Sei sulla pagina 1di 149

QUADRO DI UNIONE GENERALE

PROVINCIA DI
COMO

TRATTA C:
S.S. 35 - TANGENZIALE EST

TRATTA D:
TANGENZIALE EST - A4

A4

TANG. EST

"DESIO"

S.S. 35

TRATTA B2:
RIQUALIFICA S.S.35

S.S. 35

TRVA 14

"LENTATE"

TRATTA B1:
A9 - S.S.35

TRATTA B1
SVINCOLO LOMAZZO

A9

PROVINCIA DI LECCO

PROVINCIA DI MONZA E DELLA BRIANZA


PROVINCIA DI BERGAMO

TRVA 13

COLLEGAMENTO AUTOSTRADALE
DALMINE - COMO - VARESE - VALICO DEL GAGGIOLO E OPERE AD ESSO CONNESSE
CODICE C.U.P. E81B09000510004

TRATTE B1, B2, C, D, TRVA13+14, GREENWAY

INTEGRAZIONE AL PROGETTO ESECUTIVO


TRATTA B2 e C
CANTIERIZZAZIONE
TERRE E ROCCE DI SCAVO, CAVE E DISCARICHE
PIANO DELLA CARATTERIZZAZIONE AMBIENTALE DELLE AREE EX ICMESA AI SENSI DEL D.Lgs. 152/2006
ALLEGATO 2 AL TITOLO V PARTE IV - RELAZIONE TECNICA DESCRITTIVA

A0X

KN201

CN

RG

006 B_02

Agosto 2016
Bozza per commenti
Settembre 2016
Settembre 2016

B
B_01
B_02

GP ingegneria

srl

GESTIONE PROGETTI DI INGEGNERIA

Ing. Claudia Morici

Ing. Manuela Sorge

Ing. Alberto Cecchini

COLLEGAMENTO AUTOSTRADALE TRA A8 ED A4 TRATTE B1, B2, C, D


(DALLINTERCONNESSIONE A9 SVINCOLO DI LOMAZZO
ALLINTERCONNESSIONE A4 SVINCOLO DI OSIO SOTTO)
E TRVA13+14

INTEGRAZIONE AL PROGETTO ESECUTIVO


TRATTA B2 e C

CANTIERIZZAZIONE
TERRE E ROCCE DI SCAVO, CAVE E DISCARICHE
RELAZIONE TECNICA DESCRITTIVA DEI RISULTATI DELLA
CARATTERIZZAZIONE AMBIENTALE AI SENSI DEL
D.Lgs. 152/2006-All. 2 al Titolo V Parte IV

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

::: Sommario :::


1.

PREMESSA ....................................................................................................................................... 4

2.

QUADRO NORMATIVO E BIBLIOGRAFICO DI RIFERIMENTO .................................................... 9

3.

TRATTA B2 E C DESCRIZIONE DELLINTERVENTO IN PROGETTO ED


INTERFERENZE CON TERRITORIO INTERESSATO DALLINCIDENTE DEL
1976 (ICMESA) ................................................................................................................................ 12

4.

ATTIVIT PRELIMINARI DI INDAGINE REALIZZATE .................................................................. 15


4.1

ATTIVIT DI INDAGINE AMBIENTALE PRELIMINARE DEL MAGGIO E OTTOBRE 2008 DI


PROGETTO DEFINITIVO ..................................................................................................... 16

4.2

ATTIVITA' DI INDAGINE CONDOTTE DA ATI STRABAG NEL 2012 ......................................... 20

4.3

SINTESI FINALE DEI RISULTATI DI INDAGINE AMBIENTALE REALIZZATE PRIMA DEL 2016 . 22

5.

PIANO DI INDAGINE ADOTTATO .................................................................................................. 24

6.

MODELLO AMBIENTALE DI RIFERIMENTO ................................................................................ 26

6.1.1

Evento accidentale ICMESA ............................................................................................ 26

6.2

MAGLIA DI CAMPIONAMENTO ADOTTATA ........................................................................... 27

6.3

DESCRIZIONE DELLE ATTIVIT DI CARATTERIZZAZIONE REALIZZATE ................................. 28

6.4

MODALIT OPERATIVE DI REALIZZAZIONE DELLE INDAGINI ............................................... 29

6.4.1

Cantieramento per la realizzazione della campagna di caratterizzazione ............................ 34

6.4.2

Specifiche prelievo campioni Topsoil ............................................................................... 38

6.4.3

Specifiche prelievo campioni intermedi e profondi ............................................................ 39

6.4.4

Controllo qualit e catena di custodia dei campioni prelevati ............................................ 40

6.4.5

Monitoraggio Ambiente Sociale ....................................................................................... 41

6.5

ANALISI IN LABORATORIO DEI CAMPIONI E METODICHE ANALITICHE ADOTTATE ............... 41

6.5.1

Prelievo e conservazione campioni sino al laboratorio ...................................................... 41

6.5.2

Protocollo analitico da applicare ai campioni e limiti di riferimento .................................... 43

6.5.3

Limiti analitici di riferimento ........................................................................................... 44

6.5.4

Preparazione del Campione ............................................................................................ 44

6.5.5

Esecuzione delle analisi .................................................................................................. 47

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 2/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

6.5.6

Restituzione e trasmissione dei dati ................................................................................ 48

6.5.7

Conservazione aliquote residue ...................................................................................... 49

6.6
7.

RILIEVO PLANOALTIMETRICO ............................................................................................ 49


RESTITUZIONE DEI RISULTATI .................................................................................................... 51

7.1

VALORE ANALITICO MEDIO (MEDIUM BOUND) ................................................................... 52

7.1.1

Risultati analitici suolo ................................................................................................... 52

7.1.2

Analisi dei risultati ......................................................................................................... 54

7.2

VALUTAZIONE TECNICA E ANALISI IN CONTRADDITTORIO DA PARTE DI ARPA ................... 67

7.2.1

Risultati analitici suolo ................................................................................................... 67

7.2.2

Confronto con i risultati presentati nel paragrafo 7.1........................................................ 69

ALLEGATO 1A-1D: PLANIMETRIA UBICAZIONE PUNTI DI INDAGINE .................................................... 74


ALLEGATI 2A-2D: IDENTIFICAZIONE ESUBERI CSC A E CSC B (VALORI
ANALITICI MEDIUM BOUND) ........................................................................................................ 75
ALLEGATO 3: VALIDAZIONE ARPA DELLA CARATTERIZZAZIONE - FASCICOLO
2016.6.77.856 E RAPPORTI DI PROVA ARPA DEI CAMPIONI ESEGUITI IN
CONTRADDITTORIO ...................................................................................................................... 76
ALLEGATO 4: VALIDAZIONE ARPA DELLA CARATTERIZZAZIONE - FASCICOLO
2016.6.77.984 E RAPPORTI DI PROVA ARPA DEI CAMPIONI ESEGUITI IN
CONTRADDITTORIO ...................................................................................................................... 77
ALLEGATO 5: ELENCO ISTANZE A COMUNI INTERESSATI E ELENCO ART. 15
NOTIFICATI AI SINGOLI PROPRIETARI INTERESSATI .............................................................. 78
ALLEGATO 6: RISULTATI CARATTERIZZAZIONE ..................................................................................... 79
ALLEGATO 7: RAPPORTI DI PROVA CARATTERIZZAZIONE................................................................... 80
ALLEGATO 8: RASSEGNA STAMPA ........................................................................................................... 81

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 3/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

1. PREMESSA
La presente relazione stata redatta al fine di illustrare i risultati prodotti dallattivit di caratterizzazione
ambientale delle aree interessate dal tracciato della nuova Autostrada Pedemontana Lombarda e
interessate dallincidente ICMESA. Lelaborazione dei risultati, qui presentati, ottempera ai criteri generali
per la caratterizzazione definiti allAll. 2 al Titolo V della parte IV del D.Lgs. 152/06 e s.m.i..
Come meglio descritto nei capitoli successivi, le attivit di indagine preliminare condotte dalla Soc.
Autostrada Pedemontana Lombarda (di seguito APL) ai sensi del T.U. 152/2006 e S.m.e.i. (condotte nel
2008), hanno evidenziato, in corrispondenza di alcune aree che saranno interessate dal progetto della
futura autostrada, condizioni di esubero dei limiti (matrice terreno) previsti per il parametro diossine sia per
aree a destinazione duso industriale, che verde/residenziale. Tale situazione veniva definita nel Progetto
Definitivo (0133_D_ST_GE000_GE00_147_SD_002_A) come non passibile di bonifica poich larea
dellincidente ICMESA era considerata gi bonificata con una legge speciale e presentava un inquinamento

diffuso; infatti la norma transitoria di cui allart. 18 del D.M. 25 ottobre 1999 n. 471, sancisce la validit
dei progetti di bonifica delle aree inquinate approvate prima dellentrata in vigore della suddetta norma.
Successivamente alla consegna della Progettazione Esecutiva, in data 17 settembre 2013, il Consiglio
Regione Lombardia, con deliberazione n. X/123, ha approvato una mozione con la quale ha impegnato il
Presidente e la Giunta Regionale a richiedere ad APL, quale soggetto interessato non responsabile,
un piano di caratterizzazione delle aree del tracciato dellOpera, interessate dallincidente ICMESA del 1976;
Al fine di ottemperare alla richiesta di Regione Lombardia, APL ha richiesto allAppaltatore ATI Strabag la
redazione del suddetto Piano di Caratterizzazione in conformit a quanto previsto dal D.Lgs. 152/2006 e
ss.mm.ii., il quale stato consegnato alla Regione Lombardia ed a tutti gli Enti competenti in data 3 Marzo
2015.
A valle di apposita conferenza di servizi, Regione Lombardia ha approvato il Piano di Caratterizzazione, con
Decreto Regionale n. 8202 del 08.10.2015, pubblicato sul BURL - S.O. n. 42 del 12 Ottobre 2015.

Le attivit di indagine della caratterizzazione ambientale hanno avuto inizio in data 03 Maggio 2016. In
linea con lo stesso cronoprogramma, la caratterizzazione si conclusa il giorno 30 Giugno 2016. Le attivit
di laboratorio, che hanno previsto anche lanalisi dei campioni integrativi, in accordo con il PdC, sono
terminate ad agosto 2016.
Lattivit di perforazione stata preceduta da una assidua campagna di verifica topografica dei punti
individuati nel piano di caratterizzazione; tale fase preliminare, condivisa con APL, CAL, ARPA, gli enti
gestori dei sottoservizi ed i comuni interessati, ha consentito la ricollocazione di alcuni punti al fine di:

minimizzare il disturbo della popolazione locale;

evitare il taglio di alberature / boschi;

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 4/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

superare difficolt logistiche di accessibilit alle aree (es. scarpate della superstrada Milano Meda);

scongiurare il rischio di interferire con le numerose reti di sottoservizi presenti nelle aree di
intervento.

Lautostrada pedemontana lombarda affidata allATI Strabag, il cui sviluppo lineare di circa 58 Km, si
snoda attraverso 4 Province, interessando numerosi Comuni. A livello progettuale il tracciato suddiviso in
5 Lotti distinti. La realizzazione della nuova autostrada Pedemontana Lombarda, secondo la progettazione
approvata dagli Enti, prevede un tracciato che, andando a potenziare e riqualificare lattuale superstrada
Milano - Meda, attraverser i territori dei Comuni che furono interessati dagli effetti dellincidente ICMESA
del 1976.
Le aree interessate dallincidente Icmesa ricadono nelle tratte B2 e C, nel territorio dei

Comuni di

Barlassina, Cesano Maderno, Desio, Meda, Seveso e Bovisio Masciago.


In corrispondenza del settore relativo a questi Comuni, il tracciato di progetto della futura Pedemontana
Lombarda, presenta uno sviluppo con direzione prevalente nord sud. Una volta superato lo svincolo di
Cesano Maderno, il tracciato assume una direzione prevalente Est-Ovest.
Nel 1976, labitato di Meda stato teatro di un grave incidente industriale determinatosi allinterno
dellarea industriale della Soc. ICMESA. Questo caus la formazione di una nube tossica con conseguente
dispersione in atmosfera di diossina. I successivi fenomeni di ricaduta determinarono il deposito al suolo
dellinquinante con conseguente contaminazione del territorio.
Conseguenza di tale evento fu la contaminazione diffusa dellabitato di Meda, Seveso e di parte dei territori
comunali confinanti e posti lungo la direttrice di migrazione della nube tossica in funzione dei venti che
spiravano nei giorni in cui avvenne lincidente.
Le attivit di bonifica che furono intraprese hanno:

previsto linterruzione dellattivit produttiva e la successiva demolizione della Fabbrica ICMESA,

determinato la zonizzazione del territorio interessato dalla contaminazione con successiva


pianificazione e realizzazione di interventi di bonifica e mitigazione.

In corrispondenza delle aree a maggiore contaminazione fu realizzata la rimozione di parte dei terreni
affioranti successivamente gestiti secondo le modalit indicate dagli Enti. A tale scopo furono realizzate tre
discariche che accolsero i terreni oggetto di bonifica (si precisa che in progetto definitivo venivano
individuati n. 2 siti ubicati a Meda e a Seveso) e diverse fosse di stoccaggio degli animali morti o abbattuti
(di cui una resa nota a Cesano Maderno attraverso una testimonianza raccolta dal proprietario di una
azienda agricola allora investita dalla nube tossica). Su tutte le aree interessate dallevento furono istituite
delle limitazioni (duso e di edificabilit) definite da apposito quadro normativo e da questo regolamentate
nel corso degli anni.

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 5/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

Figura 1 Ubicazione Vasche Di Meda E Seveso Dis 11

Figura 2 Ubicazione Vasca 3 cesano Maderno e presunta fossa per stoccaggio animali
Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 6/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

Tale rilevante aspetto ambientale, ha quindi guidato alla conduzione di attivit dindagine volte ad acquisire
indicazioni preliminari relative al territorio che sar interessato dal nuovo tracciato autostradale fornendo
elementi in grado di guidare alla ricostruzione del modello locale e quindi permettere la successiva
programmazione di interventi di caratterizzazione ambientale.
In seguito alla pubblicazione della mozione (D.C.R. 17/09/13 n. X/123) del 17/09/2013, il Consiglio
Regionale Lombardo ha richiesto la redazione di un piano di caratterizzazione imposto secondo i requisiti

di legge (D. Lgs. 152/06) e, a valle di questo, la bonifica delle aree che risultano inquinate e il corretto
smaltimento delle terre contaminate in siti idonei a riceverle.
A fronte dei risultati della caratterizzazione il progetto esecutivo dellopera potrebbe subire delle
ottimizzazioni.
Il presente elaborato tecnico viene quindi redatto con lo scopo illustrare e descrivere le risultanze analitiche
necessarie delle attivit di caratterizzazione ambientale, progettate secondo il vigente quadro normativo
(Art. 242 del D. Lgs 152 del 2006), al fine di identificare e delimitare adeguatamente tutte le condizioni di
criticit del terreno ad oggi presenti e ricadenti nelle aree che ospiteranno le attivit di costruzione della
nuova autostrada Pedemontana Lombarda e quindi progettare le eventuali azioni di bonifica delle aree.
In dettaglio, le attivit di indagini sono state eseguite con richiamo all All. 2 al Titolo V della parte IV del
D.Lgs. 152/06 con lobiettivo di:

verificare l'esistenza di inquinamento di suolo e sottosuolo e acque sotterranee;

definire il grado, l'estensione volumetrica dell'inquinamento;

individuare le possibili vie di dispersione e migrazione degli inquinanti dalle fonti verso i potenziali
ricettori;

ricostruire le caratteristiche geologiche ed idrogeologiche dell'area al fine di sviluppare il modello


concettuale definitivo del sito;

ottenere i parametri necessari a condurre nel dettaglio l'analisi di rischio sito specifica;

individuare i possibili ricettori.

In relazione al tipo inquinamento, alla elevata affinit per il suolo e alla bassissima solubilit delle diossine,
il PdC approvato dalla CdS non ha previsto analisi delle acque sotterranee, come pi diffusamente illustrato
nel capitolo 5.
Come meglio descritto nei prossimi capitoli, si ribadisce che i settori che sono stati interessati dalle attivit
di Caratterizzazione ambientale, sono quelli che saranno interessati dal futuro tracciato autostradale della
Pedemontana Lombarda e comunque le aree interessate da esproprio o da occupazione temporanea per la
realizzazione del suddetto collegamento autostradale, posti allinterno della perimetrazione condotta nel
1977 dalle autorit per delimitare le aree interessate dagli effetti dellincidente ICMESA, ad eccezione di
alcuni punti ricadenti in comune di Bovisio Masciago e ubicati fuori dallarea R.
Indicativamente i limiti laterali di queste aree sono definiti dalle piante scavi di Progetto Esecutivo Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 7/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

comunque rientranti nelle aree di esproprio che costeggiano a vario modo il futuro asse autostradale mentre i limiti di inizio e fine saranno definiti dallintersezione del tracciato con la perimetrazione del
1977.
Negli allegati grafici al presente elaborato sono evidenziati i limiti di intervento precedentemente descritti.
Linterpretazione delle risultanze analitiche della caratterizzazione permetteranno di identificare il livelli di
concentrazione residua accettabili, in base ai quali condurre una corretta pianificazione dei futuri interventi
di bonifica volti a gestire le criticit ambientali eventualmente evidenziate dalle operazioni di
caratterizzazione.

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 8/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

2. QUADRO NORMATIVO E BIBLIOGRAFICO DI RIFERIMENTO


Il presente documento, e le proposte attivit di caratterizzazione delle aree, si basano sul vigente quadro
normativo in materia di ambiente e gestione di siti contaminati.

Dlgs. N.152 2006 Testo unico in materia ambientale (Art. 242);


Provvedimenti statali

Con D.L. 10 agosto 1976, n.542, convertito nella legge 8 ottobre 1976, n.688 (Interventi urgenti
per le popolazioni della zona colpita dallinquinamento da sostanze tossiche verificatosi in Provincia
di Milano il 10 luglio 1976);

Decreto del Presidente del Consiglio dei Ministri 4 agosto 1976, fu costituita una Commissione
speciale tecnico-scientifica, con il compito di studiare e proporre misure di decontaminazione,
presieduta dal Presidente del Consiglio superiore di Sanit, prof. Aldo Cimmino, da cui prese il
nome;

DL 2 giugno 1978,n.339.
Provvedimenti regionali

La legge 688/76 prevedeva che le modalit ed i criteri degli interventi venissero determinati con
leggi regionali. In attuazione di questa disposizione, la Regione Lombardia approv la l.r.17
gennaio 1977, n.2 (Interventi per le popolazioni della zona colpita dallinquinamento da sostanze
tossiche verificatosi in Provincia di Milano il 10 luglio 1976), che definiva i programmi operativi;
il 7 ottobre 1976 il Consiglio Regionale approva la mappatura stabilita dalla Commissione Cimmino
risale allagosto 1976
Il 2 giugno 1977, con Del. II/448, il Consiglio regionale approv i programmi operativi, trai quali il
primo era dedicato ai problemi della bonifica (inclusi i controlli sullinquinamento dellambiente e le
sperimentazioni circa i metodi di decontaminazione), con la definizione degli interventi da attuarsi,
dei tempi di attuazione, dei soggetti responsabili e delle somme necessarie;

l.r. 17 giugno 1977, n.27 (Norme per lattuazione dei programmi operativi di cui alla l.r. 2/27 nella
zona della Provincia di Milano inquinata da sostanze tossiche), venne istituito un Ufficio Speciale
decentrato della Regione, con sede a Seveso, a cui competeva assicurare la maggior tempestivit e
il coordinato svolgimento degli interventi e dei servizi di tutte le pubbliche amministrazioni e dei
privati. A tale Ufficio venne preposto un incaricato speciale con ampi poteri, a cui di fatto
corrispondeva il rango di assessore regionale;

L.R. 23 luglio 1979, n.39 (Nuovi interventi).

L.R. 27 maggio 1985, n.60 (Istituzione di vincoli e destinazioni duso nellarea bonificata ai sensi
della l.r. 17 maggio 1977, n.2)

Decreto del Presidente della Regione Lombardia n.1368 del 23 dicembre1986

17/09/2013 - Mozione del Consiglio Regionale della Lombardia concernente lautostrada

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 9/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

Pedemontana (D.C.R. 17/09/13 n. X/123) nella quale, il Consiglio Regionale riconosce che gli
interventi di bonifica sono stati a suo tempo condotti limitatamente alla zona A, mentre larea B
restava tuttavia inquinata. Lorgano di governo richiede quindi esplicitamente ad APL la redazione
di un piano di caratterizzazione imposto secondo i requisiti di legge (D.Lgs. 152/06) e, a valle di
questo, la bonifica delle aree che risultano inquinate e il corretto smaltimento delle terre
contaminate in siti idonei a riceverle

Decreto Regionale n. 8202 del 12 ottobre 2015 Approvazione del Piano di Caratterizzazione delle
Aree delIncidente ICMESA, pubblicato sul BURL - S.O. n. 42.

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 10/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

Nelle zone colpite da inquinamento tossico il 10.7.1976, furono rafforzati i poteri dellUfficio Speciale, che
assumeva ormai quasi tutte le funzioni gi delegate alla Provincia, e venne istituito un archivio generale per
la raccolta, conservazione e classificazione di tutti gli atti riguardanti i programmi dintervento. Lultima
legge e lunica tuttora operante la l.r. 27 maggio 1985, n.60 (Istituzione di vincoli e destinazioni duso
nellarea bonificata ai sensi della l.r. 17 maggio 1977, n.2), la quale stabilisce che, nelle aree gi
interessate da operazioni di bonifica e ripristino ambientale, fatto divieto di qualsiasi attivit edificatoria o
di trasformazione del suolo e del sottosuolo, ad eccezione degli interventi necessari alla manutenzione
ordinaria e straordinaria dei manufatti realizzati nellambito della bonifica, nonch delle attivit conservative
e migliorative per lambiente boschivo. Lultimo provvedimento amministrativo di questa fase storica il
Decreto del Presidente della Regione Lombardia n.1368 del 23 dicembre1986, con il quale, preso atto che il

programma operativo della bonifica era ormai ultimato, si provvide a chiudere lUfficio Speciale di Seveso
ed a trasferire al Settore Ambiente ed Ecologia della Giunta regionale la gestione della convenzione con
lAzienda regionale delle Foreste per la manutenzione del Bosco delle Querce e dei con-tratti con lISMES di
Bergamo per il monitoraggio delle vasche e con la ditta Bellingeri di Seveso per la depurazione del
percolato.
Come richiesto dal Comune di Desio in sede di CdS del 9 Aprile 2015, vengono di seguito elencati, a titolo
informativo, alcuni studi storici nel tempo condotti sul territorio oggetto della proposta di caratterizzazione:

Fondazione Lombardia per LAmbiente ANALISI DI RISCHIO RELATIVA ALLA PRESENZA DI

DIOSSINA RESIDUA NELLA ZONA B DI SEVESO (Antoniotti, Pastorelli, Ballarin Denti) - Aprile
2003

Fondazione Lombardia per LAmbiente SEVESO VENTANNI DOPO. DALLINCIDENTE AL BOSCO

DELLE QUERCE (M. Ramondetta, A. Repossi) Maggio 1998

Contratto N 14918-1999-03 T1 ED ISP I Rapporto finale - Campionamento analitico della zona

B di Seveso e Comuni limitrofi per la ricerca della 2,3,7,8-TCDD residua (V fase) e accordo
aggiuntivo per la Zona A (M. Barbiere, G. Umlauf, H. Skejo-Andresen) - 1999

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 11/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

3. TRATTA B2 E C DESCRIZIONE DELLINTERVENTO IN PROGETTO


ED
INTERFERENZE
CON
TERRITORIO
INTERESSATO
DALLINCIDENTE DEL 1976 (ICMESA)
Le aree interessate dallincidente Icmesa interessano prevalentemente la tratta B2, il cui progetto prevede
il potenziamento e la riqualificazione in sede della S.S. 35 Milano Meda tra i comuni di Lazzate e Cesano
Maderno, rendendola, di fatto, parte integrante del tracciato autostradale, ed il tratto iniziale della tratta C,
sino a quella che sar la futura area di servizio di Desio.
Il territorio interessato dalla costruzione della presente tratta risulta fortemente urbanizzato, poich
percorre aree densamente abitate. Le superfici agricole sono molto limitate ed interessate marginalmente
dal nuovo tracciato autostradale che si sovrappone alla stessa SS 35. I residui di vegetazione naturale che
delimitano gli appezzamenti coltivati sono gli unici elementi di diversificazione del paesaggio.
La zona di intervento interessa tre diverse aree di tutela ambientale: il Parco della Brughiera Briantea, il
Bosco delle Querce e il parco delle Groane.
Il Bosco delle Querce, sito tra Seveso e Meda, a sud dello svincolo della S.S. 35, caratterizzato da un
elevatissimo valore simbolico, tecnico, culturale quale area verde pianificata in un contesto territoriale a
grande densit antropica. A seguito della contaminazione da diossina che colp larea di Seveso nel luglio
del 1976, il 2 giugno 1977, il Consiglio Regionale della Lombardia approv i programmi di intervento per
bonificare il territorio inquinato. Abbandonata lidea di costruire un forno inceneritore per eliminare tale
materiale, tra il 1981 e il 1984, furono costruite tre vasche impermeabilizzate dove esso potesse essere
depositato:

La capacit della vasca di Seveso di 200.000 m,

La capacit della vasca di Meda di 80.000 m

La capacit della vasca di Cesano Maderno non nota.

Per la messa in sicurezza del materiale contaminato, in gran parte rappresentato dal terreno di superficie
che fu tolto dallintero territorio (Zona "A"), stato adottato un sistema di quattro barriere successive.
Allinterno della vasca di Seveso sono contenuti i resti delle case, gli oggetti personali, gli animali morti o
successivamente abbattuti a seguito dellincidente e parte delle attrezzature utilizzate per la bonifica.
Allinterno della vasca di Meda sono contenuti i detriti delle demolizioni ello stabilimento ICMESA e parte
delle attrezzature utilizzate per la bonifica.
Riguardo al contenuto della vasca di Cesano Maderno non si hanno informazioni certe.
Come sopra detto, non si conoscono le ubicazioni delle fosse contenenti gli animali morti o abbattuti, ad
eccezione di quella di Cesano Maderno contenente tutti i capi (bovini e pollame) di una grande azienda
agricola locale.

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 12/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

La terra che oggi costituisce lo strato superficiale del bosco proviene da altre zone della Lombardia (non
noto con precisione lo spessore dello strato superficiale degli scotici a suo tempo effettuati). Nel 1983 si
decise di progettare un parco in quella che era la Zona "A": i lavori ambientali e forestali iniziarono nel
1984 e terminarono nel 1986. La scelta di realizzare un bosco dopo lasportazione del terreno si deve
anche ai movimenti popolari che sorsero a Seveso dopo lincidente e che si opposero con forza alla
decisione iniziale della Regione Lombardia di costruire un forno inceneritore per bruciare tutto il materiale
inquinato. Le aree di rispetto comprendono gli impianti tecnologici ossia le due colline che ospitano le
vasche con i residui della bonifica, delimitate da una spessa barriera arbustiva e una superficie compresa
tra la superstrada, lo svincolo e larea di fruizione intensiva di Meda.
Lo svincolo di Meda, situato ad est del torrente Certesa, si snoda su aree fittamente vegetate, che
costituiscono la testa nord del Bosco delle Querce e ne sostengono e ampliano il valore di unicit
ambientale dellintero comparto. Il tratto non presenta particolari criticit per la componente ambientale,
ma risulta particolarmente significativo per azioni di riqualificazione dellambito urbano. Il bosco delle
Querce e le superfici agricole a est della Milano-Meda costituiscono, territorialmente, la testa di un sistema
potenziale di riqualificazione a verde di spazi pubblici, risultanti dalladeguamento del tracciato autostradale
sul sedime della ex Milano-Meda.
Nel tratto in attraversamento del comune di Cesano Maderno caratterizzato dai tessuti residenziali,
commerciali e industriali affacciati sulla Milano-Meda, risulta di particolare interesse lampio comparto
costituito da aree agricole residuali e superfici a verde pubblico, delimitato a nord dalla ferrovia e la Via
Don Sturzo e, a sud dalla la Via Beato Angelico. Tale tassello risulta di valore strategico ai fini della
creazione di un ampio quadro di riqualificazione di aree pubbliche a ricongiunzione di margini urbani a
cavallo dellasse stesso.
Lo svincolo di Cesano Maderno, localizzato in corrispondenza dellintersezione dellAutostrada Pedemontana
con la S.S. 35, stato progettato in modo da rispondere alle seguenti esigenze: consentire la prosecuzione
del percorso autostradale verso nord (tratta B2), garantire i collegamenti dellautostrada con lasse di
penetrazione verso sud (verso Milano) e con la viabilit locale.
Tali esigenze sono state realizzate mediante un complesso ed articolato sistema di rampe, da diverse
rotatorie (nelle quali vengono risolte le manovre tra i flussi di traffico da/per lautostrada ed i flussi che
impegnano la viabilit locale) e da alcune opere darte necessarie per realizzare le intersezioni a livelli
sfalzati, comprendenti alcuni cavalcavia e quattro tratti in galleria artificiale.
Il tratto terminale in prossimit della connessione con la tratta C della Pedemontana, un tratto
completamente urbanizzato, di difficile penetrazione trasversale. I tessuti sono prevalentemente
commerciali, sviluppati in aderenza al sedime stradale. Le aree a verde sono costituite dalle aree di rispetto
del cimitero a ovest del tracciato e da unarea residuale ad orti urbani tra le vie Valassina e Valtellina, in
aderenza al tracciato stesso.

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 13/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

Il progetto esecutivo della tratta B2 inoltre, ha recepito nel tratto compreso nello svincolo di Meda la
cosiddetta Variante di Meda (prescrizioni e raccomandazioni contenuti nella Delibera CIPE di
approvazione del progetto definitivo) che prevede la revisione del tracciato per ridurre gli scavi con
allargamento in sede tra il km 5+100 e il km 6+900 circa.
Con la riqualifica in sede del tratto esistente si ottenuto:

1. Un minor impatto sull'area del Bosco delle Querce tramite una minore occupazione di bosco.
2. Un miglioramento del tracciato e della sicurezza attraverso:

un ritracciamento del tratto interessato dall'intervento con conseguente inserimento di


curve di transizione;

l'inserimento degli allargamenti per la visibilit in prossimit delle curve


l'adeguamento della larghezza dello spartitraffico;

l'adeguamento delle corsie di marcia;

l'inserimento della corsia di emergenza e delle piazzole di sosta.

Lo scostamento si reso necessario proprio per limitare linterferenza con il parco delle Querce.
Lautostrada dal punto di vista altimetrico infatti nel primo tratto risulta in rilevato: questa soluzione ha
consentito di limitare al massimo i movimenti terra nelle aree contaminate da diossina a seguito
dellincidente dellICMESA.
Si sottolinea inoltre come la progettazione esecutiva abbia tenuto in stretta considerazione tutte le aree che
negli anni, sono state variamente interessate da interventi di ricollocamento terre provenienti da interventi
di bonifica. A tale riguardo in tutti gli allegati sono evidenziate le due vasche di confinamento terreni (di
Meda, Seveso) , la terza vasca di Cesano Maderno e lipotetica posizione della fossa di Cesano Maderno.
.

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 14/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

4. ATTIVIT PRELIMINARI DI INDAGINE REALIZZATE


Le aree del territorio comunale di Seveso e dei comuni interessati dal futuro tracciato dellautostrada
Pedemontana, sono state oggetto di attivit di indagine ambientale preliminare.
La campagna di indagine per la verifica delle concentrazioni della diossina nel terreno stata condotta da
APL in sede di redazione del Progetto Definitivo ad aprile-maggio e ottobre del 2008. Infatti, nel maggio
del 2008 APL, di concerto con ARPA Lombardia, ha pianificato e realizzato unindagine preliminare le cui
evidenze (superamenti di CSC colonna A e B della Tab.1 Allegato IV alla parte V del D.lgs. 152/06) hanno
richiesto la necessit di pianificare e condurre una ulteriore campagna di approfondimento (ottobre 2008).
In ottemperanza alle specifiche di Progetto Esecutivo lAppaltatore ha condotto indagini integrative tra
agosto e dicembre del 2012.
Nei prossimi capitoli saranno presentate le campagne di indagine realizzate e commentati i risultati
prodotti.

Sulla scorta dei risultati, che evidenziano alcune condizioni di esubero dei limiti di riferimento adottati,
stato approvato dalla CdS del 29 Luglio 2015 il piano di caratterizzazione dellintero settore lungo cui si
proceder alla realizzazione della futura opera autostradale.

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 15/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

4.1
ATTIVIT DI INDAGINE AMBIENTALE PRELIMINARE DEL MAGGIO E
OTTOBRE 2008 DI PROGETTO DEFINITIVO
La prima attivit di indagine stata condotta nel periodo compreso tra aprile e maggio del 2008.
Gli interventi sono stati progettati dalla Soc. Golder Associates su incarico di APL. Il piano di investigazione
preliminare stato oggetto di valutazione da parte degli Enti di controllo i quali, dopo aver avanzato alcune
prescrizioni tecniche volte a garantire un maggior dettaglio e completezza di indagine, hanno provveduto
alla approvazione dello stesso.
Le attivit hanno consentito la realizzazione di 63 saggi investigativi distribuiti lungo tutto il settore di
progetto nel quale previsto l'attraversamento del territorio interessato dallincidente ICMESA da parte
della futura autostrada pedemontana lombarda. Da questi saggi sono stati prelevati 127 campioni di
terreno.
In allegato 1 visibile la distribuzione areale dei punti di investigazione preliminare, i quali sono stati
ubicati sulla base del tracciato previsto dalla progettazione definitiva dell'opera autostradale.
Si pu osservare come i punti dellindagine del 2008 ricadano in corrispondenza delle tre aree di
classificazione (Area A, Area B ed Area R) che individuano i settori nei quali, a seguito dell'incidente
accorso nel 1976, stato suddiviso il territorio dei Comuni interessati dalla nube tossica (Seveso,
Meda,Desio, Cesano Maderno e Bovisio Masciago)

Figura 3 Area contaminazione (da Progetto definitivo)

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 16/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

Questa suddivisione del territorio, definita nel 1976 dagli Enti preposti alla gestione delle operazioni di
bonifica, prevedeva la definizione di 3 distinte aree caratterizzate da differenti livelli di contaminazione;

Area A (108 ha) - Zona a Alta contaminazione. Inquinamento maggiore a 50 g/mq fino a
punte maggiori di 1.000 g/mq;

Area B (269 ha) - Zona a Media contaminazione. Inquinamento compreso tra 5 e 50 g/mq;

Area R (1.403 ha) - Zona ad Bassa contaminazione. Inquinamento inferiore a 5 g/mq o nullo;

Questa prima indagine preliminare ha consentito la formazione di 127 campioni prelevati in corrispondenza
dei 63 punti di campionamento. Data la modalit con la quale le diossine furono disperse sul territorio
(aereo dispersione e successiva ricaduta al suolo), unitamente alla ridotta mobilit della molecola della
diossina tramite fenomeni di fate & transport dovuta alla sua elevata capacita di adesione alla matrice
terreno (con particolare affinit alle particelle argillose), il piano di investigazione ha previsto
principalmente il prelievo di campioni superficiali, provvedendo comunque a prelevare anche campioni a
maggiori profondit (massima profondit di campionamento pari a 6,2 m).
In sintesi risulta quindi possibile indicare in 108 i campioni prelevati entro il primo metro (campione
superficiale) e in 19 i campioni prelevati oltre il primo metro (campioni profondi).
Confrontando i risultati con i limiti di legge adottati per le aree a destinazione duso industriale, risulta
possibile identificare 10 campioni in esubero distribuiti su 10 verticali di campionamento (saggi). In
tabella 1 si riportano le risultanze analitiche della sommatoria di PCDD/DF espresse in ngE kg -1, relative ai
campioni prelevati dal top soil (TS) e dallo strato intermedio (I, a profondit tra 50 e 80 cm da p.c.). In
giallo sono riportati i superamenti delle CSC di colonna A (evidenziati in giallo) e delle CSC colonna B
(evidenziati in rosso).

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 17/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO
Sondaggio

x [m]

y [m]

Zona

PCDD come TEQ PCDD come TEQ


ng/kg SS-TS
ng/kg SS-I

Sondaggio

x [m]

y [m]

Zona

PCDD come TEQ PCDD come TEQ


ng/kg SS-TS
ng/kg SS-I

146651,98

241298,47

33

147223,58

239705,04

12

146626,04

241431,51

110

34

147275,66

239516,85

0,6

0,6

146576,94

241587,73

35

147955,47

239196,35

18

146230,79

242646,76

16

158

36

147972,57

239269,43

22

146304,62

242606,82

37

148053,43

239331,63

40

146330,03

242315,13

38

148081,42

239417,15

140

0,6

146348,1

242422,75

39

146466,66

242195,35

40

146344,21

242514,1

0,6

40

146650,92

241517,81

36

0,6

146207,79

242726,64

141

41

146753,54

241164,85

136

10

146390,55

242244,93

19

71

42

146759,96

240958,48

53

73

11

146422,02

242104,54

43

146941,68

240528,9

31

12

146477,69

241918,15

24

44

147056,25

240023,75

18

13

146524,89

241766,86

45

147888,61

239117,05

17

0,6

14

146226,68

242234,18

46

148148,28

239465,35

32

15

145968,15

242812,57

0,6

47

147482,78

238675,46

23

16

146047,11

242784,04

0,6

10,6

48

147632,05

238658,36

15

17

146129,12

242725,43

43

49

147616,08

238747,67

15

18

146530,28

241992,7

35

50

147788,19

238758

21

19

146574,52

241883,05

74

197

51

147881,06

238931,86

14

20

146633,45

241680

95

14

52

146320,26

242728,94

39

21

146567,83

241800,11

190

33

53

146420,81

242637,36

168

22

146725,83

241346,56

54

146456,41

242482,39

49

23

146730,65

241254,9

57

55

147307,08

239016,86

14

24

146695,74

241176,03

56

147195,17

239307,32

25

146833,05

240951,81

121

81

57

147369,06

238422,28

26

146874,67

240745,36

151

58

147099

238696

27

146915,79

240372,9

59

147326,94

238767,87

28

147017,87

240289,44

20

60

147603,05

239080,79

21

29

147066,11

240129,85

18

61

148235,07

239580,52

36

30

146859,27

240626,85

14

62

148410,48

239649,35

33

31

147134,49

239930,26

24

63

148506,74

239699,49

19

32

147158,99

239860,12

28

64

146923,68

240446,61

24

53

Tabella 1 Superamenti CSC colonna A (evidenziato in giallo), e colonna B (evidenziato in


rosso)-Caratterizzazione Maggio 2008. Limiti riferiti a Tabella 1, All. 5 al Titolo V, parte IV
D.Lgs 152/06

Tutti i 10 esuberi di CSC colonna B (D.Lg. 152/06) identificati ricadono internamente al primo metro dal
p.c..
Osservando la suddivisione in aree omogenee del territorio interessato dagli effetti dellincidente ICMESA,
possibile osservare come 3 degli esuberi riconosciuti (punti 9, 4 e 53) risultino posizionati nel settore
posto pi prossimo allarea oggetto dellincidente industriale accorso, mentre i rimanenti 7 omogeneamente
distribuiti lungo il settore di indagine.
Il riconoscimento delle 10 condizioni di esubero, emerse in occasione dellindagine preliminare del maggio
2008, ha determinato la necessit di pianificare e condurre una attivit integrativa volta alla delimitazione
delle condizioni di criticit evidenziate.
I progettisti di questa campagna di indagine hanno quindi identificato 6 settori definiti Aree di
Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 18/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

approfondimento ed evidenziati nell allegato 3 del Piano di Caratterizzazione. In corrispondenza di queste


aree sono stati realizzati 20 nuovi saggi investigativi, dai quali sono quindi stati prelevati 34 campioni
di terreno da sottoporre successivamente ad analisi di laboratorio.
Questi nuovi saggi investigativi (sondaggi 6584), sono stati ubicati con lo scopo di garantire una
adeguata copertura areale in corrispondenza dei sondaggi di aprile 2008, nei quali erano state riconosciute
condizioni di esubero dei limiti di riferimento adottati (Colonna B).
Oltre a tale esigenza i nuovi saggi hanno anche permesso di integrare dati in corrispondenza di aree prive
di condizioni di esubero.
I campioni, relativi a questa attivit integrativa, hanno mostrato la presenza di ulteriori 5 condizioni di
esubero, rispetto alle CSC di colonna B del D.Lgs 152/06, poste in corrispondenza di altrettanti punti di
investigazione; la tabella 2 riporta i risultati per ciascuno dei sondaggi eseguiti.
Sondaggio

x [m]

y [m]

Zona

PCDD come TEQ PCDD come TEQ


ng/kg SS-TS
ng/kg SS-I

65 146211,4627 242680,6873

66 146244,1541 242701,7762

632

67 146283,6119 242654,6358

68 146255,2088 242599,7791

29

69 146353,1967 242675,8496

547

70 146429,5761 242629,4037

166

71 146544,7728 241906,2929

40

72 146549,7325 241867,7857

373

73 146599,8498 241790,0228

84

74 146578,6901 241759,2456

151

75 146600,1979 241464,2686

0,6

76 146645,2127 241345,4994

77 146766,2684 241111,9654

71

78 146783,9712

241064,458

54

79 146804,2018 241023,5205

31

80

146822,921 240925,3363

98

81 146844,6705 240866,2041

51

82 148051,1866 239407,7968

16

83 148102,1665 239440,1407

44

84 148107,7063 239374,9866

31

Tabella 2 Superamenti CSC colonna A (evidenziato in giallo), e colonna B (evidenziato in


rosso)-Caratterizzazione Ottobre 2008. Limiti riferiti a Tabella 1, All. 5 al Titolo V, parte IV
D.Lgs 152/06

Anche queste criticit, analogamente a quanto osservato per i campioni dellindagine di aprile 2008, sono
esclusivamente relative a campioni superficiali (massima profondit di 0,75 m relativamente al punto 66).
Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 19/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

In merito alla destinazione futura delle aree oggetto di indagine, la gran parte di quelle oggetto degli
interventi per la realizzazione dellopera autostradale si caratterizzeranno per una destinazione duso
industriale. Solo alcune aree, interessate da interventi di mitigazione ambientale ed evidenziate negli
allegati alla presente relazione, avranno una destinazione duso di tipo Verde / residenziale.
Anche per le aree tecniche (B2.AT3, B2.AT4 e B2.AT7) e di cantiere (B2.O2), rappresentate nelle
planimetrie in allegato rispettivamente con retinato blu e rosso, una volta terminate le attivit di
realizzazione dellinfrastruttura autostradale, si prevede una futura destinazione duso verde/residenziale.
Verificando gli esiti delle campagne di indagine del 2008 condotte da APL risultano 7 verticali in queste
aree che presentano delle condizioni di esubero dei limiti di colonna A.
Questi punti risultano essere

4.2

Indagine preliminare del 2008 Saggi 16, 30, 40, 42 e 43;

Indagine integrativa del 2008 Saggi 80 e 81.

ATTIVITA' DI INDAGINE CONDOTTE DA ATI STRABAG NEL 2012

In aderenza alle specifiche di progettazione esecutiva stata pianificata e condotta una campagna di
indagine dei terreni.
Questa nuova indagine, condotta da ATI STRABAG tra la met del 2012 e linizio del 2013, ha altres
permesso di rispondere alla specifica prescrizione del CIPE (prescrizione CIPE Diossina P3-3).
Questo quadro operativo ha quindi consentito la realizzazione di 10 saggi investigativi con il
conseguente prelievo di 20 campioni da sottoporre ad analisi di laboratorio. Questi saggi, denominati in
progressione da B2-PE-20 a B2-PE-29 si caratterizzano per una profondit di prelievo dei campioni
compresa tra 0,15 m e 0,8 m.

Il confronto dei risultati analitici con i limiti di legge adottati per il settore di studio non ha evidenziato
nessuna condizione di esubero dei limiti di colonna B.

A questi saggi investigativi si aggiungono, quelli realizzati nel settembre 2012 per lo studio del settore
RA05 censito da APL tra i siti potenzialmente inquinati, conformemente al Capitolato Speciale dAppalto
Allegato B - Specifiche Prestazionali per la Redazione del Progetto Esecutivo. Questa campagna ha
permesso la realizzazione di 10 ulteriori sondaggi con profondit massima di 7,8 m prelevando 5
campioni a sondaggio per un totale di 50 campioni. (S01-S02-S03-S04-S05-S06-S07-S08-S09-S10)
Nel dicembre 2012, stata condotta una nuova campagna integrativa di indagine con la quale sono stati
realizzati ulteriori 12 punti di indagine (da B2-PE-30 a B2-PE-32, da B2-PE-34 a B2-PE-36 e da TSA1 a
TSA6). Da ciascuno di questi punti di indagine sono stati prelevati 2 campioni di terreno.

In tutti i campioni integrativi (settembre e dicembre 2012) non stata riscontrata nessuna condizione di
Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 20/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

esubero dei limiti delle CSC di riferimento (colonna B).


Per le aree di progetto a destinazione duso verde / residenziale (aree di mitigazione ambientale, aree
tecniche/di cantiere), si identifica soltanto un esubero del limite di colonna A (S4).
Come gi riportato, le attivit di indagine sono state condotte nel rispetto dei principi di massima
protezione dei lavoratori e della popolazione, nonch in linea con il principio di tutela ambientale, tutte le
attivit di indagine sono state attentamente pianificate e concertate con tutti i soggetti (operativi e non)
coinvolti in tutto il processo di progettazione, gestione e attivit operativa di campo.
Nel particolare gli interventi sono stati svolti in accordo con il CSE della Committente, il CSP della ATI
Strabag, tramite il coordinamento di Nuova Briantea S.c.a.r.l. (Societ Consortile costituita in data
11.06.2012 tra le imprese dellATI Strabag per lesecuzione delle prestazioni di cui al Contratto di appalto)
progettando prima, e seguendo poi in campo, dettagliate procedure operative per la sicurezza dei
lavoratori e dei cittadini.

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 21/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO
Sondaggio

x [m]

y [m]

Zona

PCDD come TEQ PCDD come TEQ


ng/kg SS-TS
ng/kg SS-I

B2-PE-20

146051,9062 242800,5312

2,3

1,25

B2-PE-21

146381,1879 242605,4515

9,85

19,02

B2-PE-22

146305,5498 242520,0506

0,52

1,34

B2-PE-23

146398,4148 242335,8158

0,96

0,737

B2-PE-24

146438,0804 242043,8387

2,26

2,94

B2-PE-25

146539,1372

241817,273

15,31

10,63

B2-PE-26

146564,4428 241733,4768

66,69

49,82

B2-PE-27

146612,5173 241491,3839

0,18

0,86

B2-PE-28

146709,4755 241188,8366

4,55

B2-PE-29

146781,8039 240904,6676

0,97

2,07

B2-PE-30

146894,6185 240529,4751

0,64

0,64

B2-PE-31

147018,994 240149,5678

0,64

0,64

B2-PE-32

147093,8854 239950,3497

0,64

0,64

B2-PE-34

147198,8491 239564,2173

0,64

0,64

B2-PE-35

147244,6575

239276,303

0,64

0,64

147284,572 238963,4796

0,64

0,64

S1

146804,0645 240774,5773

0,470

0,212

S2

146797,9893 240951,6695

0,012

0,310

S3

146727,4608 241192,7058

0,936

0,020

S4

146709,4807 241323,8435

12,430

3,300

S5

146735,1571 241710,4163

1,260

S6

146542,546 241855,4242

0,051

0,023

S7

146483,8242 242254,0829

0,059

0,035

S8

146307,4667 242291,5889

0,634

1,030

S9

146358,1589 242620,9418

0,406

2,060

B2-PE-36

S10

242783,673

0,073

0,346

TSA1

148270,5778 239582,9123

146115,063

0,64

0,64

TSA2

148044,8095 239343,3338

0,64

0,64

TSA3

147959,9564 238683,6708

0,64

0,64

TSA4

238631,75

0,64

0,64

TSA5

147370,1823 238169,5351

147543,11

0,64

0,64

TSA6

147261,3107 238678,1475

0,64

0,64

Tabella 3 Superamenti CSC colonna A (evidenziato in giallo), e colonna B (evidenziato in


rosso)-Caratterizzazione 2012. Limiti riferiti a Tabella 1, All. 5 al Titolo V, parte IV D.Lgs
152/06

4.3
SINTESI FINALE DEI
REALIZZATE PRIMA DEL 2016

RISULTATI

DI

INDAGINE

AMBIENTALE

I dati acquisiti con le attivit preliminari condotte, hanno permesso la ricostruzione di un modello locale di
qualit della matrice terreno relativamente alle aree poste in corrispondenza del tracciato investigato
(destinazione duso industriale).
Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 22/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

Questo modello distributivo delle criticit ha guidato (APL 2008) a identificare 6 ambiti principali.
Preme comunque evidenziare che anche se la definizione di tali settori trova una sufficiente giustificazione
nelle evidenze di superamento dei limiti di legge, non sempre la delimitazione areale delle criticit
riscontrate risulta circoscrivibile e chiaramente definita, sia in termini spaziali che di profondit dei
superamenti.
In merito alle 8 condizioni di esubero dei limiti di colonna A, relative a campioni compresi allinterno delle
aree di mitigazione a destinazione verde / residenziale, le attivit di caratterizzazione hanno permesso la
conterminazione delle criticit rilevate.
Dai risultati delle indagini si osserva che:
1) 61 campioni sono risultati superiori al limite verde del D.Lgs. 152/06;
2) 16 campioni sono risultati superiori anche al limite industriale.
Relativamente alle aree A B R i risultati risultano cos distribuiti:
Zona A I superamenti del limite industriale nella zona A (sondaggi 2, 4 e 9) sono occorsi in corrispondenza
dello strato al di sotto della scarifica avvenuta negli anni successivi allincidente Icmesa.
La maggior parte dei campioni prelevati in zona A sono inferiori al limite di colonna A. Tra questi anche il
campionamento profondo.
Zona B Sulla base dei risultati dei campionamenti avvenuti nella zona B, si osservano superamenti del
limite verde ed occasionalmente del limite industriale soprattutto in corrispondenza dello strato superficiale
(Top soil 0-15 cm).
Anche in questo caso sono stati effettuati dei sondaggi profondi (sondaggi 28, 40 e 45) che hanno
mostrato una situazione di non contaminazione.
Zona R I campionamenti nella zona R hanno interessato solo i Top soil (strato 0-15 cm), La situazione
ritrovata paragonabile a quella nella zona B: superamento quasi sempre del limite verde e occasionale
superamento del limite industriale.

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 23/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

5. PIANO DI INDAGINE ADOTTATO


Lo scopo delle attivit di indagine eseguite stato quello di proporre una adeguata campagna investigativa
con la quale completare il quadro conoscitivo locale, relativo alla matrice terreno, e cos permettere di
soddisfare i seguenti obiettivi:

Definire con maggiore dettaglio i modelli locali di riferimento (matrice suolo);

Perfezionare i limiti delle criticit oggi riconosciute (distribuzione areale e verticale);

Supportare la successiva progettazione e pianificazione degli interventi di bonifica;

Offrire elementi di maggiore tutela sia verso le maestranze che opereranno in cantiere che verso la
vicina popolazione;

Offrire il necessario grado di trasparenza verso gli osservatori esterni in modo da dare le
massime garanzie in relazione alle modalit con cui saranno condotte le attivit (di bonifica e
gestione del cantiere con riduzione degli impatti potenziali verso i bersagli sensibili riconosciuti).

Lattivit di caratterizzazione, integrata con le prescrizioni avanzate in CdS del 9 Aprile 2015, stata
definita per la sola matrice terreno. Questa scelta si basa sulla considerazione di alcuni aspetti tecnici di
seguito elencati;

Levento del 1976 ha determinato la diffusione di diossina in atmosfera con sua successiva ricaduta
al suolo;

Gli interventi di bonifica condotti previdero, in corrispondenza delle aree a maggiore


concentrazione di diossina, il decortico del terreno e suo conferimento in discarica;

La falda locale si attesta ad una profondit superiore a 40 m;

La geologia locale si caratterizza per la presenza di formazioni sedimentarie caratterizzate


generalmente dallo sviluppo di suolo superficiale o comunque da orizzonti superficiali di alterazione
in grado di generare una prima protezione naturale rispetto alla falda freatica sottostante. Tale
condizione permette di considerare la locale falda come ben protetta da fenomeni di eventuale
lisciviazione e trasporto;

Le diossine, che i dati ambientali provenienti dalle attivit di indagine indicano presenti
mediamente entro il primo metro di profondit, hanno caratteristiche tali da determinarne una
ridotta mobilit verticale. Tale caratteristica, confermata dai dati geochimici acquisiti con le
indagini, permette di ritenere altamente improbabile la contaminazione delle acque profonde.

Quanto sopra ha guidato a non proporre attivit di caratterizzazione della locale falda freatica. La
realizzazione di una maglia di indagine avrebbe determinato inoltre una diffusa condizione di potenziale
messa in comunicazione della falda con i terreni superficiali. Non sussistendo concreti elementi di criticit
per le acque sotterranee (contaminazione da Diossine) non si ravvisata la necessit di proporre
Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 24/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

unindagine di caratterizzazione delle acque di falda, salvo introduzione di n. 4 sondaggi profondi 20 metri
atti a verificare la non contaminazione dei terreni profondi nella zona tra lo svincolo di Cesano Maderno e
larea di servizio di Desio (prescrizione di ARPA in CDS).
I settori interessati dalle attivit di Caratterizzazione ambientale, sono quelli interessati dal futuro tracciato
autostradale della Pedemontana Lombarda e comunque le aree interessate da esproprio o da occupazione
temporanea per la realizzazione del suddetto collegamento autostradale, posti allinterno della
perimetrazione condotta nel 1977 dalle autorit per delimitare le aree interessate dagli effetti dellincidente
ICMESA, ad eccezione di alcuni punti ricadenti in comune di Bovisio Masciago e ubicati fuori dallarea R.
Indicativamente i limiti laterali di queste aree sono definiti dalle piante scavi di Progetto Esecutivo comunque rientranti nelle aree di esproprio che costeggiano a vario modo il futuro asse autostradale mentre i limiti di inizio e fine saranno definiti dalla intersezione del tracciato con la perimetrazione del
1977.

Nessuna attivit di caratterizzazione ambientale stata realizzata allesterno di detta


perimetrazione trattandosi di aree esterne alla pertinenza del futuro tracciato autostradale
progettato.
Anche per la viabilit accessoria, si prevista la stessa maglia di campionamento.

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 25/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

6. MODELLO AMBIENTALE DI RIFERIMENTO


La maglia di campionamento stata delineata nel PdC affinch fosse in grado di garantire la necessaria
rappresentativit dei dati da acquisire con le attivit di caratterizzazione; a tal fine stato preliminarmente
analizzato e valutato il quadro storico degli eventi che nel tempo hanno interessato il territorio ed a causa
dei quali possono essersi determinate condizioni di criticit ambientale.
In modo analogo sono valutati i risultati delle precedenti attivit dindagine preliminare condotte sul sito.

6.1.1

Evento accidentale ICMESA

Il 10 luglio 1976 in un reattore dellICMESA (Industrie Chimiche Meda Societ Azionaria) che produceva
triclorofenolo, laumento incontrollato della temperatura innesc una serie di reazioni chimiche
determinando un innalzamento della pressione e conseguente esplosione.
Questo determin lemissione in atmosfera di una nube tossica di massa pari a circa 3.000 Kg e contenente
una miscela di diversi composti inquinanti. La nube fu trasportata dal vento in direzione sud-est con un
percorso lineare di circa 6 Km coinvolgendo diversi Comuni limitrofi.
Larea interessata dallincidente venne subito delimitata in modo tale da distinguere le zone ad alta, media
e bassa concentrazione, da sottoporre a differenziate misure di tutela e di bonifica.
La prima mappatura, a cura della Commissione Cimmino risale allagosto 1976 e fu approvata dal Consiglio
Regionale il 7 ottobre 1976.
Complessivamente lincidente interess una superficie di 1.807 ha, con una contaminazione decrescente
allontanandosi dal punto di emissione dello stabilimento ICMESA e dallasse della nube tossica, disposto in
direzione sud-est.
Questo vasto territorio fu cos suddiviso in base al tasso di diossina presente nel suolo, misurato in g/mq,
ossia in milionesimi di grammo al mq;

Zona A (108 ha); Inquinamento maggiore di 50 ug/mq (con punte maggiori di 1000 ug/mq);

Zona B (269 ha); inquinamento compreso tra 5 e 50 ug/mq;

Zona R o di Rispetto (1043 ha): Inquinamento inferiore a 5 ug/mq o nullo.

Le aree sono individuabili negli allegati alla presente relazione.


La zona A venne ulteriormente suddivisa in 7 subaree ad inquinamento decrescente (non cartografate nel
presente documento). Vennero attuati numerosi interventi di bonifica approvati con specifica legge Regione
Lombardia (L.R. 17 gennaio 1977 n.2).
Questi interventi hanno previsto interventi tipologici distinti a seconda del grado di contaminazione rilevata
nei terreni affioranti.
Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 26/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

Decortico terreni, taglio essenze verdi, lavaggio manufatti, interventi agronomici ciclici, furono tutte
modalit di intervento che vennero impiegate per rimuovere i materiali fortemente contaminati (terreni ed
essenze vegetali) o direttamente i contaminanti presenti sui manufatti (lavaggi).
Unitamente allacqua di lavaggio dei mezzi ed alle attrezzature utilizzate, tutto il materiale contaminato
trov collocazione allinterno di tre discariche per la messa in sicurezza dello stesso. A tale proposito
vennero identificate due aree di confinamento;

Discarica di Meda;

Discarica di Seveso;

Discarica di Cesano Maderno,

oltre ad alcune fosse per linterramento di animali morti o abbattuti ( nota solo quella di Cesano
Maderno).
A seguito degli interventi di risanamento, nel 1986, fu dichiarato chiuso il procedimento di bonifica delle
aree.
In occasione della progettazione definitiva per la realizzazione dellAutostrada Pedemontana Lombarda,
stata pianificata e concordata con gli Enti di controllo, una esaustiva attivit di indagine necessaria a
comprendere leffettivo stato qualitativo della matrice terreno ricadente nel settore su cui si svilupper
lopera stradale.
I risultati di questa campagna sono descritti nei capitoli precedenti.

6.2

MAGLIA DI CAMPIONAMENTO ADOTTATA

Il posizionamento dei nuovi punti dindagine stato elaborato secondo due modalit:

Ubicazione sistematica, sulla base dell'adozione di due maglie di campionamento (50x50m Zona A 100x100m Zone B/R);

Ubicazione ragionata, in corrispondenza di punti d'indagine preliminare per i quali rimaneva da


individuare l'estensione areale/verticale della contaminazione rinvenuta.

Sulla scorta di quanto sopra si condivisa in sede di Piano di Caratterizzazione quindi la realizzazione di
una maglia di campionamento distinta:

Aree ricadenti in Zona A passo 50 x 50 m (come previsto dal Ministero dellAmbiente per
attivit di approfondimento in aree SIN);

Aree ricadenti in Zona B , Zona R e Zone oltre R passo 100 x 100 (come gi adottato
nelle attivit preliminari di indagine del 2008 e come adottato dal Ministero dellAmbiente per aree
SIN ma per attivit di indagine ambientale preliminare);

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 27/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

In corrispondenza dei punti della campagna del 2008 con esubero delle proprie CSC di
riferimento (Col. A o Col. B) maglia a chiusura area contaminata (delimitazione areale) o
necessaria alla delimitazione verticale delle criticit oggi riconosciute (es. punti 41, 74, 80).

L'adozione del criterio a maglia ha lo scopo di ubicare indicativamente i punti di indagine.


Questo viene rispettato per la maggior parte delle aree da indagare, in alcuni casi possono
essere stati omessi alcuni punti della maglia in quanto considerati non necessari o ridondanti
rispetto ad altri punti gi ubicati, cos come approvato in CdS.

6.3

DESCRIZIONE DELLE ATTIVIT DI CARATTERIZZAZIONE REALIZZATE

I sondaggi ambientali, come gi precisato, sono stati eseguiti in accordo a quanto previsto dal documento "
Piano della Caratterizzazione ai sensi del D.Lgs. 152/06 e dalle prescrizioni inserite nel verbale della CdS
decisoria propedeutica al Decreto Direttoriale di autorizzazione.
Il recepimento delle prescrizioni avanzate dagli Enti preposti nel corso della Conferenza dei Servizi del 29
Luglio 2015, infatti, ha comportato lubicazione di n 46 punti dindagine aggiuntivi di cui:

n 36 sulla viabilit accessoria al tracciato autostradale, la cui realizzazione preveda la


riqualificazione della viabilit gi esistente o la realizzazione di opere ex-novo, in corrispondenza
della quale stata estesa la frequenza di indagine uniformando la maglia di campionamento a
quella prevista per la zona in cui ricadono i punti aggiuntivi, ossia Zona A maglia 50x50m, Zona B e
Zona R maglia 100x100m;

n 10 posizionati, secondo il principio di precauzione, appena al di fuori del limite della Zona R:
n 6 punti dindagine lungo lasse autostradale in Comune di Bovisio Masciago, tra i punti SC
84 ed SC 99;
n 4 punti dindagine in Comune di Desio, tra il punto SC 132 e la rotatoria di progetto sita
allaltezza dellOspedale di Desio.

Su tali basi si deciso di realizzare una campagna di indagine cos composta (rispetto alle indicazione del
PdC vi sono stati degli scostamenti nel posizionamento dei sondaggi, legati alle condizioni logistiche di
campo, come documentato nei verbali ARPA di accompagnamento allattivit di indagine condotta):
Numero complessivo di punti di indagine - 214 - di cui:

Numero punti ricadenti in Zona A 22;

Numero punti ricadenti in Zona B 45;

Numero punti ricadenti in Zona R 137;

Numero punti ricadenti fuori dalla Zona R 10.

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 28/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

Sono stati quindi prelevati i seguenti campioni di terreno:

Campioni prelevati in Zona A 66;

Campioni prelevati in Zona B 135;

Campioni prelevati in Zona R 411;

Campioni prelevati fuori dalla Zona R 30.

6.4

MODALIT OPERATIVE DI REALIZZAZIONE DELLE INDAGINI

La metodica di campionamento seguita stata progettata tenendo a riferimento la logica adottata in


occasione delle attivit dindagine del 2008 e del 2012, oltre che recependo le indicazioni avanzate dagli
Enti in sede di CdS del 9 Aprile 2015.
Stando alle prescrizioni avanzate da ARPA Lombardia e Provincia di Monza e Brianza formalizzate in
occasione della CdS, le profondit di campionamento a cui ci si spinti permettono di garantire:

Il prelievo del TopSoil (0-0,2 m da p.c.) in corrispondenza di tutti i punti di indagine;

Il campionamento sia dei terreni potenzialmente interessati nel tempo da rimaneggiamento


(intermedio 0,2-1 m da p.c.), che quelli in posto (profondo 1-2 m da p.c.).

Aver definito una profondit massima di indagine pari a 2 m da p.c., ha trovato fondamento sia su dati
bibliografici che sulle risultanze delle indagini preliminari.
Infatti, data la modalit con la quale le diossine furono disperse sul territorio (aereo dispersione e
successiva ricaduta al suolo), unitamente alla ridotta mobilit della molecola della diossina tramite
fenomeni di fate & transport dovuta alla sua elevata capacita di adesione alla matrice terreno (con
particolare affinit alle particelle argillose), si ritiene (sulla base anche dei riscontri analitici delle pregresse
campagne di indagine) che la presenza del parametro diossina si trovi principalmente negli strati pi
superficiali di suolo.
Lattivit di campionamento, e in generale tutta la caratterizzazione, stata condotta in piena condivisione,
validazione e supervisione da parte di ARPA. In tal senso, e come richiesto in sede di CdS del 9 Aprile
2015, per ciascun sondaggio e per ciascuna profondit sono state campionate 3 aliquote distinte e
mantenute in barattoli di vetro da non meno di 500cc.
Le aliquote cos composte sono state gestite secondo lo schema seguente:

Prima aliquota Consegnata ed analizzata dallimpresa;

Seconda aliquota Consegnata ad ARPA Lombardia (si precisa che parte della seconda aliquota

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 29/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

non analizzata da ARPA stata sigillata in scatoloni di cartone e riconsegnata ad APL per la
conservazione presso il laboratorio di parte);

Terza aliquota Sigillata e conservata dallAppaltatore, presso il laboratorio incaricato, per


eventuale successivo contraddittorio.

I campioni sono stati sottoposti ad analisi secondo le modalit indicate in tabella 4 e coerentemente alle
proposte del Piano di Caratterizzazione e al Protocollo Tecnico ARPA MI MB/Pedemontana SPA.
La tabella che segue descrive i criteri di indagine adottati.
Settore

Profondit di
campionamento

Frequenza Analisi

ZONA A
(maglia 50 x 50 m)

1 campione Top Soil

ZONA B
(maglia 100 x 100 m)

1 campione Intermedio

Top Soil: Tutti i campioni


Intermedio: Tutti i campioni
Profondo: Tutti i campioni
Top Soil: Tutti i campioni
Intermedio: Tutti i campioni
Profondo: Solo se evidenze di contaminazione
nel campione intermedio

(0,00 0,20 m)

(0,20 1,00 m)

Top Soil: Tutti i campioni


ZONA R
Intermedio: 50% dei campioni
(1,00 2,00 m)
(maglia 100 x 100 m)
Profondo: Solo se evidenze di contaminazione
nel campione intermedio
Tabella 4 Schema di Piano di Indagine e analisi adottato
1 campione Profondo

In merito alla profondit di investigazione, si specifica che sono stati eseguiti n. 4 sondaggi profondi 20
metri atti a verificare la non contaminazione dei terreni profondi nella zona tra lo svincolo di Cesano
Maderno e larea di servizio di Desio (in ottemperanza alla prescrizione di ARPA in CdS).
Le relazioni preliminari di validazione sono state trasmessa con i Fascicoli 2016.6.77.856 e 2016.6.77.984; i
risultati delle analisi chimiche svolte in contraddittorio sono riportati negli Allegati 3 e 4.
In ottemperanza alle indicazioni dellAll. 2 al Titolo V della parte IV del D.Lgs 152/06, ai fini di ottenere
lobiettivo di ricostruire il profilo verticale della concentrazione degli inquinanti nel terreno, i campioni da
portare in laboratorio sono stati privati della frazione maggiore di 2 cm (da scartare in campo) e le
determinazioni analitiche in laboratorio sono state condotte sullaliquota di granulometria inferiore a 2 mm.
La concentrazione del campione stata determinata riferendosi alla totalit dei materiali secchi,
comprensiva anche dello scheletro.
I sondaggi effettuati e i campioni prelevati sono riportati in tabella 5, in essa viene inoltre indicata in quale
area della zonizzazione territoriale effettuata a seguito dellincidente ICMESA ricade ciascun sondaggio. In
essa si evince che, come criterio generale sono stati prelevati campioni rappresentativi dei 3 strati

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 30/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

individuati come Top Soil (TS), Intermedio (I) e Profondo (P).


Tuttavia, le particolari condizioni ritrovate in campo hanno richiesto alcune modifiche a quanto previsto dal
PdC: ovvero laddove i punti di sondaggio insistevano in aree coperte da pavimentazione e si trattava di una
viabilit preesistente allincidente ICMESA del 1976, non stato campionato il Top Soil; quando tali
evenienze si sono presentate in aree ricadenti nella zona R, si deciso di concerto con APL e ARPA, di
avviare ad analisi tutti i campioni Intermedi in sostituzione dei Top Soil; dei restanti punti di indagine si
proceduto con il criterio previsto, cio di avviare a laboratorio tutti i Top Soil e il 50% del totale degli
Intermedi. Per i sondaggi insistenti sulle strade non presenti prima dellincidente si provveduto a
raggiungere il terreno vergine sotto la fondazione stradale, mediante carotaggio, considerandolo come topsoil originario, sempre di concerto con APL e ARPA.
RIF. CAMPIONE

COMUNE

DATA PRELIEVO

CAMPIONE PRELEVATO
TS

COORDINATE METRICHE

NOTE

X [m]

Y [m]

Meda

03-mag

145800.038

242377.73

Su strada preesistente- NO TS

SC170

Meda

03-mag

145903.626

242354.608

Su strada preesistente- NO TS

SC155

Meda

03-mag

146554.234

242191.832

Su strada preesistente- NO TS

SC172

Meda

03-mag

146195.641

242299.793

SC173

Meda

03-mag

146254.419

242281.721

SC171

Meda

04-mag

146008.334

242337.468

ZONA

SC169

Su strada preesistente- NO TS

SC153

Meda

04-mag

146093.043

242308.780

Spostato dalla sede stradale all'aiuola marciapiedi per


presenza di sottoservizi

SC174

Seveso

04-mag

146646.767

242165.168

Su strada preesistente- NO TS

SC175

Seveso

04-mag

146737.314

242138.128

Su strada preesistente- NO TS

SC176

Seveso

04-mag

146838.762

242107.233

Su strada preesistente- NO TS

SC156

Seveso

04-mag

146944.460

242083.069

Su strada preesistente- NO TS

SC177

Meda

04-mag

147038.467

242056.755

Su strada preesistente- NO TS

SC178

Seveso

04-mag

Su strada preesistente- NO TS

SC179

Seveso

04-mag

SC 157

Seveso

05-mag

SC 180

Seveso

05-mag

SC 181

Seveso

05-mag

SC 182

Seveso

05-mag

SC 183

Seveso

SC 184

147143.555

242024.049

147237.711

241994.658

147323.265

241967.581

147415.199

241939.207

147518.083

241907.428

147612.186

241884.220

05-mag

147711.669

242027.788

Seveso

05-mag

147741.220

242119.600

SC 185

Meda

05-mag

147849.540

242104.024

SC 147

Meda

05-mag

147932.420

242097.366

SC 186

Meda

05-mag

148011.106

242062.474

SC 148

Seveso

05-mag

148088.465

242032.39

SC 142

Meda

05-mag

146566.879

242602.622

SC 141

Meda

05-mag

146692.252

242545.554

SC18

Meda

06-mag

146335.432

242570.965

SC144

Meda

06-mag

146252.436

242700.534

Vicino a esubero CSC col B campione 66

SC15

Meda

06-mag

146210.55

242736.924

Vicino a esubero CSC col B campione 9

SC9

Meda

06-mag

145911.833

242807.664

A confine con Zona A

SC11

Meda

06-mag

145999.969

242801.469

SC8

Meda

06-mag

145939.125

242867.432

SC14

Meda

06-mag

146156.728

242764.247

SC16

Meda

06-mag

146148.234

242639.440

SC7

Meda

06-mag

145845.939

242826.589

SC143

Meda

09-mag

146481.829

242714.778

SC17

Meda

09-mag

146362.547

242779.141

SC13

Meda

09-mag

146245.23

242766.281

SC19

Meda

09-mag

146411.387

242506.679

SC20

Meda

09-mag

146313.223

242460.318

SC21

Meda

09-mag

146301.933

242427.657

SC22

Meda

09-mag

146348.479

242427.075

SC30

Seveso

09-mag

146576.089

241979.894

SC31

Seveso

09-mag

146450.711

241993.903

SC32

Seveso

09-mag

146462.378

241931.66

SC33

Seveso

09-mag

146482.994

241869.255

SC39

Seveso

09-mag

146541.671

241667.34

SC41

Seveso

09-mag

146559.695

241621.087

SC43

Seveso

09-mag

146585.329

241539.961

SC47

Seveso

09-mag

146632.065

241377.578

Il TS stato prelevato da 0,5 a 0,7 m da p.c.; quindi quota


finale sondaggio 2,5 m da p.c
Il TS stato prelevato da 0,5 a 0,7 m da p.c.; quindi quota
finale sondaggio 2,5 m da p.c
Il TS stato prelevato da 0,5 a 0,7 m da p.c.; quindi quota
finale sondaggio 2,5 m da p.c
Il TS stato prelevato da 0,5 a 0,7 m da p.c.; quindi quota
finale sondaggio 2,5 m da p.c

Il TS stato prelevato da 0,8 a 1 m da p.c.; quindi quota


finale sondaggio 3 m da p.c

strada preesistente all'incidente; top-soil non eseguito

Vicino a esubero CSC col B campione 4

Il punto stato spostato di circa 2 m a lato strada per


difficolt logistiche

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 31/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO
CAMPIONE PRELEVATO
RIF. CAMPIONE

COMUNE

COORDINATE METRICHE

DATA
PRELIEVO

TS

ZONA

X [m]

Y [m]

NOTE

SC28

Seveso

09-mag

146376.714

242169.478

SC27

Seveso

09-mag

146347.791

242204.479

SC26

Seveso

09-mag

146302.685

242241.484

SC58

Seveso

10-mag

146861.676

240815.975

SC168

Seveso

10-mag

146838.116

240851.663

SC48

Seveso

10-mag

SC25
SC23

Meda
Meda

10-mag
10-mag

x
x

x
x

B
B

146743.918
146427.048

241162.945
242270.74

146442.663

242396.778

SC24

Meda

10-mag

SC50
SC53

Seveso
Seveso

10-mag
10-mag

x
x

x
x

A
B

146374.625
146754.024

242299.986
241165.346

146807.959

240978.785

SC55

Seveso

10-mag

146814.809

240961.805

SC54

Seveso

10-mag

146836.778

240956.941

SC139

Seveso

10-mag

146756.331

240970.267

SC52

Seveso

10-mag

146695.219

241009.544

SC187

Seveso

12-mag

145973.216

240775.988

SC160

Seveso

12-mag

145890.95

240767.15

Su strada preesistente- NO TS
Spostato di circa 7 m su aiuola per presenza di
sottoservizi

SC188

Cesano Maderno

12-mag

146065.215

240770.678

Su strada preesistente- NO TS

SC189

Cesano Maderno

12-mag

146175.561

240764.199

Su strada preesistente- NO TS

SC159

Cesano Maderno

12-mag

146254.488

240760.15

SC190

Cesano Maderno

12-mag

146354.835

240742.085

SC191

Cesano Maderno

12-mag

146456.316

240738.085

Su strada preesistente- NO TS
Spostato di circa 6 m verso nord per presenza di
sottoservizi
Spostato di circa 6 m verso nord per presenza di
sottoservizi

SC158

Cesano Maderno

12-mag

146592.763

240718.069

SC140

Cesano Maderno

12-mag

146955.472

240513.837

SC161

Cesano Maderno

12-mag

147036.418

240412.508

SC63

Cesano Maderno

12-mag

146934.24

240590.805

SC49

Seveso

13-mag

SC192

Cesano Maderno

13-mag

SC193

Cesano Maderno

13-mag

SC61

Cesano Maderno

13-mag

SC162

Cesano Maderno

13-mag

SC3

Seveso

13-mag

SC2

Seveso

SC4

Barlassina

SC59

146745.491

Su strada preesistente- NO TS
Su strada preesistente- NO TS; il punto stato
spostato di circa 10 m
Su strada preesistente- NO TS

Su strada preesistente- NO TS

Su strada preesistente- NO TS

Su strada preesistente- NO TS
Spostato di circa 6 m verso nord per presenza di
sottoservizi
Spostato di circa 6 m verso nord per presenza di
sottoservizi
Spostato di circa 6 m verso nord per presenza di
sottoservizi

241206.63
Il TS stato riscontrato a + 1,2 m da p.c. Il
sondaggio stato approfondito sino a 3,2 m da
240464.092
p.c.
Il TS stato riscontrato a + 0,4 m da p.c. Il
sondaggio stato approfondito sino a 2,4 m da
240475.558
p.c.

147114.419

147219.782

146905.066

147323.94

240483.97

145484.116

242857.896

13-mag

145403.687

242876.647

13-mag

145510.612

242937.781

Seveso

13-mag

146831.533

240735.853

SC10

Meda

16-mag

146046.735

242849.485

SC12

Meda

16-mag

SC194

Cesano Maderno

16-mag

x
x

x
x

x
x

R
R

146160.242
147548.771

242820.861
240519.636

SC163

Cesano Maderno

16-mag

147652.82

240531.469

SC195

Cesano Maderno

16-mag

147748.571

240548.825

SC196

Cesano Maderno

16-mag

SC69
SC103
SC102
SC100
SC82
SC167

Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno

16-mag
16-mag
16-mag
16-mag
16-mag
16-mag

x
x
x
x
x
x
x

x
x
x
x
x
x
x

x
x
x
x
x
x
x

R
B
R
R
R
R
R

147844.884
147117.31
147787.92
147705.973
147614.656
147536.726
147928.794

240554.178
240006.253
239036.349
238943.355
238848.286
238770.415
238898.309

SC89

Bovisio Masciago

16-mag

147668.88

238636.617

SC90

Bovisio Masciago

16-mag

147776.016

238651.771

SC85

Bovisio Masciago

16-mag

147381.366

SC197

Bovisio Masciago

16-mag

147336.594

240671.38
Il punto stato spostato di circa 10 m a lato
strada per difficolt logistiche

Avvertibile un odore acre


Strada non preesistente e Rilevato pi spesso
(1,5 m) su TS
Strada non preesistente
Strada non preesistente con rilevato pi spesso
di 1 m
Strada non preesistente e Rilevato pi spesso
(1,5 m) su TS
Strada non preesistente e Rilevato pi spesso
(1m) su TS
Rilevato pi spesso (1 m) su TS
Rilevato pi spesso (1 m) su TS
Rilevato pi spesso (1 m) su TS
Rilevato pi spesso (1 m) su TS
Rilevato pi spesso (1 m) su TS
Rilevato pi spesso (1 m) su TS
Rilevato pi spesso (1 m) su TS; vicino a stazione
ecologica attrezzata

Rilevato pi spesso (0.8 m) su TS


Strada non preesistente e Rilevato pi spesso
238598.699
(1,5 m) su TS
Strada non preesistente e Rilevato pi spesso
238589.572
(1,5 m) su TS

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 32/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO
RIF. CAMPIONE

COMUNE

DATA PRELIEVO

CAMPIONE PRELEVATO
TS

ZONA

COORDINATE METRICHE
X [m]

Y [m]

NOTE

SC97

Bovisio Masciago

17-mag

147347.013

237793.972

Su strada preesistente - NO TS

SC96

Bovisio Masciago

17-mag

147346.935

237901.057

Su strada preesistente - NO TS

SC95

Bovisio Masciago

17-mag

147348.604

238003.177

Su strada preesistente - NO TS

SC94

Bovisio Masciago

17-mag

147352.392

238103.822

Su strada preesistente - NO TS

SC165

Bovisio Masciago

17-mag

147325.07

238357.319

SC198

Bovisio Masciago

17-mag

147316.575

238484.986

Su strada preesistente - NO TS
strada preesistente all'incidente; top-soil non eseguito

Su strada preesistente - NO TS

SC51

Meda

17-mag

146702.399

241093.941

SC6

Seveso

17-mag

145754.09

242907.931

SC199

Bovisio Masciago

17-mag

147288.94

238307.371

SC200

Bovisio Masciago

17-mag

147276.481

238122.062

SC73

Cesano Maderno

17-mag

147224.067

239453.671

SC77

Cesano Maderno

17-mag

147258.905

239113.211

SC78

Cesano Maderno

17-mag

147240.504

239031.297

SC79

Cesano Maderno

17-mag

147269.207

238908.396

SC70

Cesano Maderno

17-mag

147120.45

239773.422

SC71

Cesano Maderno

17-mag

147166.04

239639.745

SC75

Cesano Maderno

17-mag

147357.112

239329.675

SC111

Cesano Maderno

17-mag

148396.932

239561.274

SC206

Bovisio Masciago

18-mag

147876.899

238264.415

SC98

Bovisio Masciago

18-mag

147373.503

237680.739

SC64

Cesano Maderno

18-mag

146794.473

240446.319

SC205

Bovisio Masciago

18-mag

147779.817

238253.268

SC204

Bovisio Masciago

18-mag

147601.028

238208.465

SC203

Bovisio Masciago

18-mag

147513.347

238194.66

SC93

Bovisio Masciago

18-mag

147705.87

238228.223

SC5

Seveso

18-mag

145619.85

242882.569

Su strada preesistente - NO TS

SC74

Cesano Maderno

18-mag

147265.889

239370.193

Su strada preesistente - NO TS

SC99

Bovisio Masciago

18-mag

147405.323

237571.278

SC201

Bovisio Masciago

18-mag

147290.049

237903.583

SC202

Bovisio Masciago

18-mag

147307.75

237697.613

SC35

Seveso-Fraz. Barucana

18-mag

146643.95

241856.262

SC36

Seveso-Fraz. Barucana

18-mag

146574.66

241766.469

SC37

Seveso-Fraz. Barucana

18-mag

146616.104

241728.166

SC38

Seveso-Fraz. Barucana

18-mag

146689.047

241768.79

SC46

Seveso

20-mag

146769.81

241423.133

SC44

Seveso

20-mag

146734.317

241526.546

SC42

Seveso

20-mag

146675.256

241611.669

SC40

Seveso

20-mag

146690.514

241682.963

SC45

Seveso

20-mag

146677.452

241464.657

SC 34

Seveso

20-mag

146543.444

241873.63

SC207

Desio

20-mag

148479.09

239926.531

SC146

Seveso

20-mag

147673.841

241993.047

SC 145

Seveso

20-mag

146774.247

241351.424

SC83

Cesano Maderno

06-giu

147342.968

238682.99

SC84

Cesano Maderno

06-giu

147251.828

238617.061

SC149

Cesano Maderno

06-giu

148124.508

239284.731

SC108

Cesano Maderno

06-giu

148123.692

239341.05

SC107

Cesano Maderno

06-giu

147970.638

239331.902

SC106

Cesano Maderno

06-giu

147848.218

239200.853

SC150

Cesano Maderno

06-giu

147817.53

239099.364

SC105

Cesano Maderno

06-giu

147750.814

239158.46

SC80

Cesano Maderno

07-giu

147323.866

238852.878

SC134

Cesano Maderno

07-giu

147407.351

238835.794

SC81

Cesano Maderno

07-giu

147407.688

238762.326

SC104

Cesano Maderno

07-giu

147890.395

239027.334

SC101

Cesano Maderno

07-giu

147882.423

238838.801

SC164

Cesano Maderno

07-giu

147890.716

238737.782

SC62

Cesano Maderno

07-giu

146762.07

240559.824

SC60

Cesano Maderno

07-giu

146712.747

240638.44

SC65

Cesano Maderno

08-giu

146843.024

240342.211

SC66

Cesano Maderno

08-giu

146921.688

240273.446

SC68

Cesano Maderno

08-giu

146965.449

240191.613

SC137

Cesano Maderno

08-giu

147100.294

240197.643

SC67

Cesano Maderno

08-giu

147085.672

240269.929

SC76

Cesano Maderno

08-giu

147305.506

239214.831

SC57

Seveso

08-giu

146697.442

240741.457

SC56

Seveso

08-giu

146728.559

240820.249

SC152

Cesano Maderno

08-giu

148450.597

240346.245

Su strada preesistente - NO TS - riubicato per richiesta del


comune di Meda

Su strada preesistente - NO TS

Ubicato all'interno di impianto lavorazione inerti

riubicato rispetto alla previsione progettuale per impossibilit di


accedere all'area

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 33/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO
CAMPIONE PRELEVATO
RIF. CAMPIONE

COMUNE

COORDINATE METRICHE

DATA
PRELIEVO

TS

ZONA

X [m]

NOTE

Y [m]

242968.55

riposizionato all'interno dell'attivir produttica


di progetto per interferenza con i sottoservizi

SC1

Barlassina

09-giu

R (al limite)

145344.545

SC138
SC72
SC113
SC112

Seveso
Cesano Maderno
Cesano Maderno
Cesano Maderno

09-giu
09-giu
09-giu
09-giu

x
x
x
x

x
x
x
x

x
x
x
x

B
B
R
R

146569.452
147275.683
148393.364
148330.181

SC109

Cesano Maderno

09-giu

148143.15

239531.432

SC133

Cesano Maderno

09-giu

148205.43

239509.688

SC110

Cesano Maderno

09-giu

148273.387

239469.857

SC154

Seveso

21-giu

145704.491

242396.12

SC125

Desio

21-giu

149354.105

239886.291

SC127

Desio

21-giu

149198.365

239881.665

SC121

Desio

21-giu

148882.311

239874.375

SC122

Desio

21-giu

149077.138

239764.809

SC124

Desio

21-giu

148908.329

239786.634

SC214

Desio

21-giu

149808.815

240066.631

SC213

Desio

21-giu

149754.963

240065.654

SC29

Seveso

22-giu

146470.11

242126.242

SC208

Desio

22-giu

148473.677

240047.098

SC209

Desio

22-giu

148463.465

240136.385

SC128

Desio

22-giu

149159.941 2400019.285

SC130

Desio

22-giu

149385.137

239749.434

SC126

Desio

22-giu

149233.394

239725.325

SC166

Desio

22-giu

149055.203

240095.098

SC120

Desio

22-giu

148995.193

239976.208

SC119

Desio

22-giu

148822.469

240065.195

SC92

Boviaio Masciago

23-giu

147406.61

238267.665

SC88

Bovisio Masciago

23-giu

147501.271

238509.97

SC135

Bovisio Masciago

23-giu

147486.012

238582.699

SC86

Bovisio Masciago

23-giu

147634.161

238573.587

SC91

Bovisio Masciago

23-giu

147654.51

238509.802

SC136

Bovisio Masciago

23-giu

147528.265

238440.104

SC212

Desio

23-giu

149685.846

240011.704

SC211

Desio

23-giu

149614.087

240023.094

SC131

Desio

23-giu

149419.477

239991.237

SC129

Desio

23-giu

149318.124

240011.731

SC210

Cesano Maderno

24-giu

148458.261

240274.57

SC151

Desio

24-giu

148479.278

239830.467

SC115

Desio

24-giu

148641.192

239684.561

SC116

Desio

24-giu

148677.721

239942.695

SC118

Desio

24-giu

148726.054

239817.96

SC117

Desio

24-giu

148793.697

239733.034

SC87

Boviaio Masciago

27-giu

xx

147383.652

238505.527

SC114

Desio

28-giu

xx

148563.925

239786.168

SC132

Desio

29-giu

xx

149558.771

239946.705

Il campione Profondo (19-20 m da p.c) stato


prelevato il 29/06/16
Il campione Profondo (19-20 m da p.c) stato
prelevato il 29/06/17
Campione Profondo 19-20 m da p.c

SC123

Desio

30-giu

xx

149053.272

239897.814

Campione Profondo 19-20 m da p.c

241879.979
239605.841 riposizionato per inaccessibilit all'area privata
239760.494
239675.574

No TS (realizzato su strada preesistente).


Riubicato rispetto a previsioni di progetto

Sondaggio di delimitazione contaminazione


pregressa
Rinvenuto solo materiale di riporto

Riubicato per inaccessibilit all'area; ci a


comportato il passaggio nel territorio del
comune di Cesano M. al confine con Desio

Tabella 5 Sondaggi effettuati e campioni prelevati durante lattivit di caratterizzazione; il


simbolo xx indica i campioni prelevati a 20 m da p.c.

6.4.1

Cantieramento per la realizzazione della campagna di caratterizzazione

Per la realizzazione della campagna di indagine, si sono previste 3 tipologie di cantierizzazione, a seconda
dellambito di intervento in cui le attivit di indagine sono state eseguite. In particolare:

area di lavoro in ambito agricolo: prevista la sola delimitazione dellarea di intervento mediante
coni e bandella bianco/rossa

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 34/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

area di lavoro in ambito urbano lungo viabilit locale: in tal caso si previsto di allestire delle aree
di lavoro mediante apposita segnaletica a delimitare la carreggiata stradale. Larea di lavoro stata
allestita prevedendo la delimitazione mediante rete tipo orsogrill e telo antipolvere.

Lungo la viabilit stata apposta idonea segnaletica per il restringimento della carreggiata durante
le attivit, si riporta di seguito unimmagine di uno dei cantieri allestiti per lo svolgimento di uno dei
prelievi.

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 35/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

Figura 4 Immagine di una cantierizzazione realizzata su viabilit locale

area di lavoro in ambito urbano lungo SS35: in tal caso si sono allestite le aree di lavoro
mediante apposita segnaletica a delimitare la carreggiata stradale. Essendo la SS35 strada tipo B,
ad alto traffico, larea dintervento stata segnalata con freccia luminosa e con la presegnalazione
come da schema seguente. Larea di lavoro stata poi allestita prevedendo la delimitazione
mediante rete tipo orsogrill e telo antipolvere.

Figura 5 Esempio cantiere allestito lungo viabilit locali

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 36/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

Figura 6 Immagine di una cantierizzazione realizzata su SS35

Figura 7 Dettaglio della fase di campionamento

stato inoltre utilizzato un sistema di monitoraggio delle polveri durante le attivit di perforazione,
mediante centralina

mobile posizionata di volta in volta in prossimit dei recettori sensibili, in

modo da monitorare leventuale aumento di PM10 in atmosfera, a causa delle fasi di perforazione.

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 37/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

Figura 8 centralina mobile per il monitoraggio delle polveri

Lo smaltimento dei residui della perforazione stato effettuato ai sensi di legge, inserendoli allinterno di
buste ermetiche in polietilene (LDPE da 50 ) i rifiuti, avendo cura di apporre sulla busta un cartello visibile
con indicazioni ed avvertenze: PERICOLO NON APRIRE APERTURA CONSENTITA SOLO AD
OPERATORI AUTORIZZATI DA NUOVA BRIANTEA scarl.
In attesa di essere conferiti ai siti di discarica, i sacchi confenzionati nelle aree di lavoro sono stati
temporaneamente depositati in appositi spazi allinterno del cantiere base di Lazzate.
Da qui trasportati con cadenza periodica, circa ogni 2/3 giorni, al sito di discarica per lo smaltimento finale.

6.4.2

Specifiche prelievo campioni Topsoil

Per il campionamento del solo topsoil, rappresentativo in tutte le zone dellorizzonte compreso tra 0,0 e 0,2
m di profondit, si operato attraverso luso di un campionatore manuale con paletta monouso, previa
asportazione delleventuale strato di verde superficiale, adottando il seguente procedimento di
composizione del campione, come indicato da ARPA Lombardia in sede di CdS del 9 aprile 2015.
Ognuno dei campioni di Top Soil, previsti in tutte e tre le zonizzazioni, stato preparato componendo 5
incrementi corrispondenti ai primi 20 cm di terreno (al netto della parte di vegetazione da asportare)
prelevati ai 4 vertici ed al centro di un mq perimetrato nel punto prescelto. Nel caso di carotaggi su strada
ove per presenza di sottoservizi non si potuto realizzare il campionamento ai vertici del quadrato di lato
1 metro si sono realizzati 5 sondaggi in linea.
Il campione stato quindi composto per quartatura e sigillato in apposito contenitore in vetro sterile

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 38/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

monouso opportunamente etichettato.


Durante tutte le fasi di esecuzione dei sondaggi e prelievo dei campioni sono state adottate tutte le misure
di sicurezza previste allinterno del PSC.
I prelievi sono stati effettuati dalla Societ Singea di Carpenedolo - Brescia, mentre le analisi di laboratorio
sono state eseguite da Arcadia S.r.l. di Tromello (PV) presso i laboratori LG INC di Oderzo (TV) e Theolab
di Vinovo (TO).

6.4.3

Specifiche prelievo campioni intermedi e profondi

Per tutti i prelievi dei campioni intermedi e profondi stata condotta unattivit di campionamento classica
adottando tecnologia di perforazione a bassa velocit senza circolazione di fluidi, provvedendo ad adottare
tutte le necessarie procedure operative volte a limitare al massimo eventuali fenomeni di cross
contamination.
Per tutti i prelievi si proceduto mediante lutilizzo di una perforatrice cingolata Beretta, modello T41
caratterizzata per lessere compatta con dimensioni ridotte (larghezza 1 metro) come quella riportata in
figura 9; si utilizzato un campionatore con un diametro esterno di 101 mm.

Figura 9 Sonda per carotaggi

In aggiunta, nel periodo di massima produzione, si utilizzata una perforatrice PX850 montata su
autocarro UNIMOG TARGA CF683YH.

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 39/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

Figura 10 Perforatrice su camion

Per l'esecuzione della perforazione si proceduto, nell'ordine, a:

decontaminare lattrezzatura;

posizionarsi sul foro ed iniziare la perforazione a carotaggio continuo;

prelevare i campioni di terreno alle quote previste, (i campioni sono stati raccolti in appositi
contenitori in vetro con tappo a sigillatura ermetica, etichettati in modo indelebile ed
inconfondibile, e registrati nei moduli di campagna compilati in sito).

Durante tutte le fasi di esecuzione dei sondaggi e prelievo dei campioni sono state adottate tutte le misure
di sicurezza previste allinterno del PSC.
I prelievi sono stati effettuati dalla Societ Singea di Carpenedolo (BS), mentre le analisi di laboratorio sono
state eseguite da Arcadia S.r.l. di Tromello (PV), come sopra indicato.

6.4.4

Controllo qualit e catena di custodia dei campioni prelevati

I campionamenti dei terreni investigati sono stati condotti in accordo agli standard di qualit riconosciuti e
comunque in linea con le prescrizioni del D.L.gs. n. 152/2006 Norme in materia ambientale. Tali standard
prevedono:
-

che i campioni di terreno siano raccolti in contenitori di vetro alimentare indossando guanti in lattice
monouso al fine di evitare la contaminazione degli stessi;

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 40/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

che i barattoli in vetro monouso utilizzati per contenere i campioni di terreno, siano etichettati ed
identificati mediante sigla del campione, luogo, data ed ora del campionamento, riferimento del
progetto, sigla del tecnico;

che la spedizione dei campioni sia realizzata provvedendo ad allegare specifica Catena di custodia
nella quale siano riportati tutte le informazioni necessarie alla identificazione dei campioni e le
determinazioni analitiche da condurre una volta presi in carico dal laboratorio di analisi;

che i campioni siano inviati al laboratorio provvedendo al loro imballaggio in contenitori refrigerati in
grado di mantenere una temperatura di massimo 4C;

che le operazioni di analisi chimiche siano condotte secondo i criteri metodologici riconosciuti e
condivisi con gli Enti di controllo ed a seguito di taratura ed intercalibrazione tra i laboratori.

6.4.5

Monitoraggio Ambiente Sociale

Durante la fase di caratterizzazione stata anche attentamente monitorata la componente sociale; noto
infatti come lattenzione dei media e della popolazione investita nel 1976 dalla nube dellIcmesa sia ancora
molto alta, e la popolazione ancora sensibile alla questione diossina.
Si riporta in allegato 8 la rassegna stampa.

6.5
ANALISI IN LABORATORIO DEI CAMPIONI E METODICHE ANALITICHE
ADOTTATE
Il presente documento reca le modalit operative adottate dal Laboratorio Arcadia (n. accreditamento
0533) per il ricevimento, la gestione, lanalisi e la custodia dei campioni relativi alle attivit di indagini
dellarea ex Icmesa, eseguiti a cura della Nuova Briantea Scarl.

6.5.1

Prelievo e conservazione campioni sino al laboratorio

Le attivit di perforazione, prelievo e identificazione campioni sono state eseguite in campo a cura della
societ Singea, alla presenza del personale della Nuova Briantea, della Committente APL e del personale
ARPA, con compilazione delle relative catene di custodia.

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 41/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

Figura 11 Controllo campioni aliquota A rispetto alle catene di custodia Singea


Come convenuto in sede di pianificazione delle attivit, al termine di ciascuna giornata il personale Singea
ha curato il deposito dei campioni prelevati in tre aliquote nella baracca di cantiere, appositamente allestita
allo scopo e chiusa a chiave. I campioni sono stati riposti in barattoli in vetro puliti, conservati al buio
mediante impiego di sacchi neri o scatole.
Quotidianamente, il giorno seguente il prelievo, personale incaricato della ditta Arcadia ha eseguito il ritiro
dei campioni depositati in baracca e li ha trasportati direttamente al laboratorio.
Allarrivo, i campioni contrassegnati come aliquota A (destinata ad analisi del laboratorio di parte) sono
stati portati in locale preparativa ed stata verificata la corrispondenza con le catene di custodia di Singea.
Eventuali anomalie sono state tempestivamente segnalate. I campioni da sottoporre a prova, secondo
indicazioni puntuali della Societ Nuova Briantea, sono stati trattenuti in laboratorio, mentre i restanti
campioni sono riposti in magazzino.

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 42/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

Figura 12 Controllo campioni aliquota A rispetto alle catene di custodia Singea


Le aliquote contrassegnate come B (aliquote residue di ARPA riposte in cartoni sigillati) e le aliquote C
(destinate ad eventuale contraddittorio), tutte sigillate da ARPA, come richiesto dalla Committente APL
sono state invece trasferite direttamente in magazzino.

Figura 13 Stoccaggio aliquota B

6.5.2

Protocollo analitico da applicare ai campioni e limiti di riferimento

Il protocollo analitico condiviso con gli Enti ha previsto la determinazione dei seguenti parametri:

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 43/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

Limiti di riferimento
Parametro

Metodo laboratorio di

D.Lgs. 152/06, Parte IV, All 5 tab 1

parte

Colonna A

Colonna B

Residuo 105C

CNR IRSA 2 Q 64 Vol 2 2006

pH

CNR IRSA 1 Q 64 Vol 3 2006

CNR IRSA 3 Q 64 Vol 3

Metodo VII.2 DM 13/9/99

EPA 1613B 1994

1x10-5 mg/kg

1x10-4 mg/kg

Peso specifico
FOC
PCDD-PCDF (come
I TE)*

*su indicazione degli enti, per il confronto con il limite di riferimento stato utilizzato il medium bound
Tabella 6 Protocollo analitico adottato
Per comodit, lespressione del risultato delle PCDD-PCDF (come I TE) restituito in ngE/kg, con
indicazione dei limiti di cui al successivo paragrafo.

6.5.3

Limiti analitici di riferimento

Gran parte delle aree oggetto di caratterizzazione hanno una destinazione duso Industriale, ciononostante,
su richiesta di ARPA i limiti di riferimento sui certificati sono comunque quelli di colonna A. Delle aree che
saranno interessate dagli interventi per la realizzazione della nuova Autostrada Pedemontana solo quelle
in corrispondenza delle quali si prevede la realizzazione di interventi di mitigazione
ambientale e le aree tecniche/di cantiere, avranno una destinazione duso di tipo verde
residenziale. Queste aree sono identificate e opportunamente cartografate.
Per queste aree i limiti di riferimento saranno quelli relativi alla colonna A mentre per le restanti aree si
far riferimento ai limiti della colonna B della Tab.1 Allegato 5 al titolo V della parte IV del D.Lgs.
152/06.e s.s.m.m.i.i., come sommatoria PCDD, PCDF (Conversione T.E.) pari a:

6.5.4

Siti ad uso verde pubblico e privato 10 ngE kg


Siti ad uso commerciale industriale 100 ngE kg

-1
-1

SS
SS.

Preparazione del Campione

I campioni da sottoporre a prova vengono registrati nel sistema gestionale del laboratorio Arcadia e ad essi
viene automaticamente assegnato un numero progressivo nel formato 16LAxxxxx che accompagner il
campione sino ad emissione del Rapporto di Prova corrispondente.
Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 44/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

Per la determinazione di pH e peso specifico, si procede al prelievo di una aliquota di campione tal quale
che viene omogeneizzato e sottoposto a prova.
Per i parametri FOC e Diossine-Furani, invece, il campione viene essiccato.
La fase preparativa, eseguita sotto cappa, prevede dunque il prelievo del campione dal barattolo ed il
posizionamento di ca. 100 g di terreno in vaschette di alluminio per essicazione allaria.

Figura 14 Presa campione per essiccazione


Il campione essiccato viene ulteriormente omogeneizzato manualmente con pestello e mortaio prima di
procedere alla setacciatura con setaccio a maglia 2mm.

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 45/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

Figura 15 Omogeneizzazione campione e vagliatura a 2 mm

La frazione fine, di granulometria inferiore a 2 mm, viene raccolta e riconfezionata in contenitori identificati
dal codice univoco del campione. Il campione cos preparato viene riposto in cartoni al buio e spedito ai
laboratori partner (laboratori LG-INCA Srl e Theolab Spa- sede di Volpiano, accreditati rispettivamente n.
0298 e n.0094 A) per la ricerca delle diossine.

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 46/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

Figura 16 Recupero del vagliato a 2 mm e riconfezionamento


Ad ogni passaggio il campione viene pesato per ottenere le frazioni significative (frazione fine e scheletro)
espresse in %p/p.
In alcuni casi, lessiccazione e la setacciatura della frazione di campione destinata alla ricerca di diossine e
furani stata eseguita direttamente dai laboratori partner, con le medesime modalit sopra descritte. In
tali casi, il campione aliquota A, cui sempre assegnato codice univoco da parte del laboratorio Arcadia,
viene suddiviso in due sottoaliquote, met destinata alle prove interne e met riconfezionata e mantenuta
al buio, per linvio al laboratorio esterno.

6.5.5

Esecuzione delle analisi

Le analisi sono state eseguite come da metodiche ufficiali concordate.


In particolare, per la ricerca di diossine e furani, i laboratori partner ricevono il campione con il codice
identificativo univoco; circa 3-5 grammi di campione sono tracciati con una miscela di 15 isotopi di 13CPCDD/PCDF marcati per verificare l'efficienza di estrazione ed effettuare l'analisi secondo la procedura EPA
1613B 1994.
Il campione sottoposto ad estrazione ad elevata pressione utilizzando toluene come solvente tramite
estrattore ASE (Automated Solvent Extraction) secondo il metodo EPA 3545A.
Dopo una retro-estrazione acida, quando ritenuta utile, effettuata una fase di purificazione tramite
sistema di purificazione semiautomatico Power Prep, che utilizza colonne di silice, allumina e carbone.
Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 47/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

Le analisi sono eseguite mediante due spettrometri di massa ad alta risoluzione di Thermo Fisher Scientific
modello DFS Dioxin B (n di serie 03008M) del laboratorio LG-Inca Srl e modello Thermo DFS B (n di serie
3027) del laboratorio Theolab SpA, entrambi configurati per avere una risoluzione >10000.

Figura 17 Apparecchiatura utilizzata per la ricerca delle diossine in alta risoluzione

I laboratori prescelti per lanalisi dei microinquinanti, eseguono tutti i controlli di qualit previsti dal metodo
EPA 1613B 1994; i raw data (cromatogrammi) con gli esiti dei controlli sono disponibili e conservati presso
i laboratori partner, secondo le rispettive procedure previste dallaccreditamento.

6.5.6

Restituzione e trasmissione dei dati

Una volta terminata lanalisi, il laboratorio partner trasmette gli esiti analitici ad Arcadia, che provvede a
refertarli su proprio formato, indicando in nota quali prove sono state eseguite esternamente e da quale
laboratorio accreditato, e a trasmetterli in anticipazione al committente.
Una volta ricevuta lapprovazione, si procede con la stampa su carta intestata ed alla firma autografa del
Chimico iscritto allalbo.
I Rapporti di Prova originali vengono consegnati al cliente e la scansione degli stessi viene caricata su
portale della societ Nuova Briantea.
La tracciabilit dei dati e la loro conservazione effettuata secondo le procedure adottate in virt della UNI
CEI EN ISO/IEC 17025:2005.

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 48/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

6.5.7

Conservazione aliquote residue

Larchiviazione dei campioni verr assicurata sino a completamento della validazione dei dati da parte di
ARPA; prima dellavvio a smaltimento delle aliquote residue, si attender conferma a procedere da parte
degli Enti e della Committente.

6.6

RILIEVO PLANOALTIMETRICO

Tutti i punti di indagine sono stati oggetto di specifica battuta topografica preliminare al fine di garantire la
corretta ubicazione planimetrica di tutti i punti di investigazione.
Il rilievo comprensivo di:

rilievo planoaltimetrico di tutti i sondaggi mediante stazione totale o GPS;

riferimento delle quote altimetriche al livello medio del mare.

Per i sondaggi tracciati e rilevati sono state utilizzate le coordinate rettilinee di progetto (riportate nella
tabella al par. 6.4).

Il tracciamento ed il rilievo della posizione dei sondaggi stato eseguito con strumentazione GPS tale da
garantire

una

precisione

planimetrica

inferiore

2.5

cm

ed

altimetrica

inferiore

cm.

Per tale scopo si utilizzato solo strumentazione GPS con correzione differenziale realizzata tramite
sistema Base e Rover o stazione fissa (Italpos) e Rover collegati in GPRS con correzione in tempo reale.
Lo strumento utilizzato il GS14 Leica S.No. 2871130 con controller CS15 Leica S.No. 2897178.
Alcuni ulteriori affinamenti e piccoli spostamenti sono stati apportati anche nel corso delle stesse campagne
di perforazione, sempre al fine di limitare il disagio dellattivit.
Tali spostamenti sono stati concordati direttamente in campo, alla presenza di APL, dellAppaltatore e dei
tecnici di Arpa e documentati dai verbali di sopralluogo redatti da Arpa che si allegano al presente
documento.
Da tali verbali inoltre possibile verificare quali campioni sono stati prelevati per ciascuna verticale, in
accordo con quanto definito al paragrafo 6.4 e riportato nella tabella riassuntiva presente nello stesso
paragrafo.
Lubicazione definitiva dei punti dindagine illustrata negli Allegati 1A-1D.
Si precisa che le attivit di carotaggio sono state anticipate da una fitta campagna topografica preliminare,
al fine di verificare la possibilit di raggiungere/eseguire tutti i prelievi previsti da PdC. Nel corso di tale
verifica preliminare stato necessario spostare alcuni punti, al fine di evitare linterferenza
con reti di sottoservizi presenti sul territorio, e/o posizionare i punti in aree pi facilmente
Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 49/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

raggiungibili, al fine anche di recare il minor disturbo alla cittadinanza e ai proprietari


interessati.
Tali spostamenti, sempre realizzati nellintorno prossimo dei punti originali al fine di non snaturare la
campagna del PDC, sono stati poi condivisi nel corso di incontri preliminari con APL, con Arpa e con tutti i
comuni interessati dalla campagna di indagine.
Nel caso di punti ricadenti in propriet private, alle rispettive Ditte sono state notificate le istanze per
lautorizzazione allaccesso sulle aree private secondo lex art. 15, comma 2 del Testo Unico sugli espropri
D.P.R. n. 327/01 e s.m.i.
Nel caso di punti ricadenti su suolo pubblico sono state richieste le autorizzazioni alle rispettive
Amministrazioni comunali.
Nellallegato 5 sono riportati lelenco delle istanze presentate ai comuni interessati, Province per la richiesta
di occupazione suolo pubblico e lelenco degli art. 15 notificati ai singoli proprietari interessati.

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 50/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

7. RESTITUZIONE DEI RISULTATI


In questo capitolo si presentano i risultati dellattivit di caratterizzazione condotta. Le risultanze fornite dal
laboratorio sono state elaborate e analizzate con riferimento al valore analitico medio ( medium bound, cio
quello ottenuto considerando il 50% del limite di rilevabilit per i congeneri non rilevabili). Il paragrafo 7.1
riporta e commenta i risultati ottenuti, mentre il paragrafo 7.2 riporta i dati comprensivi degli esiti della
validazione ARPA.
I 387 dati analitici raccolti coprono in modo uniforme il tracciato autostradale e in parte quello della
viabilit secondaria e riguardano la zona A, la zona B, la zona R e in minima parte aree esterne alla zona R,
come esplicitato in Tabella 7 (dove per semplicit descrittiva, i 10 campioni esterni allarea R sono stati
associati ai campioni appartenenti alla stessa zona R).
Campione

Top Soil

Intermedio

Profondo\Profondo
20m

Totale

21

22

22

65

Zona
A
B

37

45

15

97

R e Fuori R

120

98

225

Totale

178

165

44

387

Tabella 7 Campioni analizzati suddivisi per zona territoriale e per profondit di analisi

Con riferimento ai territori comunali interessati dalle aree oggetto della caratterizzazione, i 214 sondaggi
sono stati realizzati secondo la distribuzione evidenziata in Figura 18.

Cesano Maderno
30%

Bovisio Masciago
13%

Meda
16%

Desio
13%

Seveso
27%
Barlassina
1%

Seveso

Meda

Cesano Maderno

Bovisio Masciago

Desio

Barlassina

Figura 18 Distribuzione dei 214 sondaggi di caratterizzazione nei comuni interessati

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 51/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

7.1

VALORE ANALITICO MEDIO (MEDIUM BOUND)

7.1.1

Risultati analitici suolo

I risultati analitici puntuali relativi ai campioni di suolo oggetto di attivit di caratterizzazione, sono stati
elaborati per ottenere una mappatura dei superamenti puntuali delle Concentrazioni Soglia di
Contaminazione (CSC), previste dalla normativa vigente per la destinazione duso prevista in ciascuna area.
In Tabella 8, si riportano i risultati relativi ai soli superamenti delle CSC colonna A (evidenziati in giallo) e
delle CSC colonna B (evidenziati in rosso).
Emerge una distribuzione della contaminazione da diossina schematizzata come segue:

N Superamenti di CSC Col. A nel Top Soil: 37;

N Superamenti di CSC Col. B nel Top Soil: 4;

N Superamenti di CSC Col. A nellIntermedio: 22;

Nessun Superamento di CSC Col. B nellIntermedio;

N Superamenti di CSC Col. A nel Profondo: 4;


Nessun Superamento di CSC Col. B nel Profondo.
Si ritiene importante ribadire che in tale relazione i risultati analitici vengono presentati in valore assoluto,
ovvero sar oggetto delle relazioni Modello Concettuale del Sito e Analisi di Rischio Sanitario Ambientale
associare alle risultanze ottenute il limite normativo fissato in funzione della destinazione duso per
ciascuna delle aree caratterizzate, ci al fine di identificare le aree configurabili come sorgente di potenziale
contaminazione.
Ci significa che gli elaborati grafici (2A-2D) riportati in allegato alla presente relazione evidenzieranno, ad
esempio, superamenti di CSC A anche in zone con destinazione duso industriale; ci con lo scopo di
mostrare la completezza delle informazioni raccolte le quali saranno successivamente elaborate
opportunamente al fine di guidare verso le corrette e specifiche attivit di gestione e bonifica dei terreni
interessati.

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 52/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO
COORDINATE METRICHE
RIF. CAMPIONE

COMUNE

DATA PRELIEVO

X [m]

Y [m]

146008.334

242337.468

Analisi chimiche
S PCDD/DS
ngE/Kg ss TS

S CDD/DS
ngE/Kg ss I

S CDD/DS
ngE/Kg ss P

SC171

Meda

04-mag

12.9

SC153

Meda

04-mag

146093.043

242308.780

14.7

5.3

SC144

Meda

06-mag

146252.436

242700.534

1.37

28

42

SC16

Meda

06-mag

146148.234

242639.440

7.9

75

4.3

SC143

Meda

09-mag

146481.829

242714.778

41

8.5

SC17

Meda

09-mag

146362.547

242779.141

30

3.8

SC19

Meda

09-mag

146411.387

242506.679

40

0.33

SC21

Meda

09-mag

146301.933

242427.657

SC30

Seveso

09-mag

SC39

Seveso

09-mag

146541.671

SC26

Seveso

09-mag

146302.685

SC58

Seveso

10-mag

146861.676

240815.975

SC23

Meda

10-mag

146442.663

SC53

Seveso

10-mag

146807.959

SC55

Seveso

10-mag

SC139

Seveso

SC140

36

67

11.1

0.51

241667.34

19.3

10.8

0.44

242241.484

2.32

14.6

16.2

28

5.6

242396.778

122

18.5

240978.785

11.6

9.1

146814.809

240961.805

22.5

17.2

12.9

10-mag

146756.331

240970.267

42

8.1

0.7

Cesano Maderno

12-mag

146955.472

240513.837

SC161

Cesano Maderno

12-mag

147036.418

240412.508

SC61

Cesano Maderno

13-mag

146905.066

SC59

Seveso

13-mag

146831.533

SC12

Meda

16-mag

146160.242

SC102

Cesano Maderno

16-mag

147705.973

SC100

Cesano Maderno

16-mag

SC197

Bovisio Masciago

16-mag

SC199

Bovisio Masciago

SC64

Cesano Maderno

SC36

146576.089

241979.894

6.2

4.2

46

45

11.9

2.1

240671.38

5.36

12.76

0.2

240735.853

70.1

9.54

1.37

242820.861

11.5

1.01

238943.355

23

147614.656

238848.286

15.4

147336.594

238589.572

13.2

17-mag

147288.94

238307.371

41.6

1.98

18-mag

146794.473

240446.319

10.8

Seveso-Fraz. Barucana

18-mag

146574.66

241766.469

129.5

27

SC37

Seveso-Fraz. Barucana

18-mag

146616.104

241728.166

72

10.5

SC38

Seveso-Fraz. Barucana

18-mag

146689.047

241768.79

10.6

1.79

SC46

Seveso

20-mag

146769.81

241423.133

19.03

14.9

0.1

SC42

Seveso

20-mag

146675.256

241611.669

32.06

12.9

0.1

SC40

Seveso

20-mag

146690.514

241682.963

10.9

4.019

SC 34

Seveso

20-mag

146543.444

241873.63

143

70.7

SC 145

Seveso

20-mag

146774.247

241351.424

25.099

32.22

SC108

Cesano Maderno

06-giu

148123.692

239341.05

10.5

3.4

SC107

Cesano Maderno

06-giu

147970.638

239331.902

34

14.1

SC106

Cesano Maderno

06-giu

147848.218

239200.853

13.8

2.51

SC101

Cesano Maderno

07-giu

147882.423

238838.801

12.4

SC164

Cesano Maderno

07-giu

147890.716

238737.782

15.6

4.5

SC66

Cesano Maderno

08-giu

146921.688

240273.446

0.6

14.2

SC68

Cesano Maderno

08-giu

146965.449

240191.613

10.2

2.18

SC137

Cesano Maderno

08-giu

147100.294

240197.643

88

44

1.3

SC67

Cesano Maderno

08-giu

147085.672

240269.929

151

97

2.17

SC57

Seveso

08-giu

146697.442

240741.457

20.9

5.6

SC138

Seveso

09-giu

146569.452

241879.979

52

12

SC109

Cesano Maderno

09-giu

148143.15

239531.432

23.3

7.4

SC110

Cesano Maderno

09-giu

148273.387

239469.857

41.9

7.2

SC29

Seveso

22-giu

146470.11

242126.242

8.2

14.4

SC136

Bovisio Masciago

23-giu

147528.265

238440.104

15.1

2.66

7.8

0.11
0.39

0.42
0.11

0.1

0.31

Tabella 8 Superamenti CSC colonna A (evidenziato in giallo), e colonna B (evidenziato in


rosso). Limiti riferiti a Tabella 1, All. 5 al Titolo V, parte IV D.Lgs 152/06
I tabulati completi dei risultati delle analisi condotte sui campioni di suolo prelevati sono riportati nelle
tabelle in Allegato 6, mentre i certificati analitici emessi dal laboratorio sono riportati in Allegato 7.

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 53/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

7.1.2

Analisi dei risultati

Come meglio verr discusso appresso, le risultanze ottenute mostrano il maggiore verificarsi di
concentrazioni superiori al limite di 10 ngE/kg (CSC A D.Lgs. 152/06) nella zona B, in misura di circa il 40%
sul totale dei campioni analizzati in tale area. Si specifica che tale considerazione si riferisce al
valore assoluto di concentrazione di diossina senza riferimento alla specifica destinazione
duso delle aree caratterizzate, pertanto ci implica che eccedenze del valore soglia summenzionato,
possono non configurarsi come situazioni di potenziale contaminazione se larea interessata risulta a
destinazione duso industriale.
Distribuzione esuberi nelle Zone A, B, R
250

221

n campioni

N cmpioni e esuberi per Zona [-]

nesuberi

200

150
97
100

65

37.9 %

50

9.1 %

13.8 %
0
A

Figura 19 Esuberi di concentrazione soglia rispetto ai campioni analizzati nelle zone A, B e R


Nel grafico di Figura 20, si mostrano i superamenti del valore soglia di 10 ngE/kg (CSC A D.Lgs. 152/06)
registrati in ciascun Comune e relativi al campione di riferimento. Come si nota, le maggiori condizioni di
eccedenza il limite normativo si verificano nel Top Soil (0-20 cm da p.c.) allinterno del comune di Seveso.

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 54/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

30

Distribuzione esuberi nei Comuni

30

N esuberi per Comune [-]

25
21

20
17
15

13

13

11

10

TS

7
4

5
2

3
1

Tot

0
Seveso

Meda

Cesano Maderno

Bovisio Masciago

Figura 20 Distribuzione della contaminazione nei Comuni interessati


Con lo scopo di effettuare unanalisi critica generale dei risultati ottenuti, e vista lampiezza del campione
disponibile, stato possibile effettuare un opportuno trattamento statistico dei dati mediante elaborazione
delle curve di frequenza cumulata rispetto alle concentrazioni di I-TEQ risultanti dal piano della
caratterizzazione eseguito. Le curve di frequenza cumulata consentono di fornire informazioni sulle
frequenze di non superamento di un opportuno valore soglia (percentili). Nel caso specifico, i valori soglia
sono i valori 10 e 100 ng/kgSS che rappresentano le CSC rispettivamente delle colonne A e B, D.Lgs
152/06.
Nel dettaglio sono state elaborate due famiglie di curve di frequenza cumulata:

in una prima famiglia i dati sono stati raggruppati in funzione della tipologia di campione: TS (topsoil), I (intermedio), P (profondo) e PP (profondissimo);

in una seconda famiglia i dati sono stati raggruppati in funzione della collocazione del punto di
prelievo: zona A, zona B e zona R e non R (i 10 punti esterni alla zona R sono stati accorpati
a quelli della zona R in relazione allesiguit del campione).

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 55/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

Ogni curva viene presentata con riferimento a due scale di lettura:

scala lineare (lin) da 0 a 160 ng/kgSS;

scala logaritmica (log) da 0,1 a 1.000 ng/kgSS.

Le due scale di lettura consentono di enfatizzare in modo diverso i valori alti e bassi delle concentrazioni.
Gli estremi delle scale sono stati definiti a priori al fine di poter comparare in modo diretto pi grafici
diversi.
La prima famiglia di curve di frequenza cumulata considera:

tutti i dati raccolti (Figg. 21 e 22);

i dati relativi alla sola zona A (Figg. 23 e 24);

i dati relativi alla sola zona B (Figg. 25 e 26);

i dati relativi alle sole zone R e non R (Figg. 27 e 28);

La seconda famiglia di curve di frequenza cumulata considera:

i dati relativi ai campioni del top-soil (Figg. 29 e 30);

i dati relativi ai campioni intermedi (Figg. 31 e 32);

i dati relativi ai campioni profondi e profondissimi (Figg. 33 e 34).

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 56/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO
1,0
0,9

0,8

frequenza cumulata [-]

0,7
0,6
0,5
0,4
0,3
0,2
TS
I

0,1

P
0,0
0

10

20

30

40

50

60
70
80
90
100
concentrazione [ngI-TEQ/kgSS]

110

120

130

140

150

160

Figura 21 Curva di frequenza cumulata di tutti i dati raccolti in funzione del tipo di campione
(lin)

1,0
0,9

0,8

frequenza cumulata [-]

0,7
0,6
0,5
0,4
0,3
0,2
TS
I

0,1

P
0,0
0,1

10
concentrazione [ngI-TEQ/kgSS]

100

1000

Figura 22 Curva di frequenza cumulata di tutti i dati raccolti in funzione del tipo di campione
(log)

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 57/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO
1,0
0,9

0,8

frequenza cumulata [-]

0,7
0,6
0,5
0,4
0,3
0,2
TS
I

0,1

P
0,0
0

10

20

30

40

50

60
70
80
90
100
concentrazione [ngI-TEQ/kgSS]

110

120

130

140

150

160

Figura 23 Curva di frequenza cumulata dei dati della zona A in funzione del tipo di campione
(lin)

1,0
0,9

0,8

frequenza cumulata [-]

0,7
0,6
0,5
0,4
0,3
0,2
TS
I

0,1

P
0,0
0,1

10
concentrazione [ngI-TEQ/kgSS]

100

1000

Figura 24 Curva di frequenza cumulata dei dati della zona A in funzione del tipo di campione
(log)

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 58/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO
1,0
0,9

0,8

frequenza cumulata [-]

0,7
0,6
0,5
0,4
0,3
0,2
TS
I

0,1

P
0,0
0

10

20

30

40

50

60
70
80
90
100
concentrazione [ngI-TEQ/kgSS]

110

120

130

140

150

160

Figura 25 Curva di frequenza cumulata dei dati della zona B in funzione del tipo di campione
(lin)

1,0
0,9

0,8

frequenza cumulata [-]

0,7
0,6
0,5
0,4
0,3
0,2
TS
I

0,1

P
0,0
0,1

10
concentrazione [ngI-TEQ/kgSS]

100

1000

Figura 26 Curva di frequenza cumulata dei dati della zona B in funzione del tipo di campione
(log)

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 59/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO
1,0
0,9

0,8

frequenza cumulata [-]

0,7
0,6
0,5
0,4
0,3
0,2
TS
I

0,1

P
0,0
0

10

20

30

40

50

60
70
80
90
100
concentrazione [ngI-TEQ/kgSS]

110

120

130

140

150

160

Figura 27 Curva di frequenza cumulata dei dati delle zone R/non R in funzione del tipo di
campione (lin)

1,0
0,9

0,8

frequenza cumulata [-]

0,7
0,6
0,5
0,4
0,3
0,2
TS
I

0,1

P
0,0
0,1

10
concentrazione [ngI-TEQ/kgSS]

100

1000

Figura 28 Curva di frequenza cumulata dei dati delle zone R/non R in funzione del tipo
campione (log)

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 60/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO
1,0
0,9

0,8

frequenza cumulata [-]

0,7
0,6
0,5
0,4
0,3
0,2
zona A
zona B

0,1

zone R e non R
0,0
0

10

20

30

40

50

60
70
80
90
100
concentrazione [ngI-TEQ/kgSS]

110

120

130

140

150

160

Figura 29 Curva di frequenza cumulata dei campioni di top soil (TS) delle zone A, B ed R/non
R (lin)

1,0
0,9

0,8

frequenza cumulata [-]

0,7
0,6
0,5
0,4
0,3
0,2
zona A
zona B

0,1

zone R e non R
0,0
0,1

10
concentrazione [ngI-TEQ/kgSS]

100

1000

Figura 30 Curva di frequenza cumulata dei campioni di top soil (TS) delle zone A, B ed R/non
R (log)

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 61/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO
1,0
0,9

0,8

frequenza cumulata [-]

0,7
0,6
0,5
0,4
0,3
0,2
zona A
zona B

0,1

zone R e non R
0,0
0

10

20

30

40

50

60
70
80
90
100
concentrazione [ngI-TEQ/kgSS]

110

120

130

140

150

160

Figura 31 Curva di frequenza cumulata dei campioni intermedi (I) delle zone A, B ed R/non R
(lin)

1,0
0,9

0,8

frequenza cumulata [-]

0,7
0,6
0,5
0,4
0,3
0,2
zona A
zona B

0,1

zone R e non R
0,0
0,1

10
concentrazione [ngI-TEQ/kgSS]

100

1000

Figura 32 Curva di frequenza cumulata dei campioni intermedi (I) delle zone A, B ed R/non R
(log)

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 62/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO
1,0
0,9

0,8

frequenza cumulata [-]

0,7
0,6
0,5
0,4
0,3
0,2
zona A
zona B

0,1

zone R e non R
0,0
0

10

20

30

40

50

60
70
80
90
100
concentrazione [ngI-TEQ/kgSS]

110

120

130

140

150

160

Figura 33 Curva di frequenza cumulata dei campioni profondi (P o PP) delle zone A, B ed
R/non R (lin)
1,0
0,9

0,8

frequenza cumulata [-]

0,7
0,6
0,5
0,4
0,3
0,2
zona A
zona B

0,1

zone R e non R
0,0
0,1

10
concentrazione [ngI-TEQ/kgSS]

100

1000

Figura 34 Curva di frequenza cumulata dei campioni profondi (P o PP) delle zone A, B ed
R/non R (log)

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 63/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

Prima di commentare le curve si ritiene opportuno evidenziare che i campioni profondi (P) e ancor pi
quelli profondissimi (PP) sono stati raccolti in modo molto meno sistematico di quelli del top-soil e agli
intermedi (nello specifico sono stati raccolti in modo sistematico solo nella zona A, mentre nelle zone B, R e
non R lanalisi stata limitata per lo pi ai casi di accertata contaminazione nel campione intermedio),
motivo per cui la loro valenza statistica fortemente condizionata. Si utilizzato il tratto grafico continuo
per esprimere campioni statisticamente affidabili e il tratto discontinuo per i campioni statisticamente non
utili.
Le Figg. 21 e 22, valide per la totalit dei campioni raccolti (con eccezione dei 4 PP della zona R non
considerati nel tracciamento delle curve P), mostrano come:

il superamento della CSC A riguardi il 23,03% dei campioni di top-soil (41 su 178), il 13,33% dei
campioni intermedi (22 su 165) e l10,00% dei campioni profondi (4 su 40): si conferma quindi il
fatto che la contaminazione da diossina, per la tipologia di evento incidentale e sua evoluzione
(aerodispersione), abbia interessato solo gli strati superficiali del suolo; nulla rileva il fatto che la
positivit di campioni profondi sia prossima in percentuale a quella dei campioni intermedi in
quanto parte dei campioni profondi riguardano punti di campionamento in cui era stata accertata la
contaminazione del campione intermedio (campioni di approfondimento);

il superamento della CSC B riguardi solo i campioni di top-soil nella misura del 2,25% (4 su 178):
di nuovo si conferma la natura sostanzialmente superficiale della contaminazione da diossina.

Le Figg. 23 e 24, valide per i dati relativi alla sola zona A, mostrano come:

il superamento della CSC A riguardi il 9,52% dei campioni di top-soil (2 su 21), il 22,73% dei
campioni intermedi (5 su 22) e il 9,09% dei campioni profondi (2 su 22): il risultato del tutto
atteso e non sorprendente in quanto la zona A stata interessata per la maggior parte da
interventi di bonifica con asportazione del terreno superficiale e sostituzione con terreno
proveniente da aree non contaminate, ma gli interventi di bonifica non hanno potuto riguardare gli
strati intermedi e profondi che mostrano ragionevolmente una contaminazione a decrescere (la
curva di frequenza cumulata I sistematicamente pi a destra della curva P);

il superamento della CSC B non riguardi alcuno dei 65 campioni analizzati: il doppio risultato che
questo dato conferma la sostanziale riuscita dellintervento di bonifica e lazione schermante degli
strati superficiali del suolo rispetto a quelli pi profondi durante levento incidentale.

Le Figg. 25 e 26, valide per i dati relativi alla sola zona B, mostrano come:

il superamento della CSC A riguardi il 56,76% dei campioni di top-soil (21 su 37), il 31,11% dei
campioni intermedi (14 su 45) e il 13,33% dei campioni profondi (2 su 15): anche in questo caso il
risultato del tutto atteso e non sorprendente in quanto la zona B non stata interessata da
interventi di asportazione del top-soil motivo per cui il top-soil ha concentrazioni mediamente
superiori a quelle dellintermedio (la curva di frequenza cumulata TS sistematicamente pi a
destra della curva I); non statisticamente significativo il dato dei campioni profondi sia per

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 64/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

quantit (15 campioni su 97 della zona B) sia per il fatto che essi riguardano per lo pi punti di
campionamento in cui era stata accertata la contaminazione del campione intermedio (campioni di
approfondimento);

il superamento della CSC B riguardi solo i campioni di top-soil nella misura dell8,11% (3 su 37):
di nuovo si conferma la natura superficiale della contaminazione da diossina.

Le Figg. 27 e 28, valide per i dati relativi alle sole zona R e non R, mostrano come:

il superamento della CSC A riguardi il 15,00% dei campioni di top-soil (18 su 120), il 3,06% dei
campioni intermedi (3 su 98) e nessun campione profondo (0 su 3) o profondissimo (0 su 4):
mentre si conferma la natura superficiale della contaminazione da diossina, i dati mostrano come si
registri una normale riduzione dellincidenza dellinquinamento (maggiore distanza dalla sorgente
primaria, stabilimento ICMESA) e come comunque una certa quota di contaminazione residua sia
ancora apprezzabile ( evidente che la suddivisione in zone A, B ed R fu condotta sulla base degli
strumenti analitici e conoscitivi dellepoca in cui non era peraltro ancora stato introdotto il concetto
di tossicit equivalente che permette di sommare in modo pesato pi congeneri tossici; risulta
contaminato anche 1 degli 8 campioni di top-soil della zona non R, punto SC199, seppur molto
prossimo ai confini della zona R e lungo la direttrice principale della scia della nube tossica);
come ipotizzabile a priori, i 4 campioni profondissimi (19-20 m dal p.c.) non mostrano alcuna
contaminazione da diossina (0,1 ng/kgSS) con tutti o quasi tutti i congeneri tossici al di sotto dei
propri limiti di rilevabilit;

il superamento della CSC B riguardi solo i campioni di top-soil nella misura dello 0,83% (1 su
120): di nuovo si conferma la natura superficiale della contaminazione da diossina e la giustificabile
imprecisione nella originale suddivisione delle zone A, B ed R (il punto SC23, come altri della
caratterizzazione APL, ad es. 53, 69 e 70, si trova al di l della superstrada Milano-Meda rispetto
alla posizione dello stabilimento ICMESA in posizioni non molto distanti dallo stesso).

Le Figg. 2934 non aggiungono nuove informazioni quantitative (si tratta delle stesse curve di frequenza
cumulata gi discusse) ma offrono le seguenti ulteriori chiavi di lettura:

nei campioni del top-soil (Figg. 29 e 30) le maggiori incidenze percentuali di superamenti delle
CSC A o B riguardano campioni prelevati nella zona B; i campioni prelevati nelle zone A ed R e
non R mostrano andamenti statistici simili (e questo giustifica in qualche modo il fatto che la zona
R non abbia richiesto alcun tipo di bonifica) con i minori livelli di contaminazione comunque in zona
A (a giustificazione della bont della bonifica condotta); superamenti della CSC B riguardano solo
la zona B (3 su 37) e le zone R e non R (1 su 120);

nei campioni intermedi (Figg. 31 e 32) di nuovo le maggiori incidenze percentuali di superamenti
della CSC A riguardano campioni prelevati nella zona B; i campioni prelevati nelle zone A
risultano per mediamente pi contaminati di quelli delle zone R e non R in ragione del fatto che la
zona A pi prossima allo stabilimento ICMESA e che la bonifica interess il solo terreno

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 65/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

superficiale; non si registrano superamenti della CSC B a riprova del fatto che la contaminazione
da diossina di tipo sostanzialmente superficiale;

nei campioni profondi e profondissimi (Figg. 33 e 34), pur nei limiti della rappresentativit
statistica gi discussi, la contaminazione meno importante e riguarda solo il superamento della
CSC A (e mai quello della CSC B) in zona A (2 su 22) e in zona B (2 su 15).

Per concludere, linsieme delle analisi statistiche condotte dimostra ladeguata rappresentativit e coerenza
dei dati raccolti e dei risultati ottenuti per i seguenti motivi:

vengono confermati gli andamenti delle campagne di indagine storiche e di quelle condotte
nellambito del progetto da APL e da ATI STRABAG;

viene confermata la natura prevalentemente superficiale dellinquinamento associato allincidente


ICMESA del 10 luglio 1976;

viene confermata la fondatezza della suddivisione in zone A, B ed R dellarea contaminata (nei


limiti di quanto indagato) seppur puntualmente, soprattutto nelle zone di confine tra ambiti, si
rilevano situazioni talora difformi dalle attese;

viene confermato il diffuso superamento della CSC A nella zona B;

viene confermato il superamento per cos dire a hot-spot della CSC B (solo 4 campioni su 387 ed
esclusivamente nel top-soil).

Lampio numero di informazioni raccolte (numero di campioni su pi livelli TS, I, P e PP, estensione del
territorio zone A, B, R e non R) e il lungo periodo di tempo intercorso dallevento incidentale che
costituisce la sorgente primaria della contaminazione (40 anni) permettono di aggiungere alcune
considerazioni che derivano dalla conoscenza delle caratteristiche chimico-fisiche proprie delle diossine, che
sono composti organici persistenti (non biodegradabili), altamente lipofili, non lisciviabili n volatilizzabili, e
che sembrano trovare puntuale conferma nei risultati della caratterizzazione qui discussa:

seppur non esistano indagini puntuali condotte nel tempo, gli ordini di grandezza della
contaminazione rilevata sembrano confermare la persistenza biochimica delle diossine;

il fatto che gli ordini di grandezza della contaminazione non si siano modificati nel tempo (e in un
cos lungo lasso di tempo) sembrano confermare la scarsissima se non nulla mobilit delle diossine:
ci trova conferma anche nel fatto che le maggiori concentrazioni continuano a registrarsi nel topsoil e gi a 1-2 m di profondit del p.c. i livelli di contaminazione risultano trascurabili.

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 66/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

7.2
VALUTAZIONE TECNICA E ANALISI IN CONTRADDITTORIO DA PARTE DI
ARPA
7.2.1

Risultati analitici suolo

Il Dipartimento di Milano e Monza e Brianza dellARPA Lombardia ha effettuato una valutazione tecnica
preliminare dei dati relativi alla totalit dei 214 sondaggi per un totale di 380 campioni analizzati (restano
da validare solo 7 campioni di approfondimento) e ha condotto analisi in contradditorio su un totale di 46
campioni relativi a 46 differenti sondaggi (30 campioni di top-soil, 11 campioni intermedi, 4 campioni
profondi e 1 campione profondissimo, vedi Allegati 3 e 4 e Tabella 9).

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 67/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO
COORDINATE METRICHE

RIF.
CAMPIONE

COMUNE

DATA
PRELIEVO

Analisi chimiche

Analisi chimiche

S PCDD/DS
S PCDD/DS S PCDD/DS Incertezza
ngE/Kg ss
ngE/Kg ss I ngE/Kg ss P TS
TS

Incertezza I

SC155

Meda

03-mag

146554.234

242191.832

SC172

Meda

03-mag

146195.641

242299.793

SC176

Seveso

04-mag

146838.762

242107.233

SC 157

Seveso

05-mag

147323.265

241967.581

SC 185

Meda

05-mag

147849.540

SC 148

Seveso

05-mag

SC 141

Meda

SC11

Meda

SC16

Meda

06-mag

SC17

Meda

09-mag

1.51

146362.547

SC20

Meda

09-mag

146313.223

SC33

Seveso

09-mag

SC47

Seveso

09-mag

SC28

Seveso

09-mag

146376.714

SC54

Seveso

10-mag

146836.778

SC160

Seveso

12-mag

145890.95

240767.15

2.265

1.076

SC191

Cesano Maderno

12-mag

146456.316

240738.085

0.0377

0.183

SC63

Cesano Maderno

12-mag

146934.24

240590.805

8.905

4.161

SC162

Cesano Maderno

13-mag

240483.97

2.754

1.305

SC2

Seveso

13-mag

145403.687

242876.647

4.263

2.01

SC59

Seveso

13-mag

146831.533

240735.853

73.524

33.497

SC196

Cesano Maderno

16-mag

147844.884

240554.178

0.387

0.188

SC102

Cesano Maderno

16-mag

238943.355

1.287

0.616

SC89

Bovisio Masciago

16-mag

147668.88

238636.617

0.829

SC51

Meda

17-mag

146702.399

241093.941

SC6

Seveso

17-mag

145754.09

242907.931

2.466

1.17

SC73

Cesano Maderno

17-mag

147224.067

239453.671

27.196

12.539

SC111

Cesano Maderno

17-mag

148396.932

239561.274

18.809

8.71

SC206

Bovisio Masciago

18-mag

147876.899

238264.415

1.879

0.895

SC64

Cesano Maderno

18-mag

146794.473

240446.319

25.674

11.845

SC99

Bovisio Masciago

18-mag

147405.323

237571.278

9.744

4.548

SC42

Seveso

20-mag

146675.256

241611.669

104.722

47.508

SC150

Cesano Maderno

06-giu

147817.53

239099.364

13.122

6.103

SC66

Cesano Maderno

08-giu

146921.688

240273.446

16.389

7.602

SC57

Seveso

08-giu

146697.442

240741.457

18.763

8.689

SC110

Cesano Maderno

09-giu

148273.387

239469.857

29.385

13.536

6.818
0.095

0.047

0.039

0.019

242104.024

6.21

2.914

148088.465

242032.39

3.366

1.591

05-mag

146692.252

242545.554

8.235

3.852

06-mag

145999.969

242801.469

10.5

146148.234

4.898
64.575

242639.440

29.465

242779.141

29.236

13.468

242460.318

4.532

2.135

146482.994

241869.255

146632.065

241377.578

147323.94

147705.973

Incertezza
P

1.42
0.034

0.017

242169.478

2.869

1.359

240956.941

4.05

1.91

0.398
0.055

0.027

SC154

Seveso

21-giu

145704.491

242396.12

SC29

Seveso

22-giu

146470.11

242126.242

0.042

0.021

SC130

Desio

22-giu

149385.137

239749.434

SC166

Desio

22-giu

149055.203

240095.098

1.498

0.715

SC135

Bovisio Masciago

23-giu

147486.012

238582.699

5.52

2.594

SC118

Desio

24-giu

148726.054

239817.96

SC87_PP

Boviaio Masciago

27-giu

147383.652

238505.527

SC123

Desio

30-giu

149053.272

239897.814

SC210

Cesano Maderno

24-giu

148458.261

240274.57

6.382

2.994

SC213

Desio

21-giu

149754.963

240065.654

9.639

4.5

3.983
1.471

1.879
0.0702

9.112

4.257
0.032

0.016

0.079

0.039

Tabella 9 Risultati delle analisi in contradditorio eseguite da ARPA Lombardia

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 68/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

7.2.2

Confronto con i risultati presentati nel paragrafo 7.1

Nella tabella 10 si riporta un confronto con i risultati presentati nel paragrafo 7.1 in accordo con la logica di
attribuire a ciascun campione specifico la maggiore tra le concentrazioni ottenute dal laboratorio
dellesecutore del PdC (Nuova Briantea) ovvero del laboratorio di ARPA.

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 69/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO
COORDINATE METRICHE

RIF.
CAMPIONE

COMUNE

DATA
PRELIEVO

146554.234

242191.832

Nuova Briantea

Meda

03-mag

SC172

Meda

03-mag

SC176

Seveso

04-mag

146838.762

242107.233

SC 157

Seveso

05-mag

147323.265

241967.581

0.1

0.11

SC 185

Meda

05-mag

147849.540

242104.024

5.3

0.36

SC 148

Seveso

05-mag

148088.465

242032.39

2.7

242299.793

max(Nuova Briantea, ARPA)

S PCDD/DS
S PCDD/DS
S PCDD/DS
S PCDD/DS S PCDD/DS
S PCDD/DS S PCDD/DS
S PCDD/DS S PCDD/DS
ngE/Kg ss
ngE/Kg ss
ngE/Kg ss
ngE/Kg ss I ngE/Kg ss P
ngE/Kg ss I ngE/Kg ss P
ngE/Kg ss I ngE/Kg ss P
TS
TS
TS

SC155

146195.641

ARPA

1.26
2.7

1.22

1.51
4.11

1.51
6.818

0.28

2.7

0.095

1.22

0.039

0.1

0.11
0.36

6.21

6.21

3.366

3.366

8.235

8.235

0.78

10.5

10.5

3.3

0.53

7.9

75

4.3

4.6

0.83

0.98

0.52

0.87

0.1

1.34

2.869

1.44

SC 141

Meda

05-mag

146692.252

242545.554

7.3

0.78

SC11

Meda

06-mag

145999.969

242801.469

8.4

3.3

0.53

SC16

Meda

06-mag

242639.440

7.9

75

4.3

SC17

Meda

09-mag

146362.547

242779.141

30

SC20

Meda

09-mag

146313.223

242460.318

1.66

SC33

Seveso

09-mag

146482.994

241869.255

SC47

Seveso

09-mag

146632.065

241377.578

SC28

Seveso

09-mag

146376.714

242169.478

SC54

Seveso

10-mag

146836.778

240956.941

SC160

Seveso

12-mag

145890.95

SC191

Cesano Maderno

12-mag

146456.316

SC63

Cesano Maderno

12-mag

146934.24

240590.805

SC162

Cesano Maderno

13-mag

147323.94

240483.97

SC2

Seveso

13-mag

145403.687

242876.647

3.62

SC59

Seveso

13-mag

146831.533

240735.853

70.1

SC196

Cesano Maderno

16-mag

147844.884

240554.178

0.98

SC102

Cesano Maderno

16-mag

147705.973

238943.355

23

SC89

Bovisio Masciago

16-mag

147668.88

238636.617

1.46

1.03

SC51

Meda

17-mag

146702.399

241093.941

0.28

0.055

SC6

Seveso

17-mag

145754.09

242907.931

7.2

2.07

2.466

SC73

Cesano Maderno

17-mag

147224.067

239453.671

SC111

Cesano Maderno

17-mag

148396.932

239561.274

7.3

SC206

Bovisio Masciago

18-mag

147876.899

238264.415

6.3

1.35

1.879

6.3

1.35

SC64

Cesano Maderno

18-mag

146794.473

240446.319

10.8

25.674

25.674

10.8

SC99

Bovisio Masciago

18-mag

147405.323

237571.278

3.3

0.9

9.744

9.744

0.9

SC42

Seveso

20-mag

146675.256

241611.669

32.06

12.9

104.722

104.722

12.9

SC150

Cesano Maderno

06-giu

147817.53

239099.364

8.8

13.122

13.122

SC66

Cesano Maderno

08-giu

146921.688

240273.446

0.6

14.2

16.389

16.389

14.2

SC57

Seveso

08-giu

146697.442

240741.457

20.9

5.6

18.763

20.9

5.6

SC110

Cesano Maderno

09-giu

148273.387

239469.857

41.9

7.2

29.385

41.9

SC154

Seveso

21-giu

145704.491

242396.12

146148.234

64.575
29.236

30
4.532

4.6

0.83

4.532

2.47

0.98

0.52

0.87

0.1

1.34

0.78

1.44

240767.15

1.68

2.44

2.265

2.265

2.44

240738.085

0.62

0.41

0.0377

0.62

0.41

4.4

8.905

8.905

3.21

1.7

2.754

3.21

1.7

0.034
2.869

4.1

9.54

4.05

1.37

4.1

4.263

4.263

73.524

73.524

0.387

0.98
23

0.829

1.46

1.03

7.2

2.466

27.196

1.15

27.196
18.809

0.042

SC29

Seveso

22-giu

146470.11

242126.242

8.2

Desio

22-giu

149385.137

239749.434

3.1

SC166

Desio

22-giu

149055.203

240095.098

1.5

1.73

1.498

1.5

1.73

SC135

Bovisio Masciago

23-giu

147486.012

238582.699

2.48

2.5

5.52

2.48

5.52

SC118

Desio

24-giu

148726.054

239817.96

2.65

4.7

9.112

4.7

SC87_PP

Boviaio Masciago

27-giu

147383.652

238505.527

3.31

3.9

0.1

SC123

Desio

30-giu

149053.272

239897.814

1.87

0.71

0.1

0.63

Cesano Maderno

24-giu

148458.261

240274.57

0.99

SC213

Desio

21-giu

149754.963

240065.654

5.4

14.4

7.2
1.15

SC130

SC210

1.37

0.28

18.809

0.1

9.54

1.287

7.44

0.1

6.818

0.28

3.983
1.471

8.2

14.4

3.983

3.1

9.112
0.032
0.079

3.31

3.9

1.87

0.71

6.382

6.382

9.639

9.639

0.1

Tabella 10 Confronto tra i risultati delle analisi in contradditorio eseguite da Nuova Briantea e
ARPA Lombardia con riferimento al valore analitico medio.

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 70/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

In termini generali su 46 campioni in contraddittorio il dato ARPA Lombardia supera quello di Nuova
Briantea in 25 occasioni, il dato Nuova Briantea supera quello di ARPA Lombardia in 20 casi, mentre in 1
caso manca il raffronto (ARPA Lombardia ha analizzato 1 campione profondo non analizzato da Nuova
Briantea).
Nella tabella 11 si riportano i risultati relativi ai soli superamenti delle CSC colonna A (evidenziati in giallo) e
delle CSC colonna B (evidenziati in rosso) per i valori analitici medi. Gli stessi dati sono georeferenziati nelle
mappe riportate negli Allegati 2A-2D.

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 71/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO
COORDINATE METRICHE
RIF. CAMPIONE

COMUNE

DATA PRELIEVO

X [m]

Y [m]

146008.334

242337.468

146093.043

242308.780

Analisi chimiche Integrati dati ARPA


S PCDD/DS
ngE/Kg ss TS
medium
bound

S PCDD/DS
ngE/Kg ss I
medium
bound

S PCDD/DS
ngE/Kg ss P
medium
bound

SC171

Meda

04-mag

SC153

Meda

04-mag

12.9

SC144

Meda

06-mag

146252.436

242700.534

1.37

28

42

SC11

Meda

06-mag

145999.969

242801.469

10.5

3.3

0.53

SC16

Meda

06-mag

146148.234

242639.440

7.9

75

4.3

SC143

Meda

09-mag

146481.829

242714.778

41

8.5

SC17

Meda

09-mag

146362.547

242779.141

30

3.8

SC19

Meda

09-mag

146411.387

242506.679

40

0.33

SC21

Meda

09-mag

146301.933

242427.657

36

67

SC30

Seveso

09-mag

146576.089

241979.894

11.1

0.51

SC39

Seveso

09-mag

146541.671

241667.34

19.3

10.8

0.44

SC26

Seveso

09-mag

146302.685

242241.484

2.32

14.6

16.2

SC58

Seveso

10-mag

146861.676

240815.975

28

5.6

SC23

Meda

10-mag

146442.663

242396.778

122

18.5

SC53

Seveso

10-mag

146807.959

240978.785

11.6

9.1

SC55

Seveso

10-mag

146814.809

240961.805

22.5

17.2

12.9

SC139

Seveso

10-mag

146756.331

240970.267

42

8.1

0.7

SC140

Cesano Maderno

12-mag

146955.472

240513.837

SC161

Cesano Maderno

12-mag

147036.418

240412.508

SC61

Cesano Maderno

13-mag

146905.066

SC59

Seveso

13-mag

146831.533

SC12

Meda

16-mag

146160.242

SC102

Cesano Maderno

16-mag

147705.973

SC100

Cesano Maderno

16-mag

SC197

Bovisio Masciago

16-mag

SC199

Bovisio Masciago

SC73

Cesano Maderno

SC111

14.7

5.3

6.2

4.2

46

45

11.9

2.1

240671.38

5.36

12.76

0.2

240735.853

73.524

9.54

1.37

242820.861

11.5

1.01

238943.355

23

147614.656

238848.286

15.4

147336.594

238589.572

13.2

17-mag

147288.94

238307.371

41.6

17-mag

147224.067

239453.671

Cesano Maderno

17-mag

148396.932

239561.274

18.809

4.4

SC64

Cesano Maderno

18-mag

146794.473

240446.319

25.674

10.8

SC36

Seveso-Fraz. Barucana

18-mag

146574.66

241766.469

129.5

27

SC37

Seveso-Fraz. Barucana

18-mag

146616.104

241728.166

72

10.5

SC38

Seveso-Fraz. Barucana

18-mag

146689.047

241768.79

10.6

1.79

SC46

Seveso

20-mag

146769.81

241423.133

19.03

14.9

SC44

Seveso

20-mag

146734.317

241526.546

6.75

3.21

SC42

Seveso

20-mag

146675.256

241611.669

104.7

12.9

SC40

Seveso

20-mag

146690.514

241682.963

10.9

4.019

SC 34

Seveso

20-mag

146543.444

241873.63

143

70.7

SC 145

Seveso

20-mag

146774.247

241351.424

25.099

32.22

SC108

Cesano Maderno

06-giu

148123.692

239341.05

10.5

3.4

SC107

Cesano Maderno

06-giu

147970.638

239331.902

34

14.1

SC106

Cesano Maderno

06-giu

147848.218

239200.853

13.8

2.51

SC150

Cesano Maderno

06-giu

147817.53

239099.364

13.122

SC101

Cesano Maderno

07-giu

147882.423

238838.801

12.4

SC164

Cesano Maderno

07-giu

147890.716

238737.782

15.6

4.5

SC66

Cesano Maderno

08-giu

146921.688

240273.446

16.389

14.2

SC68

Cesano Maderno

08-giu

146965.449

240191.613

10.2

2.18

SC137

Cesano Maderno

08-giu

147100.294

240197.643

88

44

1.3

SC67

Cesano Maderno

08-giu

147085.672

240269.929

151

97

2.17

SC57

Seveso

08-giu

146697.442

240741.457

20.9

5.6

SC138

Seveso

09-giu

146569.452

241879.979

52

12

SC109

Cesano Maderno

09-giu

148143.15

239531.432

23.3

7.4

SC110

Cesano Maderno

09-giu

148273.387

239469.857

41.9

7.2

SC29

Seveso

22-giu

146470.11

242126.242

8.2

14.4

SC136

Bovisio Masciago

23-giu

147528.265

238440.104

15.1

2.66

7.8
1.98
27.196

1.02

0.11
0.39
0.1
0.1

0.42
0.11

0.1

0.31

3.983

Tabella 11 Superamenti CSC colonna A (evidenziato in giallo), e colonna B (evidenziato in


rosso) per valori analitici medi considerando le analisi in contraddittorio di ARPA
Lombardia
Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 72/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

I tabulati completi che tengono conto dei risultati delle analisi condotte da Nuova Briantea (ovvero da
ARPA Lombardia dove sia stata effettuata lanalisi in contraddittorio e abbia fornito una concentrazione
superiore) sono riportati nelle tabelle in Allegato 6.
Se si considera il criterio di attribuire a ciascun campione specifico la maggiore tra le concentrazioni
ottenute dai due laboratori il numero di superamenti si modifica come segue:

da 63 a 68 superamenti della sola CSC A (4 in pi nel top-soil e 1 in pi nellintermedio);

da 4 a 5 superamenti della CSC B (1 in pi nel top soil).

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 73/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

ALLEGATO 1A-1D:
INDAGINE

PLANIMETRIA

UBICAZIONE

PUNTI

DI

Si rimanda agli elaborati :

V_2_A0X_KN201_0_CN_PZ_001_B_All_1A

V_2_A0X_KN201_0_CN_PZ_002_B_All_1B

V_2_A0X_KN201_0_CN_PZ_003_B_All_1C

V_2_A0X_KN201_0_CN_PZ_004_B_All_1D

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 74/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

ALLEGATI 2A-2D: IDENTIFICAZIONE ESUBERI CSC A E CSC B


(VALORI ANALITICI MEDIUM BOUND)
Si rimanda agli elaborati:

V_2_A0X_KN201_0_CN_PZ_005_B_All_2A

V_2_A0X_KN201_0_CN_PZ_006_B_All_2B

V_2_A0X_KN201_0_CN_PZ_007_B_All_2C

V_2_A0X_KN201_0_CN_PZ_008_B_All_2D

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 75/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

ALLEGATO 3: VALIDAZIONE ARPA DELLA CARATTERIZZAZIONE FASCICOLO 2016.6.77.856 E RAPPORTI DI PROVA


ARPA
DEI
CAMPIONI
ESEGUITI
IN
CONTRADDITTORIO

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 76/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

ALLEGATO 4: VALIDAZIONE ARPA DELLA CARATTERIZZAZIONE FASCICOLO 2016.6.77.984 E RAPPORTI DI PROVA


ARPA
DEI
CAMPIONI
ESEGUITI
IN
CONTRADDITTORIO

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 77/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

ALLEGATO 5: ELENCO ISTANZE A COMUNI INTERESSATI E ELENCO


ART. 15 NOTIFICATI AI SINGOLI PROPRIETARI
INTERESSATI

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 78/81

CARATTERIZZAZIONIAREEINCIDENTEICMESA

PROTOCOLLO

DESTINATARIO

OGGETTO

CORRISPONDENZAOUT

COMUNE DESIO, SINDACO

MADERNO, COMUNE

MASCIAGO, COMUNE

Richiesta di concessione per occupazione giornaliera di suolo pubblico


Richiesta di concessione per occupazione giornaliera di suolo pubblico
Richiesta di concessione per occupazione giornaliera di suolo pubblico
Richiesta di concessione per occupazione giornaliera di suolo pubblico
Richiesta di concessione per occupazione giornaliera di suolo pubblico

COMUNE MEDA, SINDACO

MASCIAGO

Tratta B2 - Cantierizzazioni per caratterizzazione aree influenzate dall'incidente ICMESA

Tratta B2 - Richiesta di autorizzazione per la parzializzazione del traffico sulla Milano


Meda per realizzazione sondaggi
Tratta B2 - Richiesta occupazione suolo pubblico - Rif. PEC del 06.04.16

NB P. 00136 del 05.04.2016


NB P. 00137 del 05.04.2016
NB P. 00138 del 05.04.2016
NB P. 00139 del 05.04.2016
NB P. 00140 del 05.04.2016

POLIZIA LOCALE BOVISIO


MASCIAGO
PROVINCIA MONZA
BRIANZA, CITTA'
METROPOLITANA

Richiesta di concessione per occupazione giornaliera di suolo pubblico

COMUNE SEVESO, SINDACO


PROVINCIA MONZA
BRIANZA, CITTA'
METROPOLITANA

NB P. 00178 del 27.04.2016


POLIZIA LOCALE SEVESO,
COMUNE SEVESO, SINDACO
SEVESO, TECNICO
REFERENTE SEVESO

TRATTA B2 - Siti RA05 _ caratterizzazione delle aree influenzate dall'incidente ICMESA


ai sensi del D.Lgs. 152/06 e ss.mm.ii.

NB P. 00143 del 08.04.2016


NB P. 00144 del 08.04.2016
NB P. 00158 del 15.04.2016
NB P. 00159 del 15.04.2016
NB P. 00160 del 15.04.2016
NB P. 00161 del 15.04.2016

NB P. 00180 del 27.04.2016


COMUNE DI SEVESO, APL,
CAL, PREFETTURA MONZA E
BRIANZA, PROVINCIA
MONZA E BRIANZA, COMUNE
BARLASSINA, COMUNE
DESIO, COMUNE BOVISIO
MASCIAGO

Richiesta di concessione per occupazione giornaliera di suolo pubblico ed esenzione


oneri

COMUNE MEDA, SINDACO


Richiesta di concessione per occupazione giornaliera di suolo pubblico
COMUNE SEVESO, SINDACO Richiesta di concessione per occupazione giornaliera di suolo pubblico
MADERNO, COMUNE
Richiesta di concessione per occupazione giornaliera di suolo pubblico
COMUNE DESIO, SINDACO
Richiesta di concessione per occupazione giornaliera di suolo pubblico
Richiesta di concessione per occupazione giornaliera di suolo pubblico. - Rif. PEC
Segreteria comando Polizia Locale del 06.04.16.

NB P. 00183 del 29.04.2016


POLIZIA LOCALE CESANO
MADERNO, COMUNE
CESANO MADERNO,
SINDACO CESANO
MADERNO, TECNICO
REFERENTE CESANO
MADERNO

NB P. 00162 del 15.04.2016

NB P. 00192 del 06.05.2016

AUTORIZZAZIONE

INOLTROAPL/DL

ATI - P. 00495/16/AM del


08.04.2016

ATI - P. 00775/16/AM del


27.04.2016

PROTOCOLLO
PECdel06.04.2016
PECdel07.04.2016
prot.n.0006921/2016del07.04.2016
prot.n.0017522del26.04.2016
prot.n.0008362/2016del27.04.2016
Autorizzazionen.15del27.04.2016

MITTENTE
BOVISIOMASCIAGO
MEDA
MEDA
PROVINCIADIMONZAEBRIANZA
MEDA
SEVESO

BOVISIOMASCIAGO
CESANOMADERNO

Ordinanzan.646del29.04.2016prot.
PROVINCIADIMONZAEBRIANZA
n.0018067
PECdel05.05.2016
Ordinanzan.145del09.05.2016

CORRISPONDENZAIN
OGGETTO
Vostrarichiestadioccupazionedisuolopubblico
Richiestadiconcessioneperoccupazionegiornalieradisuolopubblico
ComunicazioniinmeritoconcessioneoccupazionesuolopubblicoVostroprot.n.00139/16/CA
AutorizzazioneamanovraSPexSS35esvincolidal27.04.2016al31.12.2016.
Richiestadianticipazionedelcalendariodateexrichiestaprot.n.7570del15.04.2016(prot.ricezionecomune)
Autorizzazioneexart.26dlgs285/92peroccupazionesuolopubblico

OrdinanzadiregolamentazionedeltrafficoconinstallazionedisegnaleticatemporaneadicantierelungolaSPexSS5"deiGiovi"eBrianzadalkm135+830al
km145+300svincolicompresielaSP173dalkm3+540alkm4+500perl'esecuzionedisondaggipropedeuticiallarealizzazionedellatrattaB2dell'Autostrada
PedemontanaLombardatrattoricadentenelterritoriodellaprovinciadiMonzaeBrianza
Vostrarichiestadioccupazionesuolopubblico
Ordinanza

PROT. N. 00528

13/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Meda (MB) - Sondaggio SC9 -

PROT. N. 00529

13/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Meda (MB) - Sondaggio SC11 -

PROT. N. 00530

13/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Meda (MB) - Sondaggio SC14 -

PROT. N. 00531

13/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Meda (MB) - Sondaggio SC16 -

PROT. N. 00532

13/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Meda (MB) - Sondaggio SC26 -

PROT. N. 00533

13/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso (MB) - Sondaggio SC27 -

PROT. N. 00534

13/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso (MB) - Sondaggio SC28 -

PROT. N. 00535

13/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso (MB) - Sondaggio SC29 -

PROT. N. 00536

13/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso (MB) - Sondaggio SC31 -

PROT. N. 00537

13/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso (MB) - Sondaggio SC32 -

PROT. N. 00538

13/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso (MB) - Sondaggio SC33 -

PROT. N. 00539

13/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso (MB) - Sondaggio SC39 -

PROT. N. 00540

13/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso (MB) - Sondaggio SC41 -

PROT. N. 00541

13/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso (MB) - Sondaggio SC42 -

PROT. N. 00542

13/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso (MB) - Sondaggio SC43 -

PROT. N. 00543

13/04/2016 APL

PROT. N. 00544

13/04/2016 APL

PROT. N. 00545

13/04/2016 APL

PROT. N. 00547

14/04/2016 REGIONE LOMBARDIA, APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso (MB) - Sondaggio SC47 Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Cesano Maderno (MB) Sondaggio SC83 Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Cesano Maderno (MB) Sondaggio SC84 Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC31N

PROT. N. 00549

14/04/2016 COMUNE MEDA, APL

Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Meda (MB) Sondaggio SC9-

PROT. N. 00550

14/04/2016 PUBBLICI, APL

PROT. N. 00551

14/04/2016 PUBBLICI, APL

PROT. N. 00552

14/04/2016 PUBBLICI, APL

COMUNE MEDA, MEDA SERVIZI

COMUNE MEDA, MEDA SERVIZI

COMUNE MEDA, MEDA SERVIZI

PROT. N. 00553

14/04/2016 REGIONE LOMBARDIA, APL

PROT. N. 00554

14/04/2016 REGIONE LOMBARDIA, APL

PROT. N. 00555

14/04/2016 REGIONE LOMBARDIA, APL

PROT. N. 00556

14/04/2016 CAROLINA, APL

PROVINCIA MB, GALLI ANNA, GALLI

PROT. N. 00557

14/04/2016 REGIONE LOMBARDIA, APL

PROT. N. 00558

14/04/2016 REGIONE LOMBARDIA, APL

PROT. N. 00559

14/04/2016 REGIONE LOMBARDIA, APL

PROT. N. 00560

14/04/2016 PROVINCIA MB, APL

PROT. N. 00561

14/04/2016 APL

PROT. N. 00562

14/04/2016 PROVINCIA MI, APL

PROT. N. 00563

14/04/2016 REGIONE LOMBARDIA, APL

PROT. N. 00564

14/04/2016 CESANO MADERNO, APL

SIRONI CARLA, SIRONI GERARDO,

ANGELONE ALESSANDRO GAETANO,


ANGELONE ANDREA, ARENSI GIUSEPPE,
ARENSI PATRIZIA, LEONI ANTONELLA, LEONI
GIANCARLO, LEONI PIERA, LEONI SERGIO,
ZANABONI MARIO

Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Meda (MB) Sondaggio SC11 -

Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Meda (MB) Sondaggio SC14 -

Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Meda (MB) Sondaggio SC16 Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC26 Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC27 Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC28 -

Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC29 Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC32 Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC33 Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC39 Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC41 Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC42 Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC43 Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC47 Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Cesano Maderno (MB) Sondaggio SC83 -

PROT. N. 00565

14/04/2016

PROT. N. 00568

14/04/2016 APL

Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Cesano Maderno (MB) Sondaggio SC84 Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Barlassina (MB) Sondaggio
Sondaggio SC2N

PROT. N. 00569

14/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso(MB) Sondaggio SC3

PROT. N. 00570

14/04/2016 APL

PROT. N. 00571

14/04/2016 APL

PROT. N. 00572

14/04/2016 APL

PROT. N. 00573

14/04/2016 APL

PROT. N. 00574

14/04/2016 APL

PROT. N. 00575

14/04/2016 APL

PROT. N. 00576

14/04/2016 APL

PROT. N. 00577

14/04/2016 APL

PROT. N. 00578

14/04/2016 APL

PROT. N. 00579

14/04/2016 APL

PROT. N. 00580

14/04/2016 APL

PROT. N. 00581

14/04/2016 APL

PROT. N. 00582

14/04/2016 APL

PROT. N. 00583

14/04/2016 APL

PROT. N. 00584

14/04/2016 APL

PROT. N. 00585

14/04/2016 APL

PROT. N. 00586

14/04/2016 APL

PROT. N. 00587

14/04/2016 APL

PROT. N. 00590

15/04/2016 APL

PROT. N. 00591

15/04/2016 APL

PROT. N. 00592

15/04/2016 APL

PROT. N. 00593

15/04/2016 APL

PROT. N. 00594

15/04/2016 APL

PROT. N. 00595

15/04/2016 APL

PROT. N. 00596

15/04/2016 APL

PROT. N. 00597

15/04/2016 APL

PROT. N. 00598

15/04/2016 APL

PROT. N. 00599

15/04/2016 APL

PROT. N. 00600

15/04/2016 APL

PROT. N. 00601

15/04/2016 APL

PROT. N. 00602

15/04/2016 APL

PROT. N. 00603

15/04/2016 APL

PROT. N. 00604

15/04/2016 APL

PROT. N. 00605

15/04/2016 APL

PROT. N. 00606

15/04/2016 APL

PROT. N. 00607

15/04/2016 APL

PROT. N. 00608

15/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Barlassina (MB) Sondaggio
Sondaggio SC4N
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Meda (MB) Sondaggio SC6
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Meda (MB) Sondaggio
SC7N
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Meda (MB) Sondaggio SC10
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Barlassina (MB) Sondaggio
SC1N
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Meda (MB) Sondaggio SC12
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Meda (MB) Sondaggio
SC15N
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Meda (MB) Sondaggio SC18
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso(MB) Sondaggio
SC34N
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso(MB) Sondaggio
SC49N
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso(MB) Sondaggio
SC50N
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso(MB) Sondaggio
SC55N
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso(MB) Sondaggio
SC138
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso(MB) Sondaggio
SC154
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Cesano (MB) Sondaggio
SC107N Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Meda (MB) Sondaggio
SC144
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso(MB) Sondaggio
SC168
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso(MB) Sondaggio
SC53
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso (MB) Sondaggio
SC35
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso (MB) Sondaggio
SC36n
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso (MB) Sondaggio
SC37
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso (MB) Sondaggio
SC38
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso (MB) Sondaggio
SC40
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso (MB) Sondaggio
SC44
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso (MB) Sondaggio
SC45
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso (MB) Sondaggio
SC46
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso (MB) Sondaggio
SC51
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso (MB) Sondaggio
SC56n
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso (MB) Sondaggio
SC57
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso (MB) Sondaggio
SC101
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso (MB) Sondaggio
SC104
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso (MB) Sondaggio
SC105
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso (MB) Sondaggio
SC106
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso (MB) Sondaggio
SC108
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso (MB) Sondaggio
SC109
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso (MB) Sondaggio
SC110
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso (MB) Sondaggio
SC145

PROT. N. 00609

15/04/2016 APL

PROT. N. 00610

15/04/2016 APL

PROT. N. 00611

15/04/2016 APL

PROT. N. 00612

15/04/2016 APL

PROT. N. 00613

15/04/2016 APL

PROT. N. 00614

15/04/2016 APL

PROT. N. 00622

18/04/2016 PASTIFICIO CERATI, APL

PROT. N. 00623

18/04/2016 PASTIFICIO CERATI, APL

PROT. N. 00624

18/04/2016 PASTIFICIO CERATI, APL

PROT. N. 00625

18/04/2016 PASTIFICIO CERATI, APL

PROT. N. 00626

18/04/2016 APL

PONTIGGIA SERAFINO, PONTIGGIA GIULIO,


PONTIGGIA SANDRA, PONTIGGIA DIEGO,

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso (MB) Sondaggio
SC146
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso (MB) Sondaggio
SC150
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso (MB) Sondaggio
SC164
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso (MB) Sondaggio
SC167n
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso (MB) Sondaggio
SC183
Istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione
del Progetto Esecutivo - Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Seveso (MB) Sondaggio
SC184
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC35Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC36NAvviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC37Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC38Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC40Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC44Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC46Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC51Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC56N-

PROT. N. 00627

18/04/2016 SIRONI CARLA, APL

PROT. N. 00628

18/04/2016 STEFANIA, VITALI MARIALUISA, APL

PROT. N. 00629

18/04/2016 KUWAIT PETROLEUM ITALIA SPA, APL

PROT. N. 00630

18/04/2016 CASLINI GIUSEPPE, CASLINI PAOLO, APL

PROT. N. 00631

18/04/2016 IANNUCCI SILVANA, APL

Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC57-

PROT. N. 00633

18/04/2016 COMUNE DI CESANO MADERNO, APL

Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC104-

PROT. N. 00634

18/04/2016 COMUNE DI CESANO MADERNO, APL

Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC105-

PROT. N. 00635

18/04/2016 FIORELLA, APL

CASTELLETTI MARISA, CASTELLETTI

AZZINARI ROSARIA, COZZOLINO GIUSEPPE,

DE PONTI MASSIMO, MILANI INES, DE PONTI

PROT. N. 00636

18/04/2016 MILANI DE PONTI INES

PROT. N. 00637

18/04/2016 LANZANI CARLO, APL

PROT. N. 00638

18/04/2016 LANZANI CARLO, APL

PROT. N. 00639

18/04/2016 LOCATELLI GIOVANNI, APL

PROT. N. 00640

18/04/2016 PONTIGGIA SERAFINA, APL

PROT. N. 00641

18/04/2016 COMUNE DI CESANO MADERNO, APL

COPRENI GIUSEPPINA, LANZANI ATTILIO,


COPRENI GIUSEPPINA, LANZANI ATTILIO,

PONTIGGIA CARMEN, PONTIGGIA FULVIA,

Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC106Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC108Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC109Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC110Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC145-

Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC146-

PROT. N. 00650

Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC150Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC167N18/04/2016 BONFANTI DINO, BONFANTI SANDRO, APL
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
RAGONA CARMELO F., RAGONA MARCO,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC18318/04/2016 APL
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC18418/04/2016 COMUNE DI SEVESO, APL
TEKNEPHOTO SAS, UBI LEASING SPA, SISPA Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Barlassina (MB) Sondaggio SC1N18/04/2016 SICUREZZA E INCENDIO, APL
ANTONIA TRAVERSI GRISMONDI GIOVANNI, Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Barlassina (MB) Sondaggio SC2N18/04/2016 APL
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Barlassina (MB) Sondaggio SC4N18/04/2016 MARGY SRL, APL
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Meda (MB) Sondaggio SC618/04/2016 KUWAIT PETROLEUM ITALIA SPA, APL
BUSNELLI ROSANGELA, MARIANI GIORGIO, Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Meda (MB) Sondaggio SC7N18/04/2016 APL
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
PROVINCIA DI MONZA E DELLA BRIANZA,
finalizzato alla redazione del Progetto Esecutivo. Comune di Meda (MB) Sondaggio SC1018/04/2016 APL

PROT. N. 00651

18/04/2016 BOSCO DELLE QUERCE, APL

PROT. N. 00642
PROT. N. 00643
PROT. N. 00644
PROT. N. 00645
PROT. N. 00646
PROT. N. 00647
PROT. N. 00648
PROT. N. 00649

REGIONE LOMBARDIA, COMUNE DI SEVESO


DALLA RIZZA ANGELO, DALLA RIZZA
DANIELA, DALLA RIZZA DARIO, DALLA RIZZA
FIORENZA, , APL

Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Meda (MB) Sondaggio SC15NAvviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Meda (MB) Sondaggio SC18Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC34N-

PROT. N. 00652

18/04/2016

PROT. N. 00653

18/04/2016 CALCAGNO GIUSEPPA, APL

PROT. N. 00654

18/04/2016 BALESTRA LUCA, CASTAGNARO MARIA, APL finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC49N-

PROT. N. 00655

18/04/2016 COMUNE DI SEVESO, APL

Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,

PROVINCIA DI MONZA E DELLA BRIANZA,


APL

PROT. N. 00656

18/04/2016

PROT. N. 00657

18/04/2016 MARIAMATILDE, APL

PROT. N. 00658

18/04/2016 DE PONTI MASSIMO, MILANI INES, APL

PROT. N. 00659

18/04/2016 CALCAGNO GIUSEPPA, APL

PROT. N. 00660

18/04/2016 BOSCO DELLE QUERCE, APL

RUSCONI LEONIDA LUIGI, RUSCONI

REGIONE LOMBARDIA, COMUNE DI SEVESO

PROT. N. 00661

18/04/2016

CENTRO AMBROSIANO DOCUMENTAZIONE E


STUDI RELIGIOSI, SEMINARIO
ARCIVESCOVILE DI MILANO, APL

Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC50NAvviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC53Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC55NAvviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Cesano Maderno (MB) Sondaggio SC107NAvviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC138

Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Meda (MB) Sondaggio SC144Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC1541N-

PROT. N. 00662

18/04/2016 PROVINCIADIMILANO,APL

PROT. N. 00668

19/04/2016 DALLA RIZZA ANGELO, APL

PROT. N. 00669

19/04/2016 APL

REGIONE LOMBARDIA, COMUNE DI


SEVESO BOSCO DELLE QUERCE,

PROT. N. 00670

19/04/2016 SIRONI AURELIANO, APL

PROT. N. 00671

19/04/2016 PROVINCIA DI MILANO, APL

PROT. N. 00672
PROT. N. 00673

19/04/2016 SISPA, APL


19/04/2016 APL, DL

PROT. N. 00674

19/04/2016 UBI LEASING, APL

PROT. N. 00675

19/04/2016 GIOVANNI, APL

PROT. N. 00676

19/04/2016 PROVINCIA DI MILANO, APL

PROT. N. 00677

19/04/2016 APL

ANTONA TRAVERSI GRISMONDI

DE PONTI MASSIMO, MILANI INES,

Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC168Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Meda (MB) Sondaggio SC18-

Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Meda (MB) Sondaggio SC18Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC34NAvviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC34NAvviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Barlassina (MB) Sondaggio SC1NTratta B1 - Trasmissione proposte di risoluzione non conformit 260 - 261 - 264 - 266 - 267 - 268 - 269
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Barlassina (MB) Sondaggio SC1NAvviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC3Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC36NAvviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Cesano Maderno (MB) Sondaggio SC106-1Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Cesano Maderno (MB) Sondaggio SC101Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Cesano Maderno (MB) Sondaggio SC101-

PROT. N. 00678

BONFANTI GIULIANO, VITTORIO,


19/04/2016 LUCIANO, APL

PROT. N. 00679

19/04/2016 BONFANTI DINO E SANDRO, APL

PROT. N. 00680

19/04/2016 BONFANTI LUIGA, APL

PROT. N. 00682

19/04/2016 COMUNE DI SEVESO, APL

Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Cesano Maderno (MB) Sondaggio SC101Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC57-

PROT. N. 00683

19/04/2016 COMUNE CESANO MADERNO, APL

Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Cesano Maderno (MB) Sondaggio SC150-

PROT. N. 00684

19/04/2016 PROVINCIA MONZA BRIANZA, APL

Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Meda (MB) Sondaggio SC12-

PROT. N. 00685

19/04/2016 COMUNE CESANO MADERNO, APL

BELLUSCHI ANGELA, BONFANTI


ANGELA, BONFANTI ERMINIA,

PROT. N. 00686

19/04/2016 CASTELLETTI MARIAROSA, APL

PROT. N. 00687

19/04/2016 MARIANOVELLA, APL

PROT. N. 00694

20/04/2016 APL

PROT. N. 00695

20/04/2016 APL

PROT. N. 00696

20/04/2016 APL

PROT. N. 00697

20/04/2016 APL

PROT. N. 00698

20/04/2016 APL

PROT. N. 00699

20/04/2016 APL

PROT. N. 00700

20/04/2016 APL

PROT. N. 00701

20/04/2016 APL

PROT. N. 00702

20/04/2016 APL

PROT. N. 00703

20/04/2016 APL

PROT. N. 00704

20/04/2016 APL

PROT. N. 00705

20/04/2016 APL

PROT. N. 00706

20/04/2016 APL

Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Cesano Maderno (MB) Sondaggio SC164Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC46Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Seveso (MB) Sondaggio SC45Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Cesano Maderno (MB) Sondaggio SC60 Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Cesano Maderno (MB) Sondaggio SC61N Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Cesano Maderno (MB) Sondaggio SC62 Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Cesano Maderno (MB) Sondaggio SC63N Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Cesano Maderno (MB) Sondaggio SC64 Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Cesano Maderno (MB) Sondaggio SC65 Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Cesano Maderno (MB) Sondaggio SC66 Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Cesano Maderno (MB) Sondaggio SC67 Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Cesano Maderno (MB) Sondaggio SC68 Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Cesano Maderno (MB) Sondaggio SC69 Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Cesano Maderno (MB) Sondaggio SC72NIstanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Cesano Maderno (MB) Sondaggio SC73NIstanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Cesano Maderno (MB) Sondaggio SC76N-

PROT. N. 00707

20/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Desio (MB) - Sondaggio SC80N-

PROT. N. 00708

20/04/2016 APL

PROT. N. 00709

20/04/2016 APL

PROT. N. 00710

20/04/2016 APL

PROT. N. 00711

20/04/2016 APL

PROT. N. 00712

20/04/2016 APL

PROT. N. 00713

20/04/2016 APL

PROT. N. 00714

20/04/2016 APL

PROT. N. 00715

20/04/2016 APL

MARZORATI ALVARO, MARZORATI

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Desio (MB) - Sondaggio SC81Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Boviso Masciago (MB) Sondaggio SC86Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Boviso Masciago (MB) Sondaggio SC87Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Boviso Masciago (MB) Sondaggio SC88Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Boviso Masciago (MB) Sondaggio SC89Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Boviso Masciago (MB) Sondaggio SC90Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Boviso Masciago (MB) Sondaggio SC91Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Boviso Masciago (MB) Sondaggio SC99-

PROT. N. 00717

20/04/2016 APL

PROT. N. 00718

20/04/2016 APL

PROT. N. 00719

20/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Cesano Maderno (MB) Sondaggio SC111N Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Cesano Maderno (MB) Sondaggio SC112 Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Cesano Maderno (MB) Sondaggio SC113 -

PROT. N. 00720

20/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Desio (MB) - Sondaggio SC114 -

PROT. N. 00721

20/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Desio (MB) - Sondaggio SC115 -

PROT. N. 00722

20/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Desio (MB) - Sondaggio SC116-

PROT. N. 00723

20/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Desio (MB) - Sondaggio SC117 -

PROT. N. 00724

20/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Desio (MB) - Sondaggio SC118 -

PROT. N. 00725

20/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Desio (MB) - Sondaggio SC121-

PROT. N. 00726

20/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Desio (MB) - Sondaggio SC122 -

PROT. N. 00727

20/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Desio (MB) - Sondaggio SC123-

PROT. N. 00728

20/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Desio (MB) - Sondaggio SC124-

PROT. N. 00729

20/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Desio (MB) - Sondaggio SC125-

PROT. N. 00730

20/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Desio (MB) - Sondaggio SC126 -

PROT. N. 00731

20/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Desio (MB) - Sondaggio SC128-

PROT. N. 00732

20/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Desio (MB) - Sondaggio SC129 -

PROT. N. 00733

20/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Desio (MB) - Sondaggio SC130 -

PROT. N. 00734

20/04/2016 APL

PROT. N. 00735

20/04/2016 APL

PROT. N. 00736

20/04/2016 APL

PROT. N. 00737

20/04/2016 APL

PROT. N. 00738

20/04/2016 APL

PROT. N. 00739

20/04/2016 APL

PROT. N. 00740

20/04/2016 APL

PROT. N. 00741

20/04/2016 APL

PROT. N. 00742

20/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Desio (MB) - Sondaggio SC151 Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Cesano Maderno (MB) Sondaggio SC152-

PROT. N. 00743

20/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Desio (MB) - Sondaggio SC166-

PROT. N. 00744

20/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Desio (MB) - Sondaggio SC207-

PROT. N. 00745

20/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Desio (MB) - Sondaggio SC209 -

PROT. N. 00746

20/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Desio (MB) - Sondaggio SC210 -

PROT. N. 00747

20/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Desio (MB) - Sondaggio SC211-

PROT. N. 00748

20/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Desio (MB) - Sondaggio SC212-

PROT. N. 00749

20/04/2016 STYLE COSTRUZIONI, APL

Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Cesano Maderno (MB) Sondaggio SC164-

PROT. N. 00768

26/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Desio (MB) - Sondaggio SC127-

PROT. N. 00769

26/04/2016 APL

PROT. N. 00770

26/04/2016 APL

PROT. N. 00771

26/04/2016 APL

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Desio (MB) - Sondaggio SC132 Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Cesano Maderno (MB) Sondaggio SC133 Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Cesano Maderno (MB) Sondaggio SC134N Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Boviso Masciago (MB) Sondaggio SC135Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Cesano Maderno (MB) Sondaggio SC137 Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Cesano Maderno (MB) Sondaggio SC140N Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Cesano Maderno (MB) Sondaggio SC149 -

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Desio (MB) - Sondaggio SC131Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Boviso Masciago (MB) Sondaggio SC135Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Boviso Masciago (MB) Sondaggio SC136-

Istanza per lautorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del
Progetto Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. Comune di Desio (MB) - Sondaggio SC213Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Cesano Maderno (MB) Sondaggio SC111N

PROT. N. 00772

26/04/2016 APL

PROT. N. 00779

27/04/2016 F.LLI BERTOGLIO, FECCHIO AMELIA, APL

PROT. N. 00780

27/04/2016 SCUDELLARO FABRIZIO, AVE PATRIZIO, APL finalizzato alla redazione del Progetto Esecutivo. Comune di Cesano Maderno (MB) Sondaggio SC112

AVE ANTONELLA, SOLA DANIELE, LICURSI


ERMELINDA, AVE ARMANDO, AVE ASSUNTA,

PROT. N. 00781

27/04/2016

PRONESTI LUANA, SALERNO IDA,


OSTELLARI ROSALBA, PRONESTI MASSIMO,
PRONESTI GIUSEPPE, PRONESTI FABIO,
PRONESTI MICHELANGELO, APL

PROT. N. 00782

27/04/2016 CASCINA AMERICANA SRL, APL

PROT. N. 00783

27/04/2016 CASCINA AMERICANA SRL, APL

PROT. N. 00784

27/04/2016 CASCINA AMERICANA SRL, APL

PROT. N. 00785

27/04/2016 CASCINA AMERICANA SRL, APL

PROT. N. 00786

PROT. N. 00787

PROT. N. 00788
PROT. N. 00789
PROT. N. 00793
PROT. N. 00795
PROT. N. 00796
PROT. N. 00797
PROT. N. 00798
PROT. N. 00799
PROT. N. 00800
PROT. N. 00801
PROT. N. 00802
PROT. N. 00803
PROT. N. 00804
PROT. N. 00805

PROT. N. 00817

PROT. N. 00818

PROT. N. 00819

PROT. N. 00820

PROT. N. 00821

PROT. N. 00822

PROT. N. 00823

PROT. N. 00824

PROT. N. 00825

PROT. N. 00826

PROT. N. 00827

PROT. N. 00828

PROT. N. 00829

PROT. N. 00830

PROT. N. 00831
PROT. N. 00841
PROT. N. 00842
PROT. N. 00843
PROT. N. 00844

Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,

Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Cesano Maderno (MB) Sondaggio SC113
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Desio (MB) Sondaggio SC114
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Desio (MB) Sondaggio SC115
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Desio (MB) Sondaggio SC117
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Desio (MB) Sondaggio SC118

27/04/2016

CANZI ELIANA, SCHIATTI ALBERTO,


SCHIATTI ALESSANDRA, SCHIATTI ALFIO,
SCHIATTI ALFREDO, SCHIATTI ROBERTO,
SCHIATTI STEFANO, SCHIATTI ISABELLA,
SANTAMBROGIO CARLO, SANTAMBROGIO
ANNA, APL

Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Desio (MB) Sondaggio SC131

27/04/2016

GRANFO VITTORIA, SOMASCHINI


ALESSANDRA, SOMASCHINI CLAUDIO,
SOMASCHINI ERCOLE, SOMASCHINI LIVIO,
SOMASCHINI MARIA, SOMASCHINI MARIO,
SOMASCHINI MAURO, APL

Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Desio (MB) Sondaggio SC132

RADAELLI SILVANA, CITTERIO MARIA


ANGELA, REDAELLI FRANCESCO, RADAELLI
CESARE, MARIANI VIRGILIO, COMO FELICE,
MARIANI ANSELMO, APL

Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Cesano Maderno (MB) Sondaggio SC133Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Cesano Maderno (MB) Sondaggio SC149
27/04/2016
Soc Accom Semplice Immobiliare
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
27/04/2016 Saperce di Brivio Fernando e C., APL finalizzato alla redazione del Progetto Esecutivo. Comune di Cesano Maderno (MB) Sondaggio SC140NSoc Accom Semplice Immobiliare
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
27/04/2016 Saperce di Brivio Fernando e C., APL finalizzato alla redazione del Progetto Esecutivo. Comune di Cesano Maderno (MB) Sondaggio SC60
Soc Accom Semplice Immobiliare
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
27/04/2016 Saperce di Brivio Fernando e C., APL finalizzato alla redazione del Progetto Esecutivo. Comune di Cesano Maderno (MB) Sondaggio SC61N
Soc Accom Semplice Immobiliare
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
27/04/2016 Saperce di Brivio Fernando e C., APL finalizzato alla redazione del Progetto Esecutivo. Comune di Cesano Maderno (MB) Sondaggio SC63
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
27/04/2016 MADILE LUCIANA, CORBETTA GIOVANNI, APL finalizzato alla redazione del Progetto Esecutivo. Comune di Cesano Maderno (MB) Sondaggio SC64
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
ISTITUTO DIOCESANO PER IL
finalizzato alla redazione del Progetto Esecutivo. Comune di Cesano Maderno (MB) Sondaggio SC65
27/04/2016 SOSTENTAMENTO DEL CLERO, APL
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
ISTITUTO DIOCESANO PER IL
finalizzato alla redazione del Progetto Esecutivo. Comune di Cesano Maderno (MB) Sondaggio SC66
27/04/2016 SOSTENTAMENTO DEL CLERO, APL
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
ISTITUTO DIOCESANO PER IL
finalizzato alla redazione del Progetto Esecutivo. Comune di Cesano Maderno (MB) Sondaggio SC67
27/04/2016 SOSTENTAMENTO DEL CLERO, APL
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
ISTITUTO DIOCESANO PER IL
finalizzato alla redazione del Progetto Esecutivo. Comune di Cesano Maderno (MB) Sondaggio SC68
27/04/2016 SOSTENTAMENTO DEL CLERO, APL
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
ISTITUTO DIOCESANO PER IL
finalizzato alla redazione del Progetto Esecutivo. Comune di Cesano Maderno (MB) Sondaggio SC137
27/04/2016 SOSTENTAMENTO DEL CLERO, APL
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
27/04/2016 COMUNE CESANO MADERNO, APL finalizzato alla redazione del Progetto Esecutivo. Comune di Cesano Maderno (MB) Sondaggio SC62 - EX 792
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Desio (MB) Sondaggio SC213 - EX 794
27/04/2016 COMUNE DESIO, APL
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Sondaggio SC 9 Istanza prot. n. 00528/16 del 13.04.2016 29/04/2016 APL
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Sondaggio SC 26 Istanza prot. n. 00532/16 del 13.04.2016 29/04/2016 APL
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Sondaggio SC 27 Istanza prot. n. 00533/16 del 13.04.2016 29/04/2016 APL
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Sondaggio SC 28 Istanza prot. n. 00534/16 del 13.04.2016 29/04/2016 APL
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Sondaggio SC 31N Istanza prot. n. 00536/16 del 13.04.2016 29/04/2016 APL
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Sondaggio SC 32 Istanza prot. n. 00537/16 del 13.04.2016 29/04/2016 APL
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Sondaggio SC 39 Istanza prot. n. 00539/16 del 13.04.2016 29/04/2016 APL
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Sondaggio SC 41 Istanza prot. n. 00540/16 del 13.04.2016 29/04/2016 APL
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Sondaggio SC 43 Istanza prot. n. 00542/16 del 13.04.2016 29/04/2016 APL
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Sondaggio SC 47 Istanza prot. n. 00543/16 del 13.04.2016 29/04/2016 APL
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Sondaggio SC 11 Istanza prot. n. 00529/16 del 13.04.2016 29/04/2016 APL
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Sondaggio SC 14 Istanza prot. n. 00530/16 del 13.04.2016 29/04/2016 APL
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Sondaggio SC 16 Istanza prot. n. 00531/16 del 13.04.2016 29/04/2016 APL
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Sondaggio SC 29 Istanza prot. n. 00535/16 del 13.04.2016 29/04/2016 APL
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Sondaggio SC 33 Istanza prot. n. 00538/16 del 13.04.2016 29/04/2016 APL
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
ACCORDINO SALVATORE, FOCARELLI
finalizzato alla redazione del Progetto Esecutivo. Comune di Desio (MB) Sondaggio SC72
03/05/2016 BARONE ALESSANDRA, APL
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
CANOVA CASE SRL, EMANUELA CAPELLI,
finalizzato alla redazione del Progetto Esecutivo. Comune di Desio (MB) Sondaggio SC73
03/05/2016 APL
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Cesano Maderno (MB) Sondaggio SC76
03/05/2016 CANOVA CASE SRL, APL
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Bovisio Masciago (MB) Sondaggio SC90
03/05/2016 IMMOBILMAR SRL, APL

27/04/2016

DE PONTI MASSIMO, MILANI DE PONTI INES,


APL

PROT. N. 00845

03/05/2016 G & G di Gennari Srl, APL

PROT. N. 00846

03/05/2016 IMMOBILMAR SRL, APL

PROT. N. 00847

03/05/2016 IMMOBILMAR SRL, APL

PROT. N. 00848

03/05/2016 STILE COSTRUZIONI SRL, APL

PROT. N. 00849

03/05/2016 IMMOBILMAR SRL, APL

PROT. N. 00850

03/05/2016 LUCIANO MANARA SRL

PROT. N. 00851

03/05/2016 ELISABETTA, APL

PENGO ASSUNTA BRUNA, PIVA GIOVANNA,


PIVA FRANCESCO, PIVA GAETANO, PIVA

03/05/2016

ARIENTI EMANUELA, DANILO, STEFANO,


ADRIANA, CLARA ANGELA, MASSIMO, ELIDE,
ISOLINA, JOLE, LILIANA, MARINA, MARIA
BAMBINA, MERENZIANA, OSVALDO,
SANDRINO, ALBERTO, GIORDANO, GARDIN
ANNA, RADAELLI MARCO

PROT. N. 00853

03/05/2016

MERONI GIUSEPPINA, SOMASCHINI


WALTER, SOMASCHINI MASSIMO, PEREGO
GIUSEPPINA, SOMASCHINI AMBROGIO,
SOMASCHINI GIUSEPPINA, SOMASCHINI
MARIA, SOMASCHINI BAMBINA, APL

PROT. N. 00854

03/05/2016 DE LUCA MAURO, APL

PROT. N. 00855

03/05/2016 PROVINCIA DI MILANO, APL

PROT. N. 00852

Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Bovisio Masciago (MB) Sondaggio SC87
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Bovisio Masciago (MB) Sondaggio SC88
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Bovisio Masciago (MB) Sondaggio SC89
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Bovisio Masciago (MB) Sondaggio SC90
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Bovisio Masciago (MB) Sondaggio SC91
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Desio (MB) Sondaggio SC207
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Desio (MB) Sondaggio SC210

Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Desio (MB) Sondaggio SC212

Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Desio (MB) Sondaggio SC209
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Desio (MB) Sondaggio SC211
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Cesano Maderno (MB) Sondaggio SC80

BIGAROLI CARLA, BIGAROLI CARLO,


BIGAROLI CARLO, BOSCARO SANTA
TERESINA, BIGAROLI LUCIA, BIGAROLI
GIACINTO, BIGAROLI GIOVANNINA,
BIGAROLI MARCO, BIGAROLI PATRIZIA,
BOSCARO GELINDO, BOSCARO GIUSEPPE,
GALLI VITTORIO, CAFORIO GIUSEPPE,
CAFORIO MADDALENA, GALLI ALBERTO,
GALLI SARA, GALLI MARIO, GALLI SARA,
GALLI STEFANO

PROT. N. 00876

Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Desio (MB) Sondaggio SC125
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Desio (MB) Sondaggio SC69
03/05/2016 FRATELLI BRANDINELLI, APL
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Cesano Maderno (MB) Sondaggio SC152
03/05/2016 NORD BRIANZA SRL, APL
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Desio (MB) Sondaggio SC151
03/05/2016 CASCINA AMERICANA SRL, APL
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Desio (MB) Sondaggio SC166
03/05/2016 ARIENTI, APL
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Comune di Meda (MB) Sondaggio SC9
03/05/2016 COMUNE DI MEDA
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Comune di Meda(MB) Sondaggio SC11
03/05/2016 COMUNE DI MEDA
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Comune di Meda(MB) Sondaggio SC14
03/05/2016 COMUNE DI MEDA
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Comune di Meda (MB) Sondaggio SC16
03/05/2016 COMUNE DI MEDA
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
03/05/2016 REGIONE LOMBARDIA, COMUNE DI SEVESO Comune di Seveso (MB) Sondaggio SC26
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Comune di Seveso (MB) Sondaggio SC27
03/05/2016 REGIONE LOMBARDIA
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
03/05/2016 REGIONE LOMBARDIA, COMUNE DI SEVESO Comune di Seveso (MB) Sondaggio SC28N
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Comune di Seveso (MB) Sondaggio SC29
03/05/2016 GALLI ANNA, GALLI CAROLINA
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Comune di Seveso (MB) Sondaggio SC39N
03/05/2016 REGIONE LOMBARDIA
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Boviso Masciago (MB) Sondaggio SC93
04/05/2016 GRUGNOTORTO SRL, APL
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Boviso Masciago (MB) Sondaggio SC99
04/05/2016 COMUNE DI BOVISIO MASCIAGO, APL
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Cesano Maderno (MB) Sondaggio SC101
04/05/2016 BONFANTI DINO, BONFANTI SANDRO, APL
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Desio (MB) Sondaggio SC116
04/05/2016 LUCIANO MANARA SRL, APL
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
NESPOLI RICCARDO, NESPOLI MAURIZIO,
finalizzato alla redazione del Progetto Esecutivo. Comune di Desio (MB) Sondaggio SC122
04/05/2016 APL

PROT. N. 00877

04/05/2016 APL

PROT. N. 00856
PROT. N. 00857
PROT. N. 00858
PROT. N. 00859
PROT. N. 00860

PROT. N. 00861

PROT. N. 00862

PROT. N. 00863

PROT. N. 00864

PROT. N. 00865

PROT. N. 00866

PROT. N. 00867

PROT. N. 00868

PROT. N. 00869
PROT. N. 00872
PROT. N. 00873
PROT. N. 00874
PROT. N. 00875

03/05/2016

CANTU' UMBERTO, ARIENTI CLAUDIA,


MORGANTI FRANCESCO, FUMAGALLI ANNA,

PROT. N. 00878

04/05/2016 PANTANO GIUSEPPE, APL

PROT. N. 00879

04/05/2016 COMUNE DI DESIO, APL

PROT. N. 00880

04/05/2016 COMUNE DI DESIO, APL

PROT. N. 00881

04/05/2016 APL

PROT. N. 00882

04/05/2016 LAZZARI NATALINA, APL

ARIENTI LUIGI, SOMASCHINI ARGENTINA,


ARIENTI ALESSANDRA, ARIENTI EMANUELA,
CANCELLI LUCIANA, ARIENTI MAURIZIO, DE

PROT. N. 00883

04/05/2016

PROT. N. 00884

04/05/2016

PROT. N. 00885

04/05/2016

PROT. N. 00886

04/05/2016

PROT. N. 00887

04/05/2016

PROT. N. 00888

04/05/2016

PROT. N. 00889

04/05/2016

Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Desio (MB) Sondaggio SC123
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Desio (MB) Sondaggio SC124
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Desio (MB) Sondaggio SC126
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Desio (MB) Sondaggio SC127
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Desio (MB) Sondaggio SC128

Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Desio (MB) Sondaggio SC129
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
COMUNE DI DESIO, APL
finalizzato alla redazione del Progetto Esecutivo. Comune di Desio (MB) Sondaggio SC130
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
BUSNELLI FRANCO, APL
finalizzato alla redazione del Progetto Esecutivo. Comune di Cesano Maderno (MB) Sondaggio SC134
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
IMMOBILMAR SRL, APL
finalizzato alla redazione del Progetto Esecutivo. Comune di Boviso Masciago (MB) Sondaggio SC136
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
REGIONE LOMBARDIA, COMUNE DI SEVESO Comune di Seveso (MB) Sondaggio SC31N
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
REGIONE LOMBARDIA, COMUNE DI SEVESO Comune di Seveso (MB) Sondaggio SC32N
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
REGIONE LOMBARDIA, COMUNE DI SEVESO Comune di Seveso (MB) Sondaggio SC33N
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
PROVINCIA MONZA BRIANZA, COMUNE DI
SEVESO
Comune di Seveso (MB) Sondaggio SC41N

PROT. N. 00890

PROT. N. 00891

PROT. N. 00892
PROT. N. 00897

PROT. N. 00898

PROT. N. 00899

PROT. N. 00900

PROT. N. 00901

PROT. N. 00902

PROT. N. 00903

PROT. N. 00904

PROT. N. 00905

PROT. N. 00906

PROT. N. 00907

PROT. N. 00915

PROT. N. 00915

PROT. N. 00918

PROT. N. 00919

PROT. N. 00920

PROT. N. 00921

PROT. N. 00922

PROT. N. 00923

PROT. N. 00924

PROT. N. 00925

PROT. N. 00926

PROT. N. 00927

PROT. N. 00928

PROT. N. 00929

PROT. N. 00930

PROT. N. 00931

PROT. N. 00932

PROT. N. 00933

PROT. N. 00934

PROT. N. 00935

PROT. N. 00936

PROT. N. 00937

PROT. N. 00938

PROT. N. 00939

Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
04/05/2016 PROVINCIA DI MILANO, COMUNE DI SEVESO Comune di Seveso (MB) Sondaggio SC43N
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Comune di Seveso (MB) Sondaggio SC47N
04/05/2016 REGIONE LOMBARDIA
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Comune di Seveso (MB) Sondaggio SC29
04/05/2016 PROVINCIA MONZA BRIANZA
Avviso di presentazione istanza per lautorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i.,
finalizzato alla redazione del Progetto Esecutivo. Comune di Cesano Maderno (MB) Sondaggio SC81
04/05/2016 APL
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Sondaggio SC 49N Istanza prot. n. 579/16 del 14.04.2016 04/05/2016 APL
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Sondaggio SC 50N Istanza prot. n. 580/16 del 14.04.2016 04/05/2016 APL
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Sondaggio SC 53 Istanza prot. n. 587/16 del 14.04.2016 04/05/2016 APL
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Sondaggio SC 55N Istanza prot. n. 00581/16 del 14.04.2016
04/05/2016 APL
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Sondaggio SC 168 Istanza prot. n. 00586/16 del 14.04.2016 04/05/2016 APL
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Sondaggio SC7N Istanza prot. n. 572/16 del 14.04.2016 04/05/2016 APL
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Sondaggio SC34N Istanza prot. n. 578-671-670/16 del 14.04.2016 04/05/2016 APL
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Sondaggio SC138 Istanza prot. n. 582/16 del 14.04.2016 04/05/2016 APL
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Sondaggio SC144 Istanza prot. n. 585/16 del 14.04.2016 04/05/2016 APL
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Sondaggio SC15N Istanza prot. n. 576/16 del 14.04.2016 04/05/2016 APL
Avviso di autorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. - Richiesta di affissione allAlbo Pretorio. Comune di
Desio (MB) - Sondaggio SC12105/05/2016
Avviso di autorizzazione allaccesso sulle aree private ex art. 15 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo Delibera D.d.s. del 08.10.2015 n. 8202 della Regione Lombardia. - Richiesta di affissione allAlbo Pretorio. Comune di
Desio (MB) - Sondaggio SC12105/05/2016
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
BUSNELLI ROSANGELA, MARIANI
Esecutivo.
Comune di MEDA (MB) Sondaggio 7N
06/05/2016 GIORGIO
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Comune di MEDA (MB) Sondaggio SC 15N
06/05/2016 REGIONE LOMBARDIA
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Comune di Seveso (MB) Sondaggio 34N
06/05/2016 CALCAGNO GIUSEPPA
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Comune di Seveso (MB) Sondaggio 34N
06/05/2016 SIRONI AURELIANO
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Comune di Seveso (MB) Sondaggio 34N
06/05/2016 PROVINCIA DI MILANO
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Comune di SEVESO (MB) Sondaggio SC 50N
06/05/2016 COMUNE DI SEVESO
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Comune di SEVESO (MB) Sondaggio SC53
06/05/2016 PROVINCIA DI MONZA E BRIANZA
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
RUSCONI LEONIDA LUIGI, RUSCONI Esecutivo.
Comune di Seveso (MB) Sondaggio 55N
06/05/2016 MARIAMATILDE
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Comune di SEVESO (MB) Sondaggio SC138
06/05/2016 CALCAGNO GIUSEPPA
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
REGIONELOMBARDIA,BOSCODELLE Esecutivo.
Comune di MEDA (MB) Sondaggio 144
06/05/2016 QUERCE
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Comune di SEVESO (MB) Sondaggio SC168
06/05/2016 PROVINCIA DI MILANO
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Sondaggio SC3 Istanza prot. n. 569/16 del 14.04.2016 06/05/2016
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Sondaggio SC3 Istanza prot. n. 569/16 del 14.04.2016 06/05/2016 APL
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Sondaggio SC6 Istanza prot. n. 571/16 del 14.04.2016 06/05/2016 APL
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Sondaggio SC107N Istanza prot. n. 584/16 del 14.04.2016 06/05/2016 APL
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Sondaggio SC10 Istanza prot. n. 00573/16 del 14.04.2016 06/05/2016 APL
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Sondaggio SC12 Istanza prot. n. 00575/16 del 14.04.2016 06/05/2016 APL
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Sondaggio SC18 Istanza prot. n. 00577/16 del 14.04.2016 06/05/2016 APL
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Sondaggio SC35 Istanza prot. n. 00590/16 del 15.04.2016 06/05/2016 APL
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Sondaggio SC36N Istanza prot. n. 00591/16 del 15.04.2016 06/05/2016 APL
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Sondaggio SC37 Istanza prot. n. 00592/16 del 15.04.2016 06/05/2016 APL
Autorizzazione allaccesso sulle aree private ex art. 15, comma 2 del D.P.R. n. 327/01 e s.m.i., finalizzato alla redazione del Progetto
Esecutivo.
Sondaggio SC38 Istanza prot. n. 00593/16 del 15.04.2016 06/05/2016 APL

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

ALLEGATO 6: RISULTATI CARATTERIZZAZIONE

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 79/81

CANTIERE:

Realizzazione dei lavori concernenti le tratte Svincolo di Lomazzo, B1, B2 C e D e opere di compensazione del collegamento autostradale
Dalmine-Como-Varese-Valico del Gaggiolo e opere ad esse connesse.
OGGETTO:

TRATTA B2 - CONSUNTIVO SONDAGGI


Aggiornamento del

08-set-16
387
CAMPIONE PRELEVATO

Prog.

RIF. CAMPIONE

COMUNE

DATA
PRELIEVO

TS

COORDINATE METRICHE

CAMPIONE ANALIZZATO

ZONA

TS

X [m]

Y [m]

Analisi chimiche
NOTE

SC169

Meda

03-mag

145800.038

242377.73

Su strada preesistente- NO TS

SC170

Meda

03-mag

145903.626

242354.608

Su strada preesistente- NO TS

SC155

Meda

03-mag

146554.234

242191.832

Su strada preesistente- NO TS

SC172

Meda

03-mag

146195.641

242299.793

SC173

Meda

03-mag

SC171

Meda

04-mag

SC153

Meda

04-mag

SC174

Seveso

SC175

10
12

SC176
SC156
SC177

13

x
x

x
x

x
x

2.7
Su strada preesistente- NO TS

CDD/DS
ngE/Kg ss I

Alea
CDD/DS Alea
ngE/Kg ss P analitica TS analitica

2.6

5.00

146254.419

242281.721

146008.334

242337.468

12.9

146093.043

Spostato dalla sede stradale all'aiuola marciapiedi per


presenza di sottoservizi
242308.780

14.7

x
x

PCDD/DS
ngE/Kg ss TS

Alea
TS
I analitica P

TS gC/100g
suolo

I gC/100g
suolo

8.1

1.2

4.5

1.7

8.1

1.22

1.26

0.48

8.1

1.22

4.11

7.9

1.09

0.46

1.6

0.42

4.9
5.3

5.6

7.9

9.8

8.3

7.2
2

0.77

0.63

1.15

1.47

0.64

3.01

6.5

6.9

3.57

2.1

04-mag

146646.767

242165.168

Su strada preesistente- NO TS

0.4

0.15

Seveso

04-mag

146737.314

242138.128

Su strada preesistente- NO TS

0.23

0.09

7.9

1.4

Seveso
Seveso
Meda

04-mag
04-mag
04-mag

x
x
x

x
x
x

R
R
R

x
x
x

146838.762
146944.460
147038.467

242107.233
242083.069
242056.755

Su strada preesistente- NO TS
Su strada preesistente- NO TS

0.28
0.15
0.17

0.11
0.06
0.06

8
7.9
7.9

0.79
1.78
1.07

SC178

Seveso

04-mag

147143.555

242024.049

Su strada preesistente- NO TS

14

SC179

Seveso

04-mag

147237.711

241994.658

15

SC 157

Seveso

05-mag

147323.265

241967.581

16

SC 180

Seveso

05-mag

147415.199

241939.207

17

SC 181

Seveso

05-mag

147518.083

241907.428

18

SC 182

Seveso

05-mag

147612.186

241884.220

19

SC 183

Seveso

05-mag

147711.669

242027.788

4.5

20

SC 184

Seveso

05-mag

147741.220

242119.600

0.1

21

SC 185

Meda

05-mag

147849.540

242104.024

5.3

22

SC 147

Meda

05-mag

23

SC 186

Meda

05-mag

24

SC 148

Seveso

05-mag

25

SC 142

Meda

05-mag

26

SC 141

Meda

05-mag

27

SC18

Meda

06-mag

28

SC144

Meda

29

SC15

Meda

30

SC9

31

SC11

x
x

Su strada preesistente- NO TS

0.1
9.00

Il TS stato prelevato da 0,5 a 0,7 m da p.c.; quindi


quota finale sondaggio 2,5 m da p.c
Il TS stato prelevato da 0,5 a 0,7 m da p.c.; quindi
quota finale sondaggio 2,5 m da p.c
Il TS stato prelevato da 0,5 a 0,7 m da p.c.; quindi
quota finale sondaggio 2,5 m da p.c
Il TS stato prelevato da 0,5 a 0,7 m da p.c.; quindi
quota finale sondaggio 2,5 m da p.c

0.1

0.42

242602.622

0.68

0.26

6.7

1.12

146692.252

242545.554

06-mag

Il TS stato prelevato da 0,8 a 1 m da p.c.; quindi


quota finale sondaggio 3 m da p.c
12.00

242570.965

7.3

0.78
1.23

242700.534

Vicino a esubero CSC col B campione 66

1.37

28

42

0.52

11

16

7.7

7.2

3.75

1.77

1.67

242736.924

Vicino a esubero CSC col B campione 9

4.7

2.2

0.12

1.8

0.84

0.04

7.4

7.6

7.1

3.34

2.26

1.51

145911.833

242807.664

A confine con Zona A

145999.969

242801.469

3.3

0.53

3.2

1.3

0.2

7.3

7.6

6.9

0.95

1.44

0.35

2.5
8.4

strada preesistente all'incidente; top-soil non


eseguito

06-mag

0.6

36

SC143

Meda

09-mag

146481.829

242714.778

41

37

SC17

Meda

09-mag

146362.547

242779.141

30

38
39

SC13
SC19

Meda
Meda

09-mag
09-mag

x
x

x
x

x
x

R
R

x
x

x
x

146245.23
146411.387

242766.281
242506.679

40

SC20

Meda

09-mag

146313.223

41

SC21

Meda

09-mag

146301.933

42

SC22

Meda

09-mag

146348.479

x
x

09-mag

09-mag

Seveso

09-mag

Seveso

09-mag

Seveso

09-mag

Seveso

09-mag

Seveso

09-mag

SC28

Seveso

09-mag

SC27

Seveso

09-mag

SC26

Seveso

09-mag

54

SC58

Seveso

10-mag

55

SC168
SC48
SC25
SC23

Seveso
Seveso
Meda
Meda

10-mag
10-mag
10-mag
10-mag

x
x
x

x
x
x

R
B
B

SC24
SC50
SC53

Meda
Seveso
Seveso

10-mag
10-mag
10-mag

x
x

x
x

A
B

x
x

TRATTA B2 - Caratterizzazione sottosuolo

0.77

146210.55

Meda

1.49
2.53

146252.436

SC7

61

2.78
3.68

35

60

7.8

06-mag

59

7.2

06-mag

58

6.4

Meda

56
57

7.4

Meda

53

6.2
0.04

1.24

SC16

52

0.47

2.18

SC14

51

0.3

0.5

6.4

34

SC47

2.8
0.1

7.1

146335.432

33

50

3.12

2.27

06-mag

SC43

6.2

Meda

SC41

0.78

1.76

SC8

49

2.6

1.3

32

48

2.35

146566.879

1.3

6.1

06-mag

SC39

6.7

Meda

47

0.14

2.12

Meda

SC33

1.62
0.05

6.4

46

6.9

7.1

Seveso

7.4

2.7

Seveso

0.91

1.2

2.22

2.05

SC32

0.85

7.9

0.04
0.36

7.8

242032.39

SC31

8.1

148088.465

45

0.09

0.74

0.86

06-mag

44

1.7

0.98

8.1

0.17
2.38

8.3

242097.366

06-mag

09-mag

242062.474

Seveso

0.05

0.49

147932.420

SC30

0.04

0.04
0.24

1.06

8.1

148011.106

43

0.04

0.1
0.14

8.1

0.04
0.11

0.97

3.5

0.04

0.11

P gC/100g
suolo

2.31

10.2

11

TOT. X GG

fOC

pH

Analisi chimiche

x
x

0.32

0.12

3.21

1.1

145939.125

242867.432

146156.728

242764.247

0.61

1.4

0.23

0.53

2.7

7.3

7.5

2.73

1.47

1.25

146148.234

242639.440

7.9

75

4.3

29

1.7

7.8

7.7

7.1

1.45

1.35

1.13

145845.939

242826.589

0.5

0.23

0.19

7.6

7.5

1.82

1.27

8.5

16

3.2

7.2

3.24

1.13

3.8

11

1.4

6.9

3.65

1.5

5.7
40

2.7
0.33

2.2
15

1
0.13

7.1
6.7

7.6
7.9

2.17
3.55

2.05
1.12

242460.318

1.66

4.6

0.83

0.63

1.7

0.32

7.2

7.4

7.6

2.29

2.43

1.57

242427.657

36

67

6.2

14

26

2.4

7.1

6.9

7.3

2.82

2.7

0.92

242427.075

1.03

0.56

0.23

0.39

0.21

0.09

7.2

7.9

3.3

1.78

1.48

11.1

0.51

4.2

0.19

7.3

7.5

0.24

1.34

Vicino a esubero CSC col B campione 4


9.00

Il punto stato spostato di circa 2 m a lato strada per


difficolt logistiche

146576.089

241979.894

146450.711

241993.903

3.6

1.44

0.87

1.4

0.55

0.33

7.1

8.2

4.92

1.37

146462.378

241931.66

1.77

1.38

0.11

0.67

0.52

0.04

7.4

8.2

4.65

1.57

2.36

146482.994

241869.255

2.47

0.98

0.52

0.94

0.37

0.2

7.3

7.1

8.1

3.19

2.12

0.72

146541.671

241667.34

19.3

10.8

0.44

7.4

4.1

0.17

7.5

8.2

3.94

1.64

0.72

146559.695

241621.087

0.68

0.56

0.11

0.26

0.21

0.04

7.1

7.6

7.3

3.36

1.59

1.11

146585.329

241539.961

1.25

0.72

2.61

0.48

0.27

0.99

6.7

6.9

7.4

4.67

2.22

1.67

146632.065

241377.578

0.87

0.1

1.5

0.33

0.04

7.1

7.6

7.5

3.2

0.48

1.84

146376.714

242169.478

1.34

0.78

1.44

0.51

0.3

1.44

7.4

7.6

5.4

2.11

0.69

146347.791

242204.479

4.8

9.4

0.16

1.8

3.36

0.06

7.8

8.9

2.02

1.07

0.6

146302.685

242241.484

2.32

14.6

16.2

0.88

5.6

6.2

7.2

7.9

7.8

4.29

1.02

1.03

146861.676

240815.975

x
x
x

146838.116
146743.918
146427.048

240851.663
241162.945
242270.74

x
x

18.00

28

5.6
0.14
4.5
1.16
18.5

Su strada preesistente- NO TS
Su strada preesistente- NO TS
Su strada preesistente- NO TS

146442.663

242396.778

122

146374.625
146754.024

242299.986
241165.346

2.9

146807.959

240978.785

Su strada preesistente- NO TS
11.6

0.62
6.9
9.1

0.15
4

11

2.1

46

0.05
1.7
0.44
7

1.1
4.4

0.24
2.6
3.5

0.06
1.5

7.8

6.9

7.4
7.2
7.7
8.2

7.1
7.2

7.3
7.5
7

8.8
8.9

2.16

0.98

2.63

0.89
1.32
0.64
1.39

1.98
1.89

1.65
1.24
1.59

0.79

0.52
1.56

PAG. 1 DI 4

CAMPIONE PRELEVATO
Prog.

RIF. CAMPIONE

COMUNE

CAMPIONE ANALIZZATO

DATA
PRELIEVO

TS

62

SC55

Seveso

10-mag

63

SC54

Seveso

10-mag

64

SC139

Seveso

10-mag

65

SC52

Seveso

66

SC187

67

ZONA

TS

X [m]

Y [m]

146814.809

240961.805

10-mag

Seveso

12-mag

SC160

Seveso

12-mag

68

SC188

Cesano Maderno

12-mag

69

SC189

Cesano Maderno

12-mag

70

SC159

Cesano Maderno

12-mag

71

SC190

Cesano Maderno

12-mag

72

SC191

Cesano Maderno

12-mag

73

SC158

Cesano Maderno

12-mag

74

SC140

Cesano Maderno

12-mag

75

SC161

Cesano Maderno

12-mag

76

SC63

Cesano Maderno

12-mag

77

SC49

Seveso

13-mag

78

SC192

Cesano Maderno

13-mag

79

SC193

Cesano Maderno

COORDINATE METRICHE
NOTE

TOT. X GG

PCDD/DS
ngE/Kg ss TS

22.5

CDD/DS
ngE/Kg ss I

17.2

Alea
CDD/DS Alea
ngE/Kg ss P analitica TS analitica

12.9

8.6

4.1

145890.95

240767.15

146065.215

240770.678

Su strada preesistente- NO TS

0.2

0.08

7.5

1.04

146175.561

240764.199

Su strada preesistente- NO TS

0.51

0.19

8.1

1.92

146254.488

240760.15

0.68

0.26

8.2

1.22

146354.835

240742.085

146456.316

240738.085

146592.763

240718.069

146955.472

240513.837

147036.418

240412.508

146934.24

240590.805

Su strada preesistente- NO TS
Spostato di circa 6 m verso nord per presenza di
sottoservizi
Spostato di circa 6 m verso nord per presenza di
sottoservizi
Su strada preesistente- NO TS. Riubicato su richiesta
del Comune di Cesano Maderno
Spostato di circa 6 m verso nord per presenza di
sottoservizi
Spostato di circa 6 m verso nord per presenza di
sottoservizi
Spostato di circa 6 m verso nord per presenza di
sottoservizi

146745.491

147114.419

240464.092

147219.782

240475.558

1.68

16

3.1

1.13

2.44

0.64

0.93

0.59

7.7

7.9

3.33

1.85

0.62

0.41

0.24

0.16

7.8

8.2

1.11

0.79

1.9

4.2

46

45

11.9

2.1

4.4

4.5

0.8

1.7

1.51

6.7

Il TS stato riscontrato a + 1,2 m da p.c. Il sondaggio


stato approfondito sino a 3,2 m da p.c.

0.85

Il TS stato riscontrato a + 0,4 m da p.c. Il sondaggio


stato approfondito sino a 2,4 m da p.c.

9.4

7.3

7.3

1.9

7.1

0.34

2.8

0.27

3.02

0.94

5.4

2.27

1.51

2.47

7.8

1.49

1.83

7.3

8.4

2.63

1.22

0.32

8.2

1.62

1.11

1.1

0.32

8.1

7.9

1.56

2.85

2.2

5.9

7.5

7.8

3.55

2.46

7.3

7.9

2.12

1.53

8.1

2.66

2.37

146905.066

240671.38

5.36

12.76

147323.94

240483.97

3.21

1.7

82

SC3

Seveso

13-mag

145484.116

242857.896

6.19

2.68

83

SC2

Seveso

13-mag

145403.687

242876.647

3.62

84

SC4

Barlassina

13-mag

145510.612

242937.781

1.21

2.52

0.29

0.65

85

SC59

Seveso

13-mag

146831.533

240735.853

70.1

9.54

34

4.3

86

SC10

Meda

16-mag

87

SC12

Meda

16-mag

88

SC194

Cesano Maderno

16-mag

x
x
x
x
x
x
x

x
x
x
x
x
x
x

x
x
x
x
x
x
x

R
B
R
R
R
R
R

x
x
x
x
x
x
x

x
x

R
R

146160.242

242820.861

147548.771

240519.636

147652.82

240531.469

147748.571

240548.825

147844.884
147117.31
147787.92
147705.973
147614.656
147536.726
147928.794

240554.178
240006.253
239036.349
238943.355
238848.286
238770.415
238898.309

147668.88

238636.617

147776.016

238651.771

147381.366

238598.699
238589.572
237793.972

16-mag

SC89

Bovisio Masciago

16-mag

Bovisio Masciago

Avvertibile un odore acre


Strada non preesistente e Rilevato pi spesso (1,5 m)
su TS
Il TS stato riscontrato a - 0,50 m dal p.d.c. Il
sondaggio stato approfondito fino alla quota - 2,50
m dal p.d.c
Il TS stato riscontrato a - 1,00 m dal p.d.c. - Il
sondaggio stato approfondito fino alla quota - 3,00
m dal p.d.c.
Il TS stato riscontrato a - 1,50 m dal p.d.c. - Il
sondaggio stato approfondito fino alla quota - 3,50
m dal p.d.c.
Il TS stato riscontrato a - 1 m dal p.d.c. - Il
sondaggio stato approfondito fino alla quota - 3 m
dal p.d.c.
Rilevato pi spesso (1 m) su TS
Rilevato pi spesso (1 m) su TS
Rilevato pi spesso (1 m) su TS
Rilevato pi spesso (1 m) su TS
Rilevato pi spesso (1 m) su TS
Rilevato pi spesso (1 m) su TS
Il top-soil stato riscontrato a - 0,50 m dal p.d.c. - Il
sondaggio stato approfondito fino alla quota - 2,50
m dal p.d.c.
Il top-soil stato riscontrato a - 0,80 m dal p.d.c. - Il
sondaggio stato approfondito fino alla quota - 2,80
m dal p.d.c.
Strada non preesistente e Rilevato pi spesso (1,5 m)
su TS
Strada non preesistente e Rilevato pi spesso (1,5 m)
su TS
Su strada preesistente - NO TS

16-mag

98

SC90

242849.485

16-mag

16-mag
16-mag
16-mag
16-mag
16-mag
16-mag

99

146046.735

x
x
x

16-mag

0.2

2.08

0.82

7.2

7.6

0.08

0.92

0.6
1.37

1.75

7.4

7.4
0.52

0.39

8.2

7.8

8.1

7.9

8.1

3.35

2.39

1.55

0.74

2.9

0.3

7.8

6.9

3.53

1.78

1.34

0.3

0.33

8.9

0.92

1.43

0.99

0.92

0.32

0.98
6.5
1.21
23
15.4
5.2
9.3
1.46

7.8

0.32
7.9
3.6

2.4
1.3

1.76
1.03

0.44

7.8

0.75

0.87
7.8
7.6

0.5
0.33

7.5

1.47
2.18

8.1

2.55
1.8
1.65
1.22
1.61
2.54

7.1

1.59

2.34

7.8

7.5

0.84

Bovisio Masciago

16-mag

101

SC197

Bovisio Masciago

16-mag

102

SC97

Bovisio Masciago

17-mag

x
x

147336.594
147347.013

0.34

0.11

8.4

0.65

103

SC96

Bovisio Masciago

17-mag

147346.935

237901.057

Su strada preesistente - NO TS

0.43

0.14

8.3

1.84

104

SC95

Bovisio Masciago

17-mag

147348.604

238003.177

Su strada preesistente - NO TS

0.42

0.13

8.6

1.21

105

SC94

Bovisio Masciago

17-mag

147352.392

238103.822

Su strada preesistente - NO TS

0.37

0.12

8.8

1.26

106

SC165

Bovisio Masciago

17-mag

147325.07

238357.319

Su strada preesistente - NO TS

0.79

8.7

1.43

107

SC198

Bovisio Masciago

17-mag

147316.575

238484.986

0.72

8.8

1.37

108

SC51

Meda

17-mag

146702.399

241093.941

Su strada preesistente - NO TS
strada preesistente all'incidente; top-soil non
eseguito

9.1

0.94

109

SC6

Seveso

17-mag

145754.09

242907.931

7.2

2.07

110

SC199

Bovisio Masciago

17-mag

1.98

111

SC200

Bovisio Masciago

17-mag

112

SC73

Cesano Maderno

17-mag

113

SC77

Cesano Maderno

17-mag

114

SC78

Cesano Maderno

17-mag

115

SC79

Cesano Maderno

17-mag

116

SC70

Cesano Maderno

17-mag

117

SC71

Cesano Maderno

17-mag

118

SC75

Cesano Maderno

17-mag

119

SC111

Cesano Maderno

17-mag

TRATTA B2 - Caratterizzazione sottosuolo

147288.94

238307.371

41.6

238122.062

0.42

147224.067

239453.671

147258.905

239113.211

147240.504

239031.297

147269.207

238908.396

147120.45

239773.422

6.2

147166.04

239639.745

4.02

147357.112

239329.675

148396.932

239561.274

5.9

0.28

147276.481

Su strada preesistente - NO TS - riubicato per


richiesta del comune di Meda

1.56

5.52
Su strada preesistente - NO TS

0.09
1.2

0.37

14

0.75

1.02

18.00

0.59

1.6
0.46

1.88

7.5

8.3

8.2

0.39

8.9

8.4
0.13
2.4

2.88

2.07

2.39

0.75

1.71
8.7

1.86

1.45

8.7
3

0.43

7.8

8.2

0.13
7.44

1.22

1.32

SC85

13.2

0.69

0.76

100

16.00

0.32

7.6

7.6
6.5
6.4
7
8.3
8

0.3
2.2

1.23

8.2

2.5
0.35
9.8
4.2
2
2.2

0.94
1.42

7.6

0.3

7.8

1.64
2.04

0.82

1.17

1.63
9.2

7.1

1.61

6.29

2.4

0.52

0.62

0.16

0.14

8.4

8.8

2.24

1.13

7.3

4.4

2.6

1.7

8.2

6.8

2.33

2.08

1.2

1.94

2.33

1.01

0.3

1.31

2.33

7.3

11.5

0.9

0.94

1.99

0.82

2.19

1.54

6.9

2.16

6.7

17

9.00

1.35

7.8

1.84

0.07

18

Il punto stato spostato di circa 10 m a lato strada


per difficolt logistiche

9.2

0.2

1.6

241206.63

7.4

1.14

11.00

7.1

9.2

0.26

0.04

Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno

0.64

0.95

Su strada preesistente- NO TS
Spostato di circa 7 m su aiuola per presenza di
sottoservizi

0.7

SC69
SC103
SC102
SC100
SC82
SC167

1.62

240775.988

13-mag

92
93
94
95
96
97

5.21

0.1

Cesano Maderno

8.9

7.5

145973.216

8.1

13-mag

SC196

7.2

42
12.00

13-mag

91

P gC/100g
suolo

241009.544

Cesano Maderno

Cesano Maderno

I gC/100g
suolo

146695.219

Cesano Maderno

SC195

TS gC/100g
suolo

SC162

90

240956.941

SC61

Cesano Maderno

6.9

240970.267

81

SC163

4.9

1.5

80

89

Alea
TS
I analitica P

146836.778

Su strada preesistente- NO TS

6.5

fOC

pH

146756.331

Analisi chimiche

Analisi chimiche

3.17

5.7

1.43

PAG. 2 DI 4

CAMPIONE PRELEVATO
Prog.

RIF. CAMPIONE

COMUNE

DATA
PRELIEVO

TS

CAMPIONE ANALIZZATO

ZONA

TS

COORDINATE METRICHE

X [m]

Y [m]

Analisi chimiche

Analisi chimiche
NOTE

TOT. X GG

PCDD/DS
ngE/Kg ss TS

CDD/DS
ngE/Kg ss I

Alea
CDD/DS Alea
ngE/Kg ss P analitica TS analitica

I gC/100g
suolo

2.46

1.51

Bovisio Masciago

18-mag

Bovisio Masciago

18-mag

122

SC64

Cesano Maderno

18-mag

123

SC205

Bovisio Masciago

18-mag

124

SC204

Bovisio Masciago

18-mag

125

SC203

Bovisio Masciago

18-mag

126

SC93

Bovisio Masciago

18-mag

147705.87

127

SC5

Seveso

18-mag

145619.85

242882.569

Su strada preesistente - NO TS

0.82

128

SC74

Cesano Maderno

18-mag

147265.889

239370.193

Su strada preesistente - NO TS

0.36

129

SC99

Bovisio Masciago

18-mag

147405.323

237571.278

3.3

0.9

1.1

0.25

6.8

1.43

1.36

130

SC201

Bovisio Masciago

18-mag

147290.049

237903.583

1.07

0.51

0.3

0.15

8.2

3.13

1.76

131

SC202

Bovisio Masciago

18-mag

147307.75

237697.613

1.32

132

SC35

Seveso-Fraz. Barucana

18-mag

146643.95

241856.262

9.81

2.35

4.2

0.86

5.2

3.19

133

SC36

Seveso-Fraz. Barucana

18-mag

146574.66

241766.469

129.5

27

63

13

6.1

5.3

2.86

1.89

134

SC37

Seveso-Fraz. Barucana

18-mag

146616.104

241728.166

72

10.5

34

4.9

5.6

5.4

2.51

1.47

135

SC38

Seveso-Fraz. Barucana

18-mag

146689.047

241768.79

10.6

1.79

4.5

0.62

5.9

5.4

2.72

1.56

136

SC46

Seveso

20-mag

8.8

6.8

5.7

5.9

3.07

2.61

137

SC44

Seveso

20-mag

2.7

1.2

5.9

5.9

3.46

2.59

138

SC42

Seveso

20-mag

139

SC40

Seveso

20-mag

140

SC45

Seveso

20-mag

141

SC 34

Seveso

20-mag

142

SC207

Desio

20-mag

143
144

SC146
SC 145

Seveso
Seveso

20-mag
20-mag

x
x

x
x

x
x

R
B

x
x

145

SC83

Cesano Maderno

06-giu

146

SC84

Cesano Maderno

06-giu

147

SC149

Cesano Maderno

06-giu

148

SC108

Cesano Maderno

06-giu

149

SC107

Cesano Maderno

06-giu

150

SC106

Cesano Maderno

06-giu

151

SC150

Cesano Maderno

06-giu

152

SC105

Cesano Maderno

06-giu

153

SC80

Cesano Maderno

07-giu

154

SC134

Cesano Maderno

07-giu

155

SC81

Cesano Maderno

07-giu

156

SC104

Cesano Maderno

07-giu

157

SC101

Cesano Maderno

07-giu

158

SC164

Cesano Maderno

07-giu

159

SC62

Cesano Maderno

07-giu

160

SC60

Cesano Maderno

07-giu

177

SC65

Cesano Maderno

08-giu

162

SC66

Cesano Maderno

08-giu

163

SC68

Cesano Maderno

08-giu

164

SC137

Cesano Maderno

08-giu

165

SC67

Cesano Maderno

08-giu

166

SC76

Cesano Maderno

08-giu

167

SC57

Seveso

08-giu

168

SC56

Seveso

08-giu

169

SC152

Cesano Maderno

08-giu

170

SC1

Barlassina

09-giu

171
172
173
174

SC138
SC72
SC113
SC112

Seveso
Cesano Maderno
Cesano Maderno
Cesano Maderno

09-giu
09-giu
09-giu
09-giu

x
x
x
x

175

SC109

Cesano Maderno

09-giu

161

SC133

Cesano Maderno

193

SC110

178

147876.899

238264.415

6.3

147373.503

237680.739

5.3

146794.473

240446.319

147779.817

238253.268

3.9

147601.028

238208.465

2.73

147513.347

238194.66

3.08

1.58

0.86

0.49

6.9

6.8

2.32

1.87

238228.223

4.3

2.29

1.3

0.63

8.1

7.1

2.47

1.51

1.4
10.8

0.11

3.5

8.4

TS gC/100g
suolo

SC98

16.00

6.8

SC206

0.38

121

2.1

Alea
TS
I analitica P

120

1.35

fOC

pH

7.5
4.7

0.04

1.2

1.89

6.5

6.4

8.1

6.7

0.55

2.2

8.8

1.01

7.2

6.8

241423.133

19.03

14.9

241526.546

6.75

3.21

146675.256

241611.669

32.06

12.9

15

5.9

5.7

5.9

2.95

1.26

146690.514

241682.963

10.9

4.019

4.8

1.5

5.8

3.26

1.62

146677.452

241464.657

2.3

2.17

0.7

0.67

5.7

3.23

1.77

146543.444

241873.63

143

70.7

68

33

5.9

5.9

2.93

1.65

148479.09

239926.531

x
x

147673.841
146774.247

241993.047
241351.424

147342.968

238682.99

7.1

147251.828

238617.061

3.9

1.53

11

0.58

5.1

1.89

1.7

148124.508

239284.731

9.4

2.38

14

0.91

6.9

7.3

3.21

1.32

148123.692

239341.05

10.5

3.4

1.3

6.6

6.7

2.16

2.2

147970.638

239331.902

34

14.1

147848.218

239200.853

13.8

2.51

147817.53

239099.364

147750.814

239158.46

147323.866

238852.878

147407.351

238835.794

8.2

147407.688

238762.326

3.8

147890.395

239027.334

5.6

5.7

2.52

147882.423

238838.801

12.4

5.4

5.1

2.25

147890.716

238737.782

15.6

4.5

6.8

1.8

5.5

5.2

146762.07

240559.824

9.4

3.3

4.1

1.3

5.1

5.3

3.02

1.46

146712.747

240638.44

6.2

2.27

2.2

0.78

5.2

5.1

2.16

0.64

Ubicato all'interno di impianto lavorazione inerti

1.09

9.00

8.00

3.66
25.099

1
32.22

0.29

0.42

1.3
12

0.3
15

0.11

8.4

8.4

0.16

2.7

6.1
5.8

6.4
5.5

5.8

8.2

13

5.4

5.3

0.96

0.04

1.66
3

1.49
1.74

7.5

7.5

5.72

1.63

6.2

6.1

8.2

2.19

1.37

3.3

0.76

6.8

6.3

2.13

1.66

2.24

1.8

0.85

5.7

5.7

3.2

3.2

3.2

3.4

6.2
1.2

1.84

5.1

240342.211

9.6
0.6

14.2

146965.449

240191.613

10.2

2.18

147100.294

240197.643

88

44

1.3

147085.672

240269.929

151

97

2.17

147305.506

239214.831

0.98

146697.442

240741.457

20.9

5.6

2.1

5.1

4.9

4.39

1.34

146728.559

240820.249

3.2

3.2

1.2

1.2

5.3

5.6

1.95

148450.597

240346.245

riubicato rispetto alla previsione progettuale per


impossibilit di accedere all'area

0.63

1.03

0.24

0.39

8.2

8.3

2.24

1.82

R (al limite)

145344.545

242968.55

riposizionato all'interno dell'attivir produttica di


progetto per interferenza con i sottoservizi

1.5

0.88

0.34

0.27

7.6

1.98

2.77

x
x
x
x

x
x
x
x

B
B
R
R

x
x
x
x

x
x

241879.979
239605.841
239760.494
239675.574

52
8.5
4.7
9.5

12
3.27

6.1

3.15
3.23
4.06
2.04

2.23
2.25

1.3

6.1
7.9
6.1
6

6.3
7.6

3.5

24
2.2
1.5
3.9

5.4
0.9

146569.452
147275.683
148393.364
148330.181

148143.15

239531.432

23.3

7.4

11

3.2

5.1

5.1

3.03

1.66

09-giu

148205.43

239509.688

8.2

Cesano Maderno

09-giu

148273.387

239469.857

SC154

Seveso

21-giu

145704.491

242396.12

179

SC125

Desio

21-giu

149354.105

239886.291

1.73

180

SC127

Desio

21-giu

149198.365

239881.665

1.01

0.38

7.4
7.2

181

SC121

Desio

21-giu

148882.311

239874.375

1.87

0.71

6.9

182

SC122

Desio

21-giu

149077.138

239764.809

183

SC124

Desio

21-giu

148908.329

239786.634

7.1

2.09

2.7

0.8

8.1

2.06
2.14

2.19

184

SC214

Desio

21-giu

149808.815

240066.631

2.05

1.3

0.78

0.5

6.9

4.7

2.61

1.39

185

SC213

Desio

21-giu

149754.963

240065.654

186

SC29

Seveso

22-giu

146470.11

187

SC208

Desio

22-giu

148473.677

240047.098

188

SC209

Desio

22-giu

148463.465

240136.385

1.36

189

SC128

Desio

22-giu

149159.941

2400019.285

1.75

190

SC130

Desio

22-giu

149385.137

239749.434

3.1

191

SC126

Desio

22-giu

149233.394

239725.325

6.2

4.3

2.4

1.6

5.6

4.02

2.77

192

SC166

Desio

22-giu

149055.203

240095.098

1.5

1.73

0.57

0.66

6.9

2.03

2.89

TRATTA B2 - Caratterizzazione sottosuolo

9.00

riposizionato per inaccessibilit all'area privata

24.00

41.9

No TS (realizzato su strada preesistente). Riubicato


rispetto a previsioni di progetto per mancanza di
autorizzazione all'accesso da parte della Propriet

Rinvenuto solo materiale di riporto

8.00

4.6
5.4

3.9

0.83

33
58

0.31

5.5

5.2

5.7

17

0.5

4.9

4.9

1.5

2.01

1.83

37

0.83

5.1

6.3

5.9

1.11

2.96

20

1.25

1.4

1.5

14.4

5.6

5.5

0.76

2.1

0.52
0.61

0.67

6.3

0.23

3.02

8.9

0.46

1.29

3.03
2.41

2.1

3.02

2.31

6.1

5.9

6.2

1.01

2.03
1.73

8.1

1.2

3.16

3.8

7.4

3.1

2.88

2.36

5.5

2.1

8.2

6.1

3.43

3.79

4.8

1.1

5.4

0.12

0.44
1.73

8.4

5.7

3.4
7.2

3.12

0.04

0.37

1.15

242126.242 Sondaggio di delimitazione contaminazione pregressa

3.7

1.53

240273.446

0.23

1.09

0.91

146843.024

0.1

1.57

0.51

146921.688

1.26

1.21

5.5

1.2

1.9

3.01

8.8

3.4

1.98

1.04

4.8
8.8

8.00

0.04

8.3

1.79

146769.81

0.1

0.08

1.9

146734.317
x

0.1

1.58

8.9

0.15

1.08

1.64

0.12

0.39

1.85

2.2

8.4

0.32

P gC/100g
suolo

2.66

2.14

0.25

1.43

2.33
5.6

2.28

1.72

2.31

PAG. 3 DI 4

CAMPIONE PRELEVATO
Prog.

RIF. CAMPIONE

COMUNE

CAMPIONE ANALIZZATO

DATA
PRELIEVO

TS

ZONA

TS

COORDINATE METRICHE

X [m]

Y [m]

193

SC120

Desio

22-giu

148995.193

239976.208

194

SC119

Desio

22-giu

148822.469

240065.195

195

SC92

Boviaio Masciago

23-giu

147406.61

196

SC88

Bovisio Masciago

23-giu

147501.271

197

SC135

Bovisio Masciago

23-giu

198

SC86

Bovisio Masciago

23-giu

199

SC91

Bovisio Masciago

23-giu

200

SC136

Bovisio Masciago

23-giu

201

SC212

Desio

23-giu

202

SC211

Desio

23-giu

203

SC131

Desio

23-giu

204

SC129

Desio

23-giu

TOT. X GG

PCDD/DS
ngE/Kg ss TS

CDD/DS
ngE/Kg ss I

7.5

1.31
1.45

238267.665

0.68

0.23

7.4

2.04

238509.97

3.79

1.2

5.2

2.99

147654.51

238509.802

4.5

2.9

147528.265

238440.104

15.1

149685.846

240011.704

4.7

149614.087

240023.094

0.85

149419.477

239991.237

0.9

149318.124

240011.731

148458.261

206

SC151

Desio

24-giu

148479.278

207

SC115

Desio

24-giu

148641.192

208

SC116

Desio

24-giu

209

SC118

Desio

24-giu

210

SC117

Desio

24-giu

211

SC87

Boviaio Masciago

27-giu

xx

212

SC114

Desio

28-giu

xx

213

SC132

Desio

29-giu

xx

214

SC123

Desio

30-giu

xx

TS gC/100g
suolo

8.9

4.6

0.46

2.48

24-giu

0.94

238573.587

Cesano Maderno

Alea
TS
I analitica P

1.2

238582.699

SC210

Alea
CDD/DS Alea
ngE/Kg ss P analitica TS analitica

fOC

pH

2.5

9.00

147486.012

205

TRATTA B2 - Caratterizzazione sottosuolo

NOTE

147634.161

Analisi chimiche

Analisi chimiche

10.00

Riubicato per inaccessibilit all'area; ci a


240274.57 comportato il passaggio nel territorio del comune di
Cesano M. al confine con Desio

2.5

0.94

0.8

6.9

1.9
1.7

1.1

6.1

2.66

6.4

0.95

2.36

0.81

1.5

1.5

6.9

2.34

6.6

I gC/100g
suolo

2.49

1.88
5.6

1.37

0.93

5.8

2.14

1.79

4.9

5.4

1.09

2.63

0.25

0.27

6.4

1.1

6.6

0.92
6.3

2.5

1.64

2.65

0.99

0.63

0.27

0.17

239830.467

3.93

1.31

0.93

0.31

4.8

4.4

0.52

2.63

239684.561

4.2

1.4

5.2

5.2

1.66

2.09

148677.721

239942.695

3.31

2.98

0.92

0.87

5.6

5.9

2.28

2.47

148726.054

239817.96

2.65

4.7

0.58

1.4

4.9

5.5

3.45

3.24

148793.697

239733.034

xx

149558.771

239946.705

Il campione Profondo (19-20 m da p.c) stato


prelevato il 29/06/16
Il campione Profondo (19-20 m da p.c) stato
prelevato il 29/06/17
Campione Profondo 19-20 m da p.c

xx

149053.272

239897.814

Campione Profondo 19-20 m da p.c

xx

147383.652

238505.527

xx

148563.925

239786.168

6.00

8.6

1.00

3.31

1.00

4.8

1.00

2.2

1.00

1.87

5.5

3.6
3.9

0.71

0.1

0.82

0.1

1.8

0.1

0.84

0.1

0.71

8.4

0.9

5.3
1.2

0.27

0.04

4.6

0.04

5.5

0.04

6.1

0.04

8.4

P gC/100g
suolo

1.33

2.61
6.1

9.1

7.7

1.71

2.62

8.8

3.85

8.6

2.38

2.7

0.85
2.06
1.82

3.26

0.82

PAG. 4 DI 4

CANTIERE:

Realizzazione dei lavori concernenti le tratte Svincolo di Lomazzo, B1, B2 C e D e opere di compensazione del collegamento autostradale DalmineComo-Varese-Valico del Gaggiolo e opere ad esse connesse.
OGGETTO:

TRATTA B2 - CONSUNTIVO SONDAGGI CON VALORE MASSIMO REGISTRATO TRA NUOVA BRIANTEA E ARPA (dati ARPA in grassetto)
Aggiornamento del

08-set-16

CAMPIONE PRELEVATO
Prog.

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65

RIF. CAMPIONE

SC169
SC170
SC155
SC172
SC173
SC171
SC153
SC174
SC175
SC176
SC156
SC177
SC178
SC179
SC 157
SC 180
SC 181
SC 182
SC 183
SC 184
SC 185
SC 147
SC 186
SC 148
SC 142
SC 141
SC18
SC144
SC15
SC9
SC11
SC8
SC14
SC16
SC7
SC143
SC17
SC13
SC19
SC20
SC21
SC22
SC30
SC31
SC32
SC33
SC39
SC41
SC43
SC47
SC28
SC27
SC26
SC58
SC168
SC48
SC25
SC23
SC24
SC50
SC53
SC55
SC54
SC139
SC52

TRATTA B2 - Caratterizzazione sottosuolo

COMUNE

Meda
Meda
Meda
Meda
Meda
Meda
Meda
Seveso
Seveso
Seveso
Seveso
Meda
Seveso
Seveso
Seveso
Seveso
Seveso
Seveso
Seveso
Seveso
Meda
Meda
Meda
Seveso
Meda
Meda
Meda
Meda
Meda
Meda
Meda
Meda
Meda
Meda
Meda
Meda
Meda
Meda
Meda
Meda
Meda
Meda
Seveso
Seveso
Seveso
Seveso
Seveso
Seveso
Seveso
Seveso
Seveso
Seveso
Seveso
Seveso
Seveso
Seveso
Meda
Meda
Meda
Seveso
Seveso
Seveso
Seveso
Seveso
Seveso

DATA
PRELIEVO

03-mag
03-mag
03-mag
03-mag
03-mag
04-mag
04-mag
04-mag
04-mag
04-mag
04-mag
04-mag
04-mag
04-mag
05-mag
05-mag
05-mag
05-mag
05-mag
05-mag
05-mag
05-mag
05-mag
05-mag
05-mag
05-mag
06-mag
06-mag
06-mag
06-mag
06-mag
06-mag
06-mag
06-mag
06-mag
09-mag
09-mag
09-mag
09-mag
09-mag
09-mag
09-mag
09-mag
09-mag
09-mag
09-mag
09-mag
09-mag
09-mag
09-mag
09-mag
09-mag
09-mag
10-mag
10-mag
10-mag
10-mag
10-mag
10-mag
10-mag
10-mag
10-mag
10-mag
10-mag
10-mag

TS

x
x
x

x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x

x
x
x
x
x

CAMPIONE ANALIZZATO

x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x

x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x

ZONA

R
B
R
A
A
R
R
R
R
R
R
R
R
R
R
R
R
R
R
R
R
R
R
R
R
R
A
A
A
R
A
R
A
A
R
R
R
R
R
A
A
A
B
A
A
A
A
A
A
A
A
A
A
B
R
B
B
R
A
B
B
B
B
B
B

TS

x
x
x

x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x

x
x
x
x
x

x
x
x
x
x

COORDINATE METRICHE

x
x

x
x
x
x
x
x
x
x
x
x
x
x

x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x

x
x
x
x
x
x

x
x
x
x
x
x
x
x
x
x
x
x
x

x
x
x
x

X [m]

Y [m]

145800.038
145903.626
146554.234
146195.641
146254.419
146008.334
146093.043
146646.767
146737.314
146838.762
146944.460
147038.467
147143.555
147237.711
147323.265
147415.199
147518.083
147612.186
147711.669
147741.220
147849.540
147932.420
148011.106
148088.465
146566.879
146692.252
146335.432
146252.436
146210.55
145911.833
145999.969
145939.125
146156.728
146148.234
145845.939
146481.829
146362.547
146245.23
146411.387
146313.223
146301.933
146348.479
146576.089
146450.711
146462.378
146482.994
146541.671
146559.695
146585.329
146632.065
146376.714
146347.791
146302.685
146861.676
146838.116
146743.918
146427.048
146442.663
146374.625
146754.024
146807.959
146814.809
146836.778
146756.331
146695.219

242377.73
242354.608
242191.832
242299.793
242281.721
242337.468
242308.780
242165.168
242138.128
242107.233
242083.069
242056.755
242024.049
241994.658
241967.581
241939.207
241907.428
241884.220
242027.788
242119.600
242104.024
242097.366
242062.474
242032.39
242602.622
242545.554
242570.965
242700.534
242736.924
242807.664
242801.469
242867.432
242764.247
242639.440
242826.589
242714.778
242779.141
242766.281
242506.679
242460.318
242427.657
242427.075
241979.894
241993.903
241931.66
241869.255
241667.34
241621.087
241539.961
241377.578
242169.478
242204.479
242241.484
240815.975
240851.663
241162.945
242270.74
242396.778
242299.986
241165.346
240978.785
240961.805
240956.941
240970.267
241009.544

Analisi chimiche Integrati dati ARPA


NOTE

TOT. X GG

PCDD/DS
ngE/Kg ss TS
medium
bound

Su strada preesistente- NO TS
Su strada preesistente- NO TS
Su strada preesistente- NO TS
2.7
Su strada preesistente- NO TS

5.00

12.9
14.7

Spostato dalla sede stradale all'aiuola marciapiedi per


Su strada preesistente- NO TS
Su strada preesistente- NO TS
Su strada preesistente- NO TS
Su strada preesistente- NO TS; Spostato dal bordo
Su strada preesistente- NO TS
Su strada preesistente- NO TS
9.00

Il TS stato prelevato da 0,5 a 0,7 m da p.c.; quindi


Il TS stato prelevato da 0,5 a 0,7 m da p.c.; quindi
Il TS stato prelevato da 0,5 a 0,7 m da p.c.; quindi
Il TS stato prelevato da 0,5 a 0,7 m da p.c.; quindi

Il TS stato prelevato da 0,8 a 1 m da p.c.; quindi


12.00
Vicino a esubero CSC col B campione 66
Vicino a esubero CSC col B campione 9
A confine con Zona A

Vicino a esubero CSC col B campione 4


9.00

Il punto stato spostato di circa 2 m a lato strada per

18.00

0.11
0.1
0.1
0.14
0.42
4.5
0.1
6.21
3.5
2.05
3.366
0.68
8.235
1.3
1.37
4.7
2.5
10.5
0.61
7.9
0.6
41
30
5.7
40
4.532
36
1.03
11.1
3.6
1.77
3
19.3
0.68
1.25
4
1.34
4.8
2.32
28

Su strada preesistente- NO TS
Su strada preesistente- NO TS; il punto stato
Su strada preesistente- NO TS
122
2.9
Su strada preesistente- NO TS
11.6
22.5
Su strada preesistente- NO TS
42
12.00

PCDD/DS
ngE/Kg ss I
medium
bound
2.6
4.5
1.51
1.22
7.9

PCDD/DS
Alea
ngE/Kg ss P Alea
analitica
TS
analitica
medium
bound

6.818
1.09

0.11
0.24
2.38
0.36
2.6

3.3
0.32
1.4
75
0.5
8.5
3.8
2.7
0.33
4.6
67
0.56
0.51
1.44
1.38
0.98
10.8
0.56
0.72
0.87
2.869
9.4
14.6
5.6
0.14
4.5
1.16
18.5
0.62
6.9
9.1
17.2
4.1
8.1
0.1

1
4.9
5.6

5.3
0.4
0.23
0.28
0.15
0.17
0.1

0.78
1.23
28
2.2

Analisi chimiche Integrati dati ARPA

0.1
42
0.12
0.53
7
4.3

0.83
6.2
0.23
0.87
0.11
0.52
0.44
0.11
2.61
0.1
1.44
0.16
16.2

0.15
4

0.04
0.04
0.04
0.05
0.17
1.7
0.04
2.914
1.3
0.78
1.591
0.26
3.852
0.5
0.52
1.8
1
4.898
0.23
3
0.23
16
12.704
2.2
15
2.135
14
0.39
4.2
1.4
0.67
1.42
7.4
0.26
0.48
1.5
0.51
1.8
0.88
11

46
1.1

12.9

4.4
8.6

0.7

16

1
1.7
0.23
0.46
3

Alea
I analitica P

0
0.42

2
0.15
0.09
0.11
0.06
0.06
0.04
0.04
0.09
0.91
0.14
1

0.3
0.47
11
0.84
1.3
0.12
0.53
29
0.19
3.2
1
0.13
1.7
26
0.21
0.19
0.55
0.52
0.37
4.1
0.21
0.27
0.33
1.359
3.36
5.6
2.1
0.05
1.7
0.44
0.24
2.6
3.5
6.5
1.5
3.1
0.04

0.04
16
0.04
0.2
2.7
1.7

0.32
2.4
0.09
0.33
0.04
0.2
0.17
0.04
0.99
0.04
1.44
0.06
6.2

0.06
1.5
4.9
0.26

PAG. 1 DI 3

CAMPIONE PRELEVATO
Prog.

66
67
68
69
70
71
72
73
74
75
76
77
78
79
80
81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121
122
123
124
125
126
127
128
129
130
131
132
133
134
135
136
137
138
139
140
141
142
143
144
145
146
147

RIF. CAMPIONE

SC187
SC160
SC188
SC189
SC159
SC190
SC191
SC158
SC140
SC161
SC63
SC49
SC192
SC193
SC61
SC162
SC3
SC2
SC4
SC59
SC10
SC12
SC194
SC163
SC195
SC196
SC69
SC103
SC102
SC100
SC82
SC167
SC89
SC90
SC85
SC197
SC97
SC96
SC95
SC94
SC165
SC198
SC51
SC6
SC199
SC200
SC73
SC77
SC78
SC79
SC70
SC71
SC75
SC111
SC206
SC98
SC64
SC205
SC204
SC203
SC93
SC5
SC74
SC99
SC201
SC202
SC35
SC36
SC37
SC38
SC46
SC44
SC42
SC40
SC45
SC 34
SC207
SC146
SC 145
SC83
SC84
SC149

TRATTA B2 - Caratterizzazione sottosuolo

COMUNE

Seveso
Seveso
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Seveso
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Seveso
Seveso
Barlassina
Seveso
Meda
Meda
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Bovisio Masciago
Bovisio Masciago
Bovisio Masciago
Bovisio Masciago
Bovisio Masciago
Bovisio Masciago
Bovisio Masciago
Bovisio Masciago
Bovisio Masciago
Bovisio Masciago
Meda
Seveso
Bovisio Masciago
Bovisio Masciago
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Bovisio Masciago
Bovisio Masciago
Cesano Maderno
Bovisio Masciago
Bovisio Masciago
Bovisio Masciago
Bovisio Masciago
Seveso
Cesano Maderno
Bovisio Masciago
Bovisio Masciago
Bovisio Masciago
Seveso-Fraz. Barucana
Seveso-Fraz. Barucana
Seveso-Fraz. Barucana
Seveso-Fraz. Barucana
Seveso
Seveso
Seveso
Seveso
Seveso
Seveso
Desio
Seveso
Seveso
Cesano Maderno
Cesano Maderno
Cesano Maderno

DATA
PRELIEVO

12-mag
12-mag
12-mag
12-mag
12-mag
12-mag
12-mag
12-mag
12-mag
12-mag
12-mag
13-mag
13-mag
13-mag
13-mag
13-mag
13-mag
13-mag
13-mag
13-mag
16-mag
16-mag
16-mag
16-mag
16-mag
16-mag
16-mag
16-mag
16-mag
16-mag
16-mag
16-mag
16-mag
16-mag
16-mag
16-mag
17-mag
17-mag
17-mag
17-mag
17-mag
17-mag
17-mag
17-mag
17-mag
17-mag
17-mag
17-mag
17-mag
17-mag
17-mag
17-mag
17-mag
17-mag
18-mag
18-mag
18-mag
18-mag
18-mag
18-mag
18-mag
18-mag
18-mag
18-mag
18-mag
18-mag
18-mag
18-mag
18-mag
18-mag
20-mag
20-mag
20-mag
20-mag
20-mag
20-mag
20-mag
20-mag
20-mag
06-giu
06-giu
06-giu

TS

x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x

x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x

x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x

CAMPIONE ANALIZZATO

x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x

x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x

ZONA

R
R
R
R
R
R
B
R
B
B
R
R
B
R
R
R
R
B
R
R
R
R
R
R
B
R
R
R
R
R
R
R
R
R
R
R
R
R
R
B
R
R
R
R
R
R
R
R
R
R
R
B
R
R
R
R
R
R
R
B
B
B
B
B
B
B
B
B
B
R
R
B
R
R
B

TS

x
x

x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x

x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x

x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x

x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x

COORDINATE METRICHE

x
x

x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x

x
x
x
x
x
x

x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x

x
x
x

X [m]

145973.216
145890.95
146065.215
146175.561
146254.488
146354.835
146456.316
146592.763
146955.472
147036.418
146934.24
146745.491
147114.419
147219.782
146905.066
147323.94
145484.116
145403.687
145510.612
146831.533
146046.735
146160.242
147548.771
147652.82
147748.571
147844.884
147117.31
147787.92
147705.973
147614.656
147536.726
147928.794
147668.88
147776.016
147381.366
147336.594
147347.013
147346.935
147348.604
147352.392
147325.07
147316.575
146702.399
145754.09
147288.94
147276.481
147224.067
147258.905
147240.504
147269.207
147120.45
147166.04
147357.112
148396.932
147876.899
147373.503
146794.473
147779.817
147601.028
147513.347
147705.87
145619.85
147265.889
147405.323
147290.049
147307.75
146643.95
146574.66
146616.104
146689.047
146769.81
146734.317
146675.256
146690.514
146677.452
146543.444
148479.09
147673.841
146774.247
147342.968
147251.828
148124.508

Y [m]

240775.988
240767.15
240770.678
240764.199
240760.15
240742.085
240738.085
240718.069
240513.837
240412.508
240590.805
241206.63
240464.092
240475.558
240671.38
240483.97
242857.896
242876.647
242937.781
240735.853
242849.485
242820.861
240519.636
240531.469
240548.825
240554.178
240006.253
239036.349
238943.355
238848.286
238770.415
238898.309
238636.617
238651.771
238598.699
238589.572
237793.972
237901.057
238003.177
238103.822
238357.319
238484.986
241093.941
242907.931
238307.371
238122.062
239453.671
239113.211
239031.297
238908.396
239773.422
239639.745
239329.675
239561.274
238264.415
237680.739
240446.319
238253.268
238208.465
238194.66
238228.223
242882.569
239370.193
237571.278
237903.583
237697.613
241856.262
241766.469
241728.166
241768.79
241423.133
241526.546
241611.669
241682.963
241464.657
241873.63
239926.531
241993.047
241351.424
238682.99
238617.061
239284.731

Analisi chimiche Integrati dati ARPA


NOTE

Su strada preesistente- NO TS
Spostato di circa 7 m su aiuola per presenza di
Su strada preesistente- NO TS
Su strada preesistente- NO TS
Su strada preesistente- NO TS
Spostato di circa 6 m verso nord per presenza di
Spostato di circa 6 m verso nord per presenza di
Su strada preesistente- NO TS
Spostato di circa 6 m verso nord per presenza di
Spostato di circa 6 m verso nord per presenza di
Spostato di circa 6 m verso nord per presenza di

TOT. X GG

2.265

2.16
0.62

11.00

Il TS stato riscontrato a + 1,2 m da p.c. Il sondaggio


Il TS stato riscontrato a + 0,4 m da p.c. Il sondaggio

Il punto stato spostato di circa 10 m a lato strada

9.00
Avvertibile un odore acre
Strada non preesistente e Rilevato pi spesso (1,5 m)
Strada non preesistente
Strada non preesistente con rilevato pi spesso di 1 m
Strada non preesistente e Rilevato pi spesso (1,5 m)
Strada non preesistente e Rilevato pi spesso (1m) su
Rilevato pi spesso (1 m) su TS
Rilevato pi spesso (1 m) su TS
Rilevato pi spesso (1 m) su TS
Rilevato pi spesso (1 m) su TS
Rilevato pi spesso (1 m) su TS
Rilevato pi spesso (1 m) su TS
Rilevato pi spesso (1 m) su TS; vicino a stazione
Rilevato pi spesso (0.8 m) su TS
Strada non preesistente e Rilevato pi spesso (1,5 m)
Strada non preesistente e Rilevato pi spesso (1,5 m)
Su strada preesistente - NO TS
Su strada preesistente - NO TS
Su strada preesistente - NO TS
Su strada preesistente - NO TS
Su strada preesistente - NO TS
Su strada preesistente - NO TS
ubicato in piazzale PV carburanti asfaltato

PCDD/DS
ngE/Kg ss TS
medium
bound

16.00

45
8.905
1.51
0.85
3.02
5.36
3.21
6.19
4.263
1.21
73.524
1.75
11.5
1.34
0.9
0.99
0.98
6.5
1.21
23
15.4
5.2
9.3
1.46
0.94
1.42
13.2

7.2
41.6
0.42
Su strada preesistente - NO TS - riubicato per richiesta
1.22
5.52
Su strada preesistente - NO TS

18.00

6.2
4.02
0.52
18.809
6.3
5.3
25.674
3.9
2.73
3.08
4.3

Su strada preesistente - NO TS
Su strada preesistente - NO TS

16.00

9.744
1.07
1.32
9.81
129.5
72
10.6
19.03
6.75
104.7
10.9
2.3
143

Ubicato all'interno di impianto lavorazione inerti


9.00

3.66
25.099
7.1
3.9
9.4

PCDD/DS
ngE/Kg ss I
medium
bound
0.2
2.44
0.2
0.51
0.68
1.54
0.41
5
4.2
11.9
5
6.7
1
0.94
12.76
1.7
2.68
2.52
9.54

PCDD/DS
Alea
ngE/Kg ss P Alea
analitica TS analitica
medium
bound

1.076

0.82
0.24
46
2.1

0.2

1.37

1.01
1
0.92
7.9
3.6
7.8
1.76
1.03
2.2
0.34
0.43
0.42
0.37
0.79
0.72
0.28
2.466
1.98
27.196
1.56

1.02
0.43
1.6

0.62
4.4
1.35
0.11

1.58
2.29
0.82
0.36
0.9
0.51
2.35
27
10.5
1.79
14.9
3.21
12.9
4.019
2.17
70.7
1.09
1
32.22
1.53
2.38

17
4.161
0.34
0.27
1.1
2.2
1
2
2.01
0.29
33.497
0.39
2.9
0.3
0.3
0.32
0.32
2.5
0.35
9.8
4.2
2
2.2
0.44
0.3
0.32
5.9

1.2
14
0.13

0.46
6.29

10.8

Analisi chimiche Integrati dati ARPA

0.39
0.1
0.1

0.42

2.4
1.2
0.16
8.71
2.1
1.4
11.845
1.2
0.55
0.86
1.3

4.548
0.3
0.32
4.2
63
34
4.5
8.8
2.7
47.508
4.8
0.7
68
1.3
12
2.7
11
14

0.07
0.93
0.08
0.19
0.26
0.59
0.16
1.9
1.6
4.5
1.9
2.8
0.32
0.32
5.9
0
0.92
0.65
4.3

Alea
I analitica P

18

0.52

0.3
0.33
0.3
2.4
1.3
2
0.5
0.33
0.69
0.11
0.14
0.13
0.12
0
0
0.09
1.17
0.75
12.539
0.59

0.39

0.13
2.4
0.14
1.7
0.38
4.7

0.49
0.63
0
0.12
0.25
0.15
0.86
13
4.9
0.62
6.8
1.2
5.9
1.5
0.67
33
0.29
0.3
15

0.15
0.08
0.04

0.16

0.58
0.91
PAG. 2 DI 3

CAMPIONE PRELEVATO
Prog.

RIF. CAMPIONE

COMUNE

DATA
PRELIEVO

CAMPIONE ANALIZZATO
ZONA

TS

TS

x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x

x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x

B
B
B
B
B
R
R
R
R
R
R
B
B
R
R
R
B
B
R
B
B
R
R
B
B
R
R
R
R
R
R
R
R
R
R
R
B
R
R
R
R
R
R
R
R
R
R
R
R
R
R
R
R
R

x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x

x
x
x
x
x

x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x

204

SC108
SC107
SC106
SC150
SC105
SC80
SC134
SC81
SC104
SC101
SC164
SC62
SC60
SC65
SC66
SC68
SC137
SC67
SC76
SC57
SC56
SC152
SC1
SC138
SC72
SC113
SC112
SC109
SC133
SC110
SC154
SC125
SC127
SC121
SC122
SC124
SC214
SC213
SC29
SC208
SC209
SC128
SC130
SC126
SC166
SC120
SC119
SC92
SC88
SC135
SC86
SC91
SC136
SC212
SC211
SC131
SC129

Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Seveso
Seveso
Cesano Maderno
Barlassina
Seveso
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Cesano Maderno
Seveso
Desio
Desio
Desio
Desio
Desio
Desio
Desio
Seveso
Desio
Desio
Desio
Desio
Desio
Desio
Desio
Desio
Boviaio Masciago
Bovisio Masciago
Bovisio Masciago
Bovisio Masciago
Bovisio Masciago
Bovisio Masciago
Desio
Desio
Desio
Desio

06-giu
06-giu
06-giu
06-giu
06-giu
07-giu
07-giu
07-giu
07-giu
07-giu
07-giu
07-giu
07-giu
08-giu
08-giu
08-giu
08-giu
08-giu
08-giu
08-giu
08-giu
08-giu
09-giu
09-giu
09-giu
09-giu
09-giu
09-giu
09-giu
09-giu
21-giu
21-giu
21-giu
21-giu
21-giu
21-giu
21-giu
21-giu
22-giu
22-giu
22-giu
22-giu
22-giu
22-giu
22-giu
22-giu
22-giu
23-giu
23-giu
23-giu
23-giu
23-giu
23-giu
23-giu
23-giu
23-giu
23-giu

x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x

x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x

205

SC210

Cesano Maderno

24-giu

206

SC151
SC115
SC116
SC118
SC117

Desio
Desio
Desio
Desio
Desio

24-giu
24-giu
24-giu
24-giu
24-giu

x
x
x
x
x

x
x
x
x
x

x
x
x
x
x

R
R
R
R
R

x
x
x
x
x

148
149
150
151
152
153
154
155
156
157
158
159
160
177
0.6
163
164
165
166
167
168
169
170
171
172
173
174
175
161
193
178
179
180
181
182
183
184
185
186
187
188
189
190
191
192
193
194
195
196
197
198
199
200
201
202
203

207
208
209
210
211

SC87

Boviaio Masciago

27-giu

xx

212

SC114

Desio

28-giu

xx

213

SC132
SC123

Desio
Desio

29-giu
30-giu

x
x

x
x

xx
xx

R
R

x
x

214

TRATTA B2 - Caratterizzazione sottosuolo

COORDINATE METRICHE

X [m]

Y [m]

Analisi chimiche Integrati dati ARPA


NOTE

148123.692
147970.638
147848.218
147817.53
147750.814
147323.866
147407.351
147407.688
147890.395
147882.423
147890.716
146762.07
146712.747
146843.024
146921.688
146965.449
147100.294
147085.672
147305.506
146697.442
146728.559
148450.597
145344.545
146569.452
147275.683
148393.364
148330.181
148143.15
148205.43
148273.387
145704.491
149354.105
149198.365
148882.311
149077.138
148908.329
149808.815
149754.963
146470.11
148473.677
148463.465
149159.941
149385.137
149233.394
149055.203
148995.193
148822.469
147406.61
147501.271
147486.012
147634.161
147654.51
147528.265
149685.846
149614.087
149419.477
149318.124

239341.05
239331.902
239200.853
239099.364
239158.46
238852.878
238835.794
238762.326
239027.334
238838.801
238737.782
240559.824
240638.44
240342.211
240273.446
240191.613
240197.643
240269.929
239214.831
240741.457
240820.249
240346.245
riubicato rispetto alla previsione progettuale per
242968.55 riposizionato all'interno dell'attivir produttica di
241879.979
239605.841
riposizionato per inaccessibilit all'area privata
239760.494
239675.574
239531.432
239509.688
239469.857
242396.12 No TS (realizzato su strada preesistente). Riubicato
239886.291
239881.665
239874.375
239764.809
239786.634
240066.631
240065.654
242126.242 Sondaggio di delimitazione contaminazione pregressa
240047.098
Rinvenuto solo materiale di riporto
240136.385
2400019.285
239749.434
239725.325
240095.098
239976.208
240065.195
238267.665
238509.97
238582.699
238573.587
238509.802
238440.104
240011.704
240023.094
239991.237
240011.731

148458.261

Riubicato per inaccessibilit all'area; ci a comportato


240274.57 il passaggio nel territorio del comune di Cesano M. al
confine con Desio

x
x
x
x

148479.278
148641.192
148677.721
148726.054
148793.697

x
x
x
x
x
x
x
x
x
x
x
x
x

x
x
x

x
x
x
x
x

x
x
x
x
x
x
x

x
x
x
x
x

239830.467
239684.561
239942.695
239817.96
239733.034

xx

147383.652

238505.527

xx

148563.925

239786.168

xx
xx

149558.771
149053.272

239946.705
239897.814

Il campione Profondo (19-20 m da p.c) stato


prelevato il 29/06/16
Il campione Profondo (19-20 m da p.c) stato
prelevato il 29/06/17
Campione Profondo 19-20 m da p.c
Campione Profondo 19-20 m da p.c

TOT. X GG

8.00

8.00

9.00

24.00

8.00

9.00

10.00

PCDD/DS
ngE/Kg ss TS
medium
bound
10.5
34
13.8
13.122
4.8
8.8
8.2
3.8
5.6
12.4
15.6
9.4
6.2
9.6
16.389
10.2
88
151
0.98
20.9
3.2
0.63
1.5
52
8.5
4.7
9.5
23.3
8.2
41.9
1.73
1.01
1.87
3
7.1
2.05
9.639
8.2
2
1.36
1.75
3.1
6.2
1.5
1.2
2.5
0.68
3.79
2.48
4.6
4.5
15.1
4.7
0.85
0.9
5

PCDD/DS
ngE/Kg ss I
medium
bound
3.4
14.1
2.51
2
2.24

PCDD/DS
Alea
ngE/Kg ss P Alea
analitica TS analitica
medium
bound

0.11

3.2

4.5
3.3
2.27
14.2
2.18
44
97
5.6
3.2
1.03
0.88
12
3.27

0.1
1.3
2.17

0.31

3.5
7.4
7.2
1.15
1.25

2.09
1.3
14.4
5.6

Analisi chimiche Integrati dati ARPA

3.983

0.61
4.3
1.73

5.52
2.9
2.66
2.36
1.5

4
13
5.3
6.103
1.8
3.4
3.4
1.2
2
5.4
6.8
4.1
2.2
3.7
7.602
3.9
33
58
0.37
8
1.2
0.24
0.34
24
2.2
1.5
3.9
11
3.4
20
1.73
0.38
0.71
1.1
2.7
0.78
4.5
3.1
0.76
0.52
0.67
1.2
2.4
0.57
0.46
0.94
0.23
1.2
0.94
1.9
1.7
6.4
0.81
0.25
0.27
1.1

1.3
5.4
0.96
0.76
0.85

0.04

1.2

1.8
1.3
0.78
5.4
0.83
17
37
2.1
1.2
0.39
0.27
5.4
0.9

0.04
0.5
0.83

0.12

1.3
3.2
3
0.44
1.5

0.8
0.5
5.5
2.1

1.879

0.23
1.6
0.66

2.594
1.1
0.95
1.5
0

6.382

0.63

2.994

0.17

1.31
4.2
2.98
4.7

0.93
2
0.92
4.247
3.6

0.31
1.4
0.87
1.4

6.00

3.93
6
3.31
9.122
8.6

1.00

3.31

3.9

0.1

0.82

1.2

1.00

4.8

0.1

1.8

1.00
1.00

2.2
1.87

0.1
0.1

0.84
0.71

0.71

Alea
I analitica P

0.04
0.04

0.27

0.04
0.04

PAG. 3 DI 3

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

ALLEGATO 7: RAPPORTI DI PROVA CARATTERIZZAZIONE


Si rimanda allelaborato:

V_2_A0X_KN201_0_CN_RG_009_B_cert

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 80/81

Collegamento autostradale tra A8 ed A4 Tratte B1, B2, C, D (dallinterconnessione A9 Svincolo di Lomazzo


allinterconnessione A4 Svincolo di Osio Sotto) e TRVA 13+14
INTEGRAZIONE AL PROGETTO ESECUTIVO

ALLEGATO 8: RASSEGNA STAMPA

Relazione tecnica descrittiva dei risultati della caratterizzazione ambientale

V_2_A0X_KN201_0_CN_RG_006_B_02

Pag 81/81

DSULOH
3DJLQD

,O&LWWDGLQR0% HG
9DO6HYHVR
6WUDEDJ

9HUVROHDQDOLVLGL3HGHPRQWDQD6FDWWDODSURWHVWD
GHOOHFDURWH
6LqVYROWRFRQXQYDVVRLRGLFDURWH
DSSRJJLDWRSHUSURWHVWDVXOWDYRORGHLUHODWRUL
GDUDSSUHVHQWDQWLGL1R3HGHPRQWDQDO

LQFRQWURGLPHUFROHGuVHUDLQ)ODRUJDQL]]DWR
GDO&RPXQHSHULQIRUPDUHLFLWWDGLQLVXL
FDURWDJJLLQYLVWDGHOODUHDOL]]D]LRQHGHOOD
WUDWWD%GL3HGHPRQWDQD3UHVHQWLLOVLQGDFR
3DROR%XWWLLOJHRORJR*LDQQL'HO3HUR
LQFDULFDWRGDL&RPXQL HVFOXVD0HGD GL
UHGLJHUHLO3LDQRGLFDUDWWHUL]]D]LRQHLOWHFQLFR
GL3HGHPRQWDQD%DUEDUD9L]]LQLHTXHOOLGL
6WUDEDJ H  F R Q V R U ] L R   1 X R Y D  % U L D Q W H D  
*LXVHSSH0DVVLPL$QGUHD0D]]LH*LXVHSSH
3DVWRUHOOL$QFKHVHJOLROWUHSDUWHFLSDQWL
KDQQRFHUFDWRGLWUDWWHQHUVLVRQRVWDWH
WDQJLELOLODUDEELDHODSDXUDFKHO
DXWRVWUDGD
FRQWLQXDDVXVFLWDUH4XHVWD3HGHPRQWDQD
QRQODYRJOLDPRKDQQRXUODWRDOFXQLFLWWDGLQL
DQFKHGL&RPXQLOLPLWURILLOVLQGDFRGHYH
RSSRUVLFRQIRU]DDTXHVW
RSHUDKDQQR
DJJLXQWRDOWUL3HUWXWWDULVSRVWDLWHFQLFLKDQQR
DIIHUPDWRFKHULSRUWHUDQQRDLYHUWLFLGL6RFLHWj
3HGHPRQWDQDTXDQWRFKLHVWRGDLUHVLGHQWLGDO
PRPHQWRFKHQpXQUHVSRQVDELOHGL
3HGHPRQWDQDQpXQRGHOOD)ODTXLQGLGL
5HJLRQHHUDQRSUHVHQWL*UD]LHDJOL
DPELHQWDOLVWLLO3LDQRGLFDUDWWHUL]]D]LRQHq
VWDWRDPSOLDWRHTXHVWHDQDOLVLFL
SHUPHWWHUDQQRGLFRQRVFHUHORVWDWRDWWXDOHG
LQTXLQDPHQWRGHLWHUUHQLKDGHWWRLOVLQGDFR
&RQVLGHUDWRFKHQRQFLVRQRFHUWH]]HVXOODSURVHFX]LRQHGHOO
DXWRVWUDGDQRWRDWXWWLSHUzFKHOD
0LODQR0HGDQRQUHJJHSLLYROXPLGLWUDIILFRHDEELVRJQDG
LQWHUYHQWLVWUXWWXUDOL6DUjSRLQRVWUD
SUHPXUDSUHWHQGHUHFKHODERQLILFDYHQJDIDWWDQHOPRGRPLJOLRUH$QFKHQHO3JWDEELDPRLQVHULWRFKH
FKLFRVWUXLUjQHOOHH[]RQH%HG5GRYUjIDUHSUHYHQWLYHDQDOLVLGHOWHUUHQR(OD)ODKDGLUHFHQWHFKLHVWR
LOYLDOLEHUDGHOOD5HJLRQHSHUDJJLRUQDUHOHDQDOLVLGHLWHUUHQL/DERQLILFDqVRORXQDGHOOHLSRWHVL
QRQqGHWWRFKHVLSRVVDDUULYDUHDYDULD]LRQLSURJHWWXDOLGHOO
RSHUDKDDJJLXQWR'HO3HUR,WHFQLFL
0D]]LH9L]]LQLKDQQRVSLHJDWRFKHLFDURWDJJLD6HYHVRGXUHUDQQRGDODOPDJJLRVDUDQQRGL
FXLLQDUHHSULYDWHHOXQJRODVXSHUVWUDGD,OSULPRDYYHUUjLOPDJJLRLQYLD9LJQD]]RODLO
PDJJLROHPDFFKLQHHQWUHUDQQRDO%RVFRGHOOH4XHUFHLOLQL]LHUDQQRLSUHOLHYLLQWHUUHQLSULYDWL/

DQDOLVLGLRJQLEDUDWWRORFRVWHUjHXURFKH$SOSDJKHUjFRQLIRQGLSHUJOLLPSUHYLVWLHRJQL
FDPSLRQHYHUUjDQDOL]]DWRLQFRQWUDGGLWWRULRFRQ$USD/
DQDOLVLQHOPLRWHUUHQRPHODSDJRLRPDq
DVVXUGRFKHYHQJDIDWWDLQIXQ]LRQHGL3HGHPRQWDQDHFRQVLGHUDWDLPSUHYLVWRKDGHWWRXQFLWWDGLQR
&RPHVLSURWHJJHUDQQRLSDVVDQWL"KDQQRIDWWRHFRDOWUL&KLSDJKHUjODERQLILFD"'RYHYHUUj
SRUWDWDODWHUUDFRQWDPLQDWD"3HUFKpFLUXEDWHXQDVXSHUVWUDGDJUDWLVSHUPHWWHUHDUHSHQWDJOLROD
5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

&RQWLQXD! 

DSULOH
3DJLQD
6HJXH

,O&LWWDGLQR0% HG
9DO6HYHVR

6WUDEDJ
QRVWUDVDOXWHFRQVEDQFDPHQWLGLWHUUHQLLQTXLQDWL"&RPHPDLLVRQGDJJLOXQJRODVXSHUVWUDGDVRQR
FRVuSRFKL"&LSRVVLDPRRSSRUUHDLFDURWDJJL"

6$5$%$//$%,2

5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

PDU]R
3DJLQD

*LRUQDOHGL'HVLR
6WUDEDJ

3('(0217$1$1RQULVSHWWDWLJOLDFFRUGLYLVLWDGHOODVRFLHWjVHQ]DLQIRUPDUHO

$PPLQLVWUD]LRQH

7HFQLFLQHLWHUUHQLSULYDWLLO&RPXQHVFULYHDO
3UHIHWWR
6(9(62 JEQ 8QDOHWWHUDGLSURWHVWDDO
3UHIHWWRGL0RQ]DH%ULDQ]DSHULOPDQFDWR
ULVSHWWRGHJOLDFFRUGLGDSDUWHGL
3HGHPRQWDQD
$VFULYHUODLOVLQGDFR3DROR%XWWLULPDVWR
SURIRQGDPHQWHGHOXVRGDTXDQWRDFFDGXWRVXO
WHUULWRULR1HLJLRUQLVFRUVLDOFXQLFLWWDGLQL
KDQQRLQIDWWLLQWHUSHOODWRO
XIILFLR(FRORJLDH
$PELHQWHSHUFKLHGHUHLQIRUPD]LRQLLQPHULWR
DOO
DYYLRGDSDUWHGL3HGHPRQWDQDGHOOH
SURFHGXUHUHODWLYHDOSLDQRGLFDUDWWHUL]]D]LRQH
GHLWHUUHQLFRQWDPLQDWLGDGLRVVLQD$OFXQL
WHFQLFLGL3HGHPRQWDQDH6WUDEDJHUDQRVWDWL
YLVWLIDUHGHLVRSUDOOXRJKLFRQUHODWLYR
SRVL]LRQDPHQWRGHLSLFFKHWWLLQWHUUHQLGL
SURSULHWjSULYDWD6LDPRPROWRGLVSLDFLXWL
VSLHJDLOSULPRFLWWDGLQR3HGHPRQWDQDH
6WUDEDJDQFRUDXQDYROWDGLVDWWHQGRQRJOL
LPSHJQLSUHVLGXUDQWHODFRQIHUHQ]DGHLVHUYL]L
LQ5HJLRQHHQHOWDYRORGLODYRURDSHUWRFRQOD
3UHIHWWXUDGL0RQ]D'DXQDVXFFHVVLYD
YHULILFDIDWWDGDJOLXIILFLFRPXQDOLVLDOD
FRQFHVVLRQDULDFKHODVRFLHWjLQFDULFDWDKDQQR
FRQIHUPDWRFKHVLWUDWWDYDGLLQWHUYHQWL
SURSHGHXWLFLULVSHWWRDOO
DYYLRGHOOH
SURFHGXUH/
DFFRUGRDYHYDVWDELOLWRFKHOH
GXHVRFLHWjDYUHEEHURGDSSULPDLQIRUPDWRLO
&RPXQHSHUPHWWHUVLG
DFFRUGRLQPHULWRDL
SUHOLHYLLQPRGRWDOHSRLGDLQIRUPDUHLSURSULHWDULGHOOHDELWD]LRQL1RQSXzHVVHUHXQDJLXVWLILFD]LRQH
TXHOODFKHVLWUDWWDYDVRORGLVRSUDOOXRJKLSURSHGHXWLFLDOSLDQRGLODYRURFRPPHQWD%XWWL7XWWRLO
SHUFRUVRFKHSRUWHUjDOSLDQRGLFDUDWWHUL]]D]LRQHGRYUjHVVHUHFRQGLYLVRFRQLVWLWX]LRQLHSRSROD]LRQH
1HOIUDWWHPSRLQ0XQLFLSLRqVWDWDVFULWWDDO3UHIHWWRXQDOHWWHUDGLSURWHVWDJLjJLXQWDDGHVWLQD]LRQH
,QWDQWRGRPDQL PHUFROHGu DYUHPRXQLQFRQWURFRQ6WUDEDJSHUFKLDULUHODVLWXD]LRQHFRQFOXGHLO
VLQGDFR

5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

PDJJLR

FRUULHUHLW
$XWRVWUDGD3HGHPRQWDQD

6LQGDFLSHUO
DPELHQWH

/DPLD6HYHVRqULQDWDERVFKLGRYHF
HUDOD
GLRVVLQD
,OSULPRFLWWDGLQR3DROR%XWWLLOOXJOLRDYHYDDQQLHGHUDDOPDUHFRQJOL]LL
4XDQGRVLVSDUVHODYRFHFKHYHQLYRGD6HYHVRLQFDPSHJJLRVLIHFHLOYXRWRLQWRUQR
,OOXJOLR3DROR%XWWLDYHYDDQQLHG
HUDDOPDUHLQ7RVFDQDFRQJOL]LL/HQRWL]LH
GHOORVFRSSLRGHOUHDWWRUH$GHOO
,FPHVDD
6HYHVRHGHOODQXEHWRVVLFDDUULYDYDQRGD
JLRUQDOLHWHOHYLVLRQHPDVRSUDWWXWWRGDL
JHQLWRULULPDVWLLQFLWWj4XDUDQW
DQQLGRSR
%XWWLqVLQGDFRSGD6HYHVRHIDLFRQWLFRQLO
SDVVDWRPDVRSUDWWXWWRFRQLOIXWXURGHOOXRJR
GRYHKDVHPSUHYLVVXWRFKHQRQYXROHSL
HVVHUHODFLWWjGHOODGLRVVLQD4XDQGRVL
VSDUVHODYRFHFKHYHQLYRGD6HYHVRLQ
FDPSHJJLRVLIHFHLOYXRWRLQWRUQR3HUPROWL
DQQLKRFRQWLQXDWRDGLUHGLDELWDUHD0LODQR
2JQLDQQLYHUVDULRqXQDIHULWDFKHVLULDSUH
2JQXQRUHDJLVFHDSURSULRPRGRF
qFKL
SUHIHULVFHGLPHQWLFDUHHFKLULFRUGDSHUFKp
TXHOJLRUQRKDSHUVRWXWWR2UDqJLXQWRLO
PRPHQWRGLJXDUGDUHDOSHUFRUVRIDWWR
3DUDGRVVDOPHQWHLOGLVDVWURGHOODGLRVVLQDKD
SHUPHVVRGLFRVWUXLUHXQDFLWWjUHVLOLHQWH
GRYHVLqVYLOXSSDWDXQDFRQVDSHYROH]]D
PDJJLRUHGLWXWHODDPELHQWDOH"$EELDPR
DSSHQDYLQWRXQILQDQ]LDPHQWRHXURSHRXQLFD
FLWWjLQ,WDOLDSHUDYHUDXPHQWDWRGLSXQWLLQ
XQDQQRODUDFFROWDGLIIHUHQ]LDWDDUULYDQGRDO
JUD]LHDOVDFFRFRQPLFURFKLS'DO
SURVVLPRDQQRLVHYHVLQLSDJKHUDQQRLQEDVH
DTXDQWRSURGXFRQRHO
RELHWWLYRqDUULYDUHDOO

GLGLIIHUHQ]LDWD&
qXQDGLUHWWLYDHXURSHDFKHSRUWDLOQRPHGL6HYHVRGDOODQRVWUDHVSHULHQ]D
JOL6WDWLGHOO
8QLRQHVLVRQRGRWDWLGLXQDSROLWLFDGLSUHYHQ]LRQHGHLULVFKLLQGXVWULDOL(SRLF
qLOERVFR
GHOOH4XHUFHXQSDUFRXUEDQRFUHDWRVXOO
DUHDSLFRQWDPLQDWDHVHPSLRXQLFRGLERQLILFD8QD
FRQTXLVWDGHOODFODVVHSROLWLFDGLDOORUDFKHKDVDSXWRGLUHQRDOIRUQRLQFHQHULWRUHSHUVPDOWLUHLULILXWL
WRVVLFL$EELDPRFKLHVWRLFDURWDJJLVXLWHUUHQLGRYHqSUHYLVWDOD3HGHPRQWDQDHQHFKLHGLDPROD
ERQLILFDSHUODWXWHODGHOODVDOXWH*OLXOWLPLGDWLGLFRQRFKHLQFLGHQ]DHPRUWDOLWjGHLWXPRULVX
SHUVRQHHVSRVWHGLUHWWDPHQWHQRQVRQRDXPHQWDWHLQDOFXQDGHOOH]RQHLQTXLQDWH&
qXQ
SURJUDPPDDOERVFRGHOOHTXHUFHFKHSDUWHRJJLFRQULFRUGLHWHVWLPRQLDQ]H'DOO
DOOXJOLRDYUHPR
WUHJLRUQLGLFRQWDPLQD]LRQLPDGLVSRUWHWHDWUR&KLXGLDPRDGRWWREUHFRQXQFRQYHJQRLQWHUQD]LRQDOH
VXOOHFLWWjUHVLOLHQWLFDSDFLGLULJHQHUDUVLGRSRLOWUDXPD
5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

&RQWLQXD!

PDJJLR

,O6ROH2UH
3ULPD3DJLQD

5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

PDJJLR
3DJLQD

,O&LWWDGLQR0% HG
9DO6HYHVR
6WUDEDJ

&DURWDJJLLQSXQWLGHOWHUUHQR7UD0HGDH
&HVDQRFROULVFKLRWRVVLFR
VWDWRDSSURYDWRLOOXJOLRGHOLQ
5HJLRQHLO3LDQRGLFDUDWWHUL]]D]LRQHGHL
WHUUHQLFRQWDPLQDWLGDGLRVVLQDHVXFXLGRYUj
SDVVDUHODWUDWWD%GL3HGHPRQWDQD&RQFRUGL
DQFKH$USD$VO3URYLQFLDHL&RPXQLGD
%DUODVVLQDD'HVLR3UHYHGHSXQWLG

LQGDJLQHHLVRQGDJJLVRQRLQFRUVRLQTXHVWL
JLRUQL
1HO3HGHPRQWDQDFRQ$USDDYHYDJLj
HIIHWWXDWRDQDOLVLGHLWHUUHQLVXOODWUDWWD%WUD
0HGDH&HVDQRVSLHJD*LDQQLGHO3HURLO
JHRORJRLQFDULFDWRGDL&RPXQLWUDQQH0HGD
GLUHGLJHUHHVHJXLUHLO3LDQRGL
FDUDWWHUL]]D]LRQHHWDOLDQDOLVLDYHYDQR
HYLGHQ]LDWRLOVXSHUDPHQWRGHLOLPLWLGL
GLRVVLQDLQSXQWLGLFXLDQFKHROWUHLO
OLPLWHLQGXVWULDOHVXFDPSLRQLDQDOL]]DWL
1HOHSRL$SOHIIHWWXzDOWUHDQDOLVL
FRQWUROODQGRVRORKRWVSRWHGDQFKHLQ
TXHVWRFDVRULOHYzLOVXSHUDPHQWRGLGLRVVLQD
ROWUHLOOLPLWHLQGXVWULDOH(SSXUHYHQQH
UHGDWWRLOSURJHWWRGHILQLWLYRHQHOYHQQH
SXUHSUHDQQXQFLDWDODVWHVXUDGLTXHOOR
HVHFXWLYRFRQWLQXD'HO3HUR&
qYROXWDWXWWD
ODFRQWUDULHWjGHOWHUULWRULRLQSDUWLFRODUHGHO
FRRUGLQDPHQWR,QVLHPHLQUHWHHGLDOFXQH
DPPLQLVWUD]LRQLFLRq6HYHVRH'HVLRFKH
KDQQRGLIILGDWR$SOGDOUHGLJHUHLOSURJHWWRLQ
DVVHQ]DGLXQ3LDQRGLFDUDWWHUL]]D]LRQH/DFXLQHFHVVLWjqVWDWDULEDGLWDQHOVHWWHPEUHGHOGDO
FRQVLJOLRUHJLRQDOHFKHKDDSSURYDWRDOO
XQDQLPLWjXQDPR]LRQH,O3LDQRLQDWWXD]LRQHSUHYHGH
SXQWLULFDGHQWLLQ]RQD$LQ]RQD%LQ]RQD5HDOGLIXRULGLTXHVW
XOWLPD9HUUDQQRSUHOHYDWL
FDPSLRQLSHURJQLSXQWRSHUXQWRWDOHGLFDPSLRQLGLWHUUHQR2JQLFDPSLRQHYHUUjSRLDQDOL]]DWR
GD6WUDEDJHFRQVRU]LR1XRYD%ULDQWHDLQFRQWUDGGLWWRULRFRQ$USD/DGLRVVLQDVRWWRWHUUDQRQIDQXOOD
DQHVVXQRSXQWXDOL]]D'HO3HURPDqRYYLRFKHFRQO
LPPHQVDPRYLPHQWD]LRQHGLWHUUDQHFHVVDULD
SHUUHDOL]]DUHO
DXWRVWUDGDLOSHULFRORWRUQHUjDWWXDOH&RQVLGHUDWRFKHTXHVW
XOWLPDqSHULFRORVDQHOO

RUJDQLVPRDQFKHLQTXDQWLWjLQILQLWHVLPDOL6DUjGXQTXHQHFHVVDULDXQDERQLILFDPDDGRJJL$SOKD
GLPRVWUDWRGLQRQDYHUHOHULVRUVH%DVWLGLUHFKHSXUHLOFRVWRGHLFDURWDJJLFKHGRYUHEEHDJJLUDUVLVXL
PLODHXURqVWDWRLQVHULWRDOODYRFHLPSUHYLVWLFKHULVXOWDDGRJJLVFRSHUWD,QIDWWLSHUOD%VL
GRYUDQQRPRYLPHQWDUHFLUFDPLOLRQLGLPHWULFXELGLWHUUHQLULIOHWWH'HO3HURGLFXLDOPHQRPLOD
PHWULFXELGRYUDQQRILQLUHLQGLVFDULFDSDULDFLUFDPLOLRQHGLWRQQHOODWH,OWXWWRSHUXQLPSRUWRSDULD
FLUFDPLOLRQLGLHXURSHULOVRORVPDOWLPHQWRGHOODWHUUDFRQWDPLQDWD

5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

&RQWLQXD!

PDJJLR
3DJLQD

,O&LWWDGLQR0%
6WUDEDJ

&DURWDJJLLQSXQWLGHOWHUUHQR7UD0HGDH
&HVDQRFROULVFKLRWRVVLFR
VWDWRDSSURYDWRLOOXJOLRGHOLQ
5HJLRQHLO3LDQRGLFDUDWWHUL]]D]LRQHGHL
WHUUHQLFRQWDPLQDWLGDGLRVVLQDHVXFXLGRYUj
SDVVDUHODWUDWWD%GL3HGHPRQWDQD&RQFRUGL
DQFKH$USD$VO3URYLQFLDHL&RPXQLGD
%DUODVVLQDD'HVLR3UHYHGHSXQWLG

LQGDJLQHHLVRQGDJJLVRQRLQFRUVRLQTXHVWL
JLRUQL
1HO3HGHPRQWDQDFRQ$USDDYHYDJLj
HIIHWWXDWRDQDOLVLGHLWHUUHQLVXOODWUDWWD%WUD
0HGDH&HVDQRVSLHJD*LDQQLGHO3HURLO
JHRORJRLQFDULFDWRGDL&RPXQLWUDQQH0HGD
GLUHGLJHUHHVHJXLUHLO3LDQRGL
FDUDWWHUL]]D]LRQHHWDOLDQDOLVLDYHYDQR
HYLGHQ]LDWRLOVXSHUDPHQWRGHLOLPLWLGL
GLRVVLQDLQSXQWLGLFXLDQFKHROWUHLO
OLPLWHLQGXVWULDOHVXFDPSLRQLDQDOL]]DWL
1HOHSRL$SOHIIHWWXzDOWUHDQDOLVL
FRQWUROODQGRVRORKRWVSRWHGDQFKHLQ
TXHVWRFDVRULOHYzLOVXSHUDPHQWRGLGLRVVLQD
ROWUHLOOLPLWHLQGXVWULDOH(SSXUHYHQQH
UHGDWWRLOSURJHWWRGHILQLWLYRHQHOYHQQH
SXUHSUHDQQXQFLDWDODVWHVXUDGLTXHOOR
HVHFXWLYRFRQWLQXD'HO3HUR&
qYROXWDWXWWD
ODFRQWUDULHWjGHOWHUULWRULRLQSDUWLFRODUHGHO
FRRUGLQDPHQWR,QVLHPHLQUHWHHGLDOFXQH
DPPLQLVWUD]LRQLFLRq6HYHVRH'HVLRFKH
KDQQRGLIILGDWR$SOGDOUHGLJHUHLOSURJHWWRLQ
DVVHQ]DGLXQ3LDQRGLFDUDWWHUL]]D]LRQH/DFXLQHFHVVLWjqVWDWDULEDGLWDQHOVHWWHPEUHGHOGDO
FRQVLJOLRUHJLRQDOHFKHKDDSSURYDWRDOO
XQDQLPLWjXQDPR]LRQH,O3LDQRLQDWWXD]LRQHSUHYHGH
SXQWLULFDGHQWLLQ]RQD$LQ]RQD%LQ]RQD5HDOGLIXRULGLTXHVW
XOWLPD9HUUDQQRSUHOHYDWL
FDPSLRQLSHURJQLSXQWRSHUXQWRWDOHGLFDPSLRQLGLWHUUHQR2JQLFDPSLRQHYHUUjSRLDQDOL]]DWR
GD6WUDEDJHFRQVRU]LR1XRYD%ULDQWHDLQFRQWUDGGLWWRULRFRQ$USD/DGLRVVLQDVRWWRWHUUDQRQIDQXOOD
DQHVVXQRSXQWXDOL]]D'HO3HURPDqRYYLRFKHFRQO
LPPHQVDPRYLPHQWD]LRQHGLWHUUDQHFHVVDULD
SHUUHDOL]]DUHO
DXWRVWUDGDLOSHULFRORWRUQHUjDWWXDOH&RQVLGHUDWRFKHTXHVW
XOWLPDqSHULFRORVDQHOO

RUJDQLVPRDQFKHLQTXDQWLWjLQILQLWHVLPDOL6DUjGXQTXHQHFHVVDULDXQDERQLILFDPDDGRJJL$SOKD
GLPRVWUDWRGLQRQDYHUHOHULVRUVH%DVWLGLUHFKHSXUHLOFRVWRGHLFDURWDJJLFKHGRYUHEEHDJJLUDUVLVXL
PLODHXURqVWDWRLQVHULWRDOODYRFHLPSUHYLVWLFKHULVXOWDDGRJJLVFRSHUWD,QIDWWLSHUOD%VL
GRYUDQQRPRYLPHQWDUHFLUFDPLOLRQLGLPHWULFXELGLWHUUHQLULIOHWWH'HO3HURGLFXLDOPHQRPLOD
PHWULFXELGRYUDQQRILQLUHLQGLVFDULFDSDULDFLUFDPLOLRQHGLWRQQHOODWH,OWXWWRSHUXQLPSRUWRSDULD
FLUFDPLOLRQLGLHXURSHULOVRORVPDOWLPHQWRGHOODWHUUDFRQWDPLQDWD

6$5$%$//$%,2
5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

DSULOH
3DJLQD

*LRUQDOHGL'HVLR
6WUDEDJ

3('(0217$1$(UURUHGDSDUWHGHOODVRFLHWjLSXQWLLQGLYLGXDWLSHULSUHOLHYLVRQRJLXVWLPD
QRQFRUULVSRQGRQRDLWLWRODULGHLWHUUHQLLQWHUHVVDWL

&DURWDJJLVEDJOLDWDODFRPXQLFD]LRQHDLSURSULHWDUL
&ULWLFR%XWWL(
XQJURVVRSUREOHPDFKHVWLDPRFHUFDQGRGLJHVWLUH,QWDQWRGRPDQLLQ
)ODLQFRQWURSXEEOLFRVXOSURJHWWR
6(9(62 JEQ ,FDURWDJJLSDUWRQRFROSLHGH
VEDJOLDWRLSXQWLLQGLYLGXDWLLQPDQLHUD
FRUUHWWDQRQFRUULVSRQGRQRDLSURSULHWDUL
6HPEUDDYHUVRUWLWRHIIHWWLTXDVLQXOOLO
DSSHOOR
ODQFLDWRGDOVLQGDFR3DROR%XWWLDOODVRFLHWj
3HGHPRQWDQDSHUDYHUHXQDFRPXQLFD]LRQH
SLHIILFDFHVXOSURJHWWRDXWRVWUDGDOHHLQ
SDUWLFRODUHVXLFDURWDJJLFKHSUHQGHUDQQRLO
YLDLOPDJJLR$EELDPRULFHYXWRO
HOHQFRGHL
SXQWLGLDQDOLVLLQPRGRHUUDWRVSLHJDLQIDWWLLO
SULPRFLWWDGLQR6LWUDWWDGLXQGLVJXLGRFKH
FRPSRUWDQRWHYROLGLIILFROWjFKHVWLDPR
FHUFDQGRGLJHVWLUHHGLULVROYHUHQHOPLJOLRU
PRGRSRVVLELOHJUD]LHDOODYRURFKHVWD
VYROJHQGRO
8IILFLRXUEDQLVWLFD6WLDPRLQIDWWL
SURYYHGHQGRDOODUHWWLILFDFRVuGDSRWHU
FRPXQLFDUHFRUUHWWDPHQWHFRQLFLWWDGLQL
DJJLXQJH1HOIUDWWHPSRO
$PPLQLVWUD]LRQHVL
qPRVVDSHUFRQVHJQDUHDLVHYHVLQLOHWWHUH
LQIRUPDWLYH*LRYHGuDEELDPRSUHGLVSRVWR
GHOOHFRPXQLFD]LRQLJHQHULFKHDLFLWWDGLQLFKH
DELWDQRQHOOHDUHHLQFXLYHUUDQQRHIIHWWXDWLL
FDURWDJJLRVVLDDOFXQLWUDWWLGLYLD'RQ6WXU]R
YLD9LJQD]]RODHFRUVR,VRQ]R3HUTXDQWR
ULJXDUGDLQYHFHLSUHOLHYLLQDUHHSULYDWH
YHUUDQQRFRQVHJQDWHGHOOHOHWWHUHDLSURSULHWDUL
SHUVRQDOPHQWHDIIHUPD%XWWLFKHLQWHQGH
ULQQRYDUHO
LPSHJQRSHUODFRPXQLFD]LRQH
LQYLVWDDQFKHGHOO
LQFRQWURSXEEOLFRGLGRPDQLPHUFROHGuDOOD)OD8QDSSXQWDPHQWRLPSRUWDQWHSHU
WXWWLLVHYHVLQLVRSUDWWXWWRSHUFRORURGLUHWWDPHQWHFRLQYROWLFRQLSUHOLHYL6LWUDWWDGLXQPRPHQWR
LPSRUWDQWH7XWWLVRQRLQYLWDWLDSDUWHFLSDUHPDOHLQIRUPD]LRQLLQWHUHVVHUDQQRSULQFLSDOPHQWHLFLWWDGLQL
FRLQYROWL6DUDQQRSUHVHQWLDQFKH6WUDEDJH3HGHPRQWDQD%XWWLKDLQROWUHIDWWRVDSHUHFKHO
XIILFLR
8UEDQLVWLFDVWDUHDOL]]DQGRXQDPDSSDLQWHUDWWLYDFRQ*RRJOH(DUWKSHUFRQVHQWLUHDLVHYHVLQLGL
LQGLYLGXDUHLSXQWLGHLFDURWDJJLSUHVHQWLLQFLWWj6LWUDWWDGLXQODYRURHVWUHPDPHQWHLPSHJQDWLYRFKH
SHUzULWHQLDPRSRVVDHVVHUHXWLOLVVLPR9HUUjSXEEOLFDWRVXOVLWRGHOFRPXQHIDVDSHUHLOVLQGDFR

5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

DSULOH
3DJLQD

,O*LRUQR HG%ULDQ]D
6WUDEDJ

'LRVVLQDFDFFLDDLYHOHQLGHO
QHOODWHUUDGHOOD
QXRYDDXWRVWUDGD
6LFRPLQFLDGD%DUODVVLQD3RLVHUYLUjLOSLDQRGLERQLILFD
GL621,$521&21,6(9(62&$&&,$
$3(57$DLYHOHQLGHO&KLVVjFRVD
WURYHUDQQRLWHFQLFLLQFDULFDWLGD6WUDEDJ
FRQFHVVLRQDULDGL3HGHPRQWDQDVRWWRLSUDWLH
LERVFKLVXLTXDOLGRYUjSDVVDUHODQXRYD
DXWRVWUDGD TXDORUDPDLVLIDFFLD /uIUD
FDPSLYHUGLFDVHFDSDQQRQLDOEHULHILRUL
HVDWWDPHQWHDQQLIDVLSRVzXQDSDUWHGHOOD
QXEHWRVVLFDXVFLWDGDOUHDWWRUHGHOO
,FPHVDO

D]LHQGDFKLPLFDFKHIXDOFHQWURGHOFDVRGHOOD
GLRVVLQDGL6HYHVR
'RSRTXDWWURGHFHQQLVRWWRLOSULPRVWUDWRGL
WHUUDSRWUHEEHURHVVHUFLDQFRUDUHVLGXLGL
YHOHQR(SULPDGLFRVWUXLUHVEDQFDQGRPHWUL
FXELGLPDWHULDOHqQHFHVVDULRDQDOL]]DUHFRVD
qULPDVWRGLTXHOODVRVWDQ]D'RSRXQULWDUGR
GLTXDOFKHPHVHGXQTXHQHLJLRUQLVFRUVL
6WUDEDJKDFRPXQLFDWRFKHSHUPDUWHGu
PDJJLRGHFROODHUjDSDUWLUHGDO&RPXQHGL
%DUODVVLQDLOSLDQRGLFDUDWWHUL]]D]LRQH
7HUPLQHEXURFUDWLFRFKHLQGLFDO
DQDOLVL
DWWUDYHUVRLOSUHOLHYRGLFDPSLRQLGLPDWHULDOH
GHOOH]RQHLQWHUHVVDWHGDOO
LQFLGHQWH,FPHVD
FRPSUHVHDOO
LQWHUQRGHOWUDFFLDWRGHOODQXRYD
VWUDGD
3(5,//8675$5(OHPRGDOLWjGHOO
LQWHUYHQWRqVWDWRRUJDQL]]DWRXQLQFRQWURSXEEOLFRSHUPHUFROHGu
DOOH$SSXQWDPHQWRDO&HQWUR6WXGLGHOOD)RQGD]LRQH/RPEDUGLDSHUO
$PELHQWHLQ/DUJR/XJOLR
'XUDQWHODVHUDWDVDUjSUHVHQWHDQFKHLOJHRORJR*LDQQL'HO3HURLQFDULFDWRGDL&RPXQLGL
VXSHUYLVLRQDUHVXOFDPSRLSUHOLHYLHVDUjSRVVLELOHDYHUHWXWWLLFKLDULPHQWLQHFHVVDULGDLWHFQLFLGL
6WUDEDJ
/(23(5$=,21,VSLHJD*LDQQL'HO3HURVDUDQQRFRQGRWWHLQDVVROXWDVLFXUH]]DULVSHWWRDOULVFKLR
GLGLVSHUVLRQHGLSROYHULGXUDQWHOHIDVLGLLQGDJLQHFKHULJXDUGHUDQQRLOSUHOLHYRGLFDPSLRQLGLWHUUHQR
VLQRDOODSURIRQGLWjGLPHWUL4XDOHXOWHULRUHPLVXUDGLSUHYHQ]LRQHGHOULVFKLRqSUHYLVWDODFKLXVXUD
GHJOLLQILVVLGHJOLHGLILFLFKHVRQRSRVL]LRQDWLHQWURLPHWULGDLSXQWLGLVRQGDJJLR
3$57(1'2GD%DUODVVLQDOHLQGDJLQLVLFRQFOXGHUDQQRSUREDELOPHQWHHQWURLOPHVHGLJLXJQR
3RLVHUYLUDQQRDSSURIRQGLWHDQDOLVLFKLPLFKHSHUYDOXWDUHODUHVLGXDSUHVHQ]DGLGLRVVLQDQHLWHUUHQLH
TXLQGLYHULILFDUHODIDWWLELOLWjGHOODWUDWWD%GHOO
$XWRVWUDGD3HGHPRQWDQDDOQHWWRGHLSUREDELOLHG
RQHURVLLQWHUYHQWLGLERQLILFD
$QFKHVHDOPRPHQWRQRQYLqDOFXQDFHUWH]]DUHODWLYDPHQWHDOO
HIIHWWLYDUHDOL]]D]LRQHGHOOD%OD
FDUDWWHUL]]D]LRQHDYUjFRPXQTXHGXHRELHWWLYLIRQGDPHQWDOL,OSULPRVDUjTXHOORGLDYHUHXQTXDGURSL
GHWWDJOLDWRHDJJLRUQDWRGHOODVLWXD]LRQHPHQWUHFRQLULVXOWDWLILQDOL$XWRVWUDGD3HGHPRQWDQD6SDGRYUj
SUHVHQWDUHXQSLDQRGLERQLILFDFRQLUHODWLYLFRVWLXQGRFXPHQWRFKHGRYUjRWWHQHUHDQFKHLOFRQVHQVR
5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

&RQWLQXD! 

DSULOH
3DJLQD
6HJXH

,O*LRUQR HG%ULDQ]D
6WUDEDJ

GHO&RPXQHLQXQSHUFRUVRSXEEOLFRHFRQGLYLVRFRQWXWWDODFRPXQLWj

621,$521&21,

5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

DSULOH
3DJLQD

,O*LRUQR
6WUDEDJ

3HGHPRQWDQDIHUPDDOODUPHODYRUR0LOOHSRVWLVRQR
GLYHQWDWLDULVFKLR
,OFDQWLHUHEORFFDWRHLOQRDQXRYLIRQGLDXPHQWDODSUHRFFXSD]LRQH
0RQLFD*X]]L0,/$12,/&$17,(5(GL
3HGHPRQWDQDVLqEORFFDWRLQ%ULDQ]D5RPD
KDFKLXVRLUXELQHWWLLSULYDWLVRQRULPDVWLDOOD
ILQHVWUDHLOSURMHFWILQDQFLQJFKHDYUHEEH
GRYXWRILQDQ]LDUHO
DXWRVWUDGDqULPDVWRIHUPR
VXOODFDUWD
0HQWUHSHUVWXGLDUHXQDYLDG
XVFLWDLOPLQLVWUR
SHUOH,QIUDVWUXWWXUH*UD]LDQR'HOULRLQYLWDL
VLQGDFLEULDQ]ROLSUHRFFXSDWLSHUOD
ULSHUFXVVLRQHGHLFDQWLHULVXOODYLDELOLWjORFDOH
HSHUO
DVVHQ]DGLSURVSHWWLYHFHUWHDXQ
WDYRORGLFRQFHUWD]LRQHFRQODFRQFHVVLRQDULD
O
D]LHQGDHOD5HJLRQHSHUDYYLDUHXQD
UHYLVLRQHGHOSLDQRFUHVFRQRLQXPHULGHL
ODYRUDWRULFKHWUHPDQR
3(5*/,23(5$,GHOFDQWLHUHDSSDOWDWRD
1XRYD%ULDQWHDHD6WUDEDJqJLjVWDWDDYYLDWD
ODSURFHGXUDGLPRELOLWjHRUDODSDXUDSHULO
IXWXURVLVWDGLIIRQGHQGRDQFKHDOO
LQWHUQRGL
6HUUDYDOOHHGHOODFRQWUROODWD$SO$XWRVWUDGD
3HGHPRQWDQD/RPEDUGD,QWXWWRVRQRSLGL
DOWUHSHUVRQHGLFXLLQIRU]DD
3HGHPRQWDQDTXDVLLOGRSSLRULVSHWWRDOOH
SUHYLVLRQLLQL]LDOLGLRUJDQLFR
$GDUHYRFHDOOHSUHRFFXSD]LRQLGHLGLSHQGHQWLGL6HUUDYDOOHGRYHqVWDWRDQQXQFLDWRORVWDWRGL
DJLWD]LRQHVRQRLVLQGDFDOLVWLGHOOD&XE,Q6HUUDYDOOHVLWHPRQRLFRQWUDFFROSLGHOORVWDWRFULWLFRGL
3HGHPRQWDQDGRYHLVROGLVRQRILQLWL6XPLOLDUGLGLHXURGLVSHVDOR6WDWRFLKDJLjPHVVR
PLOLDUGLROWUHDPLOLRQLGHULYDQWLGDOODGHILVFDOL]]D]LRQH
'(/5,2KDGHWWRFKHRUDOHULVRUVHELVRJQHUjFHUFDUOHDOWURYH/R6WDWRQRQqXQEDQFRPDWHQRQSXz
FRQWLQXDUHDULQFRUUHUHOHQHFHVVLWjGLXQSURJHWWRSHULOTXDOHVRQRVWDWLVEDJOLDWLLFDOFROLVXLYROXPLGL
WUDIILFR,QWDQWRLOFDQWLHUHVLqIHUPDWRD/HQWDWHVXO6HYHVRGRYHDILQHqVWDWDLQDXJXUDWDOD
WUDWWD%SURYHQLHQWHGD/RPD]]R3HUFRPSOHWDUHO
RSHUDFRPHGDSURJHWWRUHDOL]]DQGROHXOWLPHWUH
WUDWWHEULDQ]ROHSHUFROOHJDUHO
DXWRVWUDGDFKHDUULYDGD9DUHVHH&RPRDOOD%HUJDPDVFD
RFFRUUHUHEEHURDOWULPLOLDUGL
3HFFDWRFKHO
SHUFHQWRGHOOHULVRUVHDUULYDWHILQRUDVLDVWDWRVSHVRSHUFRVWUXLUHVRORXQWHU]RGHOO

RSHUD
/
$**5$9$0(172GHOODSRVL]LRQHGHELWRULDGHOOD0LODQR6HUUDYDOOHFDXVDWRGDOODFRQWUROODWD
$XWRVWUDGD3HGHPRQWDQD/RPEDUGDqPRWLYRGLIRUWHWLPRUHSHULOIXWXURGHOODFRQFHVVLRQDULDVFULYHOD
&XEDOSUHIHWWRFKHGRYUjHVSHULUHXQWHQWDWLYRGLFRQFLOLD]LRQH$GDXPHQWDUHLWLPRULYLVRQROH
FRQWLQXHLQL]LDWLYHGDSDUWHGHOO
$PPLQLVWUD]LRQHYROWHDULGXUUHODVSHVDSHULOODYRURHFKHSUHYHGRQR
WUDOHWDQWHLPSRUWDQWLUHYLVLRQLWHFQLFRRUJDQL]]DWLYH XOWHULRUHDXWRPD]LRQHGHOODULVFRVVLRQHGHO
SHGDJJLR FKHIDQQRLPPDJLQDUHDGXQDSURVVLPDULGX]LRQHGHOIDEELVRJQRODYRUDWLYR,OVLQGDFDWRKD
5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

&RQWLQXD! 

DSULOH
3DJLQD
6HJXH

,O*LRUQR
6WUDEDJ

JLjFKLHVWRDQFKHXQLQFRQWURDOVLQGDFR*LXOLDQR3LVDSLD
$QFKHLODYRUDWRULGHOFDQWLHUHGL6WUDEDJLQPRELOLWjFRQODFRQFOXVLRQHGHOOHRSHUHVXOODWUDWWD%VL
VRQRPRVVL&RQLGLSHQGHQWLSHUGHUDQQRLOSRVWRDQFKHDGGHWWLDOODPRYLPHQWD]LRQHGHOODWHUUD
GHOODGLWWDLQVXEDSSDOWR0DLOFRQWUDFFROSRULJXDUGHUjFRPSOHVVLYDPHQWHXQPLJOLDLRGLSHUVRQHFKH
ODYRUDQRVXOO
LQGRWWRGHOPHJDFDQWLHUHGHQXQFLDQRLVLQGDFDWLGLFDWHJRULDGL&JLO&LVOH8LOFKHGRSR
XQ
DXGL]LRQHLQ&RQVLJOLRUHJLRQDOHRUDFKLHGRQRDO*RYHUQDWRUH0DURQLGLIRUQLUHWHPSLFHUWLSHUOD
SURVHFX]LRQHGHOFDQWLHUH

5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

DSULOH

LOJLRUQRFRP
6WUDEDJ

3HGHPRQWDQDIHUPDDOODUPHODYRURPLOOHSRVWLVRQR
GLYHQWDWLDULVFKLR
0LODQRDSULOH,OFDQWLHUHGL
3HGHPRQWDQDVLqEORFFDWRLQ%ULDQ]D5RPD
KDFKLXVRLUXELQHWWLLSULYDWLVRQRULPDVWLDOOD
ILQHVWUDHLOSURMHFWILQDQFLQJFKHDYUHEEH
GRYXWRILQDQ]LDUHO
DXWRVWUDGDqULPDVWRIHUPR
VXOODFDUWD0HQWUHSHUVWXGLDUHXQDYLDG

XVFLWDLOPLQLVWURSHUOH,QIUDVWUXWWXUH*UD]LDQR
'HOULRLQYLWDLVLQGDFLEULDQ]ROLSUHRFFXSDWLSHU
ODULSHUFXVVLRQHGHLFDQWLHULVXOODYLDELOLWj
ORFDOHHSHUO
DVVHQ]DGLSURVSHWWLYHFHUWHD
XQWDYRORGLFRQFHUWD]LRQHFRQOD
FRQFHVVLRQDULDO
D]LHQGDHOD5HJLRQHSHU
DYYLDUHXQDUHYLVLRQHGHOSLDQRFUHVFRQRL
QXPHULGHLODYRUDWRULFKHWUHPDQR3HUJOL
RSHUDLGHOFDQWLHUHDSSDOWDWRD1XRYD%ULDQWHD
HD6WUDEDJqJLjVWDWDDYYLDWDODSURFHGXUDGL
PRELOLWjHRUDODSDXUDSHULOIXWXURVLVWD
GLIIRQGHQGRDQFKHDOO
LQWHUQRGL6HUUDYDOOHH
GHOODFRQWUROODWD$SO$XWRVWUDGD3HGHPRQWDQD
/RPEDUGD,QWXWWRVRQRSLGLDOWUH
SHUVRQHGLFXLLQIRU]DD3HGHPRQWDQD
TXDVLLOGRSSLRULVSHWWRDOOHSUHYLVLRQLLQL]LDOLGL
RUJDQLFR$GDUHYRFHDOOHSUHRFFXSD]LRQLGHL
G L S H Q G H Q WL G L 6H U U D Y D O O H G R Y H q V WD WR
DQQXQFLDWRORVWDWRGLDJLWD]LRQHVRQRL
VLQGDFDOLVWLGHOOD&XE,Q6HUUDYDOOHVLWHPRQRL
FRQWUDFFROSLGHOORVWDWRFULWLFRGL
3HGHPRQWDQDGRYHLVROGLVRQRILQLWL6X
PLOLDUGLGLHXURGLVSHVDOR6WDWRFLKDJLjPHVVRPLOLDUGLROWUHDPLOLRQLGHULYDQWLGDOOD
GHILVFDOL]]D]LRQH'HOULRKDGHWWRFKHRUDOHULVRUVHELVRJQHUjFHUFDUOHDOWURYH/R6WDWRQRQqXQ
EDQFRPDWHQRQSXzFRQWLQXDUHDULQFRUUHUHOHQHFHVVLWjGLXQSURJHWWRSHULOTXDOHVRQRVWDWLVEDJOLDWLL
FDOFROLVXLYROXPLGLWUDIILFR,QWDQWRLOFDQWLHUHVLqIHUPDWRD/HQWDWHVXO6HYHVRGRYHDILQHq
VWDWDLQDXJXUDWDODWUDWWD%SURYHQLHQWHGD/RPD]]R3HUFRPSOHWDUHO
RSHUDFRPHGDSURJHWWR
UHDOL]]DQGROHXOWLPHWUHWUDWWHEULDQ]ROHSHUFROOHJDUHO
DXWRVWUDGDFKHDUULYDGD9DUHVHH&RPRDOOD
%HUJDPDVFDRFFRUUHUHEEHURDOWULPLOLDUGL3HFFDWRFKHO
SHUFHQWRGHOOHULVRUVHDUULYDWHILQRUDVLD
VWDWRVSHVRSHUFRVWUXLUHVRORXQWHU]RGHOO
RSHUD/
DJJUDYHPHQWRGHOODSRVL]LRQHGHELWRULDGHOOD
0LODQR6HUUDYDOOHFDXVDWRGDOODFRQWUROODWD$XWRVWUDGD3HGHPRQWDQD/RPEDUGDqPRWLYRGLIRUWHWLPRUH
SHULOIXWXURGHOODFRQFHVVLRQDULDVFULYHOD&XEDOSUHIHWWRFKHGRYUjHVSHULUHXQWHQWDWLYRGL
FRQFLOLD]LRQH$GDXPHQWDUHLWLPRULYLVRQROHFRQWLQXHLQL]LDWLYHGDSDUWHGHOO
$PPLQLVWUD]LRQHYROWHD
ULGXUUHODVSHVDSHULOODYRURHFKHSUHYHGRQRWUDOHWDQWHLPSRUWDQWLUHYLVLRQLWHFQLFRRUJDQL]]DWLYH
XOWHULRUHDXWRPD]LRQHGHOODULVFRVVLRQHGHOSHGDJJLR FKHIDQQRLPPDJLQDUHDGXQDSURVVLPD
ULGX]LRQHGHOIDEELVRJQRODYRUDWLYR,OVLQGDFDWRKDJLjFKLHVWRDQFKHXQLQFRQWURDOVLQGDFR*LXOLDQR
3LVDSLD$QFKHLODYRUDWRULGHOFDQWLHUHGL6WUDEDJLQPRELOLWjFRQODFRQFOXVLRQHGHOOHRSHUHVXOODWUDWWD
5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

&RQWLQXD! 

DSULOH
6HJXH

LOJLRUQRFRP
6WUDEDJ

%VLVRQRPRVVL&RQLGLSHQGHQWLSHUGHUDQQRLOSRVWRDQFKHDGGHWWLDOODPRYLPHQWD]LRQHGHOOD
WHUUDGHOODGLWWDLQVXEDSSDOWR0DLOFRQWUDFFROSRULJXDUGHUjFRPSOHVVLYDPHQWHXQPLJOLDLRGLSHUVRQH
FKHODYRUDQRVXOO
LQGRWWRGHOPHJDFDQWLHUHGHQXQFLDQRLVLQGDFDWLGLFDWHJRULDGL&JLO&LVOH8LOFKH
GRSRXQ
DXGL]LRQHLQ&RQVLJOLRUHJLRQDOHRUDFKLHGRQRDO*RYHUQDWRUH0DURQLGLIRUQLUHWHPSLFHUWLSHU
ODSURVHFX]LRQHGHOFDQWLHUH5,352'8=,21(5,6(59$7$

5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

DSULOH
3DJLQD

,O*LRUQR
6WUDEDJ

,/352*(772/$%5,$1=$352321(81$5(9,6,21('(/3,$12

4XDWWURPLOLDUGLQRQEDVWDQRSHUFKLORPHWUL
0,/$12,/352*(772SUHYHGHXQDVWULVFLD
GLFKLORPHWULGLOXQJKH]]DGLFXLLQ
DXWRVWUDGD DVVHSULQFLSDOHHWDQJHQ]LDOLGL
&RPRH9DUHVH HGLYLDELOLWjORFDOH1HO
SDFFKHWWRVRORLQ%ULDQ]DFLVDUHEEHURDQFKH
RSHUHGLFRPSHQVD]LRQHGDPLOLRQLFKHQRQ
VRQRVWDWHUHDOL]]DWHROWUHDOOD*UHHQZD\OD
IDPRVDDXWRVWUDGDYHUGHFKHDYUHEEHGRYXWR
FRUUHUHSDUDOOHODDTXHOODG
DVIDOWR2OWUH
PLOLDUGLGLHXURODVSHVDSUHYLVWDGHVWLQDWD
SHUzDOLHYLWDUHGRSROHULVHUYHSUHVHQWDWHGD
6WUDEDJHFRQLILQDQ]LDWRULSULYDWLFKHKDQQR
GHFLVRGLVWDUHDOODILQHVWUD'LIILFLOHGDUHORUR
WRUWRYLVWRFKHOHULFDGXWHHFRQRPLFKHLQ
TXHVWRPRPHQWRVRQRGHOXGHQWLJOL
DXWRPRELOLVWLIXJJRQRGDOO
DXWRVWUDGDSLFDUD
G
,WDOLDFKHRUDVWDFRUUHQGRDLULSDULFRQ
VFRQWLHSURPR]LRQL'LIDWWRLOFRVWRPHGLRGHO
SHGDJJLRDOFKLORPHWURqGLFHQWHVLPLHL
VLQGDFLGHQXQFLDQRO
DJJUDYDUVLGHOWUDIILFR
VXOODYLDELOLWjORFDOHSURSULRDFDXVDGLFKL
FHUFDXQ
DOWHUQDWLYDDOSDJDPHQWR
/$3$57,7$'(&,6,9$VLJLRFDSURSULRLQ
%ULDQ]DGRYHVLIDQQRJLjLFRQWLFRQRSHUH
IDUDRQLFKHFRPHOD%UHEHPLDOWURFRVWRVRQDVWURG
DVIDOWRULPDVWRYXRWR6LQGDFLH3URYLQFLDKDQQR
SURSRVWRXQDUHYLVLRQHGHOSLDQRXQ
H[LWVWUDWHJ\FKHSUHYHGHODUHDOL]]D]LRQHGHOOHVROHRSHUH
QHFHVVDULHDJDUDQWLUHLOFROOHJDPHQWRFRQOHWDQJHQ]LDOLPLODQHVLSHUGHVWLQDUHOHULVRUVHULVSDUPLDWH
DGDOWULLQWHUYHQWLQHFHVVDULDOODVRVWHQLELOLWjDPELHQWDOHGHOO
RSHUD

5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

PDU]R

PEQHZVLW
$XWRVWUDGD3HGHPRQWDQD

6HYHVRDQQLGDOODGLRVVLQDXQSURJHWWRSHU
ULFRUGDUHULIOHWWHUHHLPSDUDUH
(YHQWLHFRQIHUHQ]HSHUULFRUGDUHLOGLVDVWUR
GLRVVLQDDTXDUDQW
DQQLGDOO
LQFLGHQWHGHOO

,FPHVDGL0HGD,OSURJHWWRGHQRPLQDWR
6HYHVR0HPRULDQHO3UHVHQWHH
RUJDQL]]DWRGDO&RPXQHGL6HYHVRLQ
FROODERUD]LRQHFRQ/HJDPELHQWHO
DJHQ]LD
,QQRYDHOD)RQGD]LRQH/RPEDUGLDSHUO

$PELHQWHqVWDWRSUHVHQWDWRPHUFROHGu
PDU]RD0LODQRSUHVVROD)RQGD]LRQH&DULSOR
7UDOHLQL]LDWLYHLQSURJUDPPDDQFKHXQD
FRQIHUHQ]DWHFQLFDFKHVLWHUUjD%UX[HOOHV,O
ORJRLQL]LDWLYD5LFRUGDUHLOGLVDVWUR
DPELHQWDOHHXPDQRGL6HYHVRVLJQLILFDQRQ
VRORIDUWHVRURGHJOLHUURULGHOSDVVDWRPD
ODYRUDUHSHUFKpODVLFXUH]]DHODWXWHODGHO
WHUULWRULRHGLFKLFLYLYHVLDQRXQDSULRULWj
DVVROXWDSHULOPRQGRLPSUHQGLWRULDOHHSHUOH
LVWLWX]LRQLVWHVVHKDGLFKLDUDWR&ODXGLD0DULD
7HU]LDVVHVVRUHUHJLRQDOHDG$PELHQWH
HQHUJLDHVYLOXSSRVRVWHQLELOH4XHOODGL
6HYHVRqXQDIHULWDFKHDDQQLGLGLVWDQ]D
UHVWDLQTXDOFKHPRGRDQFRUDDSHUWDXQ
PRQLWRSHUWXWWLQRLHOHJHQHUD]LRQLIXWXUH
SHUFKpHYHQWLFRVuGUDPPDWLFLQRQVLULSHWDQR
PDLSL,QXQPRPHQWRLQFXLWUDO
DOWURGL
GLRVVLQDVLqWRUQDWLDSDUODUHVHPSUHSL
VSHVVRQHJOLXOWLPLDQQLFRQ3HGHPRQWDQD OH
DQDOLVLSHUULOHYDUHLOLYHOOLGLFRQWDPLQD]LRQH
GHOWHUUHQRQRQVRQRDQFRUDFRPLQFLDWH &HOHEULDPRXQDQQLYHUVDULRFKHULFRUGDXQJLRUQR
GUDPPDWLFRKDGHWWRLOSUHVLGHQWHGL)RQGD]LRQH&DULSOR*LXVHSSH*X]]HWWL0DVLDPRTXLSHU
JXDUGDUHLQSRVLWLYRDOIXWXUR6HYHVRKDGLPRVWUDWRGLHVVHUHXQDFRPXQLWjUHVLOLHQWHSHUTXHVWRO

DEELDPRVFHOWDFRPHVLPERORSHULQDXJXUDUHXQDVHULHGLLQL]LDWLYHFKHVWLDPRUHDOL]]DQGRHFKH
PHWWRQRDOFHQWUROHFRPXQLWjFDSDFLGLUHDJLUHYDORUL]]DQGRLEHQLFRPXQLFKHWRUQDQRDGHVVHUHXQ
EHQHSUH]LRVRSHUFKLYLYHVXOWHUULWRULR6HYHVRKDSDUWHFLSDWRDGXQEDQGRGHOODQRVWUDIRQGD]LRQHH
YLQWRXQFRVSLFXRFRQWULEXWR PLODQGU SHUSURVHJXLUHTXHVWRFDPPLQRLQL]LDWRQHOGUDPPDDQQL
ID'RYHF
HUDLOWHUUHQRSLFRQWDPLQDWRRJJLF
qLO%RVFRGHOOH4XHUFHDIIHUPDLOVLQGDFRGL
6HYHVR3DROR%XWWLLOSLSLFFRORSDUFRQDWXUDOHUHJLRQDOHFKHKDFRQVpODULFFKH]]DGLXQDPHPRULD
XQLFDDOPRQGR7UDJOLHYHQWLLQSURJUDPPDSHQVDWLSHUFLWWDGLQLLVWLWX]LRQLHWHFQLFLULFRUGLDPR/

HYHQWR'LRVVLQDDQQLGRSRTXDOLLQVHJQDPHQWL PDJJLR &RQYHJQRRUJDQL]]DWRGDOO


2UGLQHGHL
0HGLFLGL0RQ]DH%ULDQ]D8QSHUFRUVRGLSDUWHFLSD]LRQHFRQLFLWWDGLQLSHUULFRUGDUHHULIOHWWHUHVXOOH
FRQVHJXHQ]HGHOGLVDVWURGL6HYHVRLQLQFRQWUL PDJJLRJLXJQROXJOLRHRWWREUH 
&RQWDPLQD]LRQLDO%RVFRGHOOH4XHUFH OXJOLR GXHJLRUQLSHUFRQRVFHUHPHJOLRLOSDUFRWUD
VWRULDYLVLWHJXLGDWHHDWWLYLWjFRPH\RJDVKLDWVXELRGDQ]DWDLFKLHQRUGLFZDONLQJ&LWWjUHVLOLHQWL
5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

&RQWLQXD! 

PDU]R
6HJXH

PEQHZVLW
$XWRVWUDGD3HGHPRQWDQD

UHVLOLHQ]DHULVFKLRQHLDQQLGL6HYHVR RWWREUH FRQYHJQRLQWHUQD]LRQDOH

*,8/,$6$17$0%52*,2

5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

DSULOH
3DJLQD

,O&LWWDGLQR0% HG
9DO6HYHVR
6WUDEDJ

,QFRJQLWH3HGHPRQWDQDFRQWDPLQD]LRQHHFRVWL
$YUDQQRGXHRELHWWLYLLFDURWDJJLFKH
LQL]LHUDQQRLOPDJJLRQHLWHUUHQLLQWHUHVVDWL
GDOSDVVDJJLRGHOODWUDWWD%GL3HGHPRQWDQD
HFKHYHUUDQQRLOOXVWUDWLDLFLWWDGLQLLODSULOH
DOOHDO&HQWURVWXGLGHOOD)RQGD]LRQH
/RPEDUGLDSHUO
DPELHQWHDOODSUHVHQ]DGL
WHFQLFLGL6WUDEDJ6HFRQGRXQFRPXQLFDWR
GLIIXVRGDOPXQLFLSLRLOSULPRVFRSRVDUj
DYHUHXQTXDGURSLGHWWDJOLDWRHDJJLRUQDWR
GHOORVWDWRGLFRQWDPLQD]LRQHSUHVHQWHQHL
WHUUHQL,OVHFRQGRVSLQJHUH$XWRVWUDGD
3HGHPRQWDQD6SDXQDYROWDLQSRVVHVVRGHL
ULVXOWDWLILQDOLDSUHVHQWDUHXQ3LDQRGLERQLILFD
FRQLUHODWLYLFRVWL3LDQRFKHGRYUjDYHUHLO
FRQVHQVRGHO&RPXQHVRWWROLQHDQRGDO
PXQLFLSLRLQXQSHUFRUVRSXEEOLFRH
FRQGLYLVRFRQWXWWDODFRPXQLWj,OWXWWR
SUHVRDWWRFKHDOPRPHQWRQRQYLqDOFXQD
FHUWH]]DUHODWLYDPHQWHDOO
HIIHWWLYD
UHDOL]]D]LRQHGHOODWUDWWD%FRQFOXGRQR
,QWDQWRJOLDPELHQWDOLVWLGL,QVLHPHLQUHWHSHU
XQRVYLOXSSRVRVWHQLELOHWRUQDQRVXOWHPD
3HGHPRQWDQD$PHWjPDU]RLOVLQGDFRGL
&LVODJRKDODQFLDWRXQDFFRUDWRDSSHOOR
GHQXQFLDQGRODVXDORWWDVHQ]DULVSRVWHFRQWUR
LOPRVWUR3HGHPRQWDQDH5HJLRQHFKH
RVWLQDWDPHQWHFRQWLQXDDYROHUOD
FRPPHQWDQR3HUFKpTXHVWRJULGRGLDLXWR
QRQYLHQHUDFFROWRGDLVLQGDFLGL0RQ]DH%ULDQ]D"/HULVRUVHUHVLGXHQHOOHPDQLGL6RFLHWj
3HGHPRQWDQDGRYUHEEHURLQSULPROXRJRFRPSHQVDUHO
DPELHQWHFRPSURPHVVR3RLFKLXVLLFDQWLHUL
FRQWLQXDQRVLGRYUDQQRWURYDUHVROX]LRQLDOWHUQDWLYHDSDUWLUHGDOODYLDELOLWjLQWHUFRPXQDOHHGDOO

LQYHVWLPHQWRVXOWUDVSRUWRSXEEOLFRHIHUURYLDULR,QROWUHFKHYLWDVDUHEEHTXHOODFRQXQFDQWLHUH
DSHUWRLQSLHQDDUHDGLRVVLQD"ULQFDUDQRJOLDPELHQWDOLVWL&RPHVDUjDIIURQWDUHXQDERQLILFDFKHIDUj
XOWHULRUPHQWHLQQDO]DUHLFRVWLHFKHSRUWHUHEEHGLQXRYRVXOWHUULWRULRORVSDXUDFFKLRGHOODGLRVVLQD"
3HUFKpLVLQGDFLGHOOD%QRQKDQQRHYLGHQ]LDWRTXHVWRSXQWRDOPLQLVWUR'HOULR"&RVuFKLHGLDPRFKH
DOWDYRORGHOPLQLVWURDQQXQFLDWRSHUODSURVVLPDHVWDWHFRQFOXGRQRLVLQGDFLVLSUHSDULQRDGDQGDUH
LQIRUPD]LRQHFRPSOHWDHIRUWLGLXQDFROODERUD]LRQHFROWHUULWRULR6%DO

5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

DSULOH
3DJLQD

,O&LWWDGLQR0% HG
9DO6HYHVR
$XWRVWUDGD3HGHPRQWDQD

7LPRULSHUODGLRVVLQDXQDIHULWDFKHVLULDSUH
8QDIHULWDFKHGRYUjULDSULUVLFRQPLOOH
LQFRJQLWHVXOODERQLILFDHO
HIIHWWLYD
UHDOL]]D]LRQHGHOODWUDWWD%GDSDUWHGL
3HGHPRQWDQD  D  F R U W R  G L  U L V R U V H   1 R Q
SRVVLDPRFUHGHUFLFKHGRSRFRVuWDQWLDQQL
QRQVLDQDXIUDJDWRLOSURJHWWRGL3HGHPRQWDQD
FLKDQQRGHWWRDQFKHVDEDWRVFRUVRYDUL
VHYHVLQLDYYLFLQDWLVLDOQRVWURFDPSHUHFKH
ODVXSHUVWUDGD0LODQR0HGDJLjGLSHUVp
LPSDWWDQWHVXOWHUULWRULRVLDGHVWLQDWDD
GLYHQWDUHXQ
DXWRVWUDGDFRQVYLQFROLHVSURSUL
GLWHUUHQLHUXPRULDQFRUDSLDVVRUGDQWLSHU
FKLDELWDQHLSUHVVL&KLFLJDUDQWLUjFKH
YHUUjIDWWDGDYYHURXQDERQLILFDGLWXWWLLWHUUHQL
FRQWDPLQDWLGDGLRVVLQDHFKHROWUHDSL
VPRJQRQVDUHPRGHVWLQDWLDUHVSLUDUHDQFRUD
QHOO
DUHDTXHOYHOHQR"KDQQRIDWWRHFRDOWUL
,QWDQWRORVWHVVRVLQGDFR3DROR%XWWLKDUHVR
QRWRFKHOHSULPHPDSSHUHGDWWHGD
3HGHPRQWDQDFRQO
LQGLFD]LRQHGHLFDURWDJJL
SUHVHQWDYDQRSXQWLJHRUHIHUHQ]LDOLLQGLYLGXDWL
LQPRGRHUUDWRHTXLQGLQRQULIHULELOLDJOL
HIIHWWLYLSURSULHWDULVWDWRTXLQGLFRPSLWR
GHOO
XIILFLRWHFQLFRSURYYHGHUHLQTXHVWLJLRUQL
DVLVWHPDUOHKDDJJLXQWRWHQXWRFRQWRFKHFL
VRQRSURSULHWDULFKHULVLHGRQRIXRULFLWWjHFKH
QRQSRVVRQRULFHYHUHLQGLFD]LRQLVRPPDULHR
HUUDWH&RVuSRLFKpORVSDXUDFFKLRGLRVVLQD
QRQDEEDQGRQDOHPHQWLGLFRORURFKHDELWDQRODGGRYHGRYUDQQRVRUJHUHDXWRVWUDGDHRSHUHFRQQHVVH
DUULYDQROHSULPHLQGLFD]LRQLLQPHULWRDLFDURWDJJLFKHSUHQGHUDQQRLOYLDLOPDJJLR6LWUDWWDGL
RSHUD]LRQLFKHYHUUDQQRFRQGRWWHLQDVVROXWDVLFXUH]]DULVSHWWRDOULVFKLRGLGLVSHUVLRQHGLSROYHUL
GXUDQWHOHIDVLGLLQGDJLQHVSLHJDLOJHRORJRFKHKDUHGDWWRLO3LDQRGLFDUDWWHUL]]D]LRQH*LDQQL'HO
3HURFKHULJXDUGHUDQQRLOSUHOLHYRGLFDPSLRQLGLWHUUHQRILQRDOODSURIRQGLWjGLPHWUL,QROWUHTXDOH
XOWHULRUHPLVXUDGLSUHYHQ]LRQHGHOULVFKLRYHUUjSUHYLVWDODFKLXVXUDGHJOLLQILVVLQHJOLHGLILFLFKHVL
WURYDQRSRVL]LRQDWLHQWURLPHWULGDLSXQWLGLVRQGDJJLR,QVRPPDQHOOHRUHLQFXLYHUUDQQRVYROWLL
FDURWDJJLLSURSULHWDULGHOOHDELWD]LRQLSLYLFLQHGRYUDQQRWHQHUHEHQFKLXVHSRUWHHILQHVWUH(OD
ERQLILFDFKLODSDJKHUj"KDQQRVFDQGLWRLQPROWLDOODQRVWUDUHGD]LRQHPRELOHGRSRFKHSHUOD
VHFRQGDYROWDVXELDPRLOGDQQRGLRVVLQDFLDUULYDDQFKHODEHIID"6%DO

5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

PDJJLR
3DJLQD

,O&LWWDGLQR0% HG
9DO6HYHVR
6WUDEDJ

&DURWDJJL3HGHPRQWDQD/D0LODQR0HGDYDLQWLOW
$TXDUDQW
DQQLGDOODIXRULXVFLWDGLGLRVVLQD
GDOORVWDELOLPHQWR,FPHVDDOFRQILQHWUD0HGDH
6HYHVROXQJRODWUDWWD%GHOODIXWXUD
DXWRVWUDGD3HGHPRQWDQD /HQWDWH6XO6HYHVR
&HVDQR0DGHUQRWRFFDQGRSDU]LDOPHQWH
%RYLVLR0DVFLDJR VLYDDFDFFLDGHOOD
SHULFRORVDVRVWDQ]DWRVVLFD&RPHULFKLHVWR
GDLVLQGDFLGHLFRPXQLFRLQYROWLVRQRLQL]LDWLL
FDURWDJJLRVVLDLSUHOLHYLGLWHUUHQRSHU
YHULILFDUHO
HYHQWXDOHSUHVHQ]DGLGLRVVLQDQHO
VRWWRVXROR8Q
D]LRQHSURSHGHXWLFDDOO
DYYLR
GHOFDQWLHUHGL3HGHPRQWDQDFKHUHVWD
VRVSHVRSHUPDQFDQ]DGLIRQGL/R6WDWRQRQ
KDDOFXQDLQWHQ]LRQHGLVWDQ]LDUHDOWULVROGLSHU
O
DXWRVWUDGDEULDQ]ROD,FDURWDJJLKDQQRJLj
GHEXWWDWRGDTXDOFKHVHWWLPDQDD6HYHVRHD
0HGDLQYHFHLOWHUULWRULRGL&HVDQR0DGHUQRq
VWDWRFRLQYROWRVRORGDYHQHUGuPDJJLR
'DOORVFRUVROXQHGuPDJJLRLOFDQWLHUHq
HQWUDWRLQVXSHUVWUDGD0ROWLDXWRPRELOLVWL
SXUWURSSRSHUORURVRQRULPDVWLLPERWWLJOLDWLLQ
FRGHLQWHUPLQDELOLGRYXWHDOODULGX]LRQHGHOOH
FRUVLHGLPDUFLDGDGXHDXQDSHUFKpDODWR
WHFQLFLHRSHUDLGHOOD1XRYD%ULDQWHD6WUDEDJ
HIIHWWXDYDQRLSUHOLHYLGLWHUUHQR8Q

RSHUD]LRQHUHDOL]]DWDVRWWRODVXSHUYLVLRQHGHO
JHRORJRPHGHVH*LDQQL'HO3HURVFHOWRFRPH
JDUDQWHGDLVLQGDFLGHOOD%
$&HVDQRLFDURWDJJLWHUPLQHUDQQRLOJLXJQRSLRJJLDSHUPHWWHQGR1HOOHSURVVLPHVHWWLPDQH
VXSHUVWUDGDQRQVDUjSLWRFFDWDPDVLHQWUHUjQHOWHVVXWRXUEDQL]]DWR6RQRLSXQWLGLFDURWDJJLR
SUHYLVWLD&HVDQR0DGHUQRHLQEXRQDSDUWHVRQRLQWHUUHQLSULYDWLGLFLWWDGLQLD]LHQGHHSHUVLQRGHOOD
GLRFHVLGL0LODQR,OFRVWRGHOO
RSHUD]LRQHqPLODHXURSHU6WUDEDJDTXHVWRLPSRUWRGHYRQRHVVHUH
DJJLXQWLLFRVWLGHOSHUVRQDOH$USD $]LHQGDUHJLRQDOHSURWH]LRQHDPELHQWH HGHOOHDQDOLVLGLFRQWUROOR
GHOODVWHVVDDJHQ]LDSLLFRVWLDPPLQLVWUDWLYL/DVRPPDILQDOHGRYUHEEHDJJLUDUVLDWWRUQRJOLPLOD
HXUR
4XHOORFKHIDVFKL]]DUHYHUVRO
DOWRODFLIUDqFKHRJQLGHWHUPLQD]LRQHGLGLRVVLQDFRVWDFLUFDHXUR
GLSHQGHGDOODERUDWRULRHGDOODTXDQWLWjFKHYLHQHSRUWDWDDGDQDOL]]DUH/DVRPPDqSDJDWDGD
3HGHPRQWDQDVSD
1HOO
DWWHVDGLUDFFRJOLHUHODUHD]LRQHGHLSULYDWLFKHVLULWURYHUDQQRODWULYHOODLQJLDUGLQRDEELDPR
SDUODWRFRQFKLGDDQQLVLEDWWHFRQWURO
LPSDWWRDPELHQWDOHHXUEDQLVWLFRGL3HGHPRQWDQD
*LXVHSSH&D]]DQLJDGL&HVDQRSHUQRLQRLSHU&HVDQRDVVRFLD]LRQHDSDUWLWLFDSHUODWXWHODGHOO

DPELHQWHHGHOSDHVDJJLRFHVDQHVHVLRFFXSDSUHWWDPHQWHGHOODTXHVWLRQHDXWRVWUDGD,QQDQ]LWXWWR
TXHVWLFDURWDJJLYHQJRQRHIIHWWXDWLSHUFKpqXQDSUHFLVDSUHVFUL]LRQHGHO&LSH &RPLWDWR
LQWHUPLQLVWHULDOHSHUODSURJUDPPD]LRQHHFRQRPLFD VSLHJD5LPDQHGDFDSLUQHODERQWj/LKDQQR
IDWWLLQYLD'H0HGLFLGRYHDELWR
5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

&RQWLQXD! 

DSULOH

PEQHZVLW
$XWRVWUDGD3HGHPRQWDQD

3HGHPRQWDQDFDURWDJJLD%DUODVVLQD6HYHVRH
0HGDHFFRGRYHVDUDQQR>0DSSH@
,O&RPXQHGL6HYHVRKDUHVRQRWHWUDPLWHLO
SURSULRVLWRZHEOHPDSSHGHLSXQWLGRYHD
SDUWLUHGDOPDJJLRYHUUDQQRHVHJXLWLL
FDURWDJJLYROWLDTXDQWLILFDUHLOOLYHOORGL
GLRVVLQDSUHVHQWHQHOWHUUHQRPHWWHQGRD
GLVSRVL]LRQHDQFKHXQDPDSSDLQWHUDWWLYDSHU
HVDPLQDUHSLGDYLFLQROHSDUWLFRODULWjGHL
VLQJROLLQWHUYHQWL*LDQQL'HO3HURLOJHRORJR
LQFDULFDWRGDLFRPXQLGHOODWUDWWD%GL
VRYULQWHQGHUHDLODYRULDVVLFXUD/H
RSHUD]LRQLVDUDQQRFRQGRWWHLQDVVROXWD
VLFXUH]]DULVSHWWRDOULVFKLRGLGLVSHUVLRQHGL
SROYHULGXUDQWHOHIDVLGLLQGDJLQHFKH
ULJXDUGHUDQQRLOSUHOLHYRGLFDPSLRQLGLWHUUHQR
VLQRDOODSURIRQGLWjGLPHWUL(DJJLXQJH
4XDOHXOWHULRUHPLVXUDGLSUHYHQ]LRQHGHO
ULVFKLRqSUHYLVWDODFKLXVXUDGHJOLLQILVVLGHJOL
HGLILFLFKHVRQRSRVL]LRQDWLHQWURLPHWULGDL
SXQWLGLVRQGDJJLR/HLQGDJLQLSDUWLUDQQRGD
%DUODVVLQDHVHFRQGRODWHPSLVWLFDSUHYLVWD
GRYUHEEHURFRQFOXGHUVLHQWURLOPHVHGL
JLXJQR,SUHOLHYLYHUUDQQRTXLQGLVRWWRSRVWLDG
DQDOLVLFKLPLFKHDSSURIRQGLWHVRORDTXHVWR
SXQWRVDUjSRVVLELOHYHULILFDUHO
HIIHWWLYD
IDWWLELOLWjGHOODWUDWWD%HLOFRVWRGLXQ
HYHQWXDOH PDVHFRQGR'HO3HURSUREDELOH
HRQHURVR LQWHUYHQWRGLERQLILFD0HUFROHGu
DSULOHDOOHRUHSUHVVROD)RQGD]LRQH
/RPEDUGLDSHUO
$PELHQWHGL6HYHVRODFLWWDGLQDQ]DSRWUjLQFRQWUDUH'HO3HURHLWHFQLFLGL
3HGHPRQWDQDSHUSRUUHGRPDQGHHFKLDULUHXOWHULRULGXEEL

*,8/,$6$17$0%52*,2

5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

PDU]R
3DJLQD

,O*LRUQR HG%ULDQ]D
6WUDEDJ

3HGHPRQWDQDFDQWLHULLQGLJHVWL
GL621,$521&21,6(9(626212
',9(56,LVHYHVLQLFKHQHJOLVFRUVLJLRUQLVRQR
DQGDWLDOO
8IILFLR(FRORJLDH$PELHQWHSHU
FKLHGHUHOXPLVX3HGHPRQWDQDGRSRDYHU
YLVWRGHLWHFQLFLFKHSLFFKHWWDYDQRGHOOH
SURSULHWjSULYDWH/DQXRYDDXWRVWUDGDqGD
DQQLXQWRUPHQWRQHFKHqSHJJLRGLXQUHEXV
QRQVRORSHULUHVLGHQWLGHOODWUDWWD%PDSXUH
GHJOLDPPLQLVWUDWRUL$OFXQLUHVLGHQWLVLVRQR
PHVVLLQVLHPHHVLVRQRSUHVHQWDWLDOOR
VSRUWHOORGHOO
XIILFLRDO%RVFRGHOOH4XHUFHHLQ
PRGRHGXFDWRPDGHWHUPLQDWRKDQQRFKLHVWR
VSLHJD]LRQLRQRWL]LHLQPHULWRDOO
DYYLRGD
SDUWHGL3HGHPRQWDQDGHOOHSURFHGXUHUHODWLYH
DOSLDQRGLFDUDWWHUL]]D]LRQHGHLWHUUHQL
SRWHQ]LDOPHQWHFRQWDPLQDWLGDGLRVVLQD
SRLFKpHUDQRVWDWLYLVWLDOFXQLWHFQLFLIDUHGHL
VRSUDOOXRJKLFRQLOUHODWLYRSRVL]LRQDPHQWRGL
SLFFKHWWLLQWHUUHQLGLSURSULHWjSULYDWD'D
XQDVXFFHVVLYDYHULILFDIDWWDGDJOL8IILFL
FRPXQDOLVSLHJDLOVLQGDFR3DROR%XWWLVLD
3HGHPRQWDQDFKH6WUDEDJKDQQRFRQIHUPDWR
FKHVLWUDWWDYDGLLQWHUYHQWLSURSHGHXWLFLDOO

DYYLRGHOOHSURFHGXUH$QFRUDXQDYROWDVLDOD
FRQFHVVLRQDULDFKHODVRFLHWjLQFDULFDWDGHOODFDUDWWHUL]]D]LRQHKDQQRHOXVRJOLDFFRUGLSUHVLHFRQGLYLVL
GXUDQWHOD&RQIHUHQ]DGHL6HUYL]LLQ5HJLRQHORVFRUVRDQQRHQHOWDYRORGLODYRURDSHUWRFRQOD
3UHIHWWXUDGL0RQ]DH%ULDQ]DQHLPHVLVFRUVL
,Q&RPXQHQRQqDVVROXWDPHQWHDUULYDWDDOFXQDFRPXQLFD]LRQHIRUPDOH1RQVROR1HSSXUHL
SURSULHWDULGHLWHUUHQLLQWHUHVVDWLVRQRVWDWLDYYHUWLWLGLTXDQWRVDUHEEHDFFDGXWR(QRQSXzHVVHUHXQD
JLXVWLILFD]LRQHTXDQWRGLFKLDUDWRGDLWHFQLFLGL6WUDEDJH3HGHPRQWDQDFKHVLWUDWWDYDVRORGL
VRSUDOOXRJKLSURSHGHXWLFLDOSLDQRGLODYRURGDSUHVHQWDUHHFRQGLYLGHUHSRLFRQO
$PPLQLVWUD]LRQH
&RPXQDOHGL6HYHVR
,OWRUPHQWRQH3HGHPRQWDQDFRQWLQXDDGLVDWWHQGHUHOHSURPHVVHIDWWH$QFKHSHUFKpQRQVRORLOVLQGDFR
GL6HYHVRPDWXWWLLSULPLFLWWDGLQLFRLQYROWLQHOSURJHWWRHOHDVVRFLD]LRQLDPELHQWDOLVWHKDQQQRSLYROWH
DYXWRLQFRQWULDQFKHLQ5HJLRQHGXUDQWHVHUDWHLQIRUPDWLYHVXOO
DUJRPHQWRFKHLQWHUHVVDWXWWDOD
FRPXQLWj
48(67$92/7$O
$PPLQLVWUD]LRQHVHYHVLQDSUHQGHUjGHLSURYYHGLPHQWLSHUFKpHQWUDUHLQSURSLHWj
SULYDWHVHQ]DDOFXQDYYLVRqXQDWWRFKHGHQRWDSRFRULVSHWWR,QROWUHFRPHDOVROLWRLQTXHVWRPRGRLO
&RPXQHVLWURYDFRVWUHWWRDULVSRQGHUHDTXHVWLRQLDOOHTXDOLqWRWDOPHQWHHVWUDQHRPDOJUDGROH
FRQWLQXHULFKLHVWHYHUEDOLHVFULWWHGLDJJLRUQDPHQWRDLYHUWLFLGL3HGHPRQWDQDH6WUDEDJ
VRQLDURQFRQL#LOJLRUQRQHW

621,$521&21,

5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

PDJJLR
3DJLQD

,O*LRUQR HG%ULDQ]D
$XWRVWUDGD3HGHPRQWDQD

6LULFRUGLO
,FPHVDDQFKHTXL
0R]LRQHLQYLVWDGHOTXDUDQWHQQDOHGHOGLVDVWURGLRVVLQD
/$/,67$GL6LQLVWUDH$PELHQWHKD
SURWRFROODWRXQDPR]LRQHSHUGDUHXQD
PHPRULDDQFKHDOODFLWWjGL0HGDVXOGLVDVWUR
,FPHVDODIDEEULFDFKHHUDVXOWHUULWRULR
FLWWDGLQRGRYHRJJLFLVRQRORVWDGLRHO
DUHD
VSRUWLYDFLWWDGLQD
1RQqDQFRUDQRWDODGDWDGHO&RQVLJOLR
FRPXQDOHVSLHJDLOFDSRJUXSSR$OEHUWR
&RORPERLQFXLYHUUjGLVFXVVD,OOXJOLR
VDUDQQRWUDVFRUVLDQQLGDOGLVDVWUR
,FPHVDODIDEEULFDFKLPLFDGDFXLIXRULXVFuOD
WHWUDFORURGLEHQ]RSDUDGLRVVLQD 7FGG LO
SHULFRORVLVVLPRFRPSRVWRFKHDQFRUDRJJL
FRQWDPLQDLOVXRORGLPROWHDUHHQHLFRPXQL
RYHVLHEEHODULFDGXWDGLTXHOODQXEH
VSULJLRQDWDVLGDOUHDWWRUH$GHOUHSDUWR%
3HUQRLQRQXQDFHOHEUD]LRQHPDLOULFRUGR
YLYRGLXQDVFLDJXUDDPELHQWDOHFKHVSHQWLL
ULIOHWWRULQRQSXzHQRQGHYHHVVHUH
GLPHQWLFDWD,OJUXSSRSROLWLFRULWLHQHFKHOD
VWRULDVFULWWDVXTXHVWRGLVDVWURDPELHQWDOHH
VXLVXRLHIIHWWLVLDDVVDLFRUSRVDHFRQWURYHUVD
DQFKHVHSXUWURSSRDQFRUDRJJLLOWHUULWRULR
VXELVFHQHIDVWHFRQVHJXHQ]HFRQXQULQQRYDWR
ULVFKLRFKHGHULYHUHEEHGDOODPRYLPHQWD]LRQHGHOWHUUHQRODGGRYHqDQFRUDLQTXLQDWRGDOOD7FGG
TXDORUDYHQLVVHFRPSOHWDWDO
DXWRVWUDGDSHGHPRQWDQDFRQODUHDOL]]D]LRQHGHOODWUDWWD%H&
$XWRVWUDGDFKHDWWUDYHUVHUHEEHSURSULROH]RQH$%H5GRYHLQVLVWHODSUHVHQ]DGL7FGGROWUHLOLPLWL
QRUPDWLYLFRQWLQXD&RORPER3UHVHQ]DGHOSRWHQWHWRVVLFRDFFHUWDWDFRQOHDQDOLVLFKLPLFKHGHO
RJJLLQIDVHG
DSSURIRQGLPHQWRFRQLOSLDQRGLFDUDWWHUL]]D]LRQHDFDPSLRQDPHQWLSLILWWLHVXXQD
VXSHUILFLHSLDPSLD,OGLVDVWUR,FPHVDqTXLQGLWXWW
DOWURFKHXQHYHQWRSDVVDWRPDqTXDOFRVDFRQFXL
ODPHPRULDFROOHWWLYDGHYHUDSSRUWDUVL3HUTXHVWRLPSRUWDQWHqLOSHUFRUVRGHO3RQWHGHOOD0HPRULD
QHOODSRU]LRQHVHYHVLQDGHO3DUFR1DWXUDOH5HJLRQDOHGHO%RVFRGHOOH4XHUFHERVFRFUHDWRGRSRXQD
ODERULRVDERQLILFDVXTXHOODFKHHUDOD]RQD$TXHOODDSLDOWDFRQWDPLQD]LRQH
,/3217(GHOOD0HPRULDqXQSHUFRUVRVXOODVWRULDGLTXHOGLVDVWURIDWWRGLSDQQHOOLLOOXVWUDWLYL/D
IDEEULFD,FPHVDHUDLQVHGLDWDVXOWHUULWRULRGHOFRPXQHGL0HGD3HUTXHVWRFLSDUHJLXQWRLOPRPHQWR
G
DYYLDUHLOFRPSOHWDPHQWRGHO3RQWHGHOOD0HPRULDDSDUWLUHGDOSRVL]LRQDPHQWRGLXQSDQQHOOR
LOOXVWUDWLYRSURSULRD0HGDFRQFOXGH&RORPER1HOODPR]LRQHVLFKLHGHDQFKHGLWUDVPHWWHUHOD
PHPRULDDQFKHDOOHJLRYDQLJHQHUD]LRQLDSDUWLUHGDFRORURFKHIUHTXHQWDQRODELEOLRWHFDFLYLFD
PHGHVHLQVWDOODQGRSHUPDQHQWHPHQWHOuODPRVWUD6FDWWLGL0HPRULDSHUUDFFRQWDUHXQD6WRULD
6HYHVR'DOO
LQFLGHQWHGHODO%RVFRGHOOH4XHUFH

621,$521&21,

5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

PDJJLR
3DJLQD

*LRUQDOHGL'HVLR
6WUDEDJ

$1$/,6,/HRSHUD]LRQLVRQRFRPLQFLDWHFRQGXHJLRUQLGLULWDUGRHSURVHJXLUDQQRDQFKHTXHVWD
VHWWLPDQD

3HGHPRQWDQDDOYLDLFDURWDJJLQRQRVWDQWHOD
SLRJJLD
&(6$120 FEL ,OPDOWHPSRKDULVFKLDWRGL
IDUVOLWWDUHOHRSHUD]LRQLGLXQ
LQWHUDVHWWLPDQD
,QYHFHYHQHUGuFRQGXHVROLJLRUQLGLULWDUGR
ULVSHWWRDOODWDEHOODGLPDUFLDLFDURWDJJLSHU
3HGHPRQWDQDVRQRFRPLQFLDWLDQFKHVXO
WHUULWRULRFHVDQHVH
/HDQDOLVLVDUHEEHURGRYXWHSDUWLUHQHOOD
PDWWLQDWDGLPHUFROHGuPDODSLRJJLD
LQFHVVDQWHKDFDPELDWRLSLDQL
(SRVWLFLSDWRWXWWRDSSXQWRDYHQHUGuTXDQGR
JOLRSHUDWRULYHVWLWLGLWXWWRSXQWRFRQOHWXWH
YHUGLGLW\YHNVLVRQRSUHVHQWDWLLQFLWWj3ULPD
KDQQRODYRUDWRLQYLDGRQ6WXU]RQHOULRQH
0DULD$XVLOLDWULFHDOFRQILQHFRQ6HYHVRSRLVL
VRQRVSRVWDWLLQYLD'H0HGLFL,QWRWDOHKDQQR
SRUWDWRDWHUPLQHXQDTXLQGLFLQDGLSUHOLHYLGHO
WHUUHQRVXVXRORSXEEOLFRFRQRSHUD]LRQLGL
FLUFDPH]]
RUDFLDVFXQD7UHOHGLYHUVH
SURIRQGLWjDQDOL]]DWHWRSVRLOLQWHUPHGLR 
HFHQWLPHWUL HSURIRQGR GXHPHWUL ,O
FDPSLRQHqVWDWRSRLGLYLVRLQDOWUHWWDQWHSDUWL
XQDqULPDVWDD6WUDEDJXQDqVWDWDWHQXWDGL
VFRUWDHO
DOWUDLQYHFHFRQVHJQDWDDLWHFQLFLGL
$USD$GDVVLVWHUHSURSULRLWHFQLFLGL6WUDEDJ
H$USDLQVLHPHDJOLRSHUDLFKHKDQQRJHVWLWR
ODYLDELOLWjSHUO
LQWHUDGXUDWDGHLFDQWLHUL OH
DUHHVRQRVWDWHGLYROWDLQYROWDFLUFRVFULWWHFRQ
GHOOHWUDQVHQQH 
,FDURWDJJLSURVHJXLUDQQRLQTXHVWLJLRUQLVLDVXVXRORSXEEOLFRVLDVXTXHOORGLSURSULHWjSULYDWDQHOOH
YLH3R,VRQ]RLQWDQJHQ]LDOHVXGHYLD&ROGL7HQGDLQYLD7XUDWLH6DQW
(XURVLDHLQILQHLQFRUVR
(XURSD1HOIUDWWHPSROHWXWHYHUGLVRQRVWDWHSUHVHQWLVHPSUHGXUDQWHVHWWLPDQDVFRUVDDQFKHD
6HYHVRSHUFRQWLQXDUHTXDQWRFRPLQFLDWRVHWWHJLRUQLSULPD4XLQRQRVWDQWHODVFULWWD1RFDURWDJJL
VXXQPXUROXQJROD1D]LRQDOHGHL*LRYLQRQVRQRVWDWLULVFRQWUDWLSUREOHPLHSHUVLQRQHLWHUUHQLSULYDWLO

LWHUQRQKDVXELWRLQWRSSLQpqVWDWREORFFDWRGDTXDOFKHODPHQWHOD

5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

IHEEUDLR
3DJLQD

*LRUQDOHGL'HVLR
$XWRVWUDGD3HGHPRQWDQD

6(9(623UHRFFXSDWRLOVLQGDFR%XWWL1RQDEELDPRQHVVXQDFRPXQLFD]LRQH

&DURWDJJLWXWWRDQFRUDIHUPRDOSDOR
6(9(62 JEQ 6DUHEEHURGRYXWLSDUWLUHSRFR
GRSRO
LQFRQWURDSHUWRRUJDQL]]DWRGDOVLQGDFR
3DROR%XWWLOXQHGuO
DOWUR,QYHFHQRQFLVRQR
DQFRUDQRYLWjLQPHULWRDLFDURWDJJL LO
QXPHURSLHOHYDWRWUDTXHOOLGHOOHFLWWj
FRLQYROWH GLFXLLQDUHHSULYDWHGD
HIIHWWXDUHSURSULRVXOWHUULWRULRGL6HYHVR,
FDURWDJJLDYUHEEHURFRQVHQWLWRGLDYYLDUHOH
SULPHDQDOLVLGHLYDORULGLGLRVVLQDSUHVHQWLQHO
WHUUHQRFRQO
DQQXQFLRFKHHUDVWDWRGDWRD
LQL]LRGLFHPEUH$OPRPHQWRSHUzQRQFLq
JLXQWDDOFXQDFRPXQLFD]LRQHGD5HJLRQH
/ R P E D U G L D  R  G D 3HGHPRQWDQD$EELDPR
VSHGLWRXQVROOHFLWRFLqVWDWRGHWWRFKHVWDQQR
HVHJXHQGRGHOOHYHULILFKHFRQODVRFLHWj
DSSDOWDQWHVSLHJDLOSULPRFLWWDGLQR
VHYHVLQR,QWDQWRQHVVXQULVFRQWURQHDQFKH
SHU3HGHPRQWDQD$QFRUDqWXWWREORFFDWR
DJJLXQJH%XWWL$EELDPRYLVWRFKHF
qVWDWRLO
FRQWULEXWRGHOOR6WDWRHODSURSRVWDGL
GHILVFDOL]]D]LRQHROWUHFKHLOSUREOHPDGHL
IRQGLSXEEOLFLFRQLOULVFKLRFKHVLDQRLSULYDWL
DGRWWHQHUHYDQWDJJLHSSXUHODVLWXD]LRQHq
WRWDOPHQWHIHUPD6HSRLOHFRVHGRYHVVHUR
ULPDQHUHFRVuFRQ3HGHPRQWDQDEORFFDWDD
/HQWDWHLOVLQGDFRQRQKDGXEEL9D
ULTXDOLILFDWDODVXSHUVWUDGD0LODQR0HGD/D
VLWXD]LRQHqPROWRLQGLYHQLUHSHUTXHVWLRQLGL
WUDIILFRPDDQFKHLQTXHVWRFDVRELVRJQDDJLUHHIDUHTXDOFRVDODVFLDUHWXWWRFRVuFRPHqDOJLRUQRG

RJJLqDVVROXWDPHQWHLQDFFHWWDELOH

5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

IHEEUDLR
3DJLQD

,O*LRUQR HG%ULDQ]D
$XWRVWUDGD3HGHPRQWDQD

/(,1,=,$7,9(,'(02&5$7,&,&+,('(5$11281&216,*/,2$3(572

,O3GFKLDPDDUDFFROWDLVXRLVLQGDFL(/HJDPELHQWH
GHQXQFLDJOLHVXEHUL
021=$,/3'/20%$5'2FHUFDGLWURYDUH
ODTXDGUDWXUDGHOFHUFKLRVX3HGHPRQWDQD
PHQWUH/HJDPELHQWHGHQXQFLDLOSUREOHPD
GHJOLHVXEHULQHOODVRFLHWjFKHGRYUHEEH
UHDOL]]DUHODQXRYDDXWRVWUDGDHUDQRSUHYLVWL
GLSHQGHQWLPDQHFRQWDSLGHOGRSSLRH
RUDLOSLDWWRSLDQJH
,(5,SRPHULJJLRLOVHJUHWDULRUHJLRQDOHGHO3G
$OHVVDQGUR$OILHULHLOFDSRJUXSSR(QULFR
%UDPELOODKDQQRLQFRQWUDWRLUDSSUHVHQWDQWLGHO
SDUWLWRQHLFRPXQLGHOOHSURYLQFHGL9DUHVH
&RPRH0RQ]DH%ULDQ]D1HqXVFLWRXQ
URVDULRGLODPHQWD]LRQLGRYHRJQXQRKD
HVSRVWRWXWWLLSUREOHPLGHOVXRWHUULWRULR
VSLHJDLOSUHVLGHQWHGHOOD3URYLQFLDGL0RQ]D
*LJL3RQWL,OSULPRSUREOHPDqO
DVVHQ]DGL
XQSLDQRHFRQRPLFRILQDQ]LDULR
'LIILFLOHGDUHULVSRVWH,O3GFKLHGHUjXQ
&RQVLJOLRUHJLRQDOHGHGLFDWRD3HGHPRQWDQD
PHQWUH/HJDPELHQWHSUHVHQWHDOO
LQFRQWURGL
LHULGHQXQFLDODGLIILFLOHVLWXD]LRQHGL$SOOD
FURQDFDGLXQDPRUWHDQQXQFLDWDGLFH'DULR
%DORWWD LQIRWR UHVSRQVDELOH7UDVSRUWL
/HJDPELHQWH/RPEDUGLD
/$127,=,$GHJOLHVXEHULHGHLSRVVLELOLOLFHQ]LDPHQWLLQ3HGHPRQWDQD/RPEDUGDUDWLILFDLOIDOOLPHQWR
ILQDQ]LDULRWHFQLFRDPELHQWDOHHSROLWLFRGHOSURJHWWRFRQWLQXDO
HVSRQHQWHDPELHQWDOLVWDLQXQDQRWD
$QFRUDXQDYROWDVRQRLVLQJROLDSDJDUHXQQDXIUDJLRGLVLVWHPDLFLWWDGLQLHJOLDXWRPRELOLVWLFKHQRQ
SRVVRQRSHUPHWWHUVLXQ
DXWRVWUDGDFRQWDULIIHG
RUR2UDDQFKHLGLSHQGHQWLVRQRLQYHVWLWLGDXQD
VLWXD]LRQHILQDQ]LDULDRUPDLGDIDOOLPHQWR
0HQWUHLFLWWDGLQLFRQWULEXHQWLKDQQRSDJDWRO
SHUFHQWRGHJOLLQXWLOLODYRULIDWWLILQRUD&RPHVHPSUH
LQYHFHQRQSDJDQRJOLDPPLQLVWUDWRULGL3HGHPRQWDQDHOD5HJLRQH/RPEDUGLDFKHKDQQRSRUWDWROD
VRFLHWjDOIDOOLPHQWR
1RQSDJDLOFRQFHGHQWH&$/ FRQFHVVLRQDULRDXWRVWUDGDOHORPEDUGR FKHDYUHEEHGRYXWRYLJLODUHVX
XQDFRQYHQ]LRQHSHUQRQSHUPHWWHUHTXHVWRGLVDVWURYLVWRFKHVLSUHYHGHYDQRGLSHQGHQWLPHQWUH
FHQHVRQRSLGHOGRSSLR6RUSUHQGHLQILQHFKH6HUUDYDOOHDEELDVERUVDWRUHFHQWHPHQWHPLOLRQLD
3HGHPRQWDSHULVXRLFRVWLGLIXQ]LRQDPHQWRLQYHFHFKHPHWWHUHHTXLW\FRPHGRYUHEEHIDUHVHFRQGRLO
SLDQRHFRQRPLFRILQDQ]LDULRDSSURYDWRGDO&LSH
&RVuIDFHQGRIUDGXHDQQLODFRQFHVVLRQDULDDXWRVWUDGDOHYHUUjUHVWLWXLWDDOOD&LWWjPHWURSROLWDQD
VSROSDWD
PRQLFDJX]]L#LOJLRUQRQHW

5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

IHEEUDLR
3DJLQD

*LRUQDOHGL'HVLR
$XWRVWUDGD3HGHPRQWDQD

%$/277$ /(*$0%,(17( ,19,7$$)(50$5(/


23(5$

/
DXWRVWUDGDQRQULHVFHDLQFDVVDUH,QWDQWRJOLXWHQWL
ODWLWDQRWURSSRFDUD
JUI /DQRWL]LDGHJOLHVXEHULHGHLSRVVLELOL
O L F H Q ] L D P H Q W L  L Q 3HGHPRQWDQD /RPEDUGD
UDWLILFDLOIDOOLPHQWRILQDQ]LDULRWHFQLFR
DPELHQWDOHHSROLWLFRGHOSURJHWWR8QDPRUWH
DQQXQFLDWD$QFRUDXQDYROWDVRQRLVLQJROLD
SDJDUHXQQDXIUDJLRGLVLVWHPDLFLWWDGLQLHJOL
DXWRPRELOLVWLFKHQRQSRVVRQRSHUPHWWHUVLXQ

DXWRVWUDGDFRQWDULIIHG
RUR
/RVRVWLHQH'DULR%DORWWLUHVSRQVDELOH
7UDVSRUWLGL/HJDPELHQWH/RPEDUGLD
8QSDVVRLQGLHWUR,FRQWLGL3HGHPRQWDQDQRQ
WRUQDQR
%DVWDXQGDWRDOPRPHQWRSHUPLODXWHQWL
QRQqDQFRUDVWDWRSRVVLELOHSDJDUHSHUFKp
QRQVRQRVWDWHHPHVVHOHIDWWXUHHTXLQGLOD
VRFLHWjQRQKDDQFRUDLQFDVVDWRLVROGL,QROWUH
PROWLDXWRPRELOLVWLKDQQRULQXQFLDWRDXWLOL]]DUH
ODQXRYDDXWRVWUDGDYLVWRFKHKDFRVWLTXDVL
GRSSLULVSHWWRDXQD$R$/HGLIILFROWjGHOO

D]LHQGDJXLGDWDGD0DVVLPR6DUPLVRQR
PROWHSOLFLLFDQWLHULVRQRIHUPLSHUFKpQRQFL
VRQRLVROGLSHUILQDQ]LDUOLHLOPLQLVWUR
*UDL]LDQR'HOULRKDGHWWRFKHGD5RPDQRQQH
DUULYHUDQQRDOWUL YHGLDUWLFRORLQSDJLQD HRUD
VLqVFRSHUWRFKHWDULIIHG
RURRQRQWDULIIHG

RURJOLLQFDVVLVRQRPHQRGHOSUHYLVWR,YHUWLFL
GHOODVRFLHWjVPHQWLVFRQRFKHFLVDUDQQR
OLFHQ]LDPHQWLWUDLGLSHQGHQWLRFKHSDUWLUj
ODFDVVDLQWHJUD]LRQH3HGHPRQWDQDQRQKDLSUHVXSSRVWLSHUSRWHUDFFHGHUHDOODFDVVDLQWHJUD]LRQH
QpqFRVuVFRQWDWRSRWHUOLFHQ]LDUHDIIHUPDQRVRVWHQHQGRFKHLQUHDOWjLOPRPHQWRFULWLFRVDUHEEH
SDVVDWRJUD]LHDOSUHVWLWRGDPLOLRQLGLHXURFKH6HUUDYDOOH VRFLHWjFKHGHWLHQHTXDVLO
SHUFHQWR
GL$XWRVWUDGD3HGHPRQWDQD/RPEDUGD qVWDWDFRVWUHWWDDFRQFHGHUH
3HGHPRQWDQDqVWDWDSHQVDWDWUHQW
DQQLIDTXDQGRODVLWXD]LRQHHUDGLYHUVD,OSURJHWWRqVWDWRSL
YROWHULIDWWRHGD3HGHPRQWDQDVLqULGRWWDDJURQGDGL0LODQR6HQ]DSHQVDUHFKHDGHVVRFKLSHUFRUUH
OHDXWRVWUDGHQRQORIDSLSHUOXQJKLWUDJLWWLPDSHUFKLORPHWUL6RQRSHUORSLSHQGRODUL(XQ
DXWRPRELOLVWDGL6HUHJQRJLjSDJDHXURDOO
DQQRDOODPRWRUL]]D]LRQHQRQSXzSHUPHWWHUVLGL
SDJDUHRJQLYROWDFKHGHYHDQGDUHD0LODQR%HUJDPRR9DUHVHYDVXOODYLDELOLWjQRUPDOHFRQWLQXD
%DORWWDULOHYDQGR/DVLWXD]LRQHGL%UH%H0LqVRWWRJOLRFFKLGLWXWWLDQFKHDFDQWLHULFKLXVLYLDJJLDDO
SHUFHQWRGHOOHVXHSRWHQ]LDOLWj4XLQGLLFRVWLGLUHDOL]]D]LRQHQRQVDUDQQRPDLULSDJDWL
'DTXLO
LQYLWRDOJRYHUQDWRUH5REHUWR0DURQLDIHUPDUVLJLjVLVRQRVSHVLWURSLVROGLHYLWLDPRGL
EXWWDUQHDOWULSHUXQ
RSHUDFKHQRQVDUjXWLOL]]DWDSURSULRSHUFKpSHUULSDJDUVLGRYUjDYHUHWDULIIHFRVu
DOWHGDQRQHVVHUHVRVWHQXWHGDOO
XWHQ]DFKHFRQWLQXHUjDGLVHUWDUOD
5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

&RQWLQXD! 

IHEEUDLR
3DJLQD
6HJXH

*LRUQDOHGL'HVLR
$XWRVWUDGD3HGHPRQWDQD

1RWDDPDUJLQH3RVVRQRWLUDUHXQVRVSLURGLVROOLHYRJOLXWHQWLFKHQRQVRQRULXVFLWLDSDJDUHLO
SHGDJJLRHFKHWHPHYDQRO
DUULYRGLSHVDQWLVDQ]LRQL3HULOPRPHQWRQLHQWHPXOWH$XWRVWUDGD
3HGHPRQWDQD /RPEDUGDROWUHDQRQDYHUDQFRUDIDWWRSDUWLUHLOFLFORGLIDWWXUD]LRQHGDQRYHPEUHLQ
DYDQWLQRQKDDQFRUDVLJODWRDFFRUGLQpGDWRLOYLDDFRQWUROOLFKHSHUPHWWHUHEEHURGLVWDFFDUHOHPXOWH
QHLFRQIURQWLGLFKLQRQSDJDLOSHGDJJLRHQWURLOTXLQGLFHVLPRJLRUQRGDOSDVVDJJLR

5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

IHEEUDLR
3DJLQD

*LRUQDOHGL'HVLR
$XWRVWUDGD3HGHPRQWDQD

'$//$5(*,21(,OJRYHUQDWRUHSURQWRDOFRQIURQWRFRQ'HOULR&ULWLFRLQWDQWR&RUEHWWD2SHUD
LQXWLOHHYHFFKLD

0DURQLLQFRQWUDLOPLQLVWURSHUWHQWDUHLOVDOYDWDJJLR
&(6$120 FEL 7UDHVDWWDPHQWHGXHJLRUQL
JLRYHGuLOJRYHUQDWRUHGHOOD/RPEDUGLD
5REHUWR0DURQLLQFRQWUHUjLOPLQLVWURGHOOH
,QIUDVWUXWWXUH*UD]LDQR'HOULR(SHU
3HGHPRQWDQDODULXQLRQHD5RPDSRWUHEEH
HVVHUHTXHOODGHFLVLYD
$FRPXQLFDUHLOYLDJJLRqVWDWRORVWHVVR
0DURQLFKHQHOOHFDSLWDOHFLDQGUjSHU
FKLXGHUHODTXHVWLRQH$UH[SR7XWWDYLDOD
WRFFDWDHIXJDVDUjIRQGDPHQWDOHDQFKHSHUOH
VRUWLGHOSURJHWWRDXWRVWUDGDOH&RJOLHUzO

RFFDVLRQHSHUSRUUHODTXHVWLRQHGL
3HGHPRQWDQD0LVHPEUDXQSR
VLQJRODUHFKH
LO*RYHUQRFLDEELDFKLDPDWRLOGLIHEEUDLR
SHUGHILQLUHLGHWWDJOLSHULQVHULUH
3HGHPRQWDQDQHOSLDQR-XQFNHUHLOJLRUQR
GRSRLOPLQLVWURGHOOH,QIUDVWUXWWXUHGLFDO

HVDWWRFRQWUDULR)RUVHF
qXQSUREOHPDGL
FRPXQLFD]LRQHIUD3DOD]]R&KLJLHPLQLVWHUR
PDORULVROYHUHPRKDFRPPHQWDWR&KLDUR
GDSDUWHGHOJRYHUQDWRUHLOULIHULPHQWRDOO

LQFRQWURGLJLRYHGuO
DOWURWUD'HOULRHXQD
GHOHJD]LRQHGHO0RYLPHQWRVWHOOHFDSLWDQDWD
GDOFRQVLJOLHUHUHJLRQDOH*LDQPDUFR&RUEHWWD
'XUDQWHLOFRQIURQWR'HOULRDYHYDLQIDWWL
FRPXQLFDWRFKHGDOOR6WDWRQRQVDUHEEHSL
DUULYDWRQHSSXUHXQHXURSHU3HGHPRQWDQD
8QDGLFKLDUD]LRQHFKHSHUz0DURQLDOODYLJLOLD
GHOODSDUWHQ]DKDWHQXWRDVPHQWLUH1HLJLRUQLVFRUVLDEELDPRSDUWHFLSDWRDXQYHUWLFHD3DOD]]R
&KLJLHLQTXHOODVHGHFLqVWDWRFRQIHUPDWRO
LPSHJQRGHO*RYHUQRDFKLHGHUHDOOD&RPPLVVLRQH8HGL
LQVHULUH3HGHPRQWDQDORPEDUGDQHOSLDQR-XQFNHU
3HUTXHVWRVRQRULPDVWRVWXSLWRGDOOHSDUROHGHOPLQLVWURKDDJJLXQWR
4XHOFKHqFHUWRqFKHDOPRPHQWRLFDQWLHULVLVRQRIHUPDWLD/HQWDWHHGDFRPSOHWDUHFLVRQROHWUDWWH
% ILQRD&HVDQR &H'SHUXQWRWDOHGLFKLORPHWULHWUHPLOLDUGLDQFRUDGDWURYDUH'DO3LUHOORQHVL
VWDTXLQGLODYRUDQGRDIILQFKpOD%HL OD%DQFDHXURSHDGHJOLLQYHVWLPHQWL YDOXWLO
RSHUDHODLQVHULVFD
SURSULRQHOSLDQR-XQFNHUSHUILQDQ]LDUOD
&KLLQYHFHVWRUFHLOQDVRSHQVDQGRFKHVLDXQDVRUWDGLPLVVLRQHLPSRVVLELOHq&RUEHWWDFKHKD
UHSOLFDWRVHFFRDOSUHVLGHQWH/DUHYLVLRQHGHOSLDQRHFRQRPLFRILQDQ]LDULRqEORFFDWDGDRWWRPHVLHO

DXWRVWUDGDDGRJJLQRQIDSDUWHGHOODOLVWDGLRSHUHLWDOLDQHLQVHULWHQHOSLDQR-XQNHU,O*RYHUQRKD
VQREEDWROHULFKLHVWHGL0DURQLGLDEEDVVDUHLSHGDJJLDOO
$QDFGL&DQWRQHqDSHUWRXQGRVVLHUVXJOL
DSSDOWLGHOOHXOWLPHWUDWWHHLOSLDQRGLFDUDWWHUL]]D]LRQHqIHUPRDOSDORHOHQFD/DFRQFOXVLRQH",IDWWL
SDUODQRFKLDUR4XHVW
RSHUDULVSRQGHDXQPRGHOORGLPRELOLWjGLFLQTXDQW
DQQLIDRJJLqIXRULGD
TXDOVLDVLLGHDPRGHUQDHVRVWHQLELOHVLDGDOSXQWRGLYLVWDDPELHQWDOHFKHILQDQ]LDULR
5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

&RQWLQXD! 

IHEEUDLR
3DJLQD
6HJXH

*LRUQDOHGL'HVLR
$XWRVWUDGD3HGHPRQWDQD

,1$77(6$'(//
,1&217520DURQLSDUOHUjFRQ'HOULRJLRYHGuPD&RUEHWWDVLqGLFKLDUDWRGHOWXWWR
VFHWWLFRVXOIXWXUR

5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

IHEEUDLR
3DJLQD

,O*LRUQR HG%ULDQ]D
$XWRVWUDGD3HGHPRQWDQD

3HGHPRQWDQDOD%ULDQ]DGDOPLQLVWUR
021=$&$52PLQLVWURYLHQLLQ%ULDQ]DD
GHFLGHUHLQVLHPHFKHFRVDIDUHGL
3HGHPRQWDQD
O
LQYLWRFKHGRPDQLXQDSLFFRODGHOHJD]LRQH
GLVLQGDFLGHOODWUDWWD%JXLGDWDGDO
SUHVLGHQWHGHOOD3URYLQFLDHSULPRFLWWDGLQRGL
&HVDQR0DGHUQR*LJL3RQWLSRUWHUj
GLUHWWDPHQWHD*UD]LDQR'HOULR
/
DSSXQWDPHQWRqLQPDWWLQDWDDOPLQLVWHUR
GHOOH,QIUDVWUXWWXUHH7UDVSRUWL4XLLEULDQ]ROL
FKLHGHUDQQRXQLQWHUYHQWRGLUHWWRGHO*RYHUQR
VXOWHUULWRULRDOODOXFHGHLWDQWLSH]]LSHUVLSHU
VWUDGDGDXQSURJHWWRFKHLQTXHVWRPRPHQWR
QRQKDQHPPHQRXQRUL]]RQWHILQDQ]LDULR
6ROGLWXWWLSXEEOLFLJLjWHUPLQDWL
DPPLQLVWUD]LRQLORFDOLVXOSLHGHGLJXHUUDSHUL
WDQWLSUREOHPLGLWUDIILFRHGLLPSDWWR
DPELHQWDOHDSHUWLGDLFDQWLHULHLSRWHWLFL
ILQDQ]LDWRULSULYDWLIHUPLDOODILQHVWUDTXDQGR
UHVWDQRGDUHDOL]]DUHDQFRUDFKLORPHWULGL
JDOOHULHHGLDVIDOWRVXWHUUHQLFRPSOLFDWLWUDL
TXDOLTXHOOLFRQWDQLPDWLGDOODGLRVVLQD
$1'5(02DFKLHGHUHDOPLQLVWURFKHYHQJD
GDQRLHVLVLHGDFRPHDUELWURSHUFKpLO
*RYHUQRqXQVRFLRLPSRUWDQWHFKHQRQSXzHVVHUHDEEDQGRQDWRDOOHFKLDFFKLHUHIDWWHILQRUDVSLHJD
*LJL3RQWL
2FFRUUHFDSLUHFRVDIDUHSHUTXHVWDLQIUDVWUXWWXUD&HUFKHUHPRDQFKHGLFDSLUHVHqLQTXDOFKHPRGR
SRVVLELOHULYHGHUHLOSURJHWWRULRULHQWDQGRORDQFKHLQIXQ]LRQHGHJOLVWXGLUHFHQWLVXOWUDIILFR
1HOIUDWWHPSRVDUDQQRFKLHVWLDOPLQLVWURLQWHUYHQWLSHULOWUDVSRUWRSXEEOLFRORFDOHSHQDOL]]DWRGDLWDJOL
VHUYRQRVROGLSHUQRQODVFLDUHDSLHGLGDVHWWHPEUHLUDJD]]LFKHSUHQGRQRO
DXWREXVSHUDQGDUHD
VFXROD
6HFRQGRO
DQDOLVLGHOWUDIILFRLQGRWWRGD3HGHPRQWDQDUHDOL]]DWDGDOORVWXGLR0HWDSHUOH3URYLQFHGL
0RQ]DH&RPRO
DUULYRGHOFDQWLHUHKDSHJJLRUDWRODYLDELOLWjQHLFRPXQLGRYHVLULIXJLDQRJOL
DXWRPRELOLVWLLQIXJDGDLSHGDJJLHVXOOD0LODQR0HGDGRYHRJJLO
DXWRVWUDGDVLLQQHVWDDOO
DOWH]]DGL
/HQWDWH(D9DUHGRVLDUULYDDVILRUDUHODPHGLDGLFHQWRPLODYHLFROLDOJLRUQR
'DWLFKHLOPLQLVWURFKHKDJLjGLFKLDUDWRGLQRQLQWHQGHUHPHWWHUHSLXQHXURSXEEOLFRQHOPD[L
FDQWLHUHFRQRVFHJLjFLKDSHQVDWRDSUHVHQWDUJOLHOLODGHOHJD]LRQHFRPDVFDULFHYXWDQHOOHVFRUVH
VHWWLPDQH
$OPLQLVWUR'HOULRFKLHGHUHPRGLIDUVLSURPRWRUHGLXQDULQQRYDWDFRQFHUWD]LRQHLVWLWX]LRQDOH
ULDVVXPH3RQWL)LQGDOPHVHGLOXJOLRLQRFFDVLRQHGHOO
DVVHPEOHDGHLVXRLVLQGDFLOD3URYLQFLDGL
0RQ]DH%ULDQ]DKDXIILFLDOL]]DWRODULFKLHVWDGLULPHWWHUHPDQRDOSURJHWWRFKHSHUHVVHUHUHDOL]]DWR
QHFHVVLWDGLDOWULPLOLDUGLGLHXURSHURUDIHUPLVRORVXOODFDUWD
2ELHWWLYRGLDOORUDUHDOL]]DUHXQ
DXWRVWUDGDVRIWPROWRPHQRFRVWRVDHPHWWHUHPDQRVXELWRDOOHRSHUH
SURPHVVHHPDLUHDOL]]DWH XQSDFFKHWWRGDPLOLRQLGLHXUR VXOODYLDELOLWjORFDOH(RJJLORVWXGLR
0HWDVXJJHULVFHXQLQWHUYHQWRSHUSRWHQ]LDUHHPHWWHUHLQVLFXUH]]DOD0LODQR0HGD8QDULFKLHVWDGL
5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

&RQWLQXD! 

IHEEUDLR
3DJLQD
6HJXH

,O*LRUQR HG%ULDQ]D
$XWRVWUDGD3HGHPRQWDQD

VLFXUH]]DIDWWDSURSULDGDOODVWHVVD3UHIHWWXUDWDQWRGDSRUWDUHLOSUHIHWWR*LRYDQQD9LODVLDFRQYRFDUH
3HGHPRQWDQDSHUFKLHGHUOHGLSDJDUHDOFXQLLQWHUYHQWLXUJHQWLVXOODH[6V

021,&$*8==,

5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV



IHEEUDLR
3DJLQD

/D3UHDOSLQD
$XWRVWUDGD3HGHPRQWDQD

8Q&RQVLJOLRUHJLRQDOHVXOIXWXURGL3HGHPRQWDQD
9$/ / (2/ 21 $  3HGHPRQWDQD H  O H  V X H
GLIILFROWjDOFHQWURGHOODGLVFXVVLRQHGHO3GLO
JUXSSRUHJLRQDOHFKLHGHUjDOJRYHUQDWRUH
5REHUWR0DURQLFKHVLIDFFLDXQFRQVLJOLR
UHJLRQDOHVWUDRUGLQDULRSURSULRSHUFKLDULUHOD
V L W X D ] L R Q H  G L  $ X W R V W U D G D 3HGHPRQWDQD
/RPEDUGDDOODOXFHGHOOHHVLJHQ]HGHLWHUULWRUL
GHOOHSURYLQFHGL9DUHVH&RPRH0RQ]D
%ULDQ]D0HQWUHXQDGHOHJD]LRQHORPEDUGD
JXLGDWDGD*LJL3RQWLSUHVLGHQWHGHOOD
SURYLQFLDGL0RQ]D%ULDQ]DGRPDQLLQFRQWUHUj
LOPLQLVWUR*UD]LDQR'HOULRSRVVLELOHFKHVL
FKLHGDXQVRVWHJQRSHUULYHGHUHLOSLDQR
HFRQRPLFRILQDQ]LDULRWDJOLDQGRODWUDWWD'
GHOUHVWRLOSHIGHODSSURYDWRQHO
SUHYHGHJLjTXHVWDLSRWHVL ILQRD%HUJDPRH
LQVHUHQGRLOFROOHJDPHQWRFRQO
DXWRVWUDGDDOOD
EDUULHUDGL$JUDWH/DSURSRVWDVDUHEEH
GXQTXHGLHOLPLQDUHODWUDWWD'HVRVWLWXLUODFRQ
LOSRWHQ]LDPHQWRGHOORVYLQFRORGL$JUDWHDFXL
VLVRPPHUHEEHXQSHGXQFRORGLFROOHJDPHQWR
FRQ3HGHPRQWDQD4XHVWDO
HVWUHPDVLQWHVL
GHOO
LQFRQWURRUJDQL]]DWRLGD$OHVVDQGUR
$OILHULVHJUHWDULRUHJLRQDOHGHO3GH
FRQVLJOLHUHUHJLRQDOHSHULQFRQWUDWRLVLQGDFLH
JOLDPPLQLVWUDWRULORFDOL'DOODSURYLQFLDGL
9DUHVHJOLXQLFLSUHVHQWLVRQRVWDWLLOVLQGDFRGL
*RUOD0LQRUH9LWWRULR/DQGRQLFRQO
DVVHVVRUH
DLODYRULSXEEOLFL*LXVHSSH0LJOLDULQR JLjVLQGDFR ROWUHDOVLQGDFRGL/R]]D*LXVHSSH/LFDWD
$EELDPRDIIURQWDWRWXWWLLWHPLSHUQRLRUDqIRQGDPHQWDOHULVROYHUHODTXHVWLRQHGHOOHFRPSHQVD]LRQL
DPELHQWDOL&LKDQQRDVVLFXUDWRFKHLIRQGLFLVRQRHGXQTXHGREELDPRIDUSDUWLUHLODYRULDOSLSUHVWR
,QWDQWRLHULLOJRYHUQDWRUH0DURQLKDLQFRQWUDWRLOSUHVLGHQWHGL$XWRVWUDGD3HGHPRQWDQD /RPEDUGD
0DVVLPR6DUPLPHQWUHJLRYHGuLOJRYHUQDWRUHLVDUjD5RPDHIUDLWHPLGLFXLGLVFXWHUjFRQLOPLQLVWUR
*UD]LDQR'HOULRFLVDUjDQFKH3HGHPRQWDQDVLIDUjFKLDUH]]DVXOO
DPPLVVLELOLWjGHOO
RSHUDDO3LDQR
-XQNHU

5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV



PDJJLR
3DJLQD

,O&LWWDGLQR0% HG
9DO6HYHVR
6WUDEDJ

,OSDUDGRVVRRUDF
qODVPDQLDGHLFDURWDJJLQHL
JLDUGLQL
1RQRVWDQWHODSLRJJLDVRQRSURVHJXLWLLQ
VHWWLPDQDLFDURWDJJLDSSURGDQGRDQFKHQHOOD
SDUWHVHYHVLQDGHO%RVFRGHOOH4XHUFHHLQ
SURSULHWjSULYDWHDSSDUHQWHPHQWHVHQ]D
SDUWLFRODULSUREOHPL,QIDWWLSXUHLOFLWWDGLQR
FKHVLHUDVXELWRGLFKLDUDWRFRQWUDULRDIDU
H Q W U D U H  J O L  R S H U D W R U L  G L 6WUDEDJ D  I D U H
FDURWDJJLQHOVXRWHUUHQRLQYLDQGRDQFKHLQ
0XQLFLSLRXQDOHWWHUDGLFRQWUDULHWj
FRPPHQWDLOVLQGDFR3DROR%XWWLVLqSRL
ULFUHGXWRGRSRHVVHUFLFRQIURQWDWLHDYHU
SDUODWRFRQJOLDGGHWWLDLODYRUL7HPHYDFKHL
SUHOLHYLFRPSURPHWWHVVHURGHLFDYLFKH
SDVVDQROXQJRLOVXRWHUUHQRPDqVWDWR
VPHQWLWRHKDFRQFHVVRFKHOHPDFFKLQH
HQWUDVVHURQHOVXRWHUUHQRDGGLULWWXUDFRQGXH
JLRUQLG
DQWLFLSR0DQRQqWXWWR*OL
RSHUDWRULKDQQRHVHJXLWRSXQWLGLSUHOLHYRLQ
SLULVSHWWRDOSUHYHQWLYDWRDJJLXQJHLO
JHRORJR*LDQQLGHO3HURGDOPRPHQWRFKH
DOFXQLFLWWDGLQLVLVRQRGLPRVWUDWLGHVLGHURVLGL
FDSLUHTXDQWDGLRVVLQDF
qDQFRUDQHLORUR
WHUUHQL1RQWXWWLSHUzJXDUGDQRGLEXRQ
RFFKLRXRPLQLLQWXWHYHUGLHWULYHOOH6RQR
SDVVDWRHKRYLVWROXQJRXQDUDPSDGHOOD
VXSHUVWUDGDXQFDQWLHUHSHULFDURWDJJL
UDFFRQWD0DXUL]LR'RQJKLHPLVRQRFKLHVWR
FRPHVLSRVVDSHUPHWWHUHFLzLQYLVWDGL
3HGHPRQWDQDSXUVDSHQGRFKHPDLDUULYHUDQQRRSHUHGLFRPSHQVD]LRQHHYLDELOLWjDFFHVVRULD%DVWL
YHGHUHOHWUDWWHSUHFHGHQWL6HSRLDQFKHOD%VDUjDSHGDJJLRQHVVXQRODSUHQGHUjRUDFKHL
VLQGDFLVLRSSRQJDQRDTXHVW
RSHUDFRQIRU]D8QPLRYLFLQRqVWDWRDYYLVDWRGLSDUWHFLSDUHDOO
XOWLPR
LQFRQWURVXLFDURWDJJLIDHFRLOFRQVLJOLHUH1DWDOH$ODPSLSHUzODOHWWHUDGL3HGHPRQWDQDLQPHULWRQRQ
O
KDULFHYXWD$PHLQYHFHqJLjDUULYDWDGDWHPSR,QROWUHO
DPPLQLVWUD]LRQHQRQDYUHEEHGRYXWR
LQFRQWUDUHLSURSULHWDULLQXQLQFRQWURDSSRVLWR"(FRPHPDLLFDQWLHULGHLFDURWDJJLVRQRFRVuPDO
VHJQDODWL"6%DO

5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

PDJJLR
3DJLQD

*LRUQDOHGL'HVLR
6WUDEDJ

6HYHVR

$OYLDLWDQWRDWWHVLHFRQWHVWDWLFDURWDJJLSHUOD
GLRVVLQDJOLXRPLQLLQWXWDYHUGHDOODYRURQHOOHDUHH
SXEEOLFKH
6(9(62 JEQ 6RQRSDUWLWLXIILFLDOPHQWH
PDUWHGuFRPHGDFURQRSURJUDPPDHVHQ]D
SDUWLFRODULSUREOHPL3ULPDD6HYHVRHSRLD
0HGDJOLXRPLQLLQYHUGHVRQRDUULYDWLSHU
GDUHLOYLDDLWDQWRDWWHVLFDURWDJJLLQYLVWDGL
3HGHPRQWDQD
,SULPLSUHOLHYLVRQRVWDWLHIIHWWXDWLVXDUHH
SXEEOLFKHLQYLD9LJQD]]RODQHOO
DUHDPH
GHVHGHO%RVFRGHOOH4XHUFHPDDQFKHLQYLD
%XVQHOOLD0HGDHQHLSUHVVLGHOORVWDGLR&LWWj
GL0HGD$UHDOL]]DUOLJOLRSHUDWRULYHVWLWLFRQ
WXWHLQW\YHNFKHDWWUDYHUVRODSDUWLFRODUH
FDURWDKDQQRUHFXSHUDWRLQFLDVFXQSXQWR
XQFDPSLRQHDGLYHUVLOLYHOOLGLSURIRQGLWjWRS
VRLOLQWHUPHGLR HFHQWLPHWUL HSURIRQGR
GXHPHWUL ,OFDPSLRQHqVWDWRSRLGLYLVRLQWUH
SDUWLXQDULPDVWDD6WUDEDJXQDGLVFRUWDHO

DOWUDGDWDDLWHFQLFLGL$USDDQFK
HVVLSUHVHQWL
DOPRPHQWRGHLSUHOLHYLLQVLHPHD*LDQQL'HO
3HURLOWHFQLFRQRPLQDWRGDL&RPXQLGHOOD
WUDWWD%$OPRPHQWRQRQVRQRVWDWLDQFRUD
WRFFDWLLWHUUHQLSULYDWL
1RQRVWDQWHVLFRQFOXGHUDQQRSULPDLFDURWDJJL
VXVXRORSXEEOLFRTXDOFKHODPHQWHODSDUHVLD
SHUzJLjDUULYDWD3HURUDVRORGXHFLWWDGLQL
KDQQRPRVWUDWRUHVLVWHQ]HVSLHJDLOVLQGDFR
3DROR%XWWL,OSULPRqDSSDUVRXQSR
ULJLGR
PLQDFFLDGLRSSRUVLHQRQIDULQL]LDUHLODYRUL
VXOSURSULRWHUUHQRPHQWUHLOVHFRQGRVLqGHWWRSUHRFFXSDWRSHUFKpLFDURWDJJLSRWUHEEHURLQWDFFDUH
DOFXQLODYRULGDOXLSUHFHGHQWHPHQWHIDWWLPDSHUTXHVWLFDVLqSUHYLVWRXQLQGHQQL]]R6HVLGR
YHVVHURSURWUDUUHHYHQWXDOLODPHQWHOHLOSULPRFLWWDGLQRKDJDUDQWLWRFKHSUHQGHUjLFRQWDWWLGLUHWWDPHQWH
FRQOHSHUVRQHLQWHUHVVDWH,QWDQWRJOLDYYLVLVRQRVWDWLIDWWLSHUYHQLUHDWXWWLLVHYHVLQLFRLQYROWLHRJQXQR
VDUjSRLFRQWDWWDWRWHOHIRQLFDPHQWHLOJLRUQRSULPD/
DWWLYLWjSURVHJXLUjFRPHSUHYLVWRHDQFKHLQFDVR
GLPDOWHPSRLFDQWLHULSRWUDQQRFRQWLQXDUHSRLFKpOH]RQHVRQRFRSHUWHHVLVRQRSUHVHOHSUHFDX]LRQL
QHFHVVDULH1HOIUDWWHPSRDQFKH)ODYRUUHEEHSURJUDPPDUHDQDOLVLVXOWHUULWRULRPDODVLWXD]LRQHq
DQFRUDLQVWDOORSRLFKp5HJLRQH/RPEDUGLDQRQKDDQFRUDULVSRVWRLQPHULWRDOO
HYHQWXDOHILQDQ]LD
PHQWRGHOSURJHWWR&RQWLDPRGLDSSURIRQGLUHLOWHPDHVROOHFLWDUHGLQXRYR5HJLRQHDIIHUPD%XWWL*Lj
LOGLUHWWRUHGL)OD0DXUL]LR3LFFDURORVWDODYRUDQGRSHURUJDQL]]DUHO
LQWHUYHQWRPDQRQF
qQXOODGL
GHILQLWLYR,QILQHSRLVXOIXWXURGHOOD%%XWWLFRQIHUPDFKHDOPRPHQWRQRQFLVRQRDJJLRUQDPHQWLVXO
SLDQRILQDQ]LDULRGL3HGHPRQWDQD6LIDQQRFDURWDJJLPDGHOODWUDWWDQRQVLVDDQFRUDQXOOD
5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

JLXJQR
3DJLQD

,O*LRUQR HG%ULDQ]D
$XWRVWUDGD3HGHPRQWDQD

,/&$626,1,675$($0%,(17(&5,7,&$,352*5$00,8)),&,$/,

4XDUDQW
DQQLGLGLRVVLQD/DSROHPLFDEUXFLDDQFRUD
&HOHEUD]LRQLHFRQWHVWD]LRQLVXOULVFKLRDWWXDOH
GL621,$521&21,0('$6(9(62
8QDOXQJDVHULHGLLQL]LDWLYHSHUQRQ
GLPHQWLFDUHODWUDJHGLDGHOOD'LRVVLQD  , Q
FDPSRGLYHUVLHQWLHDVVRFLD]LRQL0DD0HGD
VSXQWDQROHSROHPLFKH
LQGXEELRFKHLOGLVDVWUR,FPHVDVSLHJD
$OEHUWR&RORPERFDSRJUXSSRGL6LQLVWUD
$PELHQWHHWHVWLPRQHGHOO
HYHQWRDQFKHVH
HUDXQEDPELQRFKHODGLRVVLQDVLDDQFRUD
RJJLDUJRPHQWRGHOLFDWRGDWUDWWDUHSHUWXWWHOH
LPSOLFD]LRQLHPRWLYHVXOODVDOXWHVXOO

DPELHQWHVXOWHVVXWRVRFLDOHHVXOWHUULWRULR
FKHHVVDFDXVz
4XDOFRVDTXLQGLFKHQRQSXzHVVHUHFRQILQDWR
QHOODFHOHEUD]LRQHGLXQDQQLYHUVDULRSHUFKp
TXHVWRFDSLWRORQRQSXzHVVHUHFRQVLGHUDWR
FKLXVRVRSUDWWXWWRSHULOIDWWRFKHODGLRVVLQD
ULVXOWDDQFRUDFRQWDPLQDUHSDUWLGHOVXRORGHL
QRVWULFRPXQLHGqQHOVDQJXHGLFKLQRQSHU
VXDYRORQWjYLYHQQHLQFRQWDWWR
81
,03267$=,21(FKHROWUHWXWWRKD
IRFDOL]]DWRSDUWLFRODUPHQWHLOUXRORHO

DWWHJJLDPHQWRWHQXWRGDSDUWHGHOODFRPXQLWj
FDWWROLFDVLQGDOGDQGRO
LPSUHVVLRQHGL
FRQVLGHUDUHTXHOORFRPHO
XQLFRDSSRUWRSRVLWLYRDVHJXLWRGHOGLVDVWURGLRVVLQD(TXHVWRVFDWHQD
FULWLFKH'RSRPROWLDQQLSHUHYLWDUHRIIXVFDPHQWLYRORQWDULHLQYRORQWDULVDUHEEHLPSRUWDQWHULFRUGDUH
DQFKHTXHOODFKHIXODFURQDFDFRQOHVXHHYLGHQ]HFRQWLQXD&RORPERFRQLPRPHQWLFRQFLWDWLL
ULWDUGLGHOOH,VWLWX]LRQLHGHJOL(QWLSUHSRVWLDLFRQWUROOLOHFRQWUDSSRVL]LRQLOHUHVSRQVDELOLWjODVILGXFLD
ODSDXUDPDDQFKHLOGHVLGHULRHODYRORQWjGLHVVHUHLQIRUPDWLSHUSRWHUYDOXWDUHVHQ]DVXELUHGHFLVLRQL
DIIUHWWDWHRFRPRGH1RQVLGHYHJHQHULFDPHQWHYROWDUHSDJLQDSHUFKpFLzFKHqDFFDGXWRDQQLIDKD
ODVFLDWRO
HUHGLWjSHVDQWHGLXQDXPHQWRGLDOFXQHWLSRORJLHGLWXPRULPDVRSUDWWXWWRODSUHVHQ]DGHO
SRWHQWHWRVVLFRQHOVDQJXHGLPROWLGLFRORURFKHIXURQRHVSRVWLHQHOVXROR2JJLLOULVFKLRQRQq
VFRPSDUVRPDVLULSURSRQHFRQLOSURJHWWRGLUHDOL]]D]LRQHGHOO
DXWRVWUDGD3HGHPRQWDQD
8Q

DXWRVWUDGDLOFXLWUDFFLDWRDWWUDYHUVDSURSULROH]RQH$%5GRYHOHDQDOLVLGHOKDQQRFHUWLILFDWR
DQFRUDODSUHVHQ]DGLGLRVVLQD'XQTXHDQFKHRJJLFRPHQHOSDVVDWRFRQFOXGH$OEHUWR&RORPER
VRORO
LQIRUPD]LRQHGLIIXVDODVHQVLELOL]]D]LRQHODFRQVDSHYROH]]DHODPRELOLWD]LRQHSRVVRQR
FRQWHQHUHTXHVWHVFLDJXUDWHYRORQWj(FFRWXWWRTXHVWRqVWDWRLOGLVDVWUR,FPHVDFKHQRQSXzHQRQ
GHYHHVVHUHVHSSHOOLWRPDYDUDFFRQWDWRQHOODVXDFRPSOHWH]]DHFRQOHDWWXDOLLPSOLFD]LRQLOHJDWHDOOD
UHDOL]]D]LRQHGHOO
LQXWLOHDXWRVWUDGD3HGHPRQWDQDQHOOHDUHHDQFRUDFRQWDPLQDWHGDGLRVVLQD

621,$521&21,
5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

DSULOH
3DJLQD

*LRUQDOHGL'HVLR
6WUDEDJ

$872675$'$'RSRLULWDUGLGLLQL]LRDQQRLOSLDQRGRYUHEEHSDUWLUHWUDXQPHVH

3HGHPRQWDQDFDURWDJJLDPDJJLR
6(9(62 JEQ 'RYHYDQRSUHQGHUHLOYLDD
JHQQDLRPDLFDQWLHULQRQVRQRPDLSDUWLWL2UD
SHUzXQULQYLRGRSRO
DOWURVHPEUDHVVHUFL
ILQDOPHQWHXQDGDWDLFDURWDJJLGL
3HGHPRQWDQDGRYUHEEHURFRPLQFLDUHDOOD
PHWjGLPDJJLR$GDIIHUPDUORqVWDWRLO
VLQGDFR3DROR%XWWLGXUDQWHODFRQIHUHQ]D
FDSLJUXSSRGHOODVFRUVDVHWWLPDQD$OSULPR
FLWWDGLQRO
LQIRUPD]LRQHqVWDWDUHVDQRWDGRSR
XQLQFRQWURDYYHQXWRPHUFROHGuFRQ6WUDEDJ
&LqVWDWRGHWWRFKHOHDQDOLVLGRYUHEEHUR
SDUWLUHGDPHWjPDJJLR6LLQWHUYHUUjQHOOH
DUHHRJJHWWRGLFDQWLHUH,SXQWLGLFDURWDJJLR
VRQRFRQGLYLVLFRVuFRPHOHPRGDOLWjGL
DQDOLVL1HLSURVVLPLJLRUQLFLYHUUjIRUQLWRO

HOHQFRGHOOHDUHHFKHVDUDQQRRJJHWWRGL
FDPSLRQDPHQWRGRSRGLFKpODQRVWUD
LQWHQ]LRQHqTXHOODGLRUJDQL]]DUHXQLQFRQWUR
SXEEOLFRSHUDJJLRUQDUHHLQIRUPDUHWXWWLL
FLWWDGLQLSRLDYUHPRXQXOWHULRUH
DSSXQWDPHQWRPDVRORFRQLSURSULHWDULGHOOH
DUHHLQWHUHVVDWH1HOGLDORJRFRQ6WUDEDJ
VRQRSRLVWDWHFKLDULWHOHPDQRYUHGLDOFXQL
WHFQLFLGL3HGHPRQWDQDPHQWUHDYYLDYDQROH
SURFHGXUHUHODWLYHDOSLDQRGL
FDUDWWHUL]]D]LRQHHIIHWWXDQGRVRSUDOOXRJKLH
SRVL]LRQDQGRSLFFKHWWLLQSURSULHWjSULYDWH
VHQ]DDYHUSULPDWURYDWRXQDFFRUGRFRQLO
&RPXQHHLSURSULHWDUL/DVHJQDOD]LRQHHUDVWDWDSDVVDWDDOO
XIILFLR(FRORJLDGDDOFXQLFLWWDGLQL
VXVFLWDQGRODGLVDSSURYD]LRQHGHOVLQGDFRSHULOPDQFDWRULVSHWWRGHJOLDFFRUGL
$EELDPRFKLDULWRTXDQWRDFFDGXWRLQPHULWRDJOLLQWHUYHQWLGHLJLRUQLVFRUVLGXUDQWHFXLVLqFRQWUROODWR
FKHLSXQWLGLFDPSLRQDPHQWRIRVVHURYHUILFDELOL
'LFHUWRFLzQRQWRJOLHFKHSULPDGLFRPSLHUHTXHVWLVRSUDOOXRJKLDYUHEEHURGRYXWRDYYLVDUFLSHU
TXHVWRDEELDPRIDWWRXQDVHJQDOD]LRQHDO3UHIHWWR
(FFRTXLQGLHPHUJHUHQRYLWjLPSRUWDQWLVRSUDWWXWWRDOLYHOORGLWHPSLVWLFKH'RSRPHVLGLVLOHQ]LYLHQH
UHVDQRWDXQDGDWDDQFRUDXQPHVHHPH]]RFLUFDHSRLLFDURWDJJLGRYUHEEHURSHUTXHVWDYROWD
SUHQGHUHGDYYHURLOYLD

5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

PDJJLR
3DJLQD

*LRUQDOHGL'HVLR
$XWRVWUDGD3HGHPRQWDQD

$0%,(17$/,67,1R3HGHPRQWDQDKDUHJDODWRSURYRFDWRULDPHQWHDLUHODWRULXQDFDVVHWWDGL
FDURWH

/
XQLFDVROX]LRQHSRVVLELOHqIHUPDUHLODYRUL
6(9(62 JEQ 6LVRQRSUHVHQWDWLODVFLDQGRDL
UHODWRULXQDFDVVHWWDGLFDURWHSHUFKp
VHUYRQRDOFRQWUDULRGHLFDURWDJJLVXPLVXUD
/
XQLFDFRVDGDIDUHLQIDWWLqIHUPDUH
3HGHPRQWDQD
0HUFROHGuVHUDLQ)ODLOFRRUGLQDPHQWR1R
3HGHPRQWDQDKDULEDGLWRDQFRUDXQDYROWDOH
SURSULHLQWHQ]LRQL$SDUODUHLOSRUWDYRFH
'DYLGH%LJJLSUHVHQWHWUDLOSXEEOLFRFKHKD
YROXWRVRWWROLQHDUHFRPHODORJLFDHLOEXRQ
VHQVRLPSRUUHEEHURGLQRQWRFFDUHLQPRGR
FRVuLPSDWWDQWHVHGDYYHURGRYHVVHURSDUWLUHL
FDQWLHULDXWRVWUDGDOLXQWHUULWRULRWDQWRIUDJLOH
1RQYRJOLDPRVXELUHODPLQDFFLDGHOOD
GLRVVLQDSHUXQDVHFRQGDYROWD
/DQRVWUDVDOXWHVLSXzWXWHODUHVRORIHUPDQGRL
ODYRULGL3HGHPRQWDQD
%LJJLROWUHDGDYHUPRVWUDWRODSURSULD
FRQWUDULHWjVXLFDURWDJJLVLqGHWWR
LQVRGGLVIDWWRGHOODVFHOWDGLHIIHWWXDUHYHQWL
SUHOLHYLVXOOD0LODQR0HGDWUD0HGDH6HYHVR
0LVHPEUDQRVLQFHUDPHQWHSRFKLDQFKH
SHUFKpqXQD]RQDPROWRYLFLQDDOO
H[,FPHVD
'LIILFLOHSRLFKHTXHVWLSXQWLGLDQRULVXOWDWL
VLJQLILFDWLYL,QSLKDSURVHJXLWRFRQWLQXRD
SHQVDUHFKHVHUYLUHEEHXQ
LQGDJLQHDFFXUDWD
VXWXWWDO
DUHDDOORUDLQTXLQDWD6HPSOLFHPHQWH
PLGRPDQGRSHUFKp)ODQRQDEELDPDLIDWWR
TXDOFRVDYLVWRFKHWUDO
DOWURFLWURYLDPRQHOODVXDVHGH)RUVHqTXHVWRTXHOORFKHVHUYHGDYYHUR
HIIHWWXDUHXQ
LQGDJLQHDSSURIRQGLWD'RYUHEEHHVVHUHXQDSULRULWjSHUWXWWL$PPLQLVWUD]LRQLORFDOL
FRPSUHVHPDVHPEUDSURSULRQRQVLDFRVu6LSUHIHULVFHXQ
DXWRVWUDGDGDQQRVDSHUO
DPELHQWHSHUOD
TXDOHQRQVLWURYDQRVROGLHFKHqJLXGLFDWDLQXWLOHDULVROYHUHLSUREOHPLGLWUDIILFR8QDSDXUDTXLQGL
FKHqDQFRUDSUHVHQWHSHUFKpQRQVLYXROHULYLYHUHORVWHVVRLQFXERGLTXDUDQW
DQQLID5LVFKLDPRGL
VXELUHGHLFDURWDJJLSHUXQ
DXWRVWUDGDFKHIRUVHQHSSXUHVLIDUj/DQFLRTXLQGLXQDSSHOORDLFLWWDGLQL
KDFRQFOXVR1RQFROODERUDWHILQJHWHGLQRQHVVHUHLQFDVDQRQDSULWH)DWHLQPRGRFKHYHQJDSHUVR
SLWHPSRSRVVLELOHSHUFKpQRQF
qDOWUDVROX]LRQHVHQRQTXHOODGLIHUPDUHLODYRUL

5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

PDJJLR
3DJLQD

&RUULHUHGHOOD6HUD
$XWRVWUDGD3HGHPRQWDQD

'DRJJLLODYRUL

3HGHPRQWDQDYLDDLFDURWDJJLSHUVFRQJLXUDUHLO
ULVFKLRGLRVVLQD
6HYHVR4XDUDQW
DQQLGRSRODGLRVVLQD I D
DQFRUDSDXUD
,QL]LHUDQQRRJJLLFDURWDJJLLQSXQWLD
%DUODVVLQD0HGD6HYHVR&HVDQR0DGHUQR
%RYLVLR0DVFLDJRH'HVLR
$QFRUDXQDYROWDVDUjDQDOL]]DWRLOVRWWRVXROR
GHLFRPXQLSLFROSLWLGDOO
LQFLGHQWH
DPELHQWDOHGHOO
,FPHVDGL6HYHVRDYYHQXWRLO
OXJOLR
,YHOHQLJLDFFLRQRVRWWRWHUUD
0 D  V H  O H  U X V S H  G L 3HGHPRQWDQDGRYUDQQR
VFDYDUHSHUFRVWUXLUHODQXRYDDXWRVWUDGDLO
ULVFKLRqFKHOHSROYHULOHWDOLSRVVDQRGLQXRYR
HVVHUHGLVVHPLQDWHQHOO
DULD
8QLQFXERFKHLVLQGDFLLQWHVWD3DROR%XWWLGL
6HYHVRH*LJL3RQWLGL&HVDQR0DGHUQR
YRJOLRQRVFRQJLXUDUH*OLVWUXPHQWL
VFHQGHUDQQRILQRDXQDSURIRQGLWjGLGXH
PHWUL
/HDQDOLVLVDUDQQRFRQGRWWHGDLWHFQLFLGL
3HGHPRQWDQD
6DUDQQRSUHV HQWLDQF KH$USDH*LDQQL
'HOSHURJHRORJRHFRQVXOHQWHGLSDUWHGHL
FRPXQL)RUWLDQFKHOHSUHVVLRQLGHOOH
DVVRFLD]LRQLDPELHQWDOLVWHFKHPLQDFFLDQRGL
EORFFDUHLFDQWLHUL,ULVXOWDWLGHOOHDQDOLVL
VDUDQQRGHFLVLYLSRWUHEEHURPRGLILFDUHLO
WUDFFLDWRGL3HGHPRQWDQDRSSXUHQHLFDVLSL
HVWUHPLEORFFDUHODFRVWUX]LRQHGHOWUDWWR
EULDQ]RORJLjFRQWHVWDWRGDSLSDUWLHPHVVRDGXUDSURYDGDLFRVWLHVRUELWDQWLGHOODQXRYDDUWHULD
VWUDGDOH

5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

PDJJLR
3DJLQD

*LRUQDOHGL'HVLR
6WUDEDJ

'$/081,&,3,2,OVLQGDFRKDVFULWWRDLSURSULHWDULGHLWHUUHQLLQWHUHVVDWL

$0HGDXQDOHWWHUDVSLHJDO
LQWHURLWHU
0('$ DVO 8QDOHWWHUDILUPDWDGDOVLQGDFRGL
0HGD*LDQQL&DLPLSHUWUDQTXLOOL]]DUHL
FLWWDGLQLFRLQYROWLGDLFDURWDJJLLQL]LDWLRJJL
PDUWHGuSURSULRWUD6HYHVRH0HGD&RQO

DLXWRGHOO
DUFKLWHWWR3DROR0HQHJKHWWLLOSULPR
FLWWDGLQRKDLQIRUPDWRLQPRGRSUHFLVRL
PHGHVLLQPHULWRDOOHYDULHIDVLHDOOR
VYROJLPHQWRGHOOHDWWLYLWj,SURSULHWDUL
ULFHYHUDQQRGDOO
DSSDOWDWRUH6WUDEDJXQD
UDFFRPDQGDWDFKHDYYLVDVXOO
DYYLRGHLODYRUL
FRQSRVVLELOLWjGLSUHVHQWDUHOHSURSULH
RVVHUYD]LRQLQHLVXFFHVVLYLVHWWHJLRUQL/

$XWRVWUDGD3HGHPRQWDQD/RPEDUGDHPDQHUj
SRLXQSURYYHGLPHQWRD6WUDEDJVRWWRIRUPD
GLGHFUHWR$OPHQRVHWWHJLRUQLSULPDGHO
VRQGDJJLR6WUDEDJLQYLHUjDOSURSULHWDULROD
QRWLILFDGHOGHFUHWRFRQLQGLFDWDODGDWDGHO
VRQGDJJLRLQRPLGHLWHFQLFLDELOLWDWLD
HVHJXLUORHODSRVVLELOLWjGLHVVHUHSUHVHQWL
7XWWHOHRSHUD]LRQLGLVRQGDJJLRSURVHJXHLO
VLQGDFRVDUDQQRHVHJXLWHLQPRGRGD
LQFLGHUHLOPHQRSRVVLELOHVXOOHSURSULHWjGHL
VLQJROLFLWWDGLQL HYLWDQGRLOFDOSHVWLRGLSLDQWH
GLUDFFROWLHDOWUR HQHOSLHQRULVSHWWRGHOOD
QDWXUDGHLOXRJKL,OJLRUQRGHOVRQGDJJLRLO
SURSULHWDULRSRWUjDVVLVWHUHDLODYRUL
DYYDOHQGRVLGLXQDSHUVRQDGLVXDILGXFLDHO

DSSDOWDWRUHUHGLJHUjXQRVWDWRGL
FRQVLVWHQ]DSHUSUHQGHUHQRWDGHOO
HYHQWXDOHGDQQRDUUHFDWRDOOHSURSULHWj SHUHVHPSLR
FRPSURPLVVLRQLDOOHFROWXUHHVLVWHQWLQHOO
DUHDGLODYRUR FRQO
LQGLFD]LRQHGHLPHWULTXDGUDWLRJJHWWR
GHOO
HYHQWXDOHLQGHQQL]]R,RVWHVVRHLOSHUVRQDOHGHOO
DUHDLQIUDVWUXWWXUHHJHVWLRQHGHOWHUULWRULR
VDUHPRDGLVSRVL]LRQHSHUTXDOVLDVLFKLDULPHQWRFKHVLUHQGHVVHQHFHVVDULRFRQFOXGH&DLPL

/(77(5$),50$7$

5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

DSULOH
3DJLQD

,O&LWWDGLQR0% HG
9DO6HYHVR
6WUDEDJ

&DURWDJJLGL3HGHPRQWDQD)DFFLDDIDFFLD
%XWWL6WUDEDJ
,QL]LHUDQQRYHUVRPHWjPDJJLRLFDURWDJJLQHL
WHUUHQLFRQWDPLQDWLQHOGDGLRVVLQDHVX
FXLGRYUjSDVVDUHLOQDVWURG
DVIDOWRGL
3HGHPRQWDQD4XHVWRKDQQRGHWWRPHUFROHGu
SRPHULJJLRLWHFQLFLGL$XWRVWUDGD
3HGHPRQWDQDORPEDUGD $SO GHOOD
FRQFHVVLRQDULD6WUDEDJ H  G L  5 H J L R Q H  D O
VLQGDFRGL6HYHVR3DROR%XWWLGXUDQWHXQ
LQFRQWURFRQYRFDWRGRSRFKHODVFRUVD
VHWWLPDQDGDO0XQLFLSLRHUDSDUWLWDXQDOHWWHUD
GLSURWHVWDDO3UHIHWWR*LRYDQQD9LODVLSRLFKp
H U D Q R  V W D W L  D Y Y L V W D W L  W H F Q L F L  G L 6WUDEDJ
HIIHWWXDUHLQWHUUHQLSULYDWLDQDOLVLSUHOLPLQDULDL
FDURWDJJLHGHOLPLWDUHFRQSLFFKHWWLOHDUHH
LQWHUHVVDWHVHQ]DDYHUSUHYHQWLYDPHQWH
DYYLVDWRQpLO&RPXQHQpLSURSULHWDULGHL
WHUUHQL,WHFQLFLGL6WUDEDJKDQQRULEDGLWRFKH
JOLLQWHUYHQWLFKHKDQQRVYROWRQHOOHVFRUVH
VHWWLPDQHVRQRVWDWLSRFRLQYDVLYLHFKH
LQWHQGHYDQRVRORYHULILFDUHVHDOFXQHDUHHLQ
FXLVRQRSUHYLVWLLFDPSLRQDPHQWLULVXOWDQR
IDFLOPHQWHUDJJLXQJLELOLRPHQRVSLHJD%XWWL
&RVuSXUHLRKRULEDGLWRFKHJOLLPSHJQLSUHVL
DQGDYDQRLQXQDGLUH]LRQHGLYHUVDFKHq
TXHOODGHOODFRQGLYLVLRQHHGHOODWUDVSDUHQ]D
&KLDULWLTXHVWLHTXLYRFLFRQWLQXDDEELDPR
IDWWRLOSXQWRGHLSDVVLVXFFHVVLYLHLPLHL
LQWHUORFXWRULKDQQRDQQXQFLDWRFKHDPHWj
PDJJLRSRUWHUDQQROHWULYHOOHQHLWHUUHQLLQWHUHVVDWLGDLFDURWDJJL
1RQVHQ]DSHUzDJJLXQJHDYHUSULPDWUDVPHVVRLQ0XQLFLSLRO
HOHQFRGHOOHDUHHFRLQYROWHLQPRGR
GDSRWHUFLGDUHDQFKHO
RSSRUWXQLWjG
RUJDQL]]DUHSUHYHQWLYDPHQWHLQFRQWULLQIRUPDWLYLFRQLFLWWDGLQLVXL
FXLWHUUHQLLWHFQLFLGRYUDQQRSDVVDUHRHIIHWWXDUHYHULHSURSULFDURWDJJL,QROWUHPHQWUHTXHVWLXOWLPL
DYYHUUDQQRVHQ]DVROOHYD]LRQHGLSROYHUHHLQPRGRQRQLQYDVLYRSUHFLVDLOVLQGDFRSHUODVXFFHVVLYD
ERQLILFD$SO6WUDEDJH5HJLRQHPLKDQQRJLjGHWWRFKHOHQRUPHLPSRQJRQRFKHJOLDGGHWWLODYRULQRFRQ
WXWHELDQFKHPDVFKHULQHHWXWWHOHSUHFDX]LRQLGHOFDVR
(FFRSHUFKpQHJOLLQFRQWULSUHOLPLQDULLQWHQGLDPRSUHSDUDUHLOSLSRVVLELOHLFLWWDGLQLDQFKHSHUTXDQWR
ULJXDUGDO
LPSDWWRSVLFRORJLFRFKHTXHVWHRSHUD]LRQLSRWUDQQRDYHUH,QVRPPDLFDURWDJJLDYUHEEHUR
GRYXWRLQL]LDUHDJHQQDLRRUDJOLDWWRULFRLQYROWLOLKDQQRVSRVWDWLDPHWjPDJJLR2WWHQHUHGDWLUHODWLYL
DOWDVVRG
LQTXLQDPHQWRSUHVHQWHLQTXHOOHDUHHqFRPXQTXHXWLOHULIOHWWH%XWWL7HQXWRFRQWRFKHDG
RJJLODFHUWH]]DFKHODWUDWWD%YHQJDUHDOL]]DWDQRQF
q
1RQqGHWWRTXLQGLFKHGRSRFKHODPDFFKLQDSHUOHDQDOLVLQHLWHUUHQLVLqPHVVDLQPRWR$SOVLDQHOOD
FRQGL]LRQHVRSUDWWXWWRHFRQRPLFDSHUHIIHWWXDUHODERQLILFDHUHDOL]]DUHSRLO
RSHUD
5LSURGX]LRQHDXWRUL]]DWDOLFHQ]D$UV3URPRSUHVV

&RQWLQXD! 

Disastro diossina a Seveso, iniziato e subito rinviato il processo civile ...

1 of 4

http://www.ilcittadinomb.it/stories/Cronaca/disastro-diossina-a-seveso-...

11.01.2016 8:23

Disastro diossina a Seveso, iniziato e subito rinviato il processo civile ...

http://www.ilcittadinomb.it/stories/Cronaca/disastro-diossina-a-seveso-...

I cookie ci aiutano ad offrirti un servizio migliore.


Accedendo a questo sito, accetti il fatto che potremmo memorizzare e accedere ai cookie sul tuo
dispositivo.
Clicca qui per maggiori informazioni e per visionare Condizioni di servizio e informativa privacy

2 of 4

11.01.2016 8:23

Disastro diossina a Seveso, iniziato e subito rinviato il processo civile ...

http://www.ilcittadinomb.it/stories/Cronaca/disastro-diossina-a-seveso-...

I cookie ci aiutano ad offrirti un servizio migliore.


Accedendo a questo sito, accetti il fatto che potremmo memorizzare e accedere ai cookie sul tuo
dispositivo.
Clicca qui per maggiori informazioni e per visionare Condizioni di servizio e informativa privacy

3 of 4

11.01.2016 8:23

Disastro diossina a Seveso, iniziato e subito rinviato il processo civile ...

http://www.ilcittadinomb.it/stories/Cronaca/disastro-diossina-a-seveso-...

I cookie ci aiutano ad offrirti un servizio migliore.


Accedendo a questo sito, accetti il fatto che potremmo memorizzare e accedere ai cookie sul tuo
dispositivo.
Clicca qui per maggiori informazioni e per visionare Condizioni di servizio e informativa privacy

4 of 4

11.01.2016 8:23