniu si gazu, a nastpnie
ponownie dokrci nakrtk kielichow.
Upewni si, e wskazanie na
manometrze jest nieznacznie wysze
Nakrtka od wartoci cinienia atmosferycznego.
Ta procedura pozwala na sprawdzenie,
Gniazdo czy czynnik chodniczy jest prawidowo
napeniania transportowany przez rury.
Trzpie zaworu 7. Zamkn zawr Schradera, nastpnie
zdj narzdzie do wyjmowania rdzenia
Ogranicznik zaworu. Zamieni nakrtk kanalika
zasilajcego.
8. Cakowicie otworzy trzpienie zaworu
3.6.3 Korzystanie z pompy A i B.
prniowej 9. Dobrze dokrci nakrtk zaworu
dwukierunkowego.
Aby uzyska informacj o tym jak uywa Rys. 54
zaworu rozdzielajcego, naley si odnie
do niniejszej instrukcji obsugi.
Jednostka zewntrzna
1. Cakowicie dokrci nakrtki kielichowe Zawr
rozdzielajcy
w punktach A, B, C i D. Podczy
Multimetr-76 cmHg
narzdzie do wyjmowania rdzenia Dwignia
Dwignia niskiego
zaworu z kanalika zasilajcego, a cinienia wysokiego
cinienia
nastpnie podczy w prniowy W
do tego narzdzia. Otworzy zawr Zawr niskiego
cinienia W
Schradera.
UWAGA:
Zawr Schradera znajduje si wewntrz Pompa prniowa
kanalika zasilajcego.
2. Podczy drugi w zaworu
rozdzielajcego do pompy prniowej.
72 www.electrolux.com

4. KONTROLA I URUCHOMIENIE

4.1 Kontrola szczelnoci 4.3 Prba dziaania


1. Metoda z wykorzystaniem wody 1. Przed rozpoczciem prby dziaania
mydlanej Nie wcza zasilania przed
Naoy mikkim pdzlem wod zakoczeniem instalacji.
mydlan lub neutralny detergent na Przewody elektryczne musz by
poczenia przewodw jednostki prawidowo i pewnie podczone.
wewntrznej i zewntrznej (A: zawr Zawory odcinajce rurki poczeniowe
niskiego cinienia, B: zawr wysokiego powinny by cakowicie otwarte.
cinienia C i D s to koce pocze Naley usun z urzdzenia wszystkie
przewodw jednostki wewntrznej) w odpadki i zanieczyszczenia.
celu sprawdzenia szczelnoci punktw
2. Sposb przeprowadzenia prby dziaania
czcych orurowania. Jeli powstaj
baki, przewody s nieszczelne. Wczy zasilanie i nacisn przycisk
ON/OFF na pilocie zdalnego sterowania,
Rys. 55
aby uruchomi urzdzenie.
Punkty kontrolne w Nacisn przycisk MODE, aby
jednostce wewntrznej
D wybra funkcje COOL, HEAT (jeli
Przewd
cieczy
dotyczy) i FAN w celu sprawdzenia ich
C Przewodu prawidowego dziaania.
Jednostka
gazowego
Jeli temperatura otoczenia jest wynosi
zewntrzna
B Punkty kontrolne poniej 16C nie mona za pomoc
Zawr w jednostce
zewntrznej
pilota zdalnego sterowania wybra
dwudrony A trybu COOL. Naley wczy tryb
Zawr
awaryjny, ktrego uywa si, gdy nie jest
trjdrony dostpny pilot zdalnego sterowania lub w
przypadku konserwacji.
Rys. 56

2. Wykrywacz nieszczelnoci
Sprawdzi szczelno za pomoc
wykrywacza nieszczelnoci.
Przycisk sterowania
rcznego

4.2 Kontrola bezpieczestwa


elektrycznego
Po zakoczeniu instalacji dokona kontroli
bezpieczestwa elektrycznego:
1. Uziemienie Przycisk sterowania rcznego
Po podczeniu uziemienia dokona
jego ogldzin i zmierzy rezystancj za
pomoc testera. 4.4 Oprnianie
2. Kontrola upywu prdu (podczas
prbnego uruchomienia) W przypadku przenoszenia klimatyzatora
Podczas prby dziaania po zakoczeniu lub jego utylizacji naley oprni ukad
instalacji serwisant moe uy sondy chodniczy zgodnie z ponisz procedur,
i multimetru, aby sprawdzi, czy nie aby nie doszo do uwolnienia czynnika
wystpuje upyw prdu. Natychmiast chodniczego do atmosfery.
wyczy urzdzenie w przypadku Podczy przewd zaworu
wykrycia wycieku czynnika chodniczego. rozdzielajcego do gniazda napeniania
Usun przyczyn wycieku, aby zaworu odcinajcego po stronie
zapewni prawidowe dziaanie przewodu gazu jednostki zewntrznej.
urzdzenia. Niemal cakowicie zamkn zawr
odcinajcy po stronie przewodu gazu.
POLSKI 73

Cakowicie zamkn zawr odcinajcy


po stronie przewodu cieczowego.
Wczy urzdzenie w trybie COOL.
Cakowicie zamkn zawr odcinajcy
po stronie przewodu gazu, gdy
manometr pokae cinienie 1-0,5 kgf/
cm2 (100~50 kPa).
Zakoczy prb dziaania, wyczajc
urzdzenie cay gaz chodniczy
zgromadzi si w jednostce zewntrznej.

4.5 Kontrola po zakoczeniu


instalacji

Moliwe
Elementy do
nieprawidowe
sprawdzenia
dziaanie
Czy urzdzenie zostao Urzdzenie moe spa,
dobrze zamocowane? generowa drgania lub
haasowa.

Czy wykonano test Niewystarczajce


szczelnoci? chodzenie (grzanie).

Czy izolacja termiczna Kondensacja pary


jest odpowiednia? wodnej.

Czy odprowadzanie wody Wyciek wody.


jest prawidowe?

Czy napicie odpowiada Usterka elektryczna lub


napiciu znamionowemu uszkodzenie urzdzenia.
podanemu na tabliczce
znamionowej?

Czy przewody elektryczne Usterka elektryczna lub


i rurki s prawidowo i uszkodzenie czci.
pewnie podczone?

Czy urzdzenie zostao Upyw prdu


dobrze uziemione? elektrycznego.

Czy przewd zasilajcy Usterka elektryczna lub


jest zgodny ze uszkodzenie czci.
specyfikacj?

Czy nie jest zablokowany Niewystarczajce


wlot lub wylot powietrza? chodzenie (grzanie)

Czy sprawdzono Ilo czynnika


dugo przewodw chodniczego nie jest
poczeniowych w odpowiednia.
odniesieniu do iloci
czynnika chodniczego?
74 www.electrolux.com

INNEHLL
1. SKERHETSINSTRUKTIONER .......................................................................... 75
2. INNAN INSTALLATION ...................................................................................... 77
3. INSTALLATION AV PRODUKT ........................................................................... 80
4. TESTA OCH KR .............................................................................................. 96

VI HAR DIG I TANKE


Tack fr ditt kp av en apparat frn Electrolux. Du har valt en produkt som fr med sig
rtionden av erfarenhet och innovation. Genial och stilren, den har utformats med dig i
tanke. S nr du n anvnder den, kan du vara trygg i vetskap om att du fr bra resultat
varje gng.

Vlkommen till Electrolux.

Besk vr hemsida:
F anvndningsrd, broschyrer, felskning, serviceinformation:
www.electrolux.com

Registrera din produkt fr bttre service:


www.electrolux.com/productregistration

Kpa tillbehr, frbrukningsvaror och originalreservdelar fr apparaten:


www.electrolux.com/shop

KUNDVRD OCH SERVICE


Vi rekommenderar att du anvnder originalreservdelar.
Nr du kontaktar service, kontrollera att du har fljande data tillgnglig.
Informationen hittas p typskylten. Modell, PNC (produktnummer), serienummer

Varning/Iaktta frsiktighet -Skerhetsinformation.


Allmn information och tips
Miljinformation.

Kan ndras utan fregende meddelande.


SVENSKA 75

1. SKERHETSINSTRUKTIONER

Ls noggrant igenom de medfljande servicereglerna fr elleverantrer av


instruktionerna, innan montering och endast behrig personal.
anvndning av apparaten Tillverkaren s 2PHQKHWHQVND\WWDVWLOOHQDQQDQ
ansvarar inte fr en felaktig installation plats eller kasseras, fr endast en
och anvndning orsakar personliga OPSOLJNYDOLFHUDGSHUVRQXWIUDHWW
och materiella skador. Frvara alltid sdant arbete.
instruktionerna med apparaten fr framtida
referens. s Om en ovanligt situation uppstr, som
t.ex lukten av ngot brnt, sl d av
strmmen till luftkonditioneringen och
1.1 Barnens och utsatta kontakta en serviceagent hos Electrolux
mnniskors skerhet . Om detta onormala tillstndet kvarstr,
kan luftkonditioneringen vara skadad
VARNING! eller till och med orsaka elektrisk stt
Risk fr kvvning, skada eller eller eldsvda.
permanent funktionsnedsttning. s Hantera inte luftkonditioneringen
med blta hnder. Detta kan orsaka
s Apparaten kan anvndas av barn frn 8 elektriska sttar.
rs lder och uppt och personer med s Skada eller klipp inte av ntkabeln eller
nedsatt fysisk, sensorisk eller psykisk andra kablar. Om detta intrffar, lmna
frmga eller bristande erfarenhet och in den fr reparation eller fr den utbytt
kunskap om de har ftt handledning DYHQNYDOLFHUDGWHNQLNHU
eller instruktioner rrande anvndning s Anslut inte luftkonditioneringsapparaten
av apparaten p ett skert stt och till ett grenuttag.
frstr riskerna som de innebr.
s Stng av strmfrsrjningen till
s Barn ska inte leka med apparaten. luftkonditioneringen om den inte ska
s Rengring och anvndarunderhll ska anvndas under en lngre tid. Annars
inte gras av barn utan uppsikt. kommer damm att samlas och kan
orsaka en eldsvda.
1.2 Installation och anvndning s Innan du rengr luftkonditioneringen,
koppla bort ntanslutningen fr att
VARNING! eliminera risken fr elektriska sttar.
Risk fr kvvning, skada eller s Ntanslutningen br anpassas
permanent funktionsnedsttning. med luftkonditioneringen
enligt installationsmanualen.
s Kontakta en auktoriserad installatr fr Luftkonditioneringsapparater med
installation av enheten. en elkabel br anslutas direkt till ett
eluttag med lmplig skerhetsbrytare.
s Kontakta en auktoriserad
Luftkonditioneringsapparater som r
servicetekniker fr reparation eller
fast kabelanslutna mste vara anslutna
underhll av denna enhet.
till en lmplig skerhetsbrytare enligt
s Vgguttaget som krvs fr att leverera installationsmanualen.
strm mste kopplas in och igngsatt
s Se till att ntanslutningen till
av en licensierad entreprenr.
luftkonditioneringen r stabil och
s Om elkabeln r skadad, ska den uppfyller de krav som anges i
ersttas av tillverkaren, dess installationsmanualen.
VHUYLFHDJHQWHOOHUOLNYUGLJNYDOLFHUDG
s Kontrollera att produkten alltid r
person fr att undvika en fara.
installerad med lmpliga jordning.
s Installationsarbetet mste utfras i
s Ur skerhetssynpunkt mste du stnga
verensstmmelse med de nationella
av verspnningsskyddet innan du utfr
standarder fr anslutning av kablar och
ngot underhll eller rengring eller
76 www.electrolux.com

nr produkten inte anvnds under en s Frsk inte reparera luftkonditioneringen


lngre tid. Damm som ackumuleras kan sjlv. Felaktiga reparationer kan orsaka
orsaka eldsvda eller elektriska sttar. elektrisk stt eller eldsvda. Kontakta ditt
s Vlj lmpligast temperatur. Det kan lokala auktoriserade servicestlle.
spara el. s Stt inte in hnder eller freml i
s Se till att fnster och drrar inte r luftintaget eller luftuttaget. Det kan
ppna lngre tid under drift. Det orsaka skada.
kommer att resultera i bristfllig s Utstt inte djur eller vxter direkt fr
prestanda. OXIWGHW
s Blockera inte luftintaget eller luftuttaget s Anvnd inte enheten fr andra ndaml,
. Det kommer att resultera i bristfllig som att bevara mat eller torka klder.
prestanda och orsaka tekniskt fel. s Stnk inte vatten p luftkonditioneringen.
s Frvara brnnbart material minst 1 Det kan orsaka en elektrisk stt eller
m frn enheterna. Det kan orsaka funktionsstrning.
eldsvda. s Ur skerhetssynpunkt mste du stnga
s Undvik att belasta ovansidan av av verspnningsskyddet innan du utfr
utomhusenheten eller placera tunga ngot underhll eller rengring eller
saker p den. Det kan orsaka skada. nr produkten inte anvnds under en
s Handtaget p utomhusenheten r lngre tid. Damm som ackumuleras kan
lite trng. Var frsiktig nr du lyfter orsaka eldsvda eller elektriska sttar.
utomhusenheten. s Denna luftkonditionering anvnder R410A.
kldmedium.

Du kan ocks f infrskaffa denna manual genom din lokala terfr-


sljare eller genom att beska vr hemsida.
Hitta Electrolux webbadresser fr ditt land frn tabellen nedan.
Webbplatsens Webbplatsens
Land Land
adress adress
Albanien www.electrolux.al Nederlnderna www.electrolux.nl
sterrike www.electrolux.at Norge www.electrolux.no
Belgien www.electrolux.be Polen www.electrolux.pl
Bulgarien www.electrolux.bg Portugal www.electrolux.pt
Kroatien www.electrolux.hr Rumnien www.electrolux.ro
Tjeckien www.electrolux.cz Serbien www.electrolux.rs
Danmark www.electrolux.dk Slovakien www.electrolux.sk
Finland ZZZHOHFWUROX[ Slovenien www.electrolux.sl
Frankrike www.electrolux.fr Spanien www.electrolux.es
Tyskland www.electrolux.de Sverige www.electrolux.se
Grekland www.electrolux.gr Schweiz www.electrolux.ch
Ungern www.electrolux.hu Turkiet www.electrolux.com.tr
Italien www.electrolux.it Storbritannien och Irland www.electrolux.co.uk
Luxemburg www.electrolux.lu
Besk www.electrolux.com fr mer inforamtion
SVENSKA 77

2. INNAN INSTALLATION
Alla bilder i denna manual r endast avsedda som frklaring. Den faktiska modellen
av inomhusenheten du kpt kan skilja sig p frontpanelen och displayfnstret. Den
faktiska utformningen ska rda.

2.1 Verktyg behvs fr


installation
1. Nivmtare 9. Insexnyckel (4mm)
2. Skruvmejsel 10. Gaslckage detektor
3. Elektrisk borrmaskin 11. Vakuumpump
4. Krnborr (55mm / 70mm) 12. Grenrrsmtare
5. 6DWVPHGYHUNW\JIUXSSQVQLQJDY 13. Anvndarmanual
rrndar 14. Termometer
6. Momentnycklar 15. Universalinstrument
7. Skruvnyckel (dubbel) 16. Rravskrare
8. Ett glas vatten 17. Mttband

2.2 Tillbehr
Nummer Namn p tillbehr Kvantitet

1 Inomhusenhetens monteringsplatta 1
2 Skruvpluggar Medfljer inte
3 Sjlvgngade skruvar A ST3.9X25 5-8
4 Fjrrkontroll 1
5 Hllare fr fjrrkontroll (tillval) 1
6 Fjrrkontrollshllare ST2.9X10 (tillval) 2
7 Batteri (AAA 1,5V) 2
8 Isoleringsmaterial Medfljer inte
9 Koppling av rrsystem (tillval) Varierar efter land
10 Isoleringsslang fr kylrr Medfljer inte
11 Drneringsslang Medfljer inte
12 T-balkankare Medfljer inte
13 Anslutning av strmkabel Medfljer inte
14 Drneringskoppling (Endast fr vrmepumpsmodell ) 1
Avtappningsplugg (Endast fr vrmepumpsmodell)
15 3
(tillval)
Termiskt isoleringsrr fr frlngning av drnerings-
16 1
slangen
17 Flnsmutter (fr sugledning) (tillval) 1
18 Flnsmutter (fr vtskerr) (tillval) 1
Anmrkning: Andra ndvndiga delar fr installation utver de ovannmnda mste
tillhandahllas av kunden/installatren.
78 www.electrolux.com

2.3 Produktbeskrivning

1 3 2

15 cm ovan
Utrymmet till taket

Inomhusenhet
Utrymmet till vggen
15 cm ovan
Utrymmet till vggen 15 cm ovan

8
anv
3m o

9
10
Luftuttag sidan

4
11

6
Utrymme till hinder

7
50cm ovan

18
Luftintag sidan
Utrymmet till
vggen an
17 ov
30cm ovan cm
30

an 50cm ovan
16 ov
2m Utrymmet till vggen

Luftuttag sidan 12
15

14
13

ANMRKNING
Alla bilder i denna manual r endast avsedda som frklaringar. Den faktiska
modellen av inomhusenheten du kpt kan skilja sig p frontpanelen och
displayfnstret. Den faktiska utformningen ska rda.
SVENSKA 79

2.4 Installationsplatsen
s Installera inte enheten i omrden med: s Installera utomhusenheten p en torr
starka vrmekllor; plats.
ngor eller brandfarliga gaser; s Installera utomhusenheten p en plats
kontaminering med oljepartiklar; som inte r direkt utsatt fr solljus eller
starka vindar.
hgfrekvent elektromagnetisk
utrustning (t.ex. svetsutrustning eller s Installera utomhusenheten p en plats
medicinska apparater); som stder dess vikt och vibration.
hg salthalt (t.ex. nra kustomrde); s Hjdskillnaden mellan inomhusenheten
och utomhusenheten mste vara
svavelgas (e.g heta vattenkllor); mindre n 10 m.
dlig luftkvalitet. s Hjden p anslutningsrren ska vara
mindre n 25 m.
Inomhusenhet s Lmna tillrckligt med utrymme fr
s Upprtthll minimalt avstnd som rengring och underhll.
anges i detta dokument vid installation. s Utomhusenheten drivs av
Blockera inte inlopp och utlopp fr luft. inomhusenheten.
s Anvnd inte enheten p platser med
mycket hg luftfuktighet. Skerhetsfreskrifter fr elektriska
s Installera inomhusenheten utom apparater
rckhll fr barn. s Anvnd en dedicerad
s Vggen mste vara stark nog som huvudstrmkrets.
stder enhetens vikt och vibrationer. s Enheten mste vara korrekt jordad.
s Installera inomhusenheten minst 230 s Installera en jordfelsbrytare (RCD)
cm ovanfr golvet. fr att skydda mot personskador vid
s Lmna tillrckligt med utrymme fr lckstrmmar.
rengring och underhll. s Anvnd en allpolig strmbrytare med
s /XIWOWUHWEUIUEOLWLOOJQJOLJW ett kontaktavstnd separation p minst
s Lmna minst 1 m avstnd mellan 3 mm i alla poler i fasta ledningar.
enheten och andra elektriska apparater. Fr modeller med en ntkontakt,
kontrollera att ntkontakten r inom
s Installera inomhusenheten p en plats rckhll efter installationen.
dr kondensvattnet ltt kan tmmas.
s Installationen mste vara i
s Installera p en plats skyddad frn verensstmmelse med lokala
direkt solljus. elektriska skerhetsfreskrifter och
med andra relevanta lokala freskrifter.
Utomhusenhet s Enheten mste installeras
s Upprtthll minimalt avstnd som enligt nationella freskrifter fr
anges i detta dokument vid installation. ledningsdragning.
s Blockera inte inlopp och utlopp fr luft. s Utstt inte ntsladden fr kraft.
s Installera utomhusenheten utom s Avstndet mellan enheten och
rckhll fr barn. vrmekllorna ska vara minst 1,5 m.
s Installera utomhusenheten dr tillrcklig ANMRKNING
ventilation kan ombesrjas . s Se till att spnningsfrande ledning,
neutral ledning och jordledningen r
s Installera utomhusenheten dr
ordentligt anslutna till ntuttaget.
IUDPNDOODQGHDYEXOOHURFKOXIWGHLQWH
kommer att stra grannar eller djur.
80 www.electrolux.com

s Otillrckliga eller felaktiga elektriska s Jordresistans mste verensstmma


anslutningar kan orsaka elektrisk stt med lokala freskrifter.
eller eldsvda. s Ntaggregatet mste ha tillfrlitligt
jorduttag. Anslut inte en jordledning
Krav p jordanslutning till vattenledningar, gasledningar,
frorenade rr eller andra mjliga icke
s Denna enhet r en typ I elektrisk skra platser.
apparat. Kontrollera att enheten r
ordentligt jordad. s Skringar mste verensstmma med
den freskrivna modellen och mrkdata
s Gul-grna kabeln r en jordningskabel tryckt p skringens skydd eller
som inte fr anvndas fr andra kretskort.
ndaml. Felaktig jordanslutning kan
orsaka elektriska sttar.

3. INSTALLATION AV PRODUKT
3.1 Installation av inomhusenhet
3.1.1 Typ av monteringsplatta

versikt av
150mm eller mer till tak
inomhusenheten
150 mm eller 150 mm eller
mer till vgg mer till vgg

Vnster Hger
rrhl rrhl
55 med 55 med
kylmedel kylmedel

Inomhusenhet 9000Btu/h modeller

150mm eller mer till tak versikt av


inomhusenheten
150 mm eller 150 mm eller
mer till vgg mer till vgg

Vnster Hger
rrhl rrhl
55 med 55 med
kylmedel kylmedel

Inomhusenhet 12000Btu/h modeller


SVENSKA 81

versikt av
150mm eller mer till tak inomhusenheten

150 mm eller 150 mm eller


mer till vgg mer till vgg

Vnster Hger
rrhl rrhl
55 med 55 med
kylmedel kylmedel

Inomhusenhet 18000Btu/h modeller

versikt av
150mm eller mer till tak
inomhusenheten

150 mm eller 150 mm eller


mer till vgg mer till vgg

Vnster Hger
rrhl rrhl
70 med 70 med
kylmedel kylmedel

Inomhusenhet 24000Btu/h modeller

150mm eller mer till tak versikt av


inomhusenheten

150 mm eller 150 mm eller


mer till vgg mer till vgg

Vnster Hger
rrhl rrhl
70 med 70 med
kylmedel kylmedel

Inomhusenhet 28000Btu/h modeller


82 www.electrolux.com

3.1.2 Installation av 3.1.4 Anslutningsrr


vggmonteringsfste
1. Fr vnstra och hgra rrledning, ta
1. Installera vggmonteringsfstet bort omslaget p rret frn sidopanelen.
horisontellt ver de strukturella delarna Omslaget p rret kan behllas
p vggen med hjlp av mellan de eftersom det kan komma anvndas
utrymmen som anges p fstet, som QUGX\WWDUOXIWNRQGLWLRQHULQJHQWLOOHQ
YLVDVLJXU annan plats.
2. Om det gller kakel, betong eller 2. Fr den bakre hgra och bakre vnstra
liknande vggar, skapa hl med rrledningar, installera dem som visas
diameter p 5mm. Placera ankarstd LJXU%MDQVOXWQLQJVUUHWVRP
fr de lmpliga monteringsskruvar, ska lggas p en hjd av 43 mm eller
anslutningsrr och ledningar. mindre frn vggen. Fst ndan av
anslutningsrret.
3. Installera vggmonteringsfstet p
vggen med tta skruvar typ A. Figur 3
4. Det rekommenderas att alltid skra Rrskyddet Rrhllare Rrskyddet
vggposter. (hger) (vnster)
Fig.1

Hger Vnster
Hger rrledning rrledning
ANMRKNING: rrledning (bak) (bak)
s Passa in vggmonteringsfstet och Figur 4
borra hl i vggen enligt vggstrukturen versikt av
och motsvarande monteringspunkter Anslutningsrr
inomhusenhet
p vggmonteringsfstet (mtten r i
"mm" om inte annat anges).

43mm
3.1.3 Borrning av hl
1. Bestm platsen fr hlet p
rren genom att anvnda med
vggmonteringsfstet och borra hlet i 3.1.5 Drnering
rret s att den lutar lite nedt.
1. Kr drneringsslangen sluttande nedt.
2. Anvnd alltid ett omslag p Installera inte drneringsslangen som
rrledningen med en ppning nr du LOOXVWUHUDVLJXU
borrar.
Figur 5
Figur 2
Vgg
Utomhus
Inomhus

%ORFNHUDLQWHYDWWHQGHWJHQRPDWW
hja eller genom att stta slutndan
5-7mm

av drneringsslangen i vatten.
SVENSKA 83

2. Nr man ansluter den frlngda sida, upp och ner fr att kontrollera om
drneringsslangen, isolera den den r ordentligt fast.
anslutande delen av den frlngda
drneringsslangen med ett rrskydd,
och lt inte drneringsslangen bli slak. 3.1.7 Vira in rren
1. Bunta ihop rrledning, anslutningskabel
3.1.6 Fstande av och drneringsslang med tejp skert
inomhusenheten RFKMPQWVRPYLVDVLJXUHQSVLGDQ
2. Kondenserat vatten frn
1. Fr in rrledningarna genom hlet i inomhusenhetens baksida samlas
vggen. i vattenluckan och leds ut i rret.
2. Haka fast inomhusenhetens baksida p Utrymmet i denna lucka mste drfr
vre haken p vggmonteringsfstet. vara helt fritt.
Se till att den sitter fast ordentligt Figur 8
genom att frska rra den frn sida
till sida
Figur 6 Uppsamlingslucka

vre hake Kabelanslutning Rrutrymme

Anslutningsrr

Rrband
Drneringsslang

ANMRKNING:
Nedre hake s Anslut inomhusenheten frst, drefter
utomhusenheten.
3. Rrledningen kan ltt tgrdas s Var frsiktig med att inte lta
genom att lyfta inomhusenheten med drneringsslangen bli slapp.
ett sttdmpande material mellan
inomhusenheten och vggen. s Bda skarvningsrr br vara
vrmeisolerade.
Figur 7
s Var noga med att drneringsslangen
ligger p den lgsta sidan av bunten.
Lokalisera p ovansidan kan orsaka att
smltvattensklen svmmar ver inuti
enheten.
s Slingra inte ihop strmkabeln med
annan typ av kabelledningar.
s Lt drneringsslangen lpa sluttande
nedt fr att smidigt tmma ut
kondenserat vatten.

Kuddmaterial

4. Skjut den nedre delen av


inomhusenheten upp p vggen. Flytta
sedan inomhusenheten frn sida till
84 www.electrolux.com

3.2 Installation av utomhusenhet Fig.11


Luftintag
3.2.1 Skerstlla utomhusenhet
1. Installera delen p utomhusenheten Luftintag
p en plan yta fr att undvika alltfr
hgt buller och vibrationer. En dyna till
kondensator rekommenderas.
2. Rikta luftventilen mot ett omrde utan
hinder. Luftuttag
3. Installera enheten p den plats dr den
r utsatt fr s lite vind som mjligt,
srskilt i omrden dr det oftast r 3.2.2 Drnering av
blsigt. utomhusenheten p kondensat
4. Om installationsplatsen r utsatt fr (endast fr vrmepumpsmodell)
kraftiga vindar, som i kustomrden,
placera enheten lngs den bredaste 1. Under uppvrmning fr drift, br
delen av vggen eller anvnd vatten frn kondensat och avfrostning
skyddande pltar. tmmas p ett tillfrlitligt stt genom
5. Se till att inga hinder blockerar kraftig drneringsslangen.
luft inklusive buskage eller buskar. 2. Installera utomhuskopplingen till
Figur 10 vattenhlet fr tmning p chassit till
utomhusenheten och fst kontakten fr
drneringsslangen s att avloppsvattnet
som bildats i utomhusenheten kan
tmmas.
3. Vattenhlet fr tmning mste tppas
till. Installatren kommer att bedma
om andra hl ska pluggas i enlighet
med de faktiska villkoren.
4. Enheten mste installeras p en
bas mer n 3 cm i hjd, ifall en
drneringsslag nyttjas.
Figur 12

Avtappningshl

Stark vind

ANMRKNING:
Chassi
s Montering av utomhusenheten.
Frankra utomhusenheten ordentligt Drneringskoppling
och horisontellt p betong eller platt
fste med en bult och mutter 10 mm Slangens
diameter (kps separat). innerdiameter.
16mm (inte
tillhandahllen)
SVENSKA 85

3.3 Anslutning av kylrr Figur 14


Rr
ANMRKNING:
s Enheten levereras med 7,5m Brotsch
slangpaket. Det rekommenderas inte
att skra den. Om alltfr lng, rulla upp
verskottet.
Vnd nedt
s Behll den ursprungliga bjen s att
inte veck uppstr i rren.

3.3.1 $UEHWHPHGXSSQVQLQJ
av rrndar 3. Stt p mutter
s 7DERUWQVPXWWUDUVRPUIVWS
Huvudorsaken till lckage av kldmedium inomhus och utomhusenheten. Lgg
beror p undermligt arbete med dem sedan p rret/slangen efter
XSSQVQLQJDYUUQGDU att ha slutfrt borttagning av grader.
8WIUDNRUUHNWDUEHWHPHGXSSQVQLQJDY (Det r mjligt att stta p dem efter
rrndarar p fljande stt: XSSQVQLQJDYUUQGDU
Figur 15
1. Kapa rrledningar och kabel.
Flnsmutter
s Anvnd tillbehren fr rrledningar eller
rr som kpts lokalt.
s Mt avstndet mellan inomhus- och
utomhusenheten. Kopparrr
s Kapa rren lite lngre n det uppmtta
avstndet.
s Kapa kabeln 1,5 m lngre n rret.
4. $UEHWHPHGXSSQVQLQJDYUUQGDU
Figur 13
s 8WIUDUEHWHPHGXSSQVQLQJ
Rr av rrndar genom att anvnda
kragningsverktyg som visas nedan.
Figur 16
"A"

Sprr
Skev Skrovlig Grad
Kopparrr
Sprr

Handtag

Ok
2. Borttagning av grader
s Ta helt bort alla grader frn det kapade Kon
tvrsnittet p rr/slang.
s Placera slutndan av rret/kopparrret i
en nedtgende riktning nr du tar bort Rd
grader fr att undvika att grader hamnar Fsthandtag
pilmarkering
i anslutningsrren.
86 www.electrolux.com

s Hll stadigt fast kopparrret i en stans s 'UDVHGDQWQVPXWWHUQPHG


enligt det mtt som visas i tabellen en sexkantig skiftnyckel and en
nedan. momentnyckel genom att hnvisa till
Tabell 1 fljande:
Tabell 2
Outer A (mm)
diam. Yttre Extra
diameter Max Minimum Yttre diameter Vridmoment
vridmoment
(mm) (mm) (N.m)
(N.m)
6,35 (1/4) 1,3 0,7 6,35 (1/4) 15,7 (1,6kg.m) 19,6 (2,0kg.m)
9,52 (3/8) 1,6 1,0
9,52 (3/8) 29,4 (3,0kg.m) 34,3 (3,5kg.m)
12,70 (1/2) 1,8 1,0
12,70 (1/2) 49,0 (5,0kg.m) 53,9 (5,5kg.m)
15,88 (5/8) 2,4 2,2
15,88 (5/8) 73,6 (7,5kg.m) 78,6 (8,0kg.m)

2. Vira isoleringsmaterialet runt den


3.4 Anslutning av rrledning anslutande delen:
s Tck rren fr inomhusenheten
3.4.1 Inomhusenhet och anslutningsrren med
vrmeisoleringsmaterial. Bind dem
1. Anslut inomhusenhetens slangar till
tillsammans med vinyltejp s att ingen
anslutningsrren :
OXFNDQQV
s Justera rrens mittpartier och dra t
Figur 19
QVPXWWHUQRUGHQWOLJWPHGKQGHUQD
frst. Buntband Isoleringsmaterial
Figur 17

Inomhusenhet
med slangar Flnsmutter Rrledningar s Se till att isolera sugledningen frn
vtskerret separat.
Figur 20
Vrmeisolering

Skiftnyckel Momentnyckel

Figur 18
Sugledning i rr Vtskeledning i rr

Skiftnyckel
s Linda de isolerade rren med vinyltejp i
(fast)
den bakre sektionen av hljet med rr.
Fst ntkabeln p rren med vinyltejp.
Flnsmutter
Momentnyckel Rrledningar Figur 21
Installation av anslutningsrr
Inomhusenhetens
Inomhusenhet med slangar rr

Vinyltejp (bred) Linda med vinyltejp


SVENSKA 87

Figur 22 Figur 25

Rr vre hake

Vinyltejp
(smal) Ansluta kabel
Anslutningskabel

s Linda in rrledningen, Drneringsslang


drneringsslangen och ntkabeln
ordentligt med vinyltejp s att de passar
in i den bakre sektionen av hljet med Monteringsplatta
rr. Fsta nedre haken
Figur 23
Rr
Drneringsslang
Vinyltejp 3.4.2 Utomhusenhet
(smal)
1. Justera rrens mittpartier och dra t
Anslutning av Linda med QVPXWWHUQRUGHQWOLJWPHGKQGHUQD
strmkabel vinyltejp
(bred)
Figur 26

3. Anslut inomhusenhetens slangar till


anslutningsrren :
s Ta bort avstndsbrickan
s Placera inomhusenheten p den vre
delen av monteringsplattan (Anvnd
hakarna fr monteringsplattan i
ppningarna p den vre baksidan av
inomhusenheten).
2. 'UDVHGDQWQVPXWWHUQPHG
s Se till att hakarna sitter ordentligt p momentnyckeln tills nyckeln klickar.
PRQWHULQJVSODWWDQJHQRPDWW\WWD
inomhusenheten i alla riktningar. Figur 27
Figur 24 Utomhusenhet

vre hake Vtskerr

2-vgsventil Sugledning
Monteringsplatta

Mellanlgg
3-vgsventil

s Tryck p den nedre vnstra och hgra s Se till att flja tabellvrdet fr
sida av enheten mot monteringsplattan vridmomentet enligt nedan:
tills hakarna glider in p sina platser
(klickande ljud).
88 www.electrolux.com

Tabell 3 3. I de fall dr utomhusenheten installeras


ovanfr nivn fr inomhusenheten:
Extra
Yttre diameter Vridmoment s Linda in rrledning och anslutningskabel
vridmoment
(mm) (N.m) uppifrn och ned.
(N.m)
6,35 (1/4) 15,7 (1,6kg.m) 19,6 (2,0kg.m) s Skapa en flla fr att hindra vatten frn
att komma in i rummet.
9,52 (3/8) 29,4 (3,0kg.m) 34,3 (3,5kg.m)
s Skra den lindade rrledningen lngs
12,70 (1/2) 49,0 (5,0kg.m) 53,9 (5,5kg.m) yttervggen med hjlp av krage eller
15,88 (5/8) 73,6 (7,5kg.m) 78,6 (8,0kg.m) motsvarande.
Figur 29
3.4.3 Information om Tta sm ppningar
rrledningar runt rrledningar med
en typ av gummerad
1. Forma rrledningarna genom att ttning
linda den anslutande delen av
Flla
inomhusenheten med isoleringsmaterial
och skra den med smalt och brett
vinyltejp.
s Om du vill ansluta ytterligare en
drneringsslang, ska utloppet p
drneringsslangen dras ver marken.
Skra drneringsslangen p lmpligt
stt.
2. I fall dr utomhusenheten installeras Flla
under inomhusenhetens niv:
s Linda in rrledning, drneringsslang och Drneringsslang
anslutningskabel uppifrn och ned.
s Skra den lindade rrledningen lngs
yttervggen med hjlp av krage eller
motsvarande. 3.4.4 Kontrollera drneringen
Figur 28
1. ppna och lyft frontpanelen p
Tta sm ppningar
inomhusenheten.
runt rrledningar med
en typ av gummerad s Hll den nedre delen av vnster och
ttning Vira ihop hger sida av panelen, dra den mot
dig och lyft den med ett fullt std frn
Rr
fstet.
Figur 30
Drneringsslang

Anslutningskabel

Drneringsslang
Panelfste

Flla krvs fr att frhindra att vatten tar 2. Kontrollera drneringen


sig in i elektriska delar s Hll frsiktigt ett glas vatten p
frngaren.
SVENSKA 89

s Se till att vattnet rinner genom 3. Drneringsrr


drneringsslangen fr inomhusenheten s Drneringsslangen ska peka nedt fr
XWDQOFNDJHRFKGDUXWIUQ HQNHOWPQLQJDYGHW
drneringsrret.
Figur 32
Figur 31

Nedtriktad
lutning

s Placera inte drneringsrret som anges


nedan:
Figur 33
Ackumulerad
Stiger inte avtappningsvatten
Luft
Drneringsslang

Vattenlckage Vattenlckage
Spetsen p Utrymme
drneringsslangen mindre n
doppad i vatten 50mm

Vattenlckage Dike

3.5 Elektrisk Installation


3.5.1 Skerhetsfreskrifter
Elektrisk skerhetsregler innan pbrjad
installationen:
1. En srskild strmkrets och brytare 3. Apparaten skall installeras enligt
br tillhandahllas fr produkter som nationella freskrifter fr ledningar.
inte levereras med en sladd och 4. Ett verspnningsskydd med ordentlig
stickkontakt i enlighet med lokala kapacitet mste installeras enligt
elektriska skerhetsfreskrifter. tabellen nedan.
2. verspnningsskyddet mste ha
funktioner fr magnetisk utlsning
och vrmeutlsning fr att frhindra
kortslutning och verbelastning.
90 www.electrolux.com

Tabell 4
Mtare fr Anslutning av
Kapacitet i Systemets Skring typ verspnningsskydd
strmkabel kabelmtare
watt (BTU/h) spnning/frekvens (A) (A)
(mm2) (mm2)
2500 (9K) 220-240V/50Hz   3,15 10
3200 (12K) 220-240V/50Hz   3,15 16
4600 (18K) 220-240V/50Hz   3,15 25
6700 (24K) 220-240V/50Hz   3,15 25
8000 (30K) 220-240V/50Hz   3,15 32
9700 (36K) 220-240V/50Hz   3,15 32

5. Vid problem med strmfrsrjning, 3.5.3 Installation av elektriska


ska luftkonditioneringen inte installeras ledningar inomhus
innan kunden har lst problemet.
6. Var noga med att ntanslutningen 1. ppna frontpanelen och ta bort
matchar luftkonditioneringen. skyddet p ledningar genom att lossa
7. Skerstll att spnningsfrande ledning, p skruven.
neutral ledning och jordledning i Figur 34
vgguttaget r korrekt anslutna.
Ledningar
8. Otillrcklig eller felaktig elektriska
skyddade
anslutningar kan orsaka elektriska
sttar, eldsvda eller funktionsstrningar
p elektriska.
9. Innan du utfr ngon elarbeten, stng
av huvudstrmmen till systemet.

3.5.2 Skerhetsfreskrifter
2. Fr starkstrmskabel och
Krav p jordning signalstyrkabel (gller endast modellen
vrmepump) p frn baksidan
1. Enheten mste vara tillfrlitligt jordad av inomhusenheten och dra den
och ansluten till enhetens srskilda mot framsidan genom hlet fr
MRUGXWUXVWQLQJDYNYDOLFHUDGHOHNWULNHU kabeldragning fr anslutning.
2. Den gul-grna kabeln i 3. Ansluta och skruva fast kablarna p
luftkonditioneringen r den jordade XWWDJHQVRPLGHQWLHUDVDYGHUDVIUJHU
kabeln som inte kan anvndas fr
andra ndaml. Felaktig jordning kan 4. Linda kablarna som inte r anslutna
orsaka elektriska sttar. med isolerande tejp, s att de inte
kommer i berring med elektriska delar
3. Jordresistans ska vara i eller metalldelar.
verensstmmelse med nationella
frordningar fr kabeldragning. 5. Skra kablarna ordentligt med
kabelklmma.
4. Anvndarens ntstrm mste ha
tillfrlitligt jorduttag. Anslut inte den 6. Stt tillbaka skyddet p ledningar och
jordade kabeln med fljande: skruva fast.
s Vattenledning 7. Installera tillbaka frontpanelen.
s Gasrr
s Frorenad rrledning
SVENSKA 91

Figur 35 Figur 39

1300~2200 Watts (5Koch 7K) 1300~2200 Watts (5Koch 7K)


Endast kyltyp Typ av vrmepump

N(1) 2 N(1) 2 4 5

bl Svart gul- bl Svart lila orange


grn gul-
grn

Anslutning av utomhusenhet Anslutning av utomhusenhet

Figur 36 Figur 40
2500~3600 Watts (9Koch 12K) 2500~3600 Watts (9Koch 12K)
Endast kyltyp Typ av vrmepump

N(1) 2 N(1) 2 3

bl Svart gul- bl Svart Brun gul-


grn grn

Anslutning av utomhusenhet Anslutning av utomhusenhet

Figur 37 Figur .41

5200~6600 Watt (18Koch 24K) 4500~6800 Watts (18Koch 24K)


Endast kyltyp Typ av vrmepump

N(1) 2 3 N(1) 2 3

bl Svart Brun gul- bl Svart Brun gul-


grn grn

Anslutning av utomhusenhet Anslutning av utomhusenhet

Figur 38 Figur 42

8600~11000 Wattia (30Koch 36K) 8600~11000 Watts (30Koch 36K)


Endast kyltyp Typ av vrmepump

N(1) 2 3 N(1) 2 3

bl Svart Brun gul- bl Svart Brun gul-


grn grn

Anslutning av utomhusenhet Anslutning av utomhusenhet


92 www.electrolux.com

ANMRKNING: 4. Linda kablarna som inte r anslutna


med isolerande tejp, s att de inte
s Alla kablar mellan inomhus- och
kommer i berring med elektriska delar
utomhusenheter mste anslutas av en
eller metalldelar.
NYDOLFHUDGHOHNWULVNDHQWUHSUHQU
5. Fst anslutningskablarna med
s Om lngden p ntsladden inte rcker,
kabelklmmor.
kontakta din leverantr fr en ny
ntkabel. Frlngning av ntsladden 6. Installera tillbaka handtaget.
sjlv r inte tilltet. Figur 44
s Efter att ha dragit t skruvarna, dra 1300~2200 Watts (5Koch 7K)
ngot p kabeln ngot fr att bekrfta Endast kyltyp
om den r fast eller inte.
s Anslut inte tv strmkablar N(1) 2
tillsammans fr att leverera strm till
luftkonditioneringen. bl Svart gul-
grn
s Frlng inte ntkabelledaren genom att
kapa.

Anslutning av inomhusenheten
3.5.4 Installation av elektriska
ledningar utomhus Figur 45
2500~3600 Watts (9Koch 12K)
1. Ta bort handtaget p plattans hgra Endast kyltyp
sida till utomhusenheten genom att
lossa p skruven. N(1) 2
Figur 43
bl Svart gul-
grn

Handtag
Anslutning av inomhusenheten

Figur 46
5200~6600 Watts (18Koch 24K)
Anslutningsplint Endast kyltyp
N(1) 2 3

bl Svart Brun gul-


grn

2. Ta bort kabelklmman. Anslut och


skruva fast starkstrmskabel och Anslutning av inomhusenheten
signalstyrkabel (gller endast modellen
vrmepump) p anslutningsplinten efter
PRWVYDUDQGHLGHQWLNDWLRQVQXPPHU
och frger p anslutningsplinten fr
inomhus- och utomhusenheter .
3. Fr att frhindra vatten frn att ta sig in,
skapa en flla ("U") i anslutningskablar
(se sidan 88).
SVENSKA 93

Figur 47 Figur 51
8700~11000 Watts (30Koch 36K) 8700~11000 Watts (30Koch 36K)
Endast kyltyp Typ av vrmepump

N(1) 2 3 N(1) 2 3

bl Svart Brun gul- bl Svart Brun gul-


grn grn

Anslutning av inomhusenheten Anslutning av inomhusenheten


Figur 48 ANMRKNING:
1300~2200 Watt (5Koch 7K) Efter att ha ftt bekrftat ovanstende
Typ av vrmepump frhllanden, frbered kabeldragning enligt
fljande:
N(1) 2 4 5
s Skruvarna som fster kabeldragningen
bl Svart lila orange
till anslutningsplint kan lossna p grund
av vibrationer under transporten.
gul-
s Kontrollera och se till att alla skruvar
grn
UYO[HUDGH$QQDUVNDQNDEODUQD
Anslutning av inomhusenheten snderbrnnas.
s Se till att kretskapaciteten r tillrcklig.
Figur 49
s Skerstll att den inledande spnningen
2500~3600 Watt (9Koch S12K) kvarhlls ver 90% av mrkspnningen
Typ av vrmepump mrkt p namnskylten.
s Bekrfta att kabeltjockleken r som
N(1) 2 3 DQJHVLVSHFLNDWLRQHQIUHIIHNWNOOD
s Installera alltid en jordfelsbrytare (RCD) i
bl Svart Brun gul-
vta eller fuktiga omrden.
grn
s Fljande kan orsakas av spnningsfall:
Vibrationer i en kontaktor, som kommer
att skada kontaktpunkten, skring som
Anslutning av inomhusenheten
gr snder, strning av den normala
Figur 50 funktionen vid verbelastning.
s tgrder fr frnkoppling av
4500~6800 Watt (18Koch 24K)
Typ av vrmepump strmfrsrjning ska infrlivas i den
fasta kabeldragning och har en
N(1) 2 3 kontaktseparation med ett luftgap p
minst 3 mm i varje aktiva (fas) ledare.
bl Svart Brun gul-
grn
3.6 Avluftning och lckagetest
Luft och fukt i kylsystemet ger icke
Anslutning av inomhusenheten nskvrda effekter som anges enligt
nedan:
s Trycket i systemet stiger.
s Driftstrm stiger.
94 www.electrolux.com

s Effektiviteten fr kylning eller


uppvrmning (endast fr modeller med fr testkrning har slutfrts. Ta bort
vrmefunktion) sjunker. locken p serviceventilerna frn bde
p gas- och vtskesidan p utomhus
s Fukt i kretsen med kldmedium kan enheten. Observera att bde gas- och
frysa och blockera hrrr. vtskesidan fr serviceventilerna p
s Vatten kan leda till korrosion av delar i utomhusenheten hlls stngda i detta
kylsystemet. skede.
Drfr mste inomhusenheten och slangar 2. 1UGX\WWDUHQKHWHQWLOOHQDQQDQ
mellan inomhus- och utomhusenheten plats, utfra tmning med hjlp av
tillmpa lckagetest och evakueras fr att vakuumpumpen.
ta bort eventuell icke kondenserbart och 3. Kontrollera att det kldmedium som
fukt frn systemet. fylls p i luftkonditioneringen r i
\WDQGHIRUP
3.6.1 Luftning med 4. Oljeflla br installeras var 5-7 m (ingen
vakuumpump oljeflla behvs nr utomhusenheten
r installerad p en lgre plats n
1. Kontrollera att varje slang (bde vtske- inomhusenheten).
och gasslangar) mellan inomhus- 5. Rrlngd och mngden kldmedium
och utomhusenheter har kopplats fr delad typ av luftkonditionering. (se
korrekt och att all kabeldragning tabell 5 nedan)

Utomhusenhet Utomhusenhet

(A)
Oljeflla

Inomhusenhet (A) Inomhusenhet


(B)
(B)

Lngden p rrledningen under 5 m Lngden p rrledningen 5m eller mer

Tabell 5

Ytterligare kldmedium (g/m)


Kapacitet i Avloppsrr i Standard Maximal lngd Maximal hjd
watt (BTU/h) diameter (mm) lngd (m) (m)(A) (m)(B)
Endast kylning Vrmepump

2500 (9K) 9,52 (3/8) 5 15 10 15 20

3200 (12K) 9.52 (3/8) 5 20 10 15 20

4600 (18K) 9.52 (3/8) 5 20 10 15 20

6700 (24K) 15,88 (5/8) 5 25 10 15 17

8000 (30K) 15,88 (5/8) 5 30 10 15 50

9700 (36K) 15,88 (5/8) 5 30 10 15 50


SVENSKA 95

3.6.2 Visa frsiktighet 3.6.3 Nr du anvnder


vid hantering av vakuumpumpen
avstngningsventilen integrerad i
Metod fr anvndning av en
utloppen fr utomhusenheten LQVXJQLQJVYHQWLOQQVLGULIWPDQXDOHQ
1. Drift av ppen avstngningsventil: 1. 'UDKHOWWQVPXWWUDUQDYLG
ppna ventilskaftet tills den slr mot anslutningspunkt A, B, C och D. Anslut
proppen. Frsk inte att ppna den tallriksventilens borttagningsverktyg
ytterligare. till laddningsporten, anslut sedan
vakuumslangen till verktyget fr
2. Nedstngning av avstngningsventil:
tallriksventilen. ppna schrader-
Dra ordentligt t ventilskaftet med ett
ventilen.
speciellt verktyg. Dra sedan t locket
p ventilskaftet med en skruvnyckel ANMRKNING:
eller liknande. Se tabell p sidan 17 fr s Schrader-ventilen r inuti
tdragningsmoment av ventillock. laddningsporten.
Figur 52 2. Anslut den andra laddningsslangen fr
insugningsventilen till vakuumpumpen.
Kldmedium 3. ppna helt den nedre sidventilen p
insugningsventilen.
Lgtrycksventil 4. Stt igng vakuumpumpen fr att
(3-vgsventil)
Utomhusenhet Inomhusenhet tmma. Efter pbrjad tmning, lossa
Gassida QJRWSQVPXWWHUQSGHQQHGUH
sidventilen p gasslangens sida och
Vtskesidan
kontrollera om luft kommer in (bullret
frn vakuumpumpen ndras och en
Hgtryckventil Dubbel mtare av frening visar 0 istllet fr
(2-vgsventil) PLQXV GUDVHGDQWQVPXWWHUQ
)UIDUDQGHWEHNUIWDURPGHWQQV
blockeringar inuti slangarna.
ANMRKNING: 5. Utfr tmning i 15 minuter eller mer
s 'HWQQVHQODGGQLQJVSRUWLQWHJUHUDGL och kontrollera att mtaren av frening
den nedre sidan av utloppet, men inte i visar -7-3/5x 10 mikrometer Hg (-1
den vre sidan av utloppet. Nedre sidan x 10 Pa). Efter att tmningen r klar,
av utloppet visas i kartskissen nedan. stng den nedre sidhandtaget helt p
Figur 53 insugningsventilen och stoppa driften
av vakuumpumpen.
6. Vrid skaftet p avstngningsventilen
Flnsmutter B cirka 45o i moturs 6 ~ 7 sekunder
Ventilhus HIWHUDWWJDVGDWXWGUDVHGDQW
QVPXWWHUQLJHQ.RQWUROOHUDDWWWU\FNHW
i displayen p indikatorn fr tryck r
Lock lite hgre n atmosfrstrycket. Denna
SURFHGXUYHULHUDURPNOGPHGLXPHW
tar sig igenom slangarna korrekt.
Laddningsport
7. Stng Schrader-ventilen, och ta sedan
Ventilskaft bort verktyget fr ventilnippel. Stt
Propp tillbaka locket p laddningsporten.
8. ppna helt de packade ventilskaften B
och A.
96 www.electrolux.com

9. Dra t locket p avstngningsventilen


ordentligt.
Figur 54

Utomhusenhet
Insugningsrr
Multimeter -76cmHg
Handtag till lg Handtag
till hg
Laddningsslang
Lgttrycksventil
Laddningsslang

Vakuumpump

4. TESTA OCH KR

4.1 Kontroll av gaslckage 2. Lckagedetektor


s Anvnd lckagedetektor fr att
1. Tvlvatten metoden kontrollera fr lckage.
s Anvnd tvlvatten eller ett
QHXWUDOW\WDQGHUHQJULQJVPHGHO
p inomhusenhetens eller
4.2 Elektrisk skerhetskontroll
utomhusenhetens anslutningar (A: Utfra den elektrisk skerhetskontrollen
Nedre sidventilen B: Hga sidventilen C efter att slutfrt installationen:
och D r ndarna p inomhusenhetens
anslutning med en mjuk borste fr att 1. Jordningsarbete
kontrollera lckage i de anslutande s Efter att ha avslutat jordningsarbetet,
rrledningarna. Om bubblor sipprar mt jordresistans med visuell
ut, har rrledningarna en punkt med detektering och testare av jordresistans.
lckage. 2. Kontroll av elektriskt lckage (under
Fig.55 testkrning)
Inomhusenhet s Under testkrning efter avslutad
kontrollpunkter
D installation, kan servicepersonal
Vtskerr anvnda den elektriska sonden och
C multimeter fr att utfra kontroll av
Gasrr
elektriska lckage. Stng av enheten
Utomhusenhet
2-vgsventil B Utomhusenhet
omedelbart om lckage av kldmedium
kontrollpunkter intrffar. Kontrollera och hitta olika
A
lsningar tills enheten fungerar korrekt.
3-vgsventil
4.3 Test av drift
1. Fre test av drift
s Sl inte p strmmen innan
installationen r helt frdig.
SVENSKA 97

s Elektriska kabelledningar mste s Stng stoppventilen p gasslangens


anslutas korrekt och p ett skert stt. sida helt, nr tryckmtaren visar 1 - 0,5
s Anslutningsrrens sprrventiler br kgf/cm2 (100 ~ 50 kPa).
ppnas helt. s Stoppa testkrningen genom att stnga
s Alla froreningar som skrp och avfall av enheten och allt kldmedium har
mste rensas frn enheten. samlats i utomhusenheten.
2. Metod fr test av drift
s Sl p strmmen och tryck "ON/OFF" 4.5 Kontrollera efter
-knappen p fjrrkontrollen fr att starta installationen
driften.
s Tryck p MODE-knappen fr att vlja Punkter som ska Mjliga
COOL, HEAT (om tillmpligt), FAN fr kontrolleras funktionsstrning
att kolla om alla funktioner fungerar bra. Har enheten terstllts Enheten kan falla, skaka
s Nr omgivningstemperaturen r lgre ordentligt? eller avge buller.
n 16C, kan enheten kan inte stllas Har du gjort testet p Det kan orsaka otillrcklig
in p fjrrkontrollen fr att arbeta i lckage av kldmedium? kylning (uppvrmning).
COOL lge. Anvnd lget nddrift som r den termiska Det kan orsaka
anvnds endast nr fjrrkontrollen inte isoleringen tillrcklig? kondensering.
r tillgnglig eller vid underhll. r vattentmning Det kan orsaka
Figur 56 tillfredsstllande? vattenlckage.

r spnningen i Det kan orsaka elektriska


verensstmmande med funktionsstrningar eller
mrkspnningen som r skada p enheten.
mrkt p namnskylten?

r de elektriska Det kan orsaka elektriska


Manuell kontrollknapp rrledningar eller funktionsstrningar eller
anslutningsrr installerade skada p delarna.
korrekt och p ett skert
stt?

Har enheten blivit Det kan orsaka elektriskt


ordentligt jordad? lckage.

Har ntsladden Det kan orsaka elektriska


Manuell kontrollknapp VSHFLFHUDWV" funktionsstrningar eller
skada p delarna.

r inloppet eller utloppet Det kan orsaka otillrcklig


4.4 Pump klar blockerat? kylning (uppvrmning)

r lngden p Kapaciteten p
1UPDQ\WWDUHOOHUNDVVHUDU anslutningsrren kldmedium r inte
luftkonditioneringsapparaten, ska systemet och kapaciteten p korrekt.
tmmas genom att flja proceduren kldmedium registrerade?
nedan s att inget kldmedium slpps ut i
atmosfren.
s Anslut insugningsventilens slang
till stoppventilens laddningsport p
gasslangens sida p utomhusenheten.
s Stng stoppventilen p gasslangens
sida nstan helt.
s Stng stoppventilen p vtskerrets
sida helt.
s Sl p enheten i COOL-lge.
98 www.electrolux.com

SISLLYS
1. TURVALLISUUSOHJEET ................................................................................... 99
2. ENNEN ASENNUSTA ...................................................................................... 101
3. TUOTTEEN ASENNUS .................................................................................... 104
4. TESTAUS JA KYTT ..................................................................................... 120

AJATTELEMME SINUA
Kiitos Electrolux-laitteesi ostosta. Valitsemasi tuote tuo mukanaan vuosikymmenien am-
matillisen kokemuspohjan ja innovoinnit. Nerokas ja tyyliks, se on suunniteltu kyttj
ajatellen. Joten, aina kun kytt sit, voit olla rauhallisin mielin, ett saat aina aikaan loistavia
tuloksia.

Tervetuloa Electroluxille.

Vieraile sivustollamme:
Voidaksesi saada kyttneuvontaa, esitteit, vianmrityst, huoltotietoja:
www.electrolux.com

Rekisteri tuotteesi parempaa palvelua varten:


www.electrolux.com/productregistration

Osta varaosia, kulutustuotteita ja alkuperisi varaosia laitettasi varten:


www.electrolux.com/shop

ASIAKASPALVELU JA HUOLTO
On suositeltavaa kytt alkuperisi varaosia.
Ottaessasi yhteytt huoltoon, varmista, ett seuraavat tiedot ovat kytettviss.
Tiedot lytyvt laitteessa olevasta tyyppikilvest. Malli, PNC, sarjanumero

Varoitus / Turvallisuuden varotoimien tiedot.


Yleisi tietoja ja kytt
Ympristtiedot.

Oikeus muutoksiin pidtetn.


SUOMI 99

1. TURVALLISUUSOHJEET

Ennen asennusta ja laitteen kytt, lue mukaisesti ja vain valtuutetun


huolellisesti toimitetut ohjeet. Valmistaja henkilkunnan toimesta.
ei vastaa vrst asennuksesta eik s Jos laite siirretn toiseen paikkaan
kytst, joka johtaa vammoihin tai ja tai hvitetn, vain riittvn ptevn
vahinkoihin. Pid aina ohjeet laitteen henkiln on sallittua toteuttaa
mukana tulevaisuuden kytt varten. tmnkaltaisia toimia.
s Jos havaiset eptavallisen tilanteen,
1.1 Lasten ja haavoittuvassa kuten palamisen hajua, katkaise
asemassa olevien ilmastointilaitteen virta ja ota yhteys
Electrolux-huoltoon. Jos tm
henkiliden turvallisuus epnormaali tila jatkuu, ilmastointilaite
VAROITUS! voi olla vahingoittunut tai jopa aiheuttaa
Tukehtumisvaara, vamman tai shkiskun tai tulipalon.
pysyvn vammautumisen vaara. s l kyt ilmastointilaitetta mrill
ksill. Tm saattaa aiheuttaa
s Tt laitetta voivat kytt yli 8-vuotiaat shkiskun.
lapset ja henkilt joilla on vhentynyt s l vahingoita tai leikkaa virtajohtoa tai
fyysinen, aistillinen tai henkinen muita johtoja. Jos nin tapahtuu, korjaa
kapasiteetti tai ei kokemusta tai tietoja tai vaihda se akkreditoidun asentajan
mikli nille on annettu ohjausta ja toimesta.
valvontaa koskien laitteen turvallista s l liit tt ilmastointilaitetta usean
kytt ja ymmrtvt kyttn liittyvt lhdn virtalevyyn.
vaaratekijt.
s Sammuta ilmastointilaitteen virtalhde,
s Lapset eivt saa leikki laitteen miklii sit ei kytet pitkn aikaan.
lheisyydess. Muutoin siihen kertyy ply ja saattaa
s Puhdistusta ja kyttjn suorittamaa aiheuttaa tulipalon.
huoltoa ei pid suorittaa s Ennen ilmastointilaitteen puhdistamista,
valvomattomana lasten toimesta. irrota virtalhde, jotta voidaan est
shkiskun mahdollisuus.
1.2 Asennus ja kytt s Virtalhteen tulee olla kohdistettu
ilmastointilaitteen kanssa,
VAROITUS! asennusoppaan mukaisesti.
Tukehtumisvaara, vamman tai Ilmastointilaitteet, jotka ovat
pysyvn vammautumisen vaara. toimitettuja virtajohdon kanssa, tulee
liitt suoraan pistorasiaan, joka on
s Ota yhteys valtuutettuun asentajaan varustettu sopivalla turvakytkimell.
tmn yksikn asentamiseksi. Ilmastointilaitteet, jotka ovat kiintesti
s Ota yhteys valtuutettuun yhdistettyj, tulee yhdist soveliaaseen
huoltoteknikkoon tmn yksikn suojakatkaisimeen Asennusohjekirjan
korjausta ja huoltoa varten. mukaisesti.
s Pistorasian, joka vaaditaan virransytt s Varmista, ett ilmastointilaitteen
varten, tulee olla liitetty ja kyttnotettu virtalhde on vakaa ja tytt
lisensoidun urakoitsijan toimesta. asennusoppaassa ilmaistut
s Mikli virtajohto on vahingoittunut, vaatimukset.
se tulee vaihtaa valmistajan, tmn s Varmista aina, ett tuote on asennettu
huoltoliikkeen tai vastaavasti asianmukaisen maadoituksen kanssa.
ptevityneen henkiln toimesta s Turvallisuussyist, sammuta aina
vaaratilanteiden vlttmiseksi. ensin suojakytkin ennen huoltoa tai
s Asennustyt tulee suorittaa vain puhdistusta tai kun tuotetta ei kytet
kansallisten johdotuksen standardien pitkn aikaan. Kertynyt ply voi
sek shkntoimittajien huoltosntjen aiheuttaa tulipalon tai shkiskun.
100 www.electrolux.com

s Valitse kaikkein asianmukaisin lmptila. tulipalo. Ota yhteytt paikalliseen


Se voi tuottaa energiansstj. huoltopalvelukeskukseen.
s l pid ikkunoita ja ovia pitkn s l tynn ksisi tai esineit ilman
auki kytn aikana. Se aiheuttaa tulo- tai poistoaukkoon. Tm voi
riittmtnt suorituskyky. aiheuttaa vammoja.
s l est tulo- tai poistoilman virtausta. s l altista elimi tai kasveja suoraan
Se aiheuttaa riittmtnt suorituskyky ilmavirralle.
ja toimintahiriit. s l kyt laitetta mihinkn muuhun
s Pid syttyvt aineet etll yksikist, tarkoitukseen, kuten elintarvikkeiden
vhintn 1 m. Nm voivat aiheuttaa silntn tai vaatteiden kuivaukseen.
tulipalon. s l salli veden roiskumista
s l astu tai aseta painavia esineit ilmastointilaitteelle. Seurauksena voi olla
ulkotilan yksikn plle. Tm voi shkisku tai vikatila.
aiheuttaa vahinkoja tai vammautumisen. s Turvallisuussyist, sammuta aina
s Oven kahva on jonkin verran ensin suojakytkin ennen huoltoa tai
kapea, toimi varovasti nostaessa puhdistusta tai kun tuotetta ei kytet
ulkotilayksikk. pitkn aikaan. Kertynyt ply voi
s l yrit korjata ilmastointilaitetta aiheuttaa tulipalon tai shkiskun.
itse. Vrnlaisesta korjauksesta s Tm ilmastointilaite kytt R410A
voi seurauksena olla shkisku tai kylmainetta.

Voit mys saada tmn ohjekirjan paikallisen jakelijasi vlityksell tai


vierailemalla verkkosivustollamme.
Tarkista Electrolux -verkko-osoitteet paikallisen maasi osalta alla olevassa taulukossa.
Maa Verkkosivun osoite Maa Verkkosivun osoite
Albania www.electrolux.al Alankomaat www.electrolux.nl
Itvalta www.electrolux.at Norja www.electrolux.no
Belgia www.electrolux.be Puola www.electrolux.pl
Bulgaria www.electrolux.bg Portugali www.electrolux.pt
Kroatia www.electrolux.hr Romania www.electrolux.ro
Tekin tasavalta www.electrolux.cz Serbia www.electrolux.rs
Tanska www.electrolux.dk Slovakia www.electrolux.sk
Suomi ZZZHOHFWUROX[ Slovenia www.electrolux.sl
Ranska www.electrolux.fr Espanja www.electrolux.es
Saksa www.electrolux.de Ruotsi www.electrolux.se
Kreikka www.electrolux.gr Sveitsi www.electrolux.ch
Unkari www.electrolux.hu Turkki www.electrolux.com.tr

Italia www.electrolux.it Irlanti www.electrolux.co.uk


Luxemburg www.electrolux.lu
Ky sivustolla www.electrolux.com saadaksesi listietoja
SUOMI 101

2. ENNEN ASENNUSTA

Kaikki tmn ohjekirjan kuvat ovat tarkoitukseltaan vain selventvi. Hankkimasi


sistilayksikn varsinainen muoto voi olla jonkin verran erilainen etupaneelin
nyttikkunan osalta. Varsinainen muoto on merkitykseltn mrv.

2.1 Asennuksessa tarvittavat tykalut


1. Vatupassi 9. Kuusikulmainen jakoavain (4mm)
2. Ruuvimeisseli 10. Kaasuvuotojen ilmaisin
3. Shkporakone 11. Tyhjpumppu
4. Pora porausaukkoa varten 12. Jakoputken mittari
(55mm / 70mm) 13. Kyttopas
5. Puhkaisutykalusarja 14. Lmpmittari
6. Mritellyt momenttiavaimet 15. Yleismittari
7. Kiintoavain (puoli knnst) 16. Putkileikkuri
8. Lasi vett 17. Mittanauha

2.2 Lisvarusteet

Numero Lisvarusteiden nimi Lukumr


1 Sistilayksikn kiinnityslevy 1
2 Puristinankkuri Ei toimitettu
3 Poraruuvi A ST3.9X25 5-8
4 Kaukosdin 1
5 Kaukostimen pidike (valinnainen) 1
6 Ruuvi kaukosdint varten ST2.9X10 (valinnainen) 2
7 Akku (AAA 1,5V) 2
8 Eristysmateriaali Ei toimitettu
9 Liitntputkiston kokoonpano (valinnainen) Vaihtelee maittain
10 Eristysletku jhdytysnesteen putkistoa varten Ei toimitettu
11 Tyhjennysletku Ei toimitettu
12 Seinkiinnike Ei toimitettu
13 Virtakaapeliliitnt Ei toimitettu
14 Tyhjennysliitin (vain lmppumppumalli) 1
15 Tyhjennystulppa (vain lmppumppumalli) (valinnainen) 3
16 Lmmneristysputki valutusletkun laajentamiseksi 1
17 Kaulusmutteri (imuputkelle) (valinnainen) 1
18 Kaulusmutteri (nesteputkelle) (valinnainen) 1

HUOM: Muut tarvittavat osat asennusta varten, edell olevien lisksi, tulee hankkia
asiakkaan/asentajan toimesta.
102 www.electrolux.com

2.3 Tuotteen kuvaus


1 3 2

15cm yli
Vli siskattoon
Sistilayksikk

15cm yli Vli seinlle

Vli seinlle 15cm yli

8
li
3m y

9
10
Ilman ulostulon puoli

4
11

6
Tila esteelle

7
50cm yli

18 Ilman sisntulon
puoli
Vli seinlle
yli
17 30cm yli cm
30

50cm yli
16 yli
2m Vli seinlle
Ilman ulostulon puoli
12
15

14
13
HUOMAUTUS
Kaikki tmn ohjekirjan kuvat ovat tarkoitukseltaan vain selventvi.
Hankkimasi sistilayksikn varsinainen muoto voi olla jonkin verran erilainen
etupaneelin nyttikkunan osalta. Varsinainen muoto on merkitykseltn
mrv.
SUOMI 103

2.4 Asennuskohde
s l asenna yksikk alueille, joissa on: s Asenna ulkotilayksikk paikkaan, jossa
voimakkaita lmmn lhteit; riittv ilmanvaihto.
huuruja tai syttyvi kaasuja; s Asenna ulkotilayksikk paikkaan,
jossa tuotettu melu ja ilmavirtaus eivt
saastumista ljyn jnteiden hiritse naapureita tai elimi.
kanssa;
s Asenna ulkotilayksikk kuivaan
korkeataajuuksista paikkaan.
shkmagneettisia laitteita (esim.
hitsauslaitteita tai lketieteellisi s Asenna ulkotilayksikk paikkaan, joka
laitteita); ei ole altistettu suoralle auringonvalolle
tai kovalle tuulelle.
korkeaa suolapitoisuutta (esim.
lhell rannikkoalueita); s Asenna ulkotilayksikk paikkaan, joka
kest yksikn painon ja tuotetun
rikkikaasua (esim. kuumavesilhteet); vrinn.
huono ilmanlaatu. s Korkeuden erotus sis- ja
ulkotilayksikn vlill tulee olla
Sistilayksikk vhemmn kuin 10 m.
s Noudata vhimmisetisyyksien s Liitntputkien korkeuden ei tulisi olla
vaatimuksia, jotka ovat mriteltyin vhemp kuin 25 m.
tss asiakirjassa. l est tulo- tai s Jt riittvsti tilaa pudistusta ja
poistoilman virtausta. huoltoa varten.
s l kyt yksikk paikoissa, joissa on s Ulkotilayksikk virroitetaan
erityisen korkea ilmankosteus. sistilayksikn toimesta.
s Asenna sistilayksikk lasten
ulottumattomiin. Varotoimenpiteet shklaitteita varten
s Seinn tulee olla riittvn kestv s Kyt omia virtapiirej.
tukemaan yksikn tuottama paino ja
vrin. s Yksikn tulee olla asianmukaisesti
maadoitettu.
s Asenna sistilayksikk ainakin 230 cm
lattiapinnan ylpuolelle. s Asenna vikavirtasuojakytkin (RCD)
suojaamaan henkilvahinkoa vastaan
s Jt riittvsti tilaa pudistusta ja huoltoa vuotovirtojen tapauksessa.
varten.
s Kyt napojen katkaisukytkint
s Ilmasuodattimeen tulee olla psy. kosketuksen erotuksella
s Jt ainakin 1 m etisyytt yksikn ja ainakin 3 mm kaikissa navoissa
muun shklaitteen vliin. kiintell johdotuksella. Malleille
s Asenna sistilayksikk paikkaan, jossa verkkovirtapistokkeella, varmista ett
lauhdevesi voidaan helposti tyhjent. verkkovirtapistoke on saavutettavissa
asennuksen jlkeen.
s Asenna sijaintipaikkaan, joka on
suojattu suoralta auringonvalolta. s Asennuksen tulee noudattaa paikallisia
turvasdksi ja muita oleellisia
paikallisia sdksi.
Ulkotilayksikk
s Yksikn tulee olla asennettuna
s Noudata vhimmisetisyyksien kansallisten shkliitntsdsten
vaatimuksia, jotka ovat mriteltyin mukaisesti.
tss asiakirjassa.
s l altista verkkovirtajohtoa
s l est tulo- tai poistoilman virtausta. voimankytlle.
s Asenna ulkotilayksikk lasten s Yksikn ja lmplhteiden vlinen
ulottumattomiin. etisyys on ainakin 1,5 m.
104 www.electrolux.com

HUOMAUTUS tarkoituksiin. Vr maadoitus voi


s Varmista, ett vaihejohdin, nollajohto aiheuttaa shkiskun.
ja maadoitusjohdin pistorasiaan ovat s Maadoitusvastuksen tulee noudattaa
oikein kytkettyj. paikallisia sdsvaatimuksia.
s Puutteelliset tai virheelliset kytkennt s Verkkovirran tulee omata luotettava
voivat aiheuttaa shkiskun tai tulipalon. maadoitusliitin. l yhdist
maadoitusjohtoa vesi-, kaasu-,
jteputkiin tai muihin ei-turvallisiin
Maadoitusvaatimukset
kohteisiin.
s Yksikk on Tyyppi I -shklaite. Varmista,
s Sulakkeiden tulee noudattaa ennalta
ett yksikk on maadoitettu oikein.
mritelty mallia sek nimellisarvoa,
s Kelta-vihre johto on maadoitusjohto, joka on tulostettu sulakkeen kuoreen
jota ei voida kytt muihin tai piirilevylle.

3. TUOTTEEN ASENNUS
3.1 Sistilayksikn asennus
3.1.1 Kiinnityslevyn tyyppi

150mm tai enemmn siskattoon Sistilayksikn


ulosjohdin
150mm tai 150mm tai
enemmn enemmn
seinn seinn

Vasemman takasivun Oikean takasivun


jhdytysnesteputken jhdytysnesteputken
reik 55 reik 55

Sistilayksikk 9000Btu/h -mallit

150mm tai enemmn siskattoon Sistilayksikn


ulosjohdin
150mm tai 150mm tai
enemmn enemmn
seinn seinn

Vasemman takasivun Oikean takasivun


jhdytysnesteputken jhdytysnesteputken
reik 55 reik 55

Sistilayksikk 12000Btu/h -mallit


SUOMI 105

150mm tai enemmn siskattoon


Sistilayksikn
ulosjohdin
150mm tai 150mm tai
enemmn enemmn
seinn seinn

Vasemman takasivun Oikean takasivun


jhdytysnesteputken jhdytysnesteputken
reik 55 reik 55

Sistilayksikk 18000Btu/h -mallit

150mm tai enemmn siskattoon Sistilayksikn


ulosjohdin
150mm tai 150mm tai
enemmn enemmn
seinn seinn

Vasemman takasivun Oikean takasivun


jhdytysnesteputken jhdytysnesteputken
reik 70 reik 70

Sistilayksikk 24000Btu/h -mallit

150mm tai enemmn siskattoon Sistilayksikn


ulosjohdin
150mm tai 150mm tai
enemmn enemmn
seinn seinn

Vasemman takasivun Oikean takasivun


jhdytysnesteputken jhdytysnesteputken
reik 70 reik 70

Sistilayksikk 28000Btu/h -mallit


106 www.electrolux.com

3.1.2 Seinkiinnittimen 3.1.4 Liitntputki


kannattimen asennus
1. Vasemman ja oikean puolen
1. Asenna seinkiinnittimen kannatin putkien osalta, irrota putken suoja
vaakatasossa rakenteellisten osien sivupaneelista. Putken suoja voidaan
yli seinll kyttmll tiloja, jotka pit samalla tavoin kuin sit voidaan
ovat ilmaistuja kannattimessa, kuten kytt sijoittaessa ilmanvaihtolaite
esitettyin kuvassa 1. mihin muuhun paikkaan tahansa.
2. Laatoitettujen, sementti- tai muiden 2. Oikean ja vasemman takaosan
samankaltaisten seinien osalta, luo putkitusta varten, Asenna putkitus
halkaisijaltaan 5mm reit. Aseta ankkurin kuvassa 3 esitetyll tavalla. Taivuta
tuet asianmukaisille kiinnitysruuveille, liitntputki asetettavaksi 43mm
liitnnn putkille ja johdoille. korkeudelle tai vhemmn seinst.
Kiinnit liitntputken p.
3. Asenna seinkiinnittimen kannatin seinn
kahdeksalla A-tyyppisell ruuvilla. Kuva 3
4. Kaikkina aikoina, varmistus Putken Putken pidike Putken
seinnastoilla on suositeltavaa. pllys pllys
(oikea) (vasen)
Kuva 1

Oikea Takaoikea Takavasen


HUOM: putkitus putkisto putkisto
s Asenna seinkiinnityksen kannatin ja Kuva 4
poraa reit seinn seinn rakenteen ja
vastaavien kiinnityspisteiden mukaisesti Sistilayksikk Liitntputki
seinkiinnittimen kannattimen osalta Linjamme
(mitat ovat yksikss mm ellei toisin
ilmaista).

43mm
3.1.3 Rein poraaminen
1. Pttele rein kohta putkia varten
kyttmll seinkiinnittimen kannatinta 3.1.5 Viemrijrjestelm
ja poraa reik niin ett se on jonkin
verran kallistunut alasuuntaisesti. 1. Kyt valutusletkua alasuuntaisesti
2. Kyt poratessasi aina putken suojaa kallistaen. l asenna valutusletkua
avauksella. kuvassa 5 esitetyll tavalla.
Kuva 2 Kuva 5
Sein
Ulkotila
Sistila

l est veden virtausta nostamalla


5-7mm

tai asettamalla valutusletkua veteen.


SUOMI 107

2. Yhdistess jatkovalutusletkua, 3.1.7 Putkitus ja pakkaus


erist jatkovalutusletkun yhdistv
osa suojaputken kanssa, l salli 1. Tuo yhteen putkitus, liitntjohto,
valutusputken roikkumista. ja valutusletku teipill varmistaen ja
tasaisesti kuten esitetty sivulla olevassa
3.1.6 Sistilayksikn kiristminen kuvassa.
2. Koska lauhdevesi sistilayksikn
1. Kuljeta putkitus rein lpi seinss. sispuolelta kertn lauhdesammioon
2. Aseta ylempi sorkka sistilayksikn ja putkitetaan ulos huoneesta, l aseta
taakse seinkiinnityksen kannattimen mitn muuta laatikkoon.
ylempn koukkuun, siirr Kuva 8
sistilayksikk sivulta sivulle
nhdksesi ett se on oikein
koukutettu.
Kntsdin-
Kuva 6 laatikko
Kaapeli-
Ylempi koukku Putki-tila
yhteys
Liitnt-
putki
Krint-
Valutus- hihna
letku

HUOM:
s Yhdist sistilayksikk ensin, sitten
Alempi koukku ulkotilayksikk.
s Ole varovainen ettet anna valutusletkun
3. Putkitus voidaan helposti suorittaa riippua veltosti.
nostamalla sistilayksikk
s Molempien lisputkien pitisi olla
pehmentvll materiaalilla
lmmlt eristettyj.
sistilayksikn ja seinn vlill.
s Varmista ett valutusletku sijaitsee
Kuva 7
kimpun alemmalla puolella. Ylemmlle
puolelle asetus saattaa aiheuttaa
valutusastian ylivuodon yksikn
sispuolelle.
s l koskaan ved keskinisesti yli tai
sekoita toisiinsa johtoa minkn toisen
johdon kanssa.
s Kyt valutusletkua alasuuntaisesti
kallistettuna valuttaaksesi lauhdeveden
ulos tasaisesti.

Pehmustemateriaali
3.2 Ulkotilayksikn asennus
4. Tynn sistilayksikn alempaa 3.2.1 Ulkotilayksikn varmistus
osaa sein ylspin, siirr sitten
sistilayksikk sivulta sivulle, yls ja 1. Asenna yksikn ulkotilaosa tasaiselle
alas tarkistaaksesi onko se koukutettu pinnalle vlttksesi ylimrist melua ja
varmasti. vrin. Lauhdutinalustaa suositellaan.
108 www.electrolux.com

2. Kohdenna ilmanvaihto aluetta kohti, 3.2.2 Ulkotilayksikn


jossa ei esteit.
lauhdeveden valutus (vain
3. Asenna yksikk paikkaan, jossa
se altistuu tuulelle niin vhn kuin
lmppumppumallia varten)
mahdollista, erityisesti alueilla, jotka ovat
1. Lmmitystoimenpiteen aikana,
snnllisesti tuulisia.
lauhdevesi ja sulavesi tulee valuttaa pois
4. Jos asennuspaikka on alttiina koville odotetusti valutusletkun vlityksell.
tuulille, kuten rannikkoseuduilla, aseta
yksikk seinn leveimmlle kohdalle tai 2. Asenna ulkotilan valutusliitnt
kyt suojaavia levyj. valutusveden reikn ulkotilayksikn
rungossa, ja liit valutusletku liittimeen
5. Varmista ett ei ole estett, joka tukkii niin ett ulkotilayksikss muodostunut
poistuvan ilman, mukaan lukien pensaat jtevesi voidaan valuttaa ulos.
tai aluskasvillisuus.
3. Valutusveden reikn tulee asettaa
Kuva 10
tulppa. Muiden reikien varustaminen
tulpalla tulee ptt asentajan toimesta
varsinaisten olosuhteiden mukaisesti.
4. Valutusletkun tapauksessa, yksikk
tulee asentaa perustalle yli 3cm
korkeudelle.
Kuva 12

Valutusvesireik

Alusta

Valutusliitin
Kova tuuli

HUOM: Sisempi letku,


s Ulkotilayksikn paikalleen asetus. Ankkuroi halk. 16mm
ulkotilayksikk kiresti ja vaakatasoon (ei toimitettu)
sementille tai tasaiselle kiinnitysalustalle
pultilla ja mutterilla 10mm halkaisijaltaan
(hankitaan erillisen). 3.3 Jhdytysnesteen
Kuva 11 putkitusliitnt
Tuloilma
HUOM:
s Yksikk toimitetaan 7,5m letkukimpulla.
Tuloilma Sit suositellaan leikattavaksi. Jos se on
liian pitk, lenkit ylimriset osat.
s Pid alkuperinen taitos, jotta putken
sykkyritymist ei tapahdu.

Poistoilma
SUOMI 109

3.3.1 Kaulusty 3. Aseta mutteri paikalleen


s Irrota kaulusmutterit, jotka liitettyj
Jdytysaineen vuodon suurin syy johtuu sis- ja ulkotilayksikkn, aseta ne
viasta kauluksessa. sitten putkeen vietysi jysteen poiston
Suorita asianmukainen ptkseen. (Ei ole mahdollista asettaa
kaulusty suorittamalla seuraava niit kaikkia plle kaulustyn jlkeen.)
toimenpidemenetelm: Kuva 15

1. Leikkaa putket ja johto. Kaulusmutteri


s Kyt putkipakkauksen lisvarusteita tai
paikallisesti hankittuja putkia.
s Mittaa etisyys ulko- ja sistilayksikn Kupariputki
vlill.
s Leikkaa putket vhn pidemmiksi kuin
mitattu etisyys.
4. Kaulusty
s Leikkaa johto 1,5m pidemmksi kuin
s Suorita kaulusty kyttmll
putken pituus.
kaulustykalua alla esitetyll tavalla.
Kuva 13
Kuva 16
Putki

"A"
Palkki

Kupariputki

Vinokulmainen Karkeus Jyste


Kahva

Palkki
Kaulus

Kartio

2. Jysteen poisto
s Poista tysin kaikki jysteet putkista.
Punainen
s Aseta kupariputken p alasuuntaisesti Puristinkahva
nuolimerkki
poistaessasi jysteit vlttksesi
jysteiden putoamista putkeen. s Pid tukevasti kupariputkea muotissa
Kuva 14 alla esitetyn taulukon mittasuhteen
mukaisesti.
Putki
Taul. 1
Kalvain
Ulkoinen A (mm)
halki. (mm) Maksa. Min.
Tulostuspuoli 6,35 (1/4) 1,3 0,7
alaspin 9,52 (3/8) 1,6 1,0
12,70 (1/2) 1,8 1,0
15,88 (5/8) 2,4 2,2
110 www.electrolux.com

3.4 Putkiliitnt Kuva 19


Nippusiteet Eristys-
3.4.1 Sistilayksikk materiaali

1. Sistilayksikn putkitus liitntputkiin:


s Linjaa putkien keskit ja kirist riittvsti
kaulusmutteria ensin ksillsi.
Kuva 17
s Varmista erottavasi erilleen imuputken
nesteputkesta.
Kuva 20
Lmperistys
Sistilayksikn Kaulusmutteri Putket
putkitus

Ruuviavain Imulinjaputki Nestelinjaputki


Momenttiavain
s Kri eristetyt putket vinyyliteipill
Kuva 18 putkikotelon takaosaan. Kirist
Ruuviavain
virtajohto putkiin vinyyliteipill.
(kiinte) Kuva 21
Liitntputki
Kaulusmutteri
Sistilayksikkputki
Putket Vinyyliteippi (leve) Pakkaa vinyyliteipill
Vntavain
Kuva 22
Sistilayksikn putkitus
Putki
s Kirist sitten kaulusmutteria
Vinyyliteippi
ruuviavaimella ja vntavaimella
(kapea)
viitaten seuraaviin:
Liitntkaapeli
Taul. 2

Lis-
Ulkoinen halki. Vntmomentti
Vntmomentti
(mm) (Nam)
(Nam) s Kri putkitus, valutusletku virtajohto
kiresti vinyyliteipill niin ett ne voivat
6,35 (1/4) 15,7 (1,6kg.m) 19,6 (2,0kg.m) mahtua takaputkituksen koteloon.
9,52 (3/8) 29,4 (3,0kg.m) 34,3 (3,5kg.m) Kuva 23
12,70 (1/2) 49,0 (5,0kg.m) 53,9 (5,5kg.m) Putki
Tyhjennysletku
15,88 (5/8) 73,6 (7,5kg.m) 78,6 (8,0kg.m) Vinyyliteippi
(kapea)
2. Kri eristysmateriaali liittvn osuuden
ymprille: Virtakaapeliliitnt Pakkaa
s Kata sistilayksikn putki ja liitntputki vinyyliteipill
lmperistysmateriaalilla. Sido ne (leve)
yhteen vinyyliteipill niin ettei j vlej.
SUOMI 111

3. Sistilayksikn putkitus liitntputkiin: Kuva 26


s Poista vlike.
s Koukuta sistilayksikk kiinnityslevyn
ylempn osaan (hydynn
kiinnityslevyn koukkuja sistilayksikn
takaosan ylosaan).
s Varmista ett koukut ovat oikein
asetettuina kiinnityslevyll siirtmll
sistilayksikk kaikkiin suuntiin.
Kuva 24
2. Sitten, kirist kaulusmutteria
Ylempi koukku vntavaimella kunne avain napsahtaa.
Kiinnityslevy Kuva 27
Ulkotilayksikk
Vlike Neste
putki
(2-tieventtiili) Imu
putki
s Paina yksikn alavasenta ja -oikeaa
puolta kiinnityslevy vasten kunnes
koukut kiinnittyvt loviinsa (napsahtava 3-tieventtiili
ni).
Kuva 25
s Varmista ett noudatat vntmomentin
Ylempi koukku
taulukon arvoja kuten alla olevassa:
Taul. 3
Liitntkaapeli
Lis-
Ulkoinen halki. Vntmomentti
Vntmomentti
(mm) (Nam)
(Nam)
6,35 (1/4) 15,7 (1,6kg.m) 19,6 (2,0kg.m)

Tyhjennysletku 9,52 (3/8) 29,4 (3,0kg.m) 34,3 (3,5kg.m)

12,70 (1/2) 49,0 (5,0kg.m) 53,9 (5,5kg.m)


Kiinnityslevy
15,88 (5/8) 73,6 (7,5kg.m) 78,6 (8,0kg.m)
Alempi kiinnityskoukku

3.4.3 Putkituksen muoto


3.4.2 Ulkotilayksikk
1. Muotoile putkitus krimll
1. Linjaa putkien keskit ja kirist riittvsti sistilayksikn liitinosa eristysmateriaalilla
kaulusmutteria ksillsi. ja varmista se kapealla vinyyliteipill ja
levell vinyyliteipill.
s Jos haluat liitt ylimrisen valutusletkun,
valutusletkun ulostulon pn tulee olla
reititettyn maan ylpuolelle. Varmista
valutusletku asianmukaisesti.
2. Tapauksissa, joissa ulkotilayksikk on
asennettu alle sistilayksikn tason:
112 www.electrolux.com

s Kri putkitus, valutusletku ja 3.4.4 Valutuksen tarkistus


liitntjohto alhaalta yls.
s Varmista kritty putkitus ulkosein 1. Avaa ja nosta sistilayksikn
pitkin satulaa tai vastaavaa kyttmll. etupaneelia.
Kuva 28 s Pid paneelin oikeasta ja vasemmasta
alaosasta, ved sit itsesi kohti ja
Tiivist pienet aukot nosta se kannattimen tydell tuella.
putkiston ymprill Kuva 30
kumityyppisell Pllyste
tiivisteell
Putki

Tyhjennysletku
Paneelin kannatin
Liitntkaapeli
2. Tarkista valutus
Tyhjennysletku s Kaada huolellisesti lasi vett
haihduttimeen.
s Varmista veden valuminen
Ansa vaaditaan estmn veden sistilayksikn valutusletkun lpi ilman
psy shkisiin osiin vuotoja ja poistuminen valutuksen
3. Tapauksissa, joissa ulkotilayksikk pstn kautta.
on asennettu sistilayksikn tason Kuva 31
ylpuolelle:
s Kri putkitus and liitntjohto alhaalta yls.
s Muotoile ansa estksesi veden psyn
tilaan.
s Varmista kritty putkitus ulkosein
pitkin satulaa tai vastaavaa kyttmll.
Kuva 29
Tiivist pienet aukot
putkiston ymprill
kumityyppisell
tiivisteell
Ansa
Tyhjennysletku

3. Valutusputkitus
Ansa s Valutusletkun tulee osoittaa
alasuuntaisesti helppoa valutusvirtausta
varten.
Tyhjennysletku
SUOMI 113

Kuva 32 Kuva 33
Kertynyt
Alasuuntainen l nosta sadevesi
kallistus Ilma

Vesivuoto Vesivuoto
Valutusletkun Tilaa
krki veteen vhemmn
s l aseta valutusputkea alla osoitetulla kastettuna kuin 50mm
tavalla:

Vesivuoto Oja

3.5 Shkasennus
3.5.1 Turvatoimenpiteet
2. Katkaisijan tulee omata toiminnot
Shkturvallisuuden snnt ennen magneettisen laukeamisen ja
asennuksen aloitusta: lmplaukeamisen osalta, jotta estetn
1. Oma virtapiiri ja katkaisija tulee olla oikosulku ja ylikuormitus.
varustettuna tuotteille, joihin ei toimiteta 3. Laite asennetaan kansallisten
palvelujohtoa ja pistoketta paikallisten johdotusasetusten mukaisesti.
shkturvallisuuden sdsten 4. Katkaisin oikealla kapasiteetilla tulaa
mukaisesti. asentaa alla olevan taulukon mukaisesti.

Taul. 4
Kapasiteetti Jrjestelmn Virtajohtomittari Liitntjohtomittari Sulakkeen
Ylivirtasuoja(A)
watteja (BTU/h) jnnite/taajuus (mm2) (mm2) tyyppi(A)

2500 (9K) 220-240V/50Hz t1,0 t1,0 3,15 10

3200 (12K) 220-240V/50Hz t1,5 t1,5 3,15 16

4600 (18K) 220-240V/50Hz t2,5 t2,5 3,15 25

6700 (24K) 220-240V/50Hz t2,5 t2,5 3,15 25

8000 (30K) 220-240V/50Hz t4,0 t4,0 3,15 32

9700 (36K) 220-240V/50Hz t4,0 t4,0 3,15 32


114 www.electrolux.com

5. Virransytn ongelmatilanteissa, 2. Reitit virtaliitntjohto ja


ilmastointilaitteen tulee olla asennettuna signaalinohjausjohto (vain
ennen kuin asiakas korjaa ongelman. lmppumppumalli) sistilayksikn
6. Varmista ett virransytt vastaa takaosasta ja ved sit etuosaa kohti
ilmastointilaitteen vaatimusta. liitnt varten tehdyn johdotusrein
lpi.
7. Varmista, ett vaihejohdin, nollajohto
ja maadoitusjohdin pistorasiaan ovat 3. Yhdist ja ruuvaa johdot ptelohkoon
oikein kytkettyj. niiden vrien mukaan tunnistettuina.
8. Riittmttmt tai vrt shkliitnnt 4. Kri johdot, jotka eivt ole liitettyj
voivat aiheuttaa shkiskun, tulipalon tai eristysteipill niin ett ne eivt koske
joidenkin elektronisten osien vikatilan. mihinkn shkisiin tai metalliosiin.
9. Ennen minkn shktyn 5. Varmista johdot tukevasti puristimella.
suorittamista, kytke pois plt 6. Aseta paikalleen johdotuksen kansi ja
virransytt jrjestelmn. ruuvaa se.
7. Palauta paikalleen etupaneeli.
3.5.2 Turvatoimenpiteet Kuva 35

Maadoitusvaatimukset 1300/2200 Wattia (5K&7K)


Vain jhdytystyyppinen
1. Yksikk tulee maadoittaa
ja liitt varmasti erityiseen N(1) 2
maadoituslaitteeseen ptevitetyn
shkmiehen toimesta. sininen Musta kelta-
2. Keltavihre johto ilmastointilaitteessa on vihre
maadoitusjohto, jota ei voida kytt
muihin tarkoituksiin. Vr maadoitus
saattaa aiheuttaa shkiskun.
Ulkotilayksikn liitnt
3. Maadoitusvasteen tulee noudattaa
kansallista johdotuksen sdst. Kuva 36
4. Kyttjn virralla tulee olla luotettava 2500/3600 Wattia (9K&12K)
maadoitusterminaali. l kytke Vain jhdytystyyppinen
maadoitusjohtoa seuraaviin:
N(1) 2
s Vesiputki
s Kaasuputki
s Jteputki sininen Musta kelta-
vihre

3.5.3 Sistilan shkjohtojen


asennus Ulkotilayksikn liitnt
1. Avaa etupaneeli ja poista johdotuksen Kuva 37
kansi ruuvia kiertmll.
Kuva 34 5200/6600 Wattia (18K&24K)
Vain jhdytystyyppinen
Johtosuoja N(1) 2 3

sininen Musta Ruskea kelta-


vihre

Ulkotilayksikn liitnt
SUOMI 115

Kuva 38 Kuva 42
8600/11000 Wattia (30K&36K) 8600/11000 Wattia (30K&36K)
Vain jhdytystyyppinen Lmppumpun tyyppi
N(1) 2 3 N(1) 2 3

sininen Musta Ruskea kelta- sininen Musta Ruskea kelta-


vihre vihre

Ulkotilayksikn liitnt Ulkotilayksikn liitnt


Kuva 39
HUOM:
1300/2200 Wattia (5K&7K)
Lmppumpun tyyppi s Kaikki johdot sis- ja ulkotilayksikn
vlill tulee liitt ptevitetyn
N(1) 2 4 5 shkurakoitsijan toimesta.
s Jos virtajohdon pituus ei ole riittv,
sininen Musta violetti oranssi ota yhteytt toimittajaasi hankkiaksesi
uuden virtajohdon. Omatoiminen
kelta-
vihre
virtajohdon jatkaminen ei ole sallittua.
s Ruuvien kiristyksen jlkeen, ved
Ulkotilayksikn liitnt johdosta kevyesti vahvistaaksesi onko
se tukeva vai ei.
Kuva 40 s l yhdist kahta virtajohtoa yhteen
toimittaaksesi virtaa ilmastointilaitteelle.
2500/3600 Wattia (9K&12K)
Lmppumpun tyyppi s l laajenna virtajohdon johdinta
leikkaamalla.
N(1) 2 3

sininen Musta violetti oranssi


3.5.4 Ulkotilan shkjohtojen
asennus
1. Poista kahva ulkotilayksikn oikean
puolen levyll ruuvia lysentmll.
Ulkotilayksikn liitnt
Kuva 43
Kuva 41
4500/6800 Wattia (18K&24K)
Lmppumpun tyyppi Kahva

N(1) 2 3

sininen Musta violetti oranssi

Kytkentrimat

Ulkotilayksikn liitnt
116 www.electrolux.com

2. Poista virtajohdon puristin. Kuva 47


Yhdist ja ruuvaa virtaliitnnn
8700/11000 Wattia (30K&36K)
johto ja signaaliohjausjohto (vain
Vain jhdytystyyppinen
lmppumppumalli) ptelohkoon
noudattaen vastaavia tunnistelukuja N(1) 2 3
ja -vrej sis- ja ulkotilayksikiden
ptelohkoilla.
sininen Musta Ruskea kelta-
3. Estksesi veden psyn, tee lukko vihre
(U) liitntjohtoihin (ks. sivu 112).
4. Kri johdot, jotka eivt ole liitettyj
eristysteipill niin ett ne eivt koske Sistilayksikkliitnt
mihinkn shkisiin tai metalliosiin.
Kuva 48
5. Kiinnit virtaliitnnn johdot
johtopuristimilla. 1300/2200 Wattia (5K&7K)
Lmppumpun tyyppi
6. Asenna kahva uudelleen.
Kuva 44 N(1) 2 4 5
1300/2200 Wattia (5K&7K)
Vain jhdytystyyppinen sininen Musta violetti oranssi
kelta-
N(1) 2 vihre

sininen Musta kelta- Sistilayksikkliitnt


vihre
Kuva 49
2500/3600 Wattia (9K&12K)
Sistilayksikkliitnt Lmppumpun tyyppi
Kuva 45 N(1) 2 3
2500/3600 Wattia (9K&12K)
Vain jhdytystyyppinen sininen Musta violetti oranssi

N(1) 2

sininen Musta kelta-


Sistilayksikkliitnt
vihre
Kuva 50
4500/6800 Wattia (18K&24K)
Sistilayksikkliitnt Lmppumpun tyyppi
Kuva 46 N(1) 2 3
5200/6600 Wattia (18K&24K)
Vain jhdytystyyppinen sininen Musta violetti oranssi

N(1) 2 3

sininen Musta Ruskea kelta- Sistilayksikkliitnt


vihre

Sistilayksikkliitnt
SUOMI 117

Kuva 51 s Paine jrjestelmss nousee.


8700/11000 Wattia (30K&36K) s Toimintavirtaus kasvaa.
Lmppumpun tyyppi s Jhdytyksen tai lmpenemisen (vain
malleille lmptoiminnolla) tehokkuus
N(1) 2 3 putoaa.
s Kosteus jhdytysnesteen
sininen Musta Ruskea kelta-
piiriss saattaa jdytt ja tukkia
vihre
kapillaariputkiston.
s Vesi voi johtaa osien sypymiseen
jhdytysjrjestelmss.
Sistilayksikkliitnt
Tst johtuen, sistilayksikkn ja
HUOM: putkistoon sis- ja ulkotilayksikn vlill
Vahvistettuasi yll olevat olosuhteet, tulee soveltaa vuototesti ja poistaa
valmistele johdotus seuraavalla tavalla: kaikki lauhtumattomuudet ja kosteus
jrjestelmst.
s Ruuvit, jotka kiristvt ptelohkon
voivat lysty kuljetuksen aikaisesta
vrinst. 3.6.1 Ilman tyhjennys
s Tarkista ja varmista ett kaikki ruuvit tyhjipumpulla
ovat hyvin kiinnitettyj. Muutoin, se
saattaa tuottaa johtojen loppuun 1. Tarkista ett kukin putki (sek
palamisen. neste- ett kaasupuolen putket)
sis- ja ulkotilayksikiden vlill ovat
s Varmista ett virtapiirin kapasiteetti on
asianmukaisesti liitettyj ja kaikki
riittv.
johdotukset testikytt varten on viety
s Varmista ett kyttjnnitett ptkseen. Poista huoltoventtiilien
yllpidetn yli 90 % suojat ulkotilayksikn sek kaasu-
nimellisjnnitteest, joka on merkitty ett nestepuolelta. Huomioi ett sek
tyyppikilpeen. neste- ett kaasupuolen huoltoventtiilin
s Vahvista, ett johdon paksuus on sama ulkotilayksikss pidetn suljettuina
kuin mit on mritetty virtalhteen tss vaiheessa.
mrityksess. 2. Siirrettess yksikk toiseen
s Asenna aina vikavirtasuoja (RCD) paikkaan, suorita tyhjennys kyttmll
mrlle tai kostealle alueelle. tyhjipumppua.
s Seuraava saattaa johtua jnnitteen 3. Varmista ett jhdytysneste listtyn
putoamisesta: Koskettimen ilmastointilaitteeseen on kaikissa
vrhtely, joka saattaa vahingoittaa tapauksissa nestemisess muodossa.
kosketuskohtaa, sulakkeen palaminen, 4. ljyansa tulee asentaa kunkin
ylikuormituksen normaalitoiminnon 5-7m vlille (ljyansaa ei tarvita kun
hiri. ulkotilayksikk asennetaan alempaan
s Keinot virtalhteest irrottautumiseen paikkaan kuin sistilayksikk).
sisllytetn kiinten johdotukseen 5. Putken pituus ja jhdytysnesteen
ja omaavat ainakin 3mm ilmaraon mr jaetun tyyppiselle
yhteyden erottamiseksi kussakin ilmastointilaitteelle. (ks. alla oleva taul .5)
aktiivisessa (vaiheessa) johtimessa.

3.6 Ilmanpoisto- ja vuototesti


Ilma ja kosteus viilennysjrjestelmss
tuottavat alla olevassa mainittuja ei-
haluttavia vaikutuksia:
118 www.electrolux.com

Ulkotilayksikk Ulkotilayksikk

(A)
ljyansa

(A)
(B)
(B)

Sistilayksikk Sistilayksikk

Putkituksen pituus alle 5m Putkituksen pituus 5m tai enemmn

Taul. 5

Kapasiteetti Lisjhdytysaine(g/m)
Tyhjennysputki Standardi Enimmispituus Enimmiskorkeus
watteja
halkaisija (mm) pituus (m) (m)(A) (m)(B)
(BTU/h) Vain jhdytys Lmppumppu

2500 (9K) 9,52 (3/8) 5 15 10 15 20

3200 (12K) 9,52 (3/8) 5 20 10 15 20

4600 (18K) 9,52 (3/8) 5 20 10 15 20

6700 (24K) 15,88 (5/8) 5 25 10 15 17

8000 (30K) 15,88 (5/8) 5 30 10 15 50

9700 (36K) 15,88 (5/8) 5 30 10 15 50

3.6.2 Varovaisuutta pakatun Kuva 52


venttiilin ksittelyyn, joka on
kiinnitetty ulkotilayksikn Jhdytysaine
ulostuloihin
Mat. pysytysventtiili
1. Pakatun venttiilin avauksen suoritus: Ulkotilayksikk (3-tieventtiili) Sistilayksikk
Avaa venttiilin vartta kunnes se pyshtyy
Kaasupuoli
pysytint vasten. l yrit avata sit
enemp. Nestepuoli
2. Pakatun venttiilin sulkemisen suoritus:
Kirist venttiilin vartta varmistaen se Korkea pysytysventtiili Puoliliitnt
erikoistykalulla. Kirist venttiilin varren (2-tieventtiili)
suojus ruuviavaimella tai vastaavalla.
Ks. taulukko sivulla 17 venttiilin suojan
kiristysvntmomentin osalta.
SUOMI 119

HUOM: ja tarkista siirtyyk ilmaa sisn


(tyhjipumpun kyttni muuttuu ja
s On olemassa latausportti, joka on
yhdistemittari ilmaisee 0 miinuksen
yhdistetty ulostulon alempaan puoleen,
sijaan), kirist sitten kaulusmutteria.
mutta ei ulostulon korkeammalla
Toimenpidemenetelm todentaa onko
puolella. Alemman puolen ulostulo
putkien sisll tukkeita.
nkyy alla olevassa piirustuksessa.
5. Suorita poisto 15 minuutin jaksolla tai
Kuva 53
pidempn ja tarkista ett yhdistemittari
ilmaisee -7-3/5 x 10 Mikronia Hg
(-1x10 Pa). Kun poisto on viety
Kaulusmutteri
Venttiilin runko
ptkseen, sulje alemman sivun
putkistoventtiilin kahva tysin ja
pysyt tyhjipumpun toiminto.
Suoja 6. Knn pakatun venttiilin B vartta n.
45 vastapivn 6~7 sekuntia sen
jlkeen kun kaasu poistuu, sitten kirist
Laturiliitnt kaulusmutteria uudelleen. Varmista ett
Venttiilikanta paineen nytt paineilmaisimessa on
jonkin verran korkeampi kuin ilmakehn
Pysytin paine. Tm toimenpidemenetelm
varmistaa, kulkeeko jhdytysneste
putkien lpi oikein.
3.6.3 Kyttess tyhjipumppua 7. Sulje schrader-venttiili, poista sitten
venttiilin ydintykalu. Vaihda latausportin
Putkistoventtiilin kytn menetelm suoja.
varten, ks. sen kyttopas.
8. Avaa tysin pakatun venttiilin varret B
1. Kirist kaulusmutterit tysin ja A.
liitntkohdissa A, B, C ja D. Liit
9. Kirist pakatun venttiilin suoja varmasti.
venttiilin ytimen irrotustykalu
latausporttiin, liit sitten tyhjiletku Kuva 54
venttiilin ytimen tykaluun. Avaa
shrader-venttiili. Ulkotilayksikn
HUOM: Putkistoventtiilin
Yleismittari-76cmHg
s Schrader-venttiili on latausportin Kork.
sispuolella. Mat. kahva
kahva
Latausletku
2. Liit toinen putkistoventtiilin latausletku Alipaineventtiili Latausletku
tyhjipumppuun.
3. Avaa tysin putkistoventtiilin alemman
puolen kahva. Tyhjpumppu
4. Kyt tyhjipumppua poistaaksesi.
Poistamisen aloituksen jlkeen,
lysenn alemman sivuventtiilin
kaulusmutteria kaasuputken puolella
120 www.electrolux.com

4. TESTAUS JA KYTT

4.1 Kaasuvuotojen tarkistus 4.3 Kytttestaus


1. Toimintamenetelm saippuavedell 1. Ennen kytttesti
s Kyt saippuavett tai nestemist s l kytke virtaa plle ennen kuin
neutraalia pesuainetta sistilayksikn asennus on tysin viety ptkseen.
liitnnss tai ulkotilayksikn s Shkjohdotuksen tulee olla
liitnniss (A: Alempi sivuventtiili, B: yhdistettyn oikein ja varmasti.
Ylempi sivuventtiili venttiili C ja D ovat s Liitntputkien pysytysventtiilit tulee
sistilayksikn liitnnn pt) pehmell avata tysin.
harjalla tarkistaaksesi putkituksen
liitntpisteiden vuodon. Jos kuplia s Kaikki eppuhtaudet, kuten jnteet ja
ilmenee, putkissa on vuotokohta. jtteet tulee puhdistaa yksikst.
Kuva 55 2. Kytn testausmenetelm
s Kytke virta plle ja paina ON/
Sistilayksikk
tarkastuskohdat D
OFF -painiketta kaukostimell
Nesteputki kynnistksesi toiminnan.
C
Kaasuputki
s Paina MODE-painiketta valitaksesi
Ulkotilayksikk COOL, HEAT (jos kytettviss),
B
2-tieventtiili Ulkotilayksikk
FAN tarkistaaksesi toimivatko kaikki
tarkastuskohdat toiminnot oikein.
A
s Kun ympriv lmptila on vhemmn
3-tieventtiili kuin 16C, yksikk ei voida asettaa
kaukostimell toimimaan COOL-
tilassa. Kyt Httoimintatilaa, jota
kytetn vain kun kaukosdin ei ole
kytettviss tai huollon aikana.
2. Vuodon ilmaisin Kuva 56
s Kyt vuodon ilmaisinta tarkistaaksesi
vuodon.

4.2 Shkturvallisuuden tarkistus Manuaalinen


ohjauspainike
Suorita shkturvallisuuden tarkistus
asennuksen loppuun viennin jlkeen:
1. Maadoitusty
s Maadoitustyn pttmisen jlkeen,
mittaa maadoitusvastus visuaalisella
havaitsemisella ja maadoitusvastuksen Manuaalinen ohjauspainike
testaustykalulla.
2. Shkn tiiviystesti (suoritus
testauskytn aikana) 4.4 Pumppu valmis
s Testikytn aikana asennuksen
Uudelleen sijoitettaessa tai
pttmisen jlkeen, huoltohenkil
ilmanvaihtolaitetta hvitettess, pumppaa
voi kytt shkist anturia
jrjestelm tyhjksi noudattaen alla
monimittalaitetta suorittaakseen
olevaa toimenpidett niin ett yhtn
shkn tiiviystestin. Kytke yksikk pois
jhdytysainetta ei vapaudu ilmakehn.
plt vlittmsti, mikli tapahtuu
jhdytysaineen vuotoa. Tarkista ja hae s Yhdist putkistoventtiilin letku
ratkaisun mallinnukset kunnes yksikk pysytysventtiilin latausporttiin
toimii oikein. ulkotilayksikn kaasuputken sivulla.
SUOMI 121

s Sulje pysytysventtiili kaasuputken 4.5 Tarkistus asennuksen jlkeen


sivulla melkein tysin.
Tarkistettavat kohdat Mahdollinen hiritilanne
s Sulje pysytysventtiili tysin
nesteputken sivulla. Onko yksikk tukevasti Yksikk voi pudota, trist
kiinnitetty? tai tuottaa nt.
s Kytke yksikk plle COOL-tilassa.
Oletko suorittanut Se voi aiheuttaa
s Sulje pysytysventtiili tysin jhdytysnesteen riittmttmn jhtymisen
kaasuputken sivulla kun painemittari vuototestin? (lmmityksen).
osoittaa 1 - 0,5 kgf/cm2 (100 ~ 50 Onko lmperistys riittv? Se voi aiheuttaa lauhtumista.
kPa).
Onko veden tyhjennys Se voi aiheuttaa veden
s Pysyt testikytn toiminto kytkemll tyydyttv? vuotoa.
yksikk pois plt sek kaikki Vastaako jnnite Voi aiheuttaa shkvian tai
jhdytysnesteen kaasu on kertty tyyppikilpeen merkitty vahingoittaa yksikk.
ulkotilakytn yksikkn. nimellisjnnitett?

Onko shkjohdotus tai Se voi aihetta shkvian tai


putkitusliitnt asennettu vahingoittaa osia.
oikein ja varmasti?

Onko yksikk maadoitettu Se voi aiheuttaa


varmasti? shkvuodon.

Onko shkjohto mritetty? Se voi aihetta shkvian tai


vahingoittaa osia.

Onko sisn- tai ulostulo Se saattaa aiheuttaa


tukossa? riittmtnt jhdytyst
(kuumenemista)

Onko liitntputkien Jhdytysnesteen


pituus jhdytysnesteen kapasiteetti ei ole oikein.
kapasiteetti kirjattu?
www.electrolux.com 122


.1 123..................................................................................................................
.2 125..........................................................................................................
.3 128.....................................................................................................................
.4 144.................................................................................................................


. .
. .

.
:

:
www.electrolux.com

:
www.electrolux.com/productregistration

:
www.electrolux.com/shop


. .
. PNC
/

.
.
123

.1

.
.
. .
.
.
1.1
.
.
!
. .


.
8
.


.
.
.
.

. .


. 1.2
.
!
.
. .
.
. .

. .

.


.
1 . .


. .
.

.
. .
.




. . .
.
.
. .



. .
. .
.
www.electrolux.com 124



.
. .
.R410A
.


www.electrolux.nl www.electrolux.al

www.electrolux.no www.electrolux.at

www.electrolux.pl www.electrolux.be

www.electrolux.pt www.electrolux.bg

www.electrolux.ro www.electrolux.hr

www.electrolux.rs www.electrolux.cz

www.electrolux.sk www.electrolux.dk

www.electrolux.sl www.electrolux.fi

www.electrolux.es www.electrolux.fr

www.electrolux.se www.electrolux.de

www.electrolux.ch www.electrolux.gr

www.electrolux.com.tr www.electrolux.hu

www.electrolux.co.uk www.electrolux.it

www.electrolux.lu

www.electrolux.com
125

.2

.

. .

2.1
.10 .1
.11 .2
.12 .3
.13 .4 ) 55/ 70(
.14 )( .5
.15 .6
.16 .7 ) (
.17 .8
.9 ) 4(

2.2

1 1
2
5-8 A ST3.9X25 3
1 4
1 )( 5
2 ) ST2.9X10( 6
2 ) AAA 1.5( 7
8
)( 9
10
11
12
13
1 ) ( 14
3 ) ( )( 15
1 16
1 ) ( )( 17
1 ) ( )( 18

: /
.
www.electrolux.com 126

2.3

1 3 2

15




 

15
15

8
3

9
10

4
11

6

50

18


30
17
30

2 50
16



12
15

14
13



.

. .
127

2.4
.
:
10. -
25. -
-
. -
. ) (
- )
(
. - )
. (
) (RCD - .
.

3
. .
. .


. .


.
.

. .
230
1.5 . .

.

. .
1
.

.
).(I .
.

.
.
. .
. .
.
.

.
.

.
.
.
www.electrolux.com 128

.3

3.1

3.1.1

150
150 150


55 55


9000
/

150
150 150


55 55



12000 /

150

150 150


55 55



18000 /
129

150
150 150


70 70



24000 /

150

150 150


70 70



28000 /
www.electrolux.com 130

.2
3.1.2
3
43 . .1
.
.1
3
.2

5 .
)( )(

.
.3
).(A
.4
.
1

:
43mm




)
(.

3.1.3
3.1.5
.1
.1
.


.
.5
.2
5 .
2



.
5-7mm

.2


.
3.1.4
.1
.

.
131

.2 3.1.6

.1 .
. .2
8

.
6








:
.

.
.3

. .
7
.

.
.

.

3.2
3.2.1

.1
. .4
.
. .2 .
.3
. 3.1.7
.4

.1



. .
www.electrolux.com 132

.3 . .5
.
. 10
.4
3.
12


16
) (
:
.
3.3
10 )
: (.
7.5.
11
.

.

.

3.2.2 )
(
.1
.
.2


.
133

.3 3.3.1

/
) . .
(.
15 :
.1 .


.
.


.
1.5
.4 .
13
.

16
A


.2


/.
/

.

14
.

1

)( A
)(
)6.35 (1/4 1.3 0.7
)9.52 (3/8 1.6 1.0
)12.70 (1/2 1.8 1.0
)15.88 (5/8 2.4 2.2
www.electrolux.com 134

19 3.4


3.4.1
.1 :


.
. 17
20




.
. 18
21

)(


)(

22


)( :

2

)( )( ) (

)6.35 (1/4 )15.7 (1.6kg.m) 19.6 (2.0kg.m
. )9.52 (3/8 )29.4 (3.0kg.m) 34.3 (3.5kg.m
23 )12.70 (1/2 )49.0 (5.0kg.m) 53.9 (5.5kg.m
)15.88 (5/8 )73.6 (7.5kg.m) 78.6 (8.0kg.m

.2

:
)(

.
.
)(
135

26 .3 :
.

)
(.

.
24



.2
.
27




)
(.

25




:

3

)( )( ) (
)6.35 (1/4 )15.7 (1.6kg.m) 19.6 (2.0kg.m

)9.52 (3/8 )29.4 (3.0kg.m) 34.3 (3.5kg.m
)12.70 (1/2 )49.0 (5.0kg.m) 53.9 (5.5kg.m
)15.88 (5/8 )73.6 (7.5kg.m) 78.6 (8.0kg.m

3.4.2
.1
.
www.electrolux.com 136

29 3.4.3
.1

.
.

.
.
.2
:

.

.
28



.

3.4.4

.1 .


.
30



.3
:
.2 .
.
.

.
.
137

32 31

:
33





50

.3


.
www.electrolux.com 138

.2 3.5

.
.3
3.5.1
.
:
.4

.1
.

.
4

/
)
)(2 )(2
/( )(A )(A
)2500 (9K 220-240V/50Hz 1.0 1.0 3.15 10

)3200 (12K 220-240V/50Hz 1.5 1.5 3.15 16

)4600 (18K 220-240V/50Hz 2.5 2.5 3.15 25

)6700 (24K 220-240V/50Hz 2.5 2.5 3.15 25

)8000 (30K 220-240V/50Hz 4.0 4.0 3.15 32

)9700 (36K 220-240V/50Hz 4.0 4.0 3.15 32

.5

.

.6 .
.7
3.5.3 .
.1 .8
.
.
34
.9

3.5.2

.1
.
.2 .2
) (
.
. .
.3 .3

. .

.4 .4
. .
:
139

39 .5 .
2200 ~ 1300 ) 5K (7K .6 .
.7 .
)N(1 2 4 5 35
2200 ~ 1300 ) 5K(7K

- )N(1 2

40
3600 ~ 2500 ) 9K (12K

36
3600 ~ 2500 ) 9K(12K
-

)N(1 2

41
6800 ~ 4500 ) 18K(24K

37
6600 ~ 5200 ) 18K(24K
-

)N(1 2 3

-

42
11000 ~ 8600 ) 30K(36K

)N(1 2 3 38
11000 ~ 8600 ) 30K(36K
-

)N(1 2 3

-

:

.
www.electrolux.com 140

44
2200 ~ 1300 ) 5K (7K .
.

.
)N(1 2
.
- .

3.5.4
.1
.
45
43
3600 ~ 2500 ) 9K (12K

)N(1 2
-


46

6600 ~ 5200 ) 18K(24K

)N(1 2 3
. .2
- )
(


.

.3
47 ) (U ) .(136
11000 ~ 8700 ) 30K(36K
.4
.
.5
)N(1 2 3 .
.6
-


141

51 48
11000 ~ 8700 ) 30K(36K 2200 ~ 1300 ) 5K (7K

)N(1 2 3 )N(1 2 4 5

-

-


: 49
3600 ~ 2500 ) 9K (12K
:

)N(1 2 3
.
-

.
.
90%
.
50
. 3600 ~ 2500 ) 9K (12K
) (RCD
.
)N(1 2 3
:

-

.

3
)(.
www.electrolux.com 142

3.6.1 3.6
) .1
( :
.
.
. .
)
. (.
.2
. .
.3
. .
5-7 ) .4

(. .
.5
) () .
(


)(A

)(A
)(B
)(B

5 5

5
)/(

)
)( )( )( )(A )( )(B
/(
)2500 (9K )"9.52 (3/8 5 15 10 15 20

)3200 (12K )"9.52 (3/8 5 20 10 15 20


)4600 (18K )"9.52 (3/8 5 20 10 15 20

)6700 (24K )"15.88 (5/8 5 25 10 15 17


)8000 (30K )"15.88 (5/8 5 30 10 15 50
)9700 (36K )"15.88 (5/8 5 30 10 15 50
143

.1 3.6.2


.
).(Schrader valve

: .1 :
. .
.2 .2 :
. .
.
.3
17
.
.
.4 .
52


)

0
(
)
. (

.

.5 15

10-7-3/5
) 10-1( .

. ) (
.6 45
6-7
.

:
.
. .
.7 . .
. 53
.8 .
.9 .

54





-76







3.6.3

.
www.electrolux.com 144

.4

4.3 4.1
.1 .1

. ):
:
. (
.


.
.

55
.
.2
D
ON/OFF
. C

MODE COOL
B
) HEAT ( FAN
. A


16
COOL
.
) Emergency Operation
(
. .2
56 .

4.2

:
.1


.
.2 )
(



.
.


145

4.5 4.4



.
.
)(

.

.
.
.
.COOL

.
0.5 - 1 /2
) 50 ~ 100 (.

.


.
.


.
)(



.

www.electrolux.com/shop