Manual de instrues
Cortina / grade de luz de segurana
Verso 2.0
BR Manual de instrues . . . . . . . . . . .pginas 1 a 12
Original
EN Operating instructions. . . . . . . . . . .pages 13 to 24
Translation of the original operating instructions
Contedo
1 Sobre este documento
1.1 Funo . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1
1.2 A quem dirigido: pessoal tcnico especializado . . . . . . . . . . . . .1
1.3 Smbolos utilizados . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1
1.4 8WLOL]DomRFRUUHWDFRQIRUPHDQDOLGDGH . . . . . . . . . . . . . . . . . . . .2
1.5 Indicaes gerais de segurana . . . . . . . . . . . . . . . . . . . . . . . . . .2 local acessvel.
1.6 Advertncia contra utilizao incorreta . . . . . . . . . . . . . . . . . . . . .2
1.7 Iseno de responsabilidade. . . . . . . . . . . . . . . . . . . . . . . . . . . . .2
2 Descrio do produto
2.1 Descrio e utilizao . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .2
2.2 Cdigo do modelo . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .2
2.3 Verses especiais . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .2
2.4 Includo no fornecimento . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .2
2.5 Dados tcnicos . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .2
2.6 Tempo de resposta (tempo de reao) . . . . . . . . . . . . . . . . . . . . .3
2.7 &HUWLFDomRGHVHJXUDQoD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .3
2.8 Funes. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .4
2.8.1 Modo de proteo / automtico. . . . . . . . . . . . . . . . . . . . . . . . . . .4
2.8.2 Rearme manual. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .4
2.8.3 0RGRGHFRQJXUDomRSDUD5HVHWPDQXDO$WLYDGR . . . . . . . . . . 4
2.9 $XWRWHVWH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .4
3 Montagem
3.1 Condies gerais. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .4
3.2 Campo de proteo e aproximao . . . . . . . . . . . . . . . . . . . . . . .4
3.3 Alinhamento do conjunto. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .5
3.4 0RGRGHFRQJXUDomR. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .5
07.2015 / ACE 574389 / Ausgabe C
3.4.1 Operao de alinhamento com ligao de cabo de 5 polos . . . . . 5
3.4.2 Operao de alinhamento com ligao de cabo de 4 polos . . . . . 5
3.5 Distncia de segurana. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .5
3.5.1 'LVWkQFLDPtQLPDDVXSHUItFLHVUHHWRUDV . . . . . . . . . . . . . . . . . . .6
3.6 Montagem . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .6
SLC440COM
SLG440COM
3.7 Dimenses . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .7
3.7.1 Dimenses emissor e receptor SLC440COM . . . . . . . . . . . . . . . .7
3.7.2 Dimenses emissor e receptor SLG440COM . . . . . . . . . . . . . . . .7
3.8 Fixao . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .8
3.8.1 Includa no fornecimento . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .8
3.8.2 Acessrio opcional . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .8
4 Ligao eltrica
4.1 Diagrama de ligaes SLC/SLG440COM . . . . . . . . . . . . . . . . . . .9
4.2 Exemplo de ligao com mdulos de segurana . . . . . . . . . . . . 10
4.3 Pinagem dos conectores do receptor, emissor & cabos . . . . . . . 10
5 Teste de funcionamento e manuteno
5.1 9HULFDomRDQWHVGDFRORFDomRHPIXQFLRQDPHQWR . . . . . . . . . . 10
5.2 Manuteno. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .10
5.3 9HULFDomRUHJXODU. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11
5.4 Inspeo semestral . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11
5.5 Limpeza. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11
6 Diagnstico
6.1 Informao de estado . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11
6.2 Diagnstico de erros . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11
7 Desmontagem e eliminao
7.1 Desmontagem . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11
7.2 Eliminao. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11
8 Anexo
8.1 Contato . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11
8.2 Declarao de conformidade CE . . . . . . . . . . . . . . . . . . . . . . . .12
1. Sobre este documento
1.1 Funo
O presente manual de instrues fornece as informaes necessrias
para a montagem, a colocao em funcionamento, a operao segura
bem como a desmontagem do dispositivo de segurana. O manual de
instrues deve ser mantido sempre em estado legvel e guardado em
1.2 A quem dirigido: pessoal tcnico especializado
Todos os procedimentos descritos neste manual devem ser
executados apenas por pessoal formado e autorizado pelo utilizador do
equipamento.
Instale e coloque o dispositivo em funcionamento apenas depois
de ter lido e entendido o manual de instrues, bem como de se ter
familiarizado com as normas de segurana no trabalho e preveno de
acidentes.
A seleo e montagem dos dispositivos, bem como a sua integrao na
tcnica de comando, so vinculados a um conhecimento qualificado da
legislao pertinente e requisitos normativos do fabricante da mquina.
1.3 Smbolos utilizados
Informao, dica, nota:
Este smbolo identifica informaes teis adicionais.
Cuidado: A no observao deste aviso de advertncia
pode causar avarias ou funcionamento incorreto.
Advertncia: A no observao deste aviso de advertncia
pode causar danos pessoais e/ou danos na mquina.
BR 1
Manual de instrues
Cortina / grade de luz de segurana
1.4 Utilizao correta conforme a finalidade
Os produtos aqui descritos foram desenvolvidos para assumir funes
voltadas para a segurana, como parte integrante de um equipamento
completo ou mquina. Est na responsabilidade do fabricante do
equipamento ou mquina assegurar o funcionamento correto do
equipamento completo.
O dispositivo interruptor pode ser utilizado exclusivamente conforme
as consideraes a seguir ou para as finalidades homologadas pelo
fabricante. Informaes detalhadas sobre a rea de aplicao podem ser
consultadas no captulo "Descrio do produto".
1.5 Indicaes gerais de segurana
Devem ser observadas as indicaes de segurana do manual de
instrues bem como as normas nacionais especficas de instalao,
segurana e preveno de acidentes.
Outras informaes tcnicas podem ser consultadas nos
catlogos da Schmersal ou nos catlogos online na Internet
em www.schmersal.net.
Todas as informaes so fornecidas sem garantia. Reservado o direito
de alteraes conforme o desenvolvimento tecnolgico.
SLC440COM
SLG440COM
A avaliao e o dimensionamento do sistema de segurana
devem ser efetuados pelo utilizador em conformidade com as
normas e regulamentos relevantes, de acordo com o nvel de
segurana requerido.
2.2 Cdigo do modelo
Este manual de instrues vlido para os seguintes modelos:
SLC440COM-ER--
N Opo Descrio
xxxx Altura do campo de proteo em mm, comprimentos
disponveis: 0330, 0410, 0490, 0570, 0650, 0730,
0810, 0890, 0970, 1050, 1130, 1210, 1290, 1370,
1450, 1530*, 1610*, 1690*, 1770*, 1850*, 1930*
14 Resoluo 14 mm com faixa de alcance de 0,3 m ... 7 m
30 Resoluo 30 mm com faixa de alcance de 0,3 m ... 10 m
35 Resoluo 35 mm com faixa de alcance de 0,3 m ... 7 m
* Resoluo 14 mm: Altura do campo de proteo 1530 at 1930 mm
com faixa de alcance de 0,3 m 6 m
* Resoluo 35 mm: Altura do campo de proteo 1850 e 1930 mm
com faixa de alcance de 0,3 m 6 m

O conceito global do comando, no qual o componente de SLG440COM-ER-

segurana ser integrado, deve ser validado segundo a N Opo Descrio
QRUPD(1,62
Distncia dos feixes externos:
2EVHUYDQGRVHDVLQGLFDo}HVGHVHJXUDQoDEHPFRPRDVLQVWUXo}HV  500 mm, 2 feixes
de montagem, colocao em funcionamento, operao e manuteno,  800 mm, 3 feixes
no so conhecidos riscos residuais.  900 mm, 4 feixes
Faixa de alcance 0,3 12 m
Podem ser necessrias medidas adicionais para assegurar que
o sistema no falhe, originando perigos, caso outras formas de 2.3 Verses especiais
radiao luminosa estejam presentes numa aplicao especial (ex: Para as verses especiais que no esto listadas no cdigo de modelo,
unidades de comando sem fios em gruas de solda ou efeitos de luzes DVHVSHFLILFDo}HVDQWHULRUHVHVHJXLQWHVDSOLFDPVHGHIRUPDDQiORJD
estroboscpicas). desde que sejam coincidentes com a verso de srie.

1.6 Advertncia contra utilizao incorreta 2.4 Includo no fornecimento

6HQVRUHV(5UHFHSWRUFRPOX]GHHVWDGRLQWHJUDGD
A utilizao tecnicamente incorreta ou quaisquer manipu .LWGHPRQWDJHP06
laes no dispositivo de segurana podem ocasionar a 0DQXDOGHLQVWUXo}HV'((1
ocorrncia de perigos para pessoas e danos em partes da 'LVWDQFLDGRU06'DSDUWLUGHXPDDOWXUDGR
mquina ou equipamento. Por favor observar tambm as campo de proteo de 1050 mm
respectivas indicaes relacionadas nas normas EN 13855 &
EN ISO 13857. 2.5 Dados tcnicos
Instrues: (1(1(1,62(1
Material do invlucro: Alumnio
Apenas com a execuo correta das modificaes descritas Alturas do campo de proteo:
neste manual de instrues est assegurada a funo de 6/&&20 330 1930 mm
VHJXUDQoDHSRUWDQWRpPDQWLGDDFRQIRUPLGDGHUHODWLYD 6/*&20 500 mm, 800 mm, 900 mm
mente Diretiva de Mquinas. Capacidade de deteco de corpos de prova:
6/&&20 PPPPPP
1.7 Iseno de responsabilidade 6/*&20 2 feixes com resoluo 500 mm 1)
No nos responsabilizamos por falhas operacionais ocasionadas 3 feixes com resoluo 400 mm 1)
por erros de montagem ou pela no observao deste manual de 4 feixes com resoluo 300 mm 1)
instrues. Tambm no assumida qualquer responsabilidade Faixa do campo de proteo:
adicional por danos causados pela utilizao de peas sobressalentes 6/&&20
ou acessrios no homologados pelo fabricante. 5HVROXomRPP Altura do campo de proteo
330 at 1450 mm: 0,3 7,0 m
Por motivo de segurana no so permitidos quaisquer reparos, Altura do campo de proteo
alteraes ou modificaes efetuadas por conta prpria, nestes casos 1530 at 1930 mm: 0,3 6,0 m
o fabricante se exime da responsabilidade pelos danos resultantes. 5HVROXomRPP Altura do campo de proteo
330 at 1450 mm: 0,3 7,0 m
Altura do campo de proteo
2. Descrio do produto 1850 e 1930 mm: 0,3 6,0 m
5HVROXomRPP 0,3 10,0 m
2.1 Descrio e utilizao 6/*&20 0,3 12,0 m
A SLC/SLG 440COM um dispositivo de segurana de atuao sem Tempo de reao: IHL[HV PV
FRQWDWRItVLFRHFRPDXWRWHVWHXWLOL]DGDSDUDDSURWHomRGHSRQWRVGH IHL[HV PV
perigo, zonas de perigo e acessos de mquinas. A interrupo de um ou IHL[HV PV
mais feixes deve provocar a parada do movimento gerador de perigo. Tenso de operao: 24 VDC 10% (PELV) fonte de alimentao,
Imx.$FRQIRUPH(1IDOKDGHUHGHPV

2 BR
Manual de instrues SLC440COM
Cortina / grade de luz de segurana SLG440COM
Corrente de operao: 200 mA mx. + 2 x 0,25 A cada OSSD SLC440COM Resoluo 30 mm
Comprimento de onda da radiao IR: 880 nm
Altura do campo Feixes Tempo de Peso
Emissor, radiao Infravermelha emitida de proteo [mm] [Nmero] reao [ms] [kg]
VHJXQGR',1(1 categoria 0
330 16 10 0,5
VHJXQGR',1(1 grupo livre
Sadas de segurana 410 20 10 0,7
OSSD1, OSSD2: [VDtGDV313jSURYDGHFXUWRFLUFXLWR 490 24 10 0,8
Ciclo de pulso de teste OSSD: 750 ms 570 28 10 0,9
Comprimento do pulso de teste: 150 s 650 32 10 1,0
Tenso de comutao HIGH 2): 15 26,4 V 730 36 10 1,1
Tenso de comutao LOW 2): 0 2 V 810 40 10 1,3
Corrente de comutao em cada sada OSSD: 0 250 mA
890 44 10 1,4
Corrente de fuga 3): 1 mA
970 48 10 1,5
Capacitncia de carga: 0 50 nF
Indutncia de carga 4): 0 2H 1050 52 20 1,6
Funo: Modo de proteo / automtica, 1130 56 20 1,7
Reset manual, Modo de configurao 1210 60 20 1,9
Indicador de estado do receptor: Tampa com sinalizador de status 1290 64 20 2,0
integrado: OSSD LIG (verde), OSSD DESLIG. (vermelho), 1370 68 20 2,1
Qualidade de alinhamento/funcionamento de rearme (amarelo)
1450 72 20 2,2
Ligao:
1530 76 20 2,3
7UDQVPLVVRU Cabo M12, 4 polos,
5HFHSWRU Cabo M12, 4 polos, 5 polos 1610 80 20 2,5
Temperatura de operao: && 1690 84 20 2,6
Temperatura de armazenagem: && 1770 88 20 2,7
Grau de proteo: IP67 (IEC 60529) 1850 92 20 2,8
Resistncia a vibraes: +]VHJXQGR,(& 1930 96 20 2,9
Resistncia a impactos: JPVFRQIRUPH,(&
Ano de fabricao: a partir de 2014 verso 2.0 SLC440COM Resoluo 35 mm
1)
5HVROXomR GLVWkQFLDGRIHL[HGLkPHWURGRIHL[HPP Altura do campo Feixes Tempo de Peso
2)
FRQIRUPH,(&
de proteo [mm] [Nmero] reao [ms] [kg]
3)
Em caso de erro, flui no mximo a corrente de fuga na sada OSSD. 330 11 10 0,5
O elemento de comando subsequente deve identificar este estado 410 14 10 0,7
como LOW. Um CLP de segurana deve identificar este estado. 490 16 10 0,8
4)
Indutncia de carga quando o desligamento gera uma tenso induzida que 570 19 10 0,9
prejudica elementos construtivos subsequentes (elemento supressor de fasca).
650 22 10 1,0
730 25 10 1,1
2.6 Tempo de resposta (tempo de reao)
O tempo de resposta depende da altura do campo de proteo, da 810 27 10 1,3
resoluo e do nmero de feixes. 890 30 10 1,4
970 33 10 1,5
SLC440COM Resoluo 14 mm 1050 36 10 1,6
Altura do campo Feixes Tempo de Peso 1130 38 10 1,7
de proteo [mm] [Nmero] reao [ms] [kg] 1210 41 10 1,9
330 32 10 0,5 1290 44 10 2,0
410 40 10 0,7 1370 47 10 2,1
490 48 10 0,8 1450 49 20 2,2
570 56 20 0,9 1530 52 20 2,3
650 64 20 1,0 1610 55 20 2,5
730 72 20 1,1 1690 58 20 2,6
810 80 20 1,3 1770 60 20 2,7
890 88 20 1,4 1850 63 20 2,8
970 96 20 1,5 1930 66 20 2,9
1050 104 20 1,6
1130 112 20 1,7 SLG440COM
1210 120 20 1,9 Feixes Distncia do Tempo de Peso
1290 128 20 2,0 [Nmero] feixe [mm] reao [ms] [kg]
1370 136 20 2,1 2 500 10 0,8
1450 144 20 2,2 3 400 10 1,3
1530 152 28 2,3 4 300 10 1,4
1610 160 28 2,5
1690 168 28 2,6 2.7 Certificao de segurana
1770 176 28 2,7 Normas: (1,62(1
1850 184 28 2,8 PL: at e
1930 192 28 2,9 Categoria: at 4
Valor PFH: 8,05 x 10 / h
SIL: at 3
Vida til: 20 anos

BR 3
Manual de instrues SLC440COM
Cortina / grade de luz de segurana SLG440COM
2.8 Funes 3. Montagem
O sistema formado por emissor e receptor. No so necessrios
outros elementos de comutao para as funes descritas. 3.1 Condies gerais
Os regulamentos a seguir servem como indicaes preventivas de alerta,
O sistema oferece os seguintes modos de operao: com o objetivo de assegurar um manuseio tecnicamente correto. Estes
2SHUDomRSURWHJLGDDXWRPiWLFDHVWDGRGHIRUQHFLPHQWR
(inicializao automtica aps habilitao do campo de proteo)
5HVHWPDQXDO
0RGRGHFRQILJXUDomR
2.8.1 Modo de proteo / automtico
O modo protegido comuta as sidas OSSD para o estado ON (o campo
de proteo no interrompido), sem liberao externa de um dispositivo
interruptor.
Este modo de operao pode ser selecionado apenas em
combinao com o rearme manual da mquina.
2.8.2 Rearme manual
O rearme manual impede uma libertao automtica das sadas
(OSSD em estado LIGA) aps a ligao da tenso operacional
ou depois de uma interrupo do campo de proteo. O sistema
s comuta as sadas para o estado LIGA quando uma unidade de
comando externa (botao de reset) gera um sinal de liberao na
entrada do rearme ( receptor) .
2.8.3 Modo de configurao para Reset manual - Ativado
No estado de formecimento (ajuste de fbrica), o modo de
funcionamento operao protegida / automtica est ativo. Para o
modo de funcionamento rearme manual necessrio cabo de ligao
de 5 pinos no recetor.
0RGRGHFRQILJXUDomRSDUD5HVHWPDQXDO$WLYDGR O campo de proteo da SLC/SLG formado por toda a rea entre
5HPRYDDDOLPHQWDomRGRVLVWHPD
regulamentos so parte integrante essencial das medidas de segurana e
por isso devem sempre ser observados.
$6/&6/*QmRSRGHVHUXWLOL]DGDHPPiTXLQDVTXHQmR
podem ser paralisadas eletricamente em caso de emergncia
(mquinas com inrcia).
$GLVWkQFLDGHVHJXUDQoDHQWUHD6/&6/*HXPPRYLPHQWR
perigoso da mquina deve ser sempre cumprida.
'LVSRVLWLYRVGHSURWHomRPHFkQLFRVDGLFLRQDLVGHYHPVHU
instalados de tal modo que, para adentrar s partes perigosas
da mquina, seja preciso atravessar o campo de proteo.
$6/&6/*GHYHVHULQVWDODGDGHWDOPRGRTXHRSHVVRDO
quando a mquina estiver em operao, esteja sempre dentro
da zona de deteco do dispositivo de segurana. Instalaes
incorretas podem causar ferimentos graves.
1XQFDFRQHFWDUDPEDVDVVDtGDVFRP9'&&DVRDV
sadas sejam ligadas em +24 VDC, elas se mantm em
funcionamento normal e no podem parar uma situao
perigosa na aplicao / mquina.
$VLQVSHo}HVGHVHJXUDQoDGHYHPVHUUHDOL]DGDVUHJXODUPHQWH
$6/&6/*QmRSRGHVHUH[SRVWDDJDVHVLQIODPiYHLVRXH[SORVLYRV
2VFDERVGHOLJDomRGHYHPVHUOLJDGRVFRQIRUPHDVLQVWUXo}HV
de instalao.
2VSDUDIXVRVGHIL[DomRGRVWDPS}HVHGDVFDQWRQHLUDVGH
fixao devem ser apertados firmemente.
3.2 Campo de proteo e aproximao
as marcaes de campo de proteo do emissor e do receptor.
)DoDXP-XPSHUHQWUH266'H266'3LQRVH Dispositivos de proteo adicionais devem assegurar que para adentrar
$ROLJDUR$23'9jHQWUDGDGHUHDUPHSLQR
por exemplo, ao acionar e manter acionado o boto de liberao
$FRUWLQDGHOX]PRVWUDRPRGRGHRSHUDomRDWXDODWUDYpVGRQ~PHUR
de pulsos no LED de estado integrado:
Modo de operao automtico LQGLFDomRFtFOLFDGHXPSXOVRD
cada intervalo de tempo (vermelho)
Modo de operao manual LQGLFDomRFtFOLFDGHGRLVSXOVRVDFDGD
intervalo de tempo (vermelho)
s partes perigosas da mquina preciso atravessar o campo de
proteo. A SLC/SLG deve ser instalada de tal modo que o pessoal,
quando da operao de partes perigosas da mquina a ser protegida,
esteja sempre dentro da zona de deteco do dispositivo de segurana.
Instalao correta
As partes perigosas da mquina podem ser
alcanadas apenas atravessando o campo de
$RSUHVVLRQDUEUHYHPHQWHRERWmRPVWPVSRGHVHU proteo.
alterado o modo de operao. O nmero dos pulsos de luz indicados
(vermelho) apresenta o modo de operao selecionado.
$RPDQWHURERWmRGHUHDUPHSUHVVLRQDGRpPHPRUL]DGRRPRGR
de operao atualmente selecionado. O processo de memorizao
confirmado atravs de impulsos de alta frequncia da lmpada de
O pessoal no pode permanecer entre o campo
sinalizao. O boto de rearme deve ser mantido pressionado at
que a cortina se encontre novamente no modo da seleo do modo de proteo e as partes perigosas da mquina
de operao (perodo mnimo de trs segundos) (intermitncia do (proteo contra acesso por trs).
PRGRGHRSHUDomR(PVHJXLGDGHYHVHUHPRYHUDDOLPHQWDomRGD
cortina de luz, e deve ser removida a ponte entre OSSD1 e OSSD2 e
a cortina de luz deve ser reiniciada (aplicar tenso de operao).

A unidade de comando (boto de liberao) deve ser dispos

to fora da zona de perigo. A zona de perigo deve estar visvel Instalao inadmissvel
para o operador quando o boto de liberao pressionado. As partes perigosas da mquina podem ser
alcanadas sem ter que atravessar o campo de
proteo.
2.9 Auto-teste
Depois de se ligar a tenso operacional, dentro de 2 segundos o
sistema executa um autoteste e teste de segurana completo. Se o
campo de proteo no estiver interrompido, o sistema comuta para
o estado ligado (modo automtico). Em caso de erro, as sadas no
O pessoal pode permanecer entre o campo de
recetor no comutam para o estado ligado.
proteo e as partes perigosas da mquina.
8PDXWRWHVWHpH[HFXWDGRFLFOLFDPHQWHGXUDQWHDRSHUDomR(UURV
relevantes para a segurana so identificados durante o tempo de
reao e causam o desligamento das sadas.

4 BR
Manual de instrues SLC440COM
Cortina / grade de luz de segurana SLG440COM
3.3 Alinhamento do conjunto (2) S = 1600 mm/s * T + 8 (d - 14) [mm]
Procedimento:
1. As unidades emissora e receptora devem ser montadas uma Se o novo valor S > 500 mm, ento utilize este valor como distncia de
paralelamente outra, na mesma altura de fixao. segurana.
2. Selecionar o modo de operao automtico (ver captulo Modo de 6HRQRYRYDORU6PPHQWmRXWLOL]HPPFRPRGLVWkQFLDGH
proteo / automtico) e ligar a tenso de alimentao. segurana.
3. Primeiro rotacione o transmissor e em seguida o receptor, at que o
sinalizador de status acenda verde. Alinhe o transmissor e o receptor Exemplo:
de forma a que estes se situem no centro da faixa do ngulo para a 7HPSRGHUHDomRGDFRUWLQDGHOX]GHVHJXUDQoD PV
indicao verde. Fixe a posio com ambos os parafusos no correto 5HVROXomRGDFRUWLQDGHOX]GHVHJXUDQoD PP
ngulo de fixao. 7HPSRGHLQpUFLDGDPiTXLQD PV

3.4 Modo de configurao S = 2000 mm/s * (330 ms + 10 ms) + 8(14 mm - 14 mm)

S = 680 mm
3.4.1 Operao de alinhamento com ligao de cabo de 5 polos S = > 500 mm, por isso feito um novo clculo com V = 1600 mm/s
Se ao iniciar o sistema na entrada (pino 5, recetor ) "permisso de S = 544 mm
rearme" existir, pelo menos, durante 2 segundos com +24 V (por
exemplo, acionando o boto de rearme), o sistema entra no modo de Distncia de segurana at ao ponto de perigo
operao de alinhamento.
Neste modo de operao a fora do sinal do raio sinalizada com o S

valor mais reduzido atravs dos pulsos de luz de estado (cor amarela). Distncia de
segurana (S) Limite do ponto de perigo
Quanto melhor for o alinhamento, mais alta a frequncia dos pulsos
de luz. O alinhamento est correto quando os leds de estado passam a
ficar acesos permanentemente. Parte superior da ferramenta
Se no existir uma sincronizao ptica entre o transmissor e o
receptor, a cada trs segundos emitido um impulso de luz. O modo de Sinal de paralisao
alinhamento terminado por um arranque do sistema (+UB LIG/DESL). tA do movimento perigoso

Marcao do campo tB Movimento

3.4.2 Operao de alinhamento com ligao de cabo de 4 polos de proteo perigoso parado
tn WBWA
1) Ligao no receptor, conectar pino 1 (24V DC) com pino 2 (OSSD 1)
2) Retirar a tenso de alimentao no receptor
3) Luz de estado sinaliza (amarela):
Parte inferior
$OLQKDPHQWRQmRH[LVWHQWHXPSXOVRGHOX]QXPLQWHUYDORGHVHJ da ferramenta
$OLQKDPHQWRH[LVWHQWHSXOVRVGHOX]FRPIUHTXrQFLDHOHYDGD
$OLQKDPHQWRLGHDO/('DPDUHOROLJDGRFRQWLQXDPHQWH
4) Retirar a tenso de alimentao no receptor
5) Remover ligao entre pino 1 e pino 2
6) Aplicar tenso de alimentao no receptor
(operao de alinhamento desativada)
PP GLVWkQFLDPi[GDSURWHomRFRQWUDDFHVVRSRUWUiV
Esta medida deve ser obrigatoriamente cumprida para se evitar o
3.5 Distncia de segurana acesso por trs do campo de proteo.
A distncia de segurana a distncia mnima entre o campo de
proteo da cortina de luz de segurana e a zona de perigo. A distncia
de segurana deve ser cumprida para assegurar que a zona de perigo Clculo da distncia de segurana para a grade de luz de feixe
no possa ser alcanada antes da paralisao do movimento gerador mltiplo SLG440COM
de perigo.
S = (1600 mm/s * T) + 850mm
Determinao da distncia de segurana conforme EN ISO 13855
e EN ISO 13857 6 'LVWkQFLDGHVHJXUDQoD>PP@
A distncia de segurana depende dos seguintes fatores: 7 7HPSRGHUHDomRWRWDOWHPSRGHSDUDGDSRULQpUFLDGDPiTXLQD
7HPSRGHSDUDGDSRULQpUFLDGDPiTXLQDGHWHUPLQDomRDWUDYpVGH tempo de reao do dispositivo de segurana, dos rels, etc.)
medio do tempo de parada por inrcia) . YHORFLGDGHGHDSUR[LPDomRPPV
7HPSRGHUHDomRGDPiTXLQDGDFRUWLQDGHOX]GHVHJXUDQoDHDYDOLDomR & DFUpVFLPRGHVHJXUDQoDPP
de segurana subsequente (sistema de segurana completo)
9HORFLGDGHGHDSUR[LPDomR Exemplo
&DSDFLGDGHGHUHVROXomRGDFRUWLQDGHOX]GHVHJXUDQoD 7HPSRGHUHDomRGD6/*&20 PV
7HPSRGHSDUDGDSRULQpUFLDGDPiTXLQD PV
Cortina de Luz de Segurana SLC440COM
A distncia de segurana para a resoluo 14 mm at 40 mm S = 1600 mm/s * (170 ms + 10 ms) + 850 mm
determinada conforme a seguinte frmula: S = 1138 mm

(1) S = 2000 mm/s * T + 8 (d - 14) [mm] Aqui devem ser observadas as seguintes alturas de montagem:

6 'LVWkQFLDGHVHJXUDQoD>PP@ Nmero de Altura de montagem acima do plano

7 7HPSRGHUHVSRVWDWRWDOWHPSRGHLQpUFLDGDPiTXLQDWHPSRGH feixes de referncia (piso) em mm
reao do dispositivo de segurana, dos rels, etc.) 2 400, 900
G UHVROXomRGDFRUWLQDGHOX]GHVHJXUDQoD 3 300, 700, 1100
4 300, 600, 900, 1200
A velocidade de aproximao est includa com um valor de 2000
PPV6HDSyVDGHWHUPLQDomRGDGLVWkQFLDGHVHJXUDQoDRYDORU6
500 mm, ento utilize este valor.

6HRYDORU6PPHQWmRGHWHUPLQHHVWHYDORUQRYDPHQWH

BR 5
Manual de instrues SLC440COM
Cortina / grade de luz de segurana SLG440COM
Distncia de segurana at ao ponto de perigo Distncia de segurana a
a [mm]
1000
Emissor 900
800
Direo de acesso
700
600
zona de perigo 500
S
400
Ponto de perigo 300
200
100 D [m]
0 3 5 10 15 20
Receptor
Unidade de Calcule a distncia mnima em relao a superfcies refletoras em
comando
Liberao
IXQomRGRkQJXORGHDEHUWXUDGHJUDXVRXFRQVXOWHRYDORUQD
tabela abaixo:
Proteo mecnica
Distncia entre emissor e receptor Distncia mnima a
$VIyUPXODVHH[HPSORVGHFiOFXORUHIHUHPVHjGLVSRVLomRYHUWLFDOYHU [m] [mm]
desenho) da grade de luz em relao ao ponto de perigo. Observe as 0,2 3,0 130
normas harmonizadas EN em vigor e as normas nacionais, se for o caso. 4 175
5 220
A distncia de segurana entre a cortina de luz de segurana/ 7 310
grade de luz e o ponto perigoso deve ser sempre cumprida.
10 440
Podem ocorrer ferimentos graves se uma pessoa alcanar o
ponto perigoso antes de o movimento perigoso ser paralisado. 12 530

Frmula: a = tan 2,5 x L [mm]

Para o clculo das distncias mnimas dos dispositivos
de proteo, em relao ao ponto de perigo, devem ser
observadas as normas EN ISO 13855 e EN ISO 13857.
Se uma interveno no campo de proteo for possvel,
observar a determinao da distncia de segurana quanto
ao acrscimo CRO segundo a tabela A1 conforme a norma
EN ISO 13855.
D GLVWkQFLDPtQLPDDVXSHUItFLHVUHIOHWRUDV
/ GLVWkQFLDHQWUHHPLVVRUHUHFHSWRU
3.6 Montagem
A SLC/SLG440COM tem de ser montada de forma a que seja excluda
uma influncia atravs da cortina ptica de segurana/grade de luz do
mesmo tipo (SLC/SLG440COM) nos aparelhos vizinhos.

3.5.1 Distncia mnima a superfcies refletoras Se duas ou mais aplicaes estiverem colocadas para permitirem uma
Na instalao devem ser considerados os efeitos de superfcies influncia oposta, esta deve ser ligada a uma parede separadora.
refletoras. Uma instalao incorreta pode causar a no deteco de
interrupes do campo de proteo e portanto pode levar a ferimentos
graves. Por isso, observe obrigatoriamente as distncias de segurana
listadas a seguir em relao a superfcies refletoras (paredes, pisos,
tetos ou peas metlicas).

Direo de acesso

Emissor Receptor
Obstculo

Mquina A Mquina B
Eixo ptico

8 
8
D PP
a= 262 mm

Corpo refletor
(p.ex. depsito
Limite do ponto de material)
de perigo

Mquina A Mquina B

A influncia mtua do conjunto deve ser evitada com uma

montagem correta. Se isto no for garantido, entre em
contato com o comerciante.

6 BR
Manual de instrues SLC440COM
Cortina / grade de luz de segurana SLG440COM
3.7 Dimenses 3.7.2 Dimenses emissor e receptor SLG440COM
Todas as medidas em mm.
3.7.1 Dimenses emissor e receptor SLC440COM
Todas as medidas em mm.

L2
75
75 7,7
7,7

42,5
27,8
27,8 33

A
B
C
33
A
B
C

41,5
22,2

24
22,2

24

L1

Tipo A B C Tipo A B C L1 L2
Altura do Medida de Compri- Distn- Medi- Compri-
campo de fixao mento cia do da de mento
proteo total feixe fixao total
1 1 1 6/*&20(5 500 584 603 358,5 357,5
6/&&20(5;; 330 384 403 6/*&20(5 400 884 903 258,5 257,5
6/&&20(5;; 410 464 483 6/*&20(5 300 984 1003 258,5 257,5
6/&&20(5;; 490 544 563
6/&&20(5;; 570 624 643 / 'LVWkQFLDGHPRQWDJHPPPHQWUHRSLVRHRFHQWURGRIXUR
6/&&20(5;; 650 704 723 oblongo (tampo curto)
/ 'LVWkQFLDGHPRQWDJHPPPHQWUHRSLVRHRFHQWURGRIXUR
6/&&20(5;; 730 784 803
oblongo (cabo conector)
6/&&20(5;; 810 864 883
6/&&20(5;; 890 944 963 O comprimento total Ls (medida da tampa at o conector M12) dos
6/&&20(5;; 970 1024 1043 sensores determinada atravs da seguinte forma:
6/&&20(5;; 1050 1104 1123
6/&&20(5;; 1130 1184 1203 /V PHGLGD%PP
6/&&20(5;; 1210 1264 1283
6/&&20(5;; 1290 1344 1363 ([HPSOR6/&&20(5[[
/V  PP
6/&&20(5;; 1370 1424 1443
6/&&20(5;; 1450 1504 1523
6/&&20(5;; 1530 1584 1603
6/&&20(5;; 1610 1664 1683
6/&&20(5;; 1690 1744 1763
6/&&20(5;; 1770 1824 1843
6/&&20(5;; 1850 1904 1923
6/&&20(5;; 1930 1984 2003

BR 7
Manual de instrues SLC440COM
Cortina / grade de luz de segurana SLG440COM
3.8 Fixao 3.8.2 Acessrio opcional

3.8.1 Includa no fornecimento Suporte central MS-1110 (cd. 164202)

Kit de fixao MS-1100 .LWGHIL[DomRIRUPDGRSRUXQLGFDQWRQHLUDVGHDoRHXQLG

O kit de fixao formado por 4 cantoneiras de ao e espaadores para fixao centralizada.
8 parafusos de fixao (tipo Torx plus 10IP).
4
17
7

11,5
27,8

38
24
11

19,5

11,5
5,5
28 69
54,3
24
38

3
LED de estado integrado
A luz de estado no receptor sinaliza o estado de comutao das sadas

3
27
7
OSSD1 e OSSD2.

&RUYHUGH 6DtGDVDXWRUL]DGDVVLQDO+9 5,5

&RUYHUPHOKD 6DtGDVGHVOLJDGDVVLQDO/9
&RUDPDUHOD %RWmRGHUHDUPHRSHUDomRGHDOLQKDPHQWR
Cabo de ligao para emissor (4 polos)
15 0,1

Cdigo Designao Descrio Compri-
numrico mento
14,5

101207741 &2150 Conector M12, 4 polos 5 m

2,5

339&
101207742 .$ Conector M12, 4 polos 10 m
Distanciador MSD5 (cd. 164203) 101207743 &2150 Conector M12, 4 polos 20 m
O kit formado por 2 distanciadores. Preparao a partir de uma altura
339&
de campo de proteo de 1050 mm. Os distanciadores devem ser
montados em caso de vibrao.
Cabo de ligao para receptor (5 polos)*

Cdigo Designao Descrio Compri-

8

10

Numrico mento
7,7 101209949 &21503 Conector M12, 5 polos 5 m
M4 PVC
101209948 &21503 Conector M12, 5 polos 15 m
PVC

*Na utilizao do modo de operao / reset manual

Basto de teste PLS

O basto de teste serve para a verificao do campo de proteo

MSD4 Atenuador de vibrao (includo no fornecimento)

.LWIRUPDGRSRUXQLGDPRUWHFHGRUHVGHYLEUDomR[PP
33 8 unid. parafusos de cabea cilndrica M5 com sextavado interno, 8
XQLGDQLOKDVHOiVWLFDV0RQWDJHPGHFRUUHFRP06

O kit de amortecedor de vibrao MSD4 deve ser utilizado para o

amortecimento de vibraes no SLC/SLG440COM. Para aplicaes
com cargas mecnicas elevadas, p. ex. prensagem e estampagem,
recomendamos o kit MSD4. Dessa forma, a disponibilidade do
SLC/SLG440 COM aumentada.

8 BR
Manual de instrues SLC440COM
Cortina / grade de luz de segurana SLG440COM
4. Ligao eltrica

4.1 Diagrama de ligaes SLC/SLG440COM

2 4 3 1 5 1 3 2 4
Reset / Restart (CZ)
No ligado (BR)

No ligado (PR)

+24 VDC (MR)

+24 VDC (MR)

OSSD 1 (BR)

OSSD 2 (PR)
0 VDC (AZ)

0 VDC (AZ)

S1
K1 K2

E1

Terra

Modo de proteo / Automtico ativo: .. Rel para o processamento das sadas de comutao
Estado de fornecimento (boto de comando S1 no ligado) OSSD 1,OSSD 2
S1: Boto de habilitao para Restart (opcional)
Reset manual ativo: E1: fonte de alimentao 24 VDC 10%
Ver captulo Ativar modo de operao reset manual
(boto de comando S1 ligado)

BR 9
Manual de instrues SLC440COM
Cortina / grade de luz de segurana SLG440COM
4.2 Exemplo de ligao com mdulos de segurana As designaes de cor so vlidas apenas para os tipos
de cabos mostrados no tpico "Acessrios opcionais"!

J L1 Para produtos listados UL recomendamos cabos com

certificao UL, tipo 20549.
KB
S
KA
5. Teste de funcionamento e manuteno
A1 S12 S11 S21 S22 X1 X2 13 23 33 41
5.1 Verificao antes da colocao em funcionamento
F1 Antes da colocao em funcionamento, a pessoa responsvel deve
Ansteuerlogik/ verificar os itens a seguir.
Logic
K1 KA
Verificao da ligao eltrica antes da colocao em
Ui funcionamento:
K2
K1 K2
KB 1. A tenso de alimentao uma rede de corrente contnua de
24V (ver dados tcnicos)em conformidade com as diretivas CEE,
A2 14 24 34 42 diretivas de baixa tenso. Deve ser transposto um tempo de queda
de rede de 20 ms..
KA KB 2. A tenso de alimentao deve estar presente na SLC/SLG com a
N polaridade correta .
3. O cabo de ligao do emissor est ligado corretamente ao
Legenda Mdulo de segurana emissor, o cabo de ligao do receptor est ligado corretamente ao
)HHGEDFNGRVFRQWDWRUHV.AH.BSDUD;; receptor.
8QLGDGHGHFRPDQGRJERWmRGHUHVHWSDUD;; 4. A dupla isolao entre a sada da cortina ptica de segurana e um
6DtGDV266'
VSDUD6H6 potencial externo est assegurada.
'LSVZLWFK46 Q46GHVDWLYDUPRQLWRUDomRGHFXUWRFLUFXLWR 5. As sadas OSSD1 e OSSD2 no esto ligadas em +24 VDC.
6. Os elementos de comutao (carga) no esto ligados em +24 VDC.
4.3 Pinagem dos conectores do receptor, emissor & cabos 7. Caso duas ou mais SLC/SLG sejam utilizadas num espao
SUy[LPRGHYHVHWHUHPDWHQomRDGLVSRVLomRHQWUHXPDHRXWUDQD
RECEPTOR LQVWDODomR([FOXLVHXPDLQIOXrQFLDP~WXDGRVVLVWHPDV
Conector da SLC
M12, 5 polos Designao Descrio Ligue a SLC/SLG e verifique o funcionamento como segue:
1 MR 24 VDC alimentao Depois de se ligar a tenso de operao, o aparelho executa um teste
4 3 2 BR OSSD 1 Sada de segurana 1 do sistema durante aprox. 2 segundos. Em seguida so liberadas
3 AZ 0 VDC alimentao as sadas (com o campo de proteo no interrompido). As luzes de
estado no receptor acendem a verde.
2 4 PR OSSD 2 Sada de segurana 2
1 5 5 CZ Habilitao/ Confirmao Reset
Em caso de funcionamento incorreto siga as instrues
Reset do captulo Diagnstico de erros.
Conector do Cabo
M12, 5 polos
3 4 5.2 Manuteno

No utilize a SLC/SLG antes da concluso da inspeo

2 subsequente. Inspees incorretas podem ocasionar
5 1 ferimentos graves ou fatais.

Pr-requisitos
Uma operao com um cabo de 4 polos (sem pino 5) Por motivos de segurana todos os resultados de inspeo devem ser
possvel no modo de reset automtico. guardados. O modo de funcionamento do SLC/SLG e da mquina
tm de ser conhecidos para se poder realizar uma inspeo. Caso o
tcnico de montagem, de planeamento e o operador sejam pessoas
EMISSOR GLIHUHQWHVHQWmRFHUWLILTXHVHTXHRXWLOL]DGRUGLVS}HGHLQIRUPDo}HV
Conector da SLC suficientes para poder executar a manuteno.
M12, 4 polos Designao Descrio
1 MR 24 VDC alimentao
4 3 2 BR No utilizado No colocar sinal
(no ligar fiao)
1 2 3 AZ 0 VDC alimentao
4 PR No utilizado No colocar sinal
(no ligar fiao)
Conector do Cabo
M12, 4 polos
3 4

2 1

10 BR
Manual de instrues SLC440COM
Cortina / grade de luz de segurana SLG440COM
5.3 Verificao regular 6.2 Diagnstico de erros
Execute uma verificao visual e funcional em intervalos regulares, A luz de estado est vermelha e emite o nmero de erro a cada
com os seguintes passos: segundo com impulsos breves:
1. O aparelho no apresenta danos visveis.
2. A cobertura da lente ptica no est arranhada nem suja. LED de estado integrado Caracterstica do erro
3. Uma aproximao at s partes de risco da mquina s possvel 1 Pulso Erro de ligao eltrica
atravs do campo de proteo da SLC/SLG. 2 Pulsos Verificar erro de tenso de alimentao
4. Quando est a trabalhar junto a partes de risco da mquina, o 3 Pulsos Erro na sada, OSSD1 ou OSSD2
pessoal permanece dentro da zona de deteco.
4 Pulsos Diagnstico de erro interno
5. A distncia de segurana da aplicao maior do que a distncia
6 Pulsos Configurao incorreta
calculada.
7 Pulsos Outros erros internos
Opere a mquina e verifique se o movimento perigoso
paralisado sob as condies citadas a seguir.
1. As partes perigosas da mquina no se movimentam com o campo 7. Desmontagem e eliminao
de proteo interrompido.
2. O movimento perigoso da mquina imediatamente parado, 7.1 Desmontagem
quando o campo de proteo interrompido com o basto de teste A pedaleira deve ser desmontada apenas em estado desenergizado.
diretamente em frente ao emissor, em frente ao receptor e no meio,
entre emissor e receptor. 7.2 Eliminao
3. No ocorre nenhum movimento perigoso enquanto o basto de teste O dispositivo de segurana deve ser eliminado de modo tecnicamente
se encontra no campo de proteo correto, conforme as normas e legislao nacional.
4. O movimento perigoso paralisado quando a tenso de alimentao
da SLC/SLG desligada.

5.4 Inspeo semestral

Verifique os itens a seguir a cada seis meses ou quando um ajuste da 8. Anexo
mquina for alterado.
1. A mquina para ou impede toda funo de segurana. 8.1 Contato
2. No ocorreu nenhuma modificao na mquina ou alterao de Consultoria / Vendas:
ligaes que tenha efeito sobre o sistema de segurana. .$6FKPHUVDO*PE+ &R.*
3. As sadas da SLC/SLG esto ligadas corretamente mquina. Industrielle Sicherheitsschaltsysteme
4. O tempo de reao total da mquina no maior do que o tempo Mddinghofe 30
determinado na primeira colocao em funcionamento. ':XSSHUWDO
5. Cabos, conectores, tampes e cantoneiras de fixao esto em 7HO
perfeito estado. )D[

5.5 Limpeza Informaes pormenorizadas sobre a nossa gama de produtos

Caso a lente da cortina / grade de luz esteja extremamente suja, pode tambm esto disponveis na Internet em www.schmersal.com
ocorrer um mal funcionamento nas sadas OSSD. A limpeza realizada
com um pano limpo macio, sem pressionar. Servio de reparaes / expedio:
No permitida a utilizao de produtos de limpeza agressivos e Safety Control GmbH
abrasivos, que podem danificar a superfcie. Am Industriepark 11
'0KOGRUI,QQ
7HO
6. Diagnstico )D[

6.1 Informao de estado

A sinalizao dos estados ocorre na tampa do receptor (o emissor no
possui luz de estado).
Para o sinalizador de estado, esto disponveis as seguintes trs cores:
YHUPHOKR
DPDUHOR
YHUGH

Indicao de estado

Receptor Estado Descrio

tampa
OSSD Verde Campo de proteo livre
LIGADO
OSSD Vermelho Campo de proteo interrompido
DESLIGADO Vermelho com Operao normal: erro do sistema
interrupes ou de configurao, v. ponto 6.2
Vermelho Seletor de modos de operao:
intermitente verificar modo de operao
Rearme / Amarelo Reset manual ativo, esperado
Reset um sinal na entrada Rearme
Amarelo Operao de alinhamento:
intermitente qualidade do sinal

BR 11
Manual de instrues SLC440COM
Cortina / grade de luz de segurana SLG440COM
Anexo

8.2 Declarao de conformidade CE

Declarao de conformidade CE
Original ACE SCHMERSAL
Eletroeletrnica Industrial LTDA
Av. Brasil, n 815
-DUGLP(VSODQDGD
&(3%RLWXYD63
Brasil
Internet: http://www.schmersal.com.br

Pelo presente declaramos que, devido sua concepo e tipo construtivo, os componentes de
segurana listados a seguir correspondem aos requisitos das diretivas europeias abaixo citadas.

Designao do componente de SLC440COM

segurana / modelo: SLG440COM
(ver cdigo de modelo)

Descrio do componente de segurana: Cortina e grade de luz de segurana

Diretivas CE pertinentes: 2006/42/CE Diretiva de mquinas CE

2004/108/CE Diretiva CEM

Normas aplicadas: (1WLSR

(1
(1,623/H
(16,/

Responsvel pela organizao da Oliver Wacker

documentao tcnica: Mddinghofe 30
42279 Wuppertal

2UJDQLVPRQRWLFDGRGHH[DPH&(GHWLSR TV Nord Cert GmbH

Langemarckstr. 20
45141 Essen
1GHLGHQWLFDomR

&HUWLFDGR&(GHH[DPHGHWLSR N 44 205 13 1446 09

Local e data da emisso: Boituva, 24 de julho de 2015

ACE-SLC440COM-C-BR

Assinatura legalmente vinculativa

Marco Antonio De Dato
Diretor Projeto & Desenvolvimento

Local de produo:
ACE Schmersal
K.A. Schmersal GmbH & Co. KG Eletroeletrnica Industrial Ltda.
Mddinghofe 30, D - 42279 Wuppertal Av. Brasil, n 815
Postfach 24 02 63, D - 42232 Wuppertal Jardim Esplanada CEP: 18550-000, Boituva SP
Brasil
Telefone +49 - (0)2 02 - 64 74 - 0 Telefone +55 - (0)15 - 32 63 - 9866
Telefax +49 - (0)2 02 - 64 74 - 1 00 Telefax +55 - (0)15 - 32 63 - 9890
E-Mail: info@schmersal.com E-Mail: vendas@schmersal.com.br
Internet: http://www.schmersal.com Internet: http://www.schmersal.com.br

12 BR
Operating instructions
Safety light curtain / safety light grid
Version 2.0
EN Operating instructions. . . . . . . . . . .pages 13 to 24
Translation of the original operating instructions
Content
1 About this document
1.1 Function. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .13
1.2 7DUJHWJURXSDXWKRULVHGTXDOLHGSHUVRQQHO . . . . . . . . . . . . . . . 13
1.3 Explanation of the symbols used. . . . . . . . . . . . . . . . . . . . . . . . .13
1.4 Appropriate use . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .14
1.5 General safety instructions . . . . . . . . . . . . . . . . . . . . . . . . . . . . .14
1.6 Warning about misuse. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .14
1.7 Exclusion of liability . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .14
2 Product description
2.1 Destination and use. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .14
2.2 Ordering code . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .14
2.3 Special versions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .14
2.4 Included in delivery . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .14
2.5 Technical data . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .14
2.6 Response time (reaction time) . . . . . . . . . . . . . . . . . . . . . . . . . .15
2.7 6DIHW\FODVVLFDWLRQ. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .15
2.8 Functions. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .16
2.8.1 Protective mode / Automatic . . . . . . . . . . . . . . . . . . . . . . . . . . . .16
2.8.2 Restart Interlock (operation) . . . . . . . . . . . . . . . . . . . . . . . . . . . .16
2.8.3 Mode of operation - Restart Interlock - activate . . . . . . . . . . . . .16
2.9 Self-test . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .16
3 Mounting
3.1 General conditions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .16
3.2 3URWHFWLRQHOGDQGDSSURDFK . . . . . . . . . . . . . . . . . . . . . . . . . . .16
3.3 Alignment of the sensors. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .17
3.4 Setting mode . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .17
3.4.1 Setting mode with cable connection 5-pole. . . . . . . . . . . . . . . . .17
3.4.2 Setting mode with cable connection 4-pole. . . . . . . . . . . . . . . . .17
3.5 Sicherheitsabstand . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .17
3.5.1 0LQLPXPGLVWDQFHWRUHHFWLQJVXUIDFHV . . . . . . . . . . . . . . . . . . .18
3.6 Mounting . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .18
SLC440COM
SLG440COM
3.7 Dimensions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .19
3.7.1 Dimensions transmitter and receiver SLC440COM . . . . . . . . . . 19
3.7.2 Dimensions transmitter and receiver SLG440COM . . . . . . . . . .19
3.8 Fixing. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .20
3.8.1 Included in delivery . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .20
3.8.2 Optional accessories . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .20
4 Electrical connection
4.1 Wiring example SLC/SLG440COM . . . . . . . . . . . . . . . . . . . . . . .21
4.2 Wiring example with safety-monitor module . . . . . . . . . . . . . . . .22
4.3 &RQQHFWRUFRQJXUDWLRQ5HFHLYHU7UDQVPLWWHU &DEOH . . . . . . . 22
5 Set-up and maintenance
5.1 Check before start-up . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .22
5.2 Maintenance . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .22
5.3 Regular check . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .23
5.4 Half-yearly inspection . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .23
5.5 Cleaning . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .23
6 Diagnostic
6.1 Status information . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .23
6.2 Fault diagnostic . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .23
7 Disassembly and disposal
7.1 Disassembly . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .23
7.2 Disposal. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .23
8 Appendix
8.1 Contact . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .23
8.2 EC Declaration of conformity. . . . . . . . . . . . . . . . . . . . . . . . . . . .24
1. About this document
1.1 Function
This operating instructions manual provides all the information you
need for the mounting, set-up and commissioning to ensure the safe
operation and disassembly of the safety switchgear. he operating
instructions must be available in a legible condition and a complete ver-
sion in the vicinity of the device.
1.2 Target group: authorised qualified personnel
All operations described in this operating instructions manual must
be carried out by trained specialist personnel, authorised by the plant
operator only.
Please make sure that you have read and understood these operat-
ing instructions and that you know all applicable legislations regarding
occupational safety and accident prevention prior to installation and
putting the component into operation.
The machine builder must carefully select the harmonised standards
to be complied with as well as other technical specifications for the
selection, mounting and integration of the components.
1.3 Explanation of the symbols used
Information, hint, note:
This symbol is used for identifying useful additional information.
Caution: Failure to comply with this warning notice could
lead to failures or malfunctions.
Warning: Failure to comply with this warning notice could
lead to physical injury and/or damage to the machine.
EN 13
Operating instructions SLC440COM
Safety light curtain / safety light grid SLG440COM
1.4 Appropriate use The user must evaluate and design the safety chain in
The products described in these operating instructions are developed to accordance with the relevant standards and the required
execute safety-related functions as part of an entire plant or machine. It safety level.
is the responsibility of the manufacturer of a machine or plant to ensure
the correct functionality of the entire machinery or plant. 2.2 Ordering code
This operating instructions manual applies to the following types:
The safety switchgear must be exclusively used in accordance with the
versions listed below or for the applications authorised by the manufac- SLC440COM-ER--
turer. Detailed information regarding the range of applications can be No. Option Discription
found in the chapter "Product description".
xxxx Protection field heights in mm available lengths:
1.5 General safety instructions 0330, 0410, 0490, 0570, 0650, 0730, 0810,
The user must observe the safety instructions in this operating instruc- 0890, 0970, 1050, 1130, 1210, 1290, 1370,
tions manual, the country-specific installation standards as well as all 1450, 1530*, 1610*, 1690*, 1770*, 1850*, 1930*
prevailing safety regulations and accident prevention rules. 14 Resolution 14 mm with a range of 0.3 m 7 m
30 Resolution 30 mm with a range of 0.3 m 10 m
Further technical information can be found in the Schmersal 35 Resolution 35 mm with a range of 0.3 m 7 m
catalogues or in the online catalogue on the Internet:
www.schmersal.net. * Resolution 14 mm:
protection field height 1530 1930 mm with a range of 0.3 m 6 m
The information contained in this operating instructions manual is pro- * Resolution 35 mm:
vided without liability and is subject to technical modifications. protection field height 1850 1930 mm with a range of 0.3 m 6 m

The entire concept of the control system, in which the

safety component is integrated, must be validated to SLG440COM-ER-
EN ISO 13849-2. No. Option Discription

There are no residual risks, provided that the safety instructions as well Distance between outermost beams:
as the instructions regarding mounting, commissioning, operation and 0500-02 500 mm, 2-beam
maintenance are observed. 0800-03 800 mm, 3-beam
0900-04 900 mm, 4-beam
Additional measures could be required to ensure that the system does 5DQJHPP
not present a dangerous breakdown, when other forms of light beams
are available in a special application (e.g. use of wireless control devices 2.3 Special versions
on cranes, radiation of welding sparks or effects of stroboscopic lights). For special versions, which are not listed in the order code, these
specifications apply accordingly, provided that they correspond to the
1.6 Warning about misuse standard version.

In case of improper use or manipulation of the safety switch- 2.4 Included in delivery
gear, personal hazards or damages to machinery or plant 6HQVRUV(5UHFHLYHUZLWKLQWHJUDWHGVWDWXVODPS
components cannot be excluded when safety switchgear is 0RXQWLQJNLW06
used. The relevant requirements of the standards 2SHUDWLQJLQVWUXFWLRQV'((1
(1,62 (1,62PXVWEHREVHUYHG 6SDFHU06'IURPSURWHFWLRQfield height of 1050 mm

2.5 Technical data

Only if the information described in this operating instructions Standards: EN 61496-1; EN 61496-2;
manual are realised correctly, the safety function and therefore EN ISO 13849; EN 62061
the compliance with the Machinery Directive is maintained. Material of the enclosure: Aluminium
Protection field heights:
1.7 Exclusion of liability - SLC440COM: 330 1930 mm
We shall accept no liability for damages and malfunctions resulting from - SLG440COM: 500 mm, 800 mm, 900 mm
defective mounting or failure to comply with this operating instructions Detection ability for test bodies:
manual. The manufacturer shall accept no liability for damages result- - SLC440COM: 14 mm, 30 mm, 35 mm
ing from the use of unauthorised spare parts or accessories. - SLG440COM: 2 beams with resolution 500 mm 1)
3 beams with resolution 400 mm 1)
For safety reasons, invasive work on the device as well as arbitrary re- 4 beams with resolution 300 mm 1)
pairs, conversions and modifications to the device are strictly forbidden; Range of the protection field:
the manufacturer shall accept no liability for damages resulting from - SLC440COM:
such invasive work, arbitrary repairs, conversions and/or modifications - Resolution 14 mm: Protection field height 330 1450 mm: 0.3 7.0 m
to the device. Protection field height 1530 1930 mm: 0.3 6.0 m
- Resolution 35 mm: Protection field height 330 1450 mm: 0.3 7.0 m
Protection field height 1850 and 1930 mm: 0.3 6.0 m
2. Product description - Resolution 30 mm: 0.3 10.0 m
- SLG440COM: 0.3 12.0 m
2.1 Destination and use Response time: 1 - 48 beams = 10 ms
The SLC/SLG440COM is a non-contact, self-testing safety guard which 49 - 144 beams = 20 ms
is used for the protection of hazardous points, hazardous areas and 145 - 192 beams = 28 ms
machine accesses. If one or more light beams are interrupted, the Rated operating voltage: 24 VDC 10% (PELV) supply unit
hazardous movement must be stopped. Imax.$WR(1SRZHUGURSPV
Rated operating current: 200 mA max. + 2 x 0.25 A each OSSD

14 EN
Operating instructions SLC440COM
Safety light curtain / safety light grid SLG440COM
Wavelength of the infrared radiation: 880 nm SLC440COM Resolution 30 mm
Transmitter, infrared emitted radiation
Protection field Beams (lines) Response Weight
- to DIN EN 12198-1: Category 0 height mm] [Number] time [ms] [kg]
- to DIN EN 62471: free group
330 16 10 0.5
Safety outputs
OSSD1, OSSD2: 2 x short-circuit proof PNP semi-conductor outputs 410 20 10 0.7
Test impulse cycle OSSD: 750 ms 490 24 10 0.8
Test impulse length: 150 s 570 28 10 0.9
Switching voltage HIGH 2): 15 26.4 V 650 32 10 1.0
Switching voltage LOW 2): 0 2 V 730 36 10 1.1
Switching current each OSSD: 0 250 mA 810 40 10 1.3
Leakage current 3): 1 mA
890 44 10 1.4
Load capacity: 0 50 nF
970 48 10 1.5
Load inductance 4): 0 2H
Function: Protective mode / Automatic, 1050 52 20 1.6
Restart Interlock (manual reset), Setting mode 1130 56 20 1.7
Status indication receiver: end cap with integrated status indication: 1210 60 20 1.9
OSSD ON (green), OSSD OFF (red), 1290 64 20 2.0
alignment quality/restart mode (yellow) 1370 68 20 2.1
Connection:
1450 72 20 2.2
- Transmitter: Cable M12, 4-pole,
1530 76 20 2.3
- Receiver: Cable M12, 4-pole, 5-pole
Ambient temperature: && 1610 80 20 2.5
Storage temperature: && 1690 84 20 2.6
Protection class: IP67 (IEC 60529) 1770 88 20 2.7
Resistance to vibration: 10 55 Hz to IEC 60068-2-6 1850 92 20 2.8
Resistance to shock: 10 g, 16 ms, to IEC 60028-2-29 1930 96 20 2.9
Year of construction: as of 2014 version 2.0

1)
SLC440COM Resolution 35 mm
Resolution = beam distance + beam diameter 10 mm
2)
To IEC 61131-2 Protection field Beams (lines) Response Weight
3)
In case of failure, the leakage current flows to the OSSD cable. The height [mm] [Number] time [ms] [kg]
downstream control element must recognise this state as LOW. A 330 11 10 0.5
safety PLC must detect this state. 410 14 10 0.7
4)
The load inductivity generates an induced voltage during the switch-off, 490 16 10 0.8
which compromises the downstream components (spark quenching 570 19 10 0.9
element).
650 22 10 1.0
730 25 10 1.1
2.6 Response time (reaction time)
The response time depends on the height of the protected field, the 810 27 10 1.3
resolution, the number of light beams. 890 30 10 1.4
970 33 10 1.5
SLC440COM Resolution 14 mm 1050 36 10 1.6
Protection field Beams (lines) Response Weight 1130 38 10 1.7
height [mm] [Number] time [ms] [kg] 1210 41 10 1.9
330 32 10 0.5 1290 44 10 2.0
410 40 10 0.7 1370 47 10 2.1
490 48 10 0.8 1450 49 20 2.2
570 56 20 0.9 1530 52 20 2.3
650 64 20 1.0 1610 55 20 2.5
730 72 20 1.1 1690 58 20 2.6
810 80 20 1.3 1770 60 20 2.7
890 88 20 1.4 1850 63 20 2.8
970 96 20 1.5 1930 66 20 2.9
1050 104 20 1.6
1130 112 20 1.7 SLG440COM
1210 120 20 1.9 Beams Beam distance Response time Weight
1290 128 20 2.0 [Number] [mm] [ms] [kg]
1370 136 20 2.1 2 500 10 0.8
1450 144 20 2.2 3 400 10 1.3
1530 152 28 2.3 4 300 10 1.4
1610 160 28 2.5
1690 168 28 2.6
1770 176 28 2.7 2.7 Safety classification
1850 184 28 2.8 Standards: EN ISO 13849-1, EN 62061
1930 192 28 2.9 PL: up to e
Control category: up to 4
PFH value: 8.05 x 10-9 / h
SIL: up to 3
Service life: 20 years

EN 15
Operating instructions SLC440COM
Safety light curtain / safety light grid SLG440COM
2.8 Functions 3. Mounting
The system consists of a receiver and a transmitter. For the described
functions, no further switching elements are required. 3.1 General conditions
The following guidelines are provided as preventive warning notices
The system has the following operating modes: to ensure a safe and appropriate handling. These guidelines are an
3URWHFWLYHPRGHDXWRPDWLFIDFWRU\VHWWLQJ essential part of the safety instructions and therefore must always be
(automatic start after release of the protection field) observed and respected.
5HVWDUW,QWHUORFNPDQXDOUHVHW
6HWWLQJPRGH
2.8.1 Protective mode / Automatic
The protective mode switches the OSSD outputs to the ON state
(protection field not interrupted), without external release of a switching
device.
This operating mode may only be chosen in conjunction
with the restart interlock (manual reset) of the machine.
2.8.2 Restart Interlock (operation)
The restart interlock (manual reset) prevents an automatic enabling of
the outputs (OSSD's ON state) after switch-on of the operating volt-
age or an interruption of the protection field. The system switches the
outputs only to ON state, when an external command device (restart
button) generates an enabling signal at the restart input (receiver).
2.8.3 Mode of operation - Restart Interlock - activate
When delivered (factory setting) the operating mode Protection /
Automatic is active. For the operating mode Restart Interlock, a 5 pole
connection cable is needed for the receiver.
The operating mode Restart Interlock can be activated as follows:
- Remove power from the AOPD
- Move wire-link from OSSD1 to OSSD2 (Pin 2 and 4)
- When switching on the AOPD, apply +24V to the restart input (Pin 5),
e.g. by pushing and holding down the restart interlock button of the
command device.
- The AOPD indicates the current operating mode by the number of
pulses on the integrated status indicator:
Automatic operating mode = cyclic display of a pulse and pulse
interval (red)
Restart interlock operating mode = cyclic display of two pulses and
pulse interval (red)
- Quickly pressing changes the operating mode (100 ms < t < 1500
ms). The number of displayed light pulses (red) indicates the selected
mode of operation.
- Keeping the restart button pressed stores the current mode of opera-
tion. This action is confirmed by the signal lamp rapidly flashing.
Continue to hold down the restart button (for about another three
seconds) until the AOPD has returned to its selected mode of opera-
tion (flashing the operation mode). To start the AOPD in the new mode
remove power from the AOPD, remove the wire link between OSSD1
and OSSD2, and then reconnect power.
The command devices (enabling button) must be installed
outside of the hazardous area. The operator must have a
clear view on the hazardous area when actuating the
enabling button.
2.9 Self-test
The system performs a complete self-test and safety test within
2 seconds after the operating voltage has been switched on. If the
protection field is free, the system switches to the ON condition
(automatic mode). In case of an error, the outputs at the receiver
do not switch to the ON state.
During operation, the system executes a cyclic self-test. Safety-relevant
faults are detected within the reaction time and cause the outputs to be
switched off.
16
7KH6/&6/*PXVWQRWEHXVHGRQPDFKLQHVZKLFKFDQEH
stopped electrically in case of emergency.
7KHVDIHW\GLVWDQFHEHWZHHQWKH6/&6/*DQGDKD]DUGRXV
machine movement must always be observed and respected.
$GGLWLRQDOPHFKDQLFDOVDIHW\JXDUGVPXVWEHLQVWDOOHGVRWKDW
the operator has to pass by the protection field to reach the
hazardous machine parts.
7KH6/&6/*PXVWEHLQVWDOOHGVRWKDWWKHSHUVRQQHODOZD\V
must be within the detection zone when operating the machi-
ne. An incorrect installation can lead to serious injuries.
1HYHUFRQQHFWWKHRXWSXWVWR9'&,IWKHRXWSXWVDUH
wired to +24VDC, they are in ON state, as a result of which
they are unable to stop a hazardous situation occurring on the
application/machine.
7KHVDIHW\LQVSHFWLRQVPXVWEHFRQGXFWHGUHJXODUO\
7KH6/&6/*PXVWQRWEHH[SRVHGWRLQIODPPDEOHRU
explosive gasses.
7KHFRQQHFWLQJFDEOHVPXVWEHFRQQHFWHGLQDFFRUGDQFHZLWK
the installation instructions.
7KHIL[LQJVFUHZVRIWKHHQGFDSVDQGWKHPRXQWLQJDQJOH
must be firmly tightened.
3.2 Protection field and approach
The protection field of the SLC/SLG consists of the entire range located
between the protection field markings of transmitter and receiver. Ad-
ditional protective devices must ensure that the operator has to pass by
the protection field to reach the hazardous machine parts.
The SLC/SLG must be installed so that the personnel is always located
within the detection zone of the safety device when operating the haz-
ardous machine parts to be secured.
Correct installation
Hazardous machine parts can only be reached
after passing through the protection field.
The presence of staff members between the
protection field and hazardous machine parts
must be prevented/avoided (protection against
stepping over).
Unauthorised installation
Hazardous machine parts can be reached
without passing through the protection field.
The presence of staff members between the
protection field and hazardous machine parts
is enabled.
EN
Operating instructions SLC440COM
Safety light curtain / safety light grid SLG440COM
3.3 Alignment of the sensors (2) S = 1600 mm/s * T + 8 (d - 14) [mm]
Procedure:
1. Transmitter and receiver must be fitted parallel to each other and at If the new value S > 500 mm, use this value as safety distance.
the same height. If the new value S < 500 mm, use a minimum distance of 500 mm.
2. Choose the operating mode "Automatic" (see chapter Protective
mode/automatic) and switch the operating voltage on. Example:
3. First rotate the transmitter, then the receiver to each other until the Reaction time of the safety light curtain = 10 ms
integrated status indicator lights up green. Adjust the transmitter Resolution of the safety light curtain = 14 mm
and receiver so that they are in the middle of the angular range for a Stopping time of the machine = 330 ms
green indication. Fix the position with the two screws for each mount-
ing bracket. S = 2000 mm/s * (330 ms + 10 ms) + 8(14 mm - 14 mm)
S = 680 mm
3.4 Setting mode S = > 500 mm, therefore new calculation with V = 1600 mm/s
S = 544 mm
3.4.1 Setting mode with cable connection 5-pole
If +24 V is on the input (Pin 5, receiver) "Release restart" at system Safety distance to the hazardous area
start for at least two seconds (by pressing the button restart), the sys-
tem changes over to the setting mode of operation. S

In this mode the signal strength of the beam is signalled to the status Safety distance (S)
Limit of the hazardous point
indicator with the lowest value through light pulses (colour yellow).
The better the alignment, the higher the frequency of the light pulses.
The alignment is correct when the light pulses switch over to continu- Tool - upper part
ous light.
If there is no optical synchronisation between the transmitter and the Signal to stop the
receiver, a light pulse is emitted every three seconds. The setting mode tA hazardous movement
is ended by a system start ( +UB OFF/ON). Protection field marking tB Standstill of the hazardous
movement
tn = tB - tA
3.4.2 Setting mode with cable connection 4-pole
1) Receiver connection, connect Pin 1 (24V DC) with Pin 2 (OSSD 1).
2) Receiver supply voltage ON
Tool - lower part
3) Status indicator signals (yellow):
- No alignment present: A light pulse every 3 sec.;
- Alignment signal present: Higher frequency light pulse;
- Alignment optimal: Light pulse is continuous ON
(fix sensors)
4) Receiver supply voltage OFF
5) Remove wire link Pin 1 and Pin 2
6) Receiver supply voltage ON PP PD[GLVWDQFHIRUSURWHFWLRQDJDLQVWVWHSSLQJRYHU
To prevent persons from stepping over the protection field this dimension
(Setting mode deactivated) must be imperatively respected and observed.

3.5 Sicherheitsabstand
The safety distance is the minimum distance between the protection Calculation of the safety distance for the multi-beam light grid
field of the safety light curtain and the hazardous area. The safety dis- SLG440COM
tance must be observed to ensure that the hazardous area cannot be
reached before the hazardous movement has come to standstill. S = (1600 mm/s * T) + 850mm

Calculation of the safety distance to EN ISO 13855 and EN ISO S = Safety distance [mm]
13857 T = Total reaction time (machine run-on time, reaction time of the safety
guard, relays, etc.)
The safety distance depends on the following elements: K = Approach speed 1600 mm/s
6WRSSLQJWLPHRIWKHPDFKLQHFDOFXODWLRQE\UXQRQWLPHPHDVXUH- C = Safety supplement 850 mm
ment)
5HVSRQVHWLPHRIWKHPDFKLQHDQGWKHVDIHW\OLJKWFXUWDLQDQGWKH Example
downstream safety-monitoring module (entire safety guard) Reaction time of the SLG440COM = 10 ms
$SSURDFKVSHHG Stopping time of the machine T = 170 ms
5HVROXWLRQRIWKHVDIHW\OLJKWFXUWDLQ
S = 1600 mm/s * (170 ms + 10 ms) + 850 mm
Safety light curtain SLC440COM S = 1138 mm
The safety distance for resolutions 14 mm up to 40 mm is calculated by
means of the following formula: The following mounting heights must be observed:

(1) S = 2000 mm/s * T + 8 (d - 14) [mm] Number of Mounting height above reference floor
beams in mm
S = Safety distance [mm] 2 400, 900
T = Total reaction time (machine run-on time, reaction time of the safety 3 300, 700, 1100
guard, relays, etc.) 4 300, 600, 900, 1200
d = Resolution of the safety light curtain

7KHDSSURDFKVSHHGLVFRYHUHGZLWKDYDOXHRIPPV,IYDOXH6
500 mm after the calculation of the safety distance, then use this value.

If value S >= 500 mm, recalculate the distance:

EN 17
Operating instructions SLC440COM
Safety light curtain / safety light grid SLG440COM
Safety distance to the hazardous area Safety distance a
a [mm]
1000
Transmitter 900
800
Direction from which the
700
600
hazardous area is accessed 500
S
400
Hazardous point
300
200
100 D [m]
0 3 5 10 15 20
Receiver
Calculate the minimum distance to reflecting surfaces as a function of
Command device
Authorised operation WKHGLVWDQFHZLWKDQDSHUWXUHDQJOHVRIGHJUHHVRUXVHWKHYDOXH
from the table below:
Mechanical protection
Distance between transmitter and receiver Minimum distance
The formulae and calculation examples are related to the vertical set-up [m] a [mm]
(refer to drawing) of the safety light grid with regard to the hazardous 0.2 3.0 130
point. Please observe the applicable harmonised EN standards and 4 175
possible applicable national regulations. 5 220
7 310
The safety distance between the safety light curtain / light
10 440
grid and the hazardous point must always be respected and
observed. If a person reaches the hazardous point before the 12 530
hazardous movement has come to a standstill, he or she is
exposed to serious injuries. Formula: a = tan 2.5 x L [mm]

a = Minimum distance to reflecting surfaces

To calculate the minimum distances of the safety guards with
regards to the hazardous point, the EN ISO 13855 and
EN ISO 13857 must be observed.
If an overlap of the protection field is possible, take care with
the calculation of the safety distance referring to additional
CRO according to the table A1 as per norm EN ISO 13855.
L = Distance between transmitter and receiver
3.6 Mounting
The SLC/SLG440COM should be installed in such a way that interfer-
ence with neighbouring safety light barriers / grids of the same type
(SLC/SLG440COM) is excluded.

If two or more applications are arranged so that mutual interference is

3.5.1 Minimum distance to reflecting surfaces possible, this should be eliminated with a partition.
During the installation, the effects of reflecting surfaces must be taken
into account. In case of an incorrect installation, interruptions of the
protection field could possibly not be detected, which could lead to
serious injuries. The hereafter-specified minimum distances with regard
to reflecting surfaces (metal walls, floors, ceilings or parts) must be
imperatively observed.

Access direction

Transmitter Receiver
Obstacle Machine A Machine B

optical axis

8 
8
a=130mm
a= 262 mm

reflecting body
(e.g. Material container)
Limit of the hazardous point

Machine A Machine B

Mutual interference of the sensors is to be prevented through

appropriate installation. If this is not guaranteed, contact the
manufacturer.

18 EN
Operating instructions SLC440COM
Safety light curtain / safety light grid SLG440COM
3.7 Dimensions 3.7.2 Dimensions transmitter and receiver SLG440COM
All measurements in mm.
3.7.1 Dimensions transmitter and receiver SLC440COM
All measurements in mm.

L2
75
75 7,7
7,7

42,5
27,8
27,8 33

A
B
C
33
A
B
C

41,5
22,2

24
22,2

24

L1

Type A B C Type A B C L1 L2
Protected Mounting Total Beam Mounting Total
height dimension length dis- dimen- lenght
1 1 1 tance sion

SLC440COM-ER-0330-XX 330 384 403 SLG440COM-ER-0500-02 500 584 603 358.5 357.5
SLC440COM-ER-0410-XX 410 464 483 SLG440COM-ER-0800-03 400 884 903 258.5 257.5
SLC440COM-ER-0490-XX 490 544 563 SLG440COM-ER-0900-04 300 984 1003 258.5 257.5
SLC440COM-ER-0570-XX 570 624 643
L1 = Mounting distance (mm) between floor and slotted hole centre
SLC440COM-ER-0650-XX 650 704 723
(short end cap)
SLC440COM-ER-0730-XX 730 784 803
L2 = Mounting distance (mm) between floor and slotted hole centre
SLC440COM-ER-0810-XX 810 864 883 (diagnostic window)
SLC440COM-ER-0890-XX 890 944 963
SLC440COM-ER-0970-XX 970 1024 1043 The overall length Ls (dimension end cap with regard to the cable
SLC440COM-ER-1050-XX 1050 1104 1123 connection up to the connector M12) of the sensors is calculated in the
SLC440COM-ER-1130-XX 1130 1184 1203 following way:
SLC440COM-ER-1210-XX 1210 1264 1283
Ls = size B - 13 mm
SLC440COM-ER-1290-XX 1290 1344 1363
SLC440COM-ER-1370-XX 1370 1424 1443 Example: SLC440COM-ER-0970-XX
SLC440COM-ER-1450-XX 1450 1504 1523 Ls = 1024 - 13 = 1011 mm
SLC440COM-ER-1530-XX 1530 1584 1603
SLC440COM-ER-1610-XX 1610 1664 1683
SLC440COM-ER-1690-XX 1690 1744 1763
SLC440COM-ER-1770-XX 1770 1824 1843
SLC440COM-ER-1850-XX 1850 1904 1923
SLC440COM-ER-1930-XX 1930 1984 2003

EN 19
Operating instructions SLC440COM
Safety light curtain / safety light grid SLG440COM
3.8 Fixing 3.8.2 Optional accessories

3.8.1 Included in delivery Centre support MS-1110

Mounting kit consists of 2 steel angles and 4 spacers for central fixing
Mounting kit MS-1100
The mounting kit consists of 4 steel angles and 8 fixing screws 4
(Type Torx plus 10IP).

17

11,5
27,8

38
7

19,5

11,5
24
11

69
5,5 54,3
28
24
38

3
27
Integrated status indication 7
The status indication at the receiver indicates the switching condition
of the outputs OSSD1 and OSSD2. 5,5
Green = release outputs (H-signal 24V)
Red = outputs switched off (L-signal 0V) Connecting cable for emitter / receiver (4-pole)
Yellow = Restart Interlock released / Setting mode
Item Number Designation Discription Length
15 0,1

101207741 KA-0804 Female connector M12, 4-pole 5 m
101207742 KA-0805 Female connector M12, 4-pole 10 m
101207743 KA-0808 Female connector M12, 4-pole 20 m
14,5
2,5

Connecting cable for receiver (5-pole)*

MSD5 spacer
The kit consists of 2 spacers. Available as of a protection zone height of Item No Designation Description Length
1050 mm. Mounting must be used in case of vibrations. 101209949 A-K5P-M12-S-G-5M-BK-2-X-A-1 Female connec- 5 m
tor M12, 5-pole
101209948 A-K5P-M12-S-G-15M-BK-2-X-A-1 Female connec- 15 m
8

10

tor M12, 5-pole

7,7
M4 * For use in the operating mode Restart Interlock (manual reset)

Test rod PLS

The test rod is used for testing the protection field.

MSD4 Vibration damper

Kit consists of: 8 vibration dampers 15 x 20 mm, 8 M5 cylinder
head screws with hexagon socket, 8 spring washers. Mounting using
MS-1100.

The MSD4 vibration damper kit is recommend to be used for damping

vibrations and oscillations on the SLC/SLG440COM. For applications
33 with higher mechanical stresses, e.g. presses, punching machines,
we recommend the MSD4 kit. In this way, the availability of the
SLC/SLG440COM is increased.

20 EN
Operating instructions SLC440COM
Safety light curtain / safety light grid SLG440COM
4. Electrical connection

4.1 Wiring example SLC/SLG440COM

2 4 3 1 5 1 3 2 4
Release restart (GY)
Not connected (WH)

Not connected (BK)

+24 VDC (BN)

+24 VDC (BN)

OSSD 1 (WH)

OSSD 2 (BK)
0 VDC (BU)

0 VDC (BU)

S1
K1 K2

E1

Earth connection

Protective mode / Automatic active: K1, K2: Relay for processing the switching outputs
Delivery state (Command device button S1 not connected) OSSD 1,OSSD 2
S1: Command device pushbutton for restart (optional)
Restart Interlock (manual reset) active: E1: Power supply 24 VDC 10%
Refer to the chapter: operating mode activate restart interlock
(Command device button 1 connected)

EN 21
Operating instructions SLC440COM
Safety light curtain / safety light grid SLG440COM
4.2 Wiring example with safety-monitor module The colour codes are only valid for the cable types mentioned
below "optional accessories".

J L1 For UL evaluated products we do recommend to use the UL

style cable 20549.
KB
S
KA
5. Set-up and maintenance
A1 S12 S11 S21 S22 X1 X2 13 23 33 41
5.1 Check before start-up
F1 Prior to start-up, the following items must be checked by the responsi-
Ansteuerlogik/ ble person.
Logic
K1 KA
Wiring check prior to start-up
Ui 1. The voltage supply is a 24V direct current power supply (see techni-
K2
K1 K2
KB cal specifications), which meets the CE Directives, Low Voltage
Directives. A power downtime of 20 ms must be bridged.
A2 14 24 34 42 2. Presence of a voltage supply with correct polarity at the SLC/SLG.
3. The connecting cable of the transmitter is correctly connected to the
KA KB transmitter and the connecting cable of the receiver correctly to the
N receiver.
4. The double insulation between the light curtain output and an exter-
Key safety-monitoring module nal potential is guaranteed.
&RQWDFWRUFRQWURO.A and KB at X1/X2 5. The outputs OSSD1 and OSSD2 are not connected to +24 VDC.
&RPPDQGGHYLFHJ Restart interlock restart at X1/X2 6. The connected switching elements (load) are not connected to
266'RXWSXWVDW6DQG6 +24 VDC.
46VZLWFK Q46GHDFWLYDWHFURVVZLUHVKRUWGHWHFWLRQ 7. If two or more SLC/SLG units are used within close range to each
other, an alternating arrangement must be observed. Any mutual
interference of the systems must be prevented.
4.3 Connector configuration Receiver, Transmitter & Cable
Switch the SLC/SLG on and check the operation in the following
RECEIVER way:
SLC Connector The component performs a system test during approx. 2 seconds after
M12, 5-pole Designation Discription the operating voltage has been switched on. After that, the outputs are
1 BN 24 VDC Power supply enabled if the protection field is not interrupted. The status indication at
4 3 2 WH OSSD 1 Safety output 1 the receiver is on.
3 BU 0 VDC Power supply
In case of incorrect functionality, please follow the instructions
2 4 BK OSSD 2 Safety output 2
1 5 5 GY Release/ Acknowledgement
listed in the chapter Fault diagnostic.

restart interlock restart interlock

Cable: Connector 5.2 Maintenance
female M12, 5-pole
3 4 Do not use the SLC/SLG before the next inspection is termi-
nated. An incorrect inspection can lead to serious and mortal
injuries.
2
5 1 Conditions
For safety reasons, all inspection results must be archived. The operat-
ing principle of the SLC/SLG and the machine must be known in order
It is possible to use the Automatic operating mode with a to be able conducting an inspection. If the fitter, the planning technician
4-pole cable (without pin 5 restart interlock). and the operator are different persons, please make sure that the user
has the necessary information at his disposal to be able conduct the
maintenance.
TRANSMITTER
SLC Connector
M12, 4-pole Designation Discription
1 BN 24 VDC Power supply
4 3 2 WH Not used Do not connect a signal
(do not wire)
1 2 3 BU 0 VDC Power supply
4 BK Not used Do not connect a signal
(do not wire)
Cable: Connector
female M12, 4-pole
3 4

2 1

22 EN
Operating instructions SLC440COM
Safety light curtain / safety light grid SLG440COM
5.3 Regular check 6.2 Fault diagnostic
A regular visual inspection and functional test, including the following Wiring fault
steps, is recommended:
1. The component does not have any visible damages. Status display Fault feature
2. The optics cover is not scratched or soiled. 1 impulse Wiring fault
3. Hazardous machinery parts can only be accessed by passing 2 impulses Voltage fault, check the supply voltage
through the protection field of the SLC/SLG. 3 impulses Error output OSSD1 or OSSD2
4. The staff remains within the detection area, when works are con-
4 impulses Internal error diagnostic
ducted on hazardous machinery parts.
6 impulses Incorrect configuration data
5. The safety distance of the application exceeds the mathematically
calculated one. 7 impulses Other internal fault

Operate the machine and check whether the hazardous movement

stops under the hereafter-mentioned circumstances. 7. Disassembly and disposal
1. Hazardous machine parts do not move when the protection field is
interrupted. 7.1 Disassembly
2. The hazardous machine movement is immediately stopped, when The safety switchgear must be disassembled in a de-energised
the protection field is interrupted with the test rod immediately before condition only.
the transmitter, immediately before the receiver and in the middle
between the transmitter and the receiver. 7.2 Disposal
3. No hazardous machine movement when the test rod is within the The safety switchgear must be disposed of in an appropriate manner in
protection field. accordance with the national prescriptions and legislations.
4. The hazardous machine movement comes to standstill, when the
voltage supply of the SLC/SLG is switched off.
8. Appendix
5.4 Half-yearly inspection
The following items must be checked every six months or when a ma- 8.1 Contact
chine setting is changed. Consultancy / Sales:
1. Machine stops or does not inhibit any safety function. .$6FKPHUVDO*PE+ &R.*
2. No machine modification or connection change, which affects the Industrielle Sicherheitsschaltsysteme
safety system, has taken place. Mddinghofe 30
3. The outputs of the SLC/SLG are correctly connected to the machine. D-42279 Wuppertal
4. The total response time of the machine does not exceed the re- Tel.: +49 (0)2 02 - 64 74 - 0
sponse time calculated during the first putting into operation. Fax: +49 (0)2 02 - 64 74 - 100
5. The cables, the connectors, the caps and the mounting angles are in
perfect condition. You will also find detailed information regarding our product variety on
our website: www. schmersal.com
5.5 Cleaning
If the optics cover of the sensors is extremely soiled, the OSSD outputs Repair handling / shipping:
can be disabled. Clean with a clean, soft cloth with exercising pressure. Safety Control GmbH
The use of agressive, abrasive or scratching cleaning agents, which Am Industriepark 11
could attack the surface, is prohibited. D-84453 Mhldorf/ Inn
Tel.: +49 (0) 86 31 - 1 87 96 - 0
Fax: +49 (0) 86 31 - 1 87 96 - 1
6. Diagnostic

6.1 Status information

Signalisation of the status occurs at the receiver end cap (the transmit-
ter has no status indicator).
For status indication the following three colours are available:
5HG
<HOORZ
*UHHQ

Status display

Receiver Status Discription

end cap
OSSD ON Green Protection field clear
OSSD OFF Red Protection field interrupted
Red with Normal operation: System of
interruptions configuration fault, see point 6.2
Red flashing Operation mode selection:
Check operation mode
Restart Yellow Restart interlock (manual reset)
active, signal expected at input
restart interlock
Yellow flashing Setting mode: signal quality

EN 23
Operating instructions SLC440COM
Safety light curtain / safety light grid SLG440COM
Appendix

8.2 EC Declaration of conformity

EC Declaration of conformity
Translation ACE SCHMERSAL
of the original Declaration of Conformity Eletroeletrnica Industrial LTDA
Av. Brasil, n 815
Jardim Esplanada
CEP: 18550-000, Boituva SP
Brasil
Internet: http://www.schmersal.com.br

We hereby certify that the hereafter described safety components both in its basic design and
construction conform to the applicable European Directives.

Name of the safety component / type: SLC440COM

SLG440COM
(See ordering code)

Description of the safety component: Safety light curtain and

safety light grid

Relevant EC-Directives: 2006/42/EC-EC-Machinery Directive

2004/108/EC EMC-Directive

Applied standards: EN 61496-1, type 4

EN 61496-2
EN ISO 13849-1; PL e
EN 62061; SIL 3

Person authorised for the compilation Oliver Wacker

of the technical documentation: Mddinghofe 30
42279 Wuppertal

1RWLHGERG\IRUWKHSURWRW\SHWHVW TV Nord Cert GmbH

Langemarckstr. 20
45141 Essen
,'Q

(&SURWRW\SHWHVWFHUWLFDWH No. 44 205 13 1446 09

Place and date of issue: Boituva, July 24, 2015
ACE-SLC440COM-C-EN

Authorised signature
Marco Antonio De Dato
&RQVWUXFWLRQ 'HYHORSPHQW'HSDUWPHQW&KLHI

Production site:
ACE Schmersal
K.A. Schmersal GmbH & Co. KG Eletroeletrnica Industrial Ltda.
Mddinghofe 30, D - 42279 Wuppertal Av. Brasil, n 815
Postfach 24 02 63, D - 42232 Wuppertal Jardim Esplanada CEP: 18550-000, Boituva SP
Brazil
Phone +49 - (0)2 02 - 64 74 - 0 Phone +55 - (0)15 - 32 63 - 9866
Telefax: +49 - (0)2 02 - 64 74 - 1 00 Fax +55 - (0)15 - 32 63 - 9890
E-Mail: info@schmersal.com E-Mail: vendas@schmersal.com.br
Internet: http://www.schmersal.com Internet: http://www.schmersal.com.br

24 EN