Sei sulla pagina 1di 142

Archeologia e paesaggio

nellarea costiera veneta:


conoscenza, partecipazione e valorizzazione
Arheologija in krajina
M@NA@KMDLNALNIT5DMDS@
spoznati, podeliti in ovrednotiti

Archeologia e paesaggio nellarea costiera veneta:


conoscenza, partecipazione e valorizzazione
QGDNKNFHI@HMJQ@IHM@M@NA@KMDLNALNIT5DMDS@
spoznati, podeliti in ovrednotiti

/@QSMDQ@SST@SNQD(YC@I@SDKI O@QSMDQOQNIDJS@

Archeologia e paesaggio nellarea costiera veneta:


conoscenza, partecipazione e valorizzazione
$UKHRORJLMDLQNUDMLQDQDREDOQHPREPRMX9HQHWD
spoznati, podeliti in ovrednotiti
Prima Edizione novembre 2013
Tiratura n. 1000 copie
Coordinamento generale
2OKNMNTRJK@IDU@MID
Regione del Veneto
Segreteria Regionale per la Cultura
Clara Peranetti
Unit Complessa Progetti strategici e politiche comunitarie
Palazzo Sceriman - Cannaregio, 168 30121 Venezia
http://www.regione.veneto.it/web/cultura/ue-per-la-cultura
Segreteria di redazione
3@IMHSUNTQDCMHSU@
Sabrina Trov
"NNQCHM@LDMSNRBHDMSHBN
9M@MRSUDMNTRJK@IDU@MID
Sauro Gelichi (Universit Ca Foscari Venezia - Dipartimento Studi umanistici),
Paolo Mozzi (Universit degli Studi di Padova - Dipartimento di Geoscienze),
Fabrizio Panozzo (Universit Ca Foscari Venezia - Dipartimento di Management),
#NLDMHBN/@S@RRHMH ,@SDKC@1DGN4MHUDQRHS(T@UCH5DMDYH@ #HO@QSHLDMSNCH/QNFDSS@YHNMDDOH@MHB@YHNMDHM@LAHDMSHBNLOKDRRH
Testi
Besedila
Tiziano Abba, Moreno Baccichet, Silvia Cadamuro, Elisa Corr, Alessandro Fontana,
Sauro Gelichi, Davide Longhi, Cecilia Moine, Paolo Mozzi, Claudio Negrelli, Andrea Ninfo,
Fabrizio Panozzo, Domenico Patassini, Sandra Primon, Lara Sabbionesi
Il contenuto della presente pubblicazione non rispecchia necessariamente
KDONRHYHNMHTBH@KHCDKK4MHNMD$TQNOD@ +@QDRONMR@AHKHSCDKBNMSDMTSN
della presente pubblicazione appartiene agli autori dei testi.
5RDAHM@OTAKHJ@BHIDMHMTIMNNCQ@YTQ@CMHGRS@KH$UQNORJDTMHID 
Odgovornost za vsebino te publikacije prevzema avtor besedil.
3Q@CTYHNMD
Prevod
Studio Moretto Group - Italia
/QNFDSSNFQ@BNDHLO@FHM@YHNMD
&Q@MNNAKHJNU@MIDHMONRS@UHSDU
Biblos srl - Cittadella (PD)
1DEDQDMYDENSNFQ@BGD
Fotografski material
Regione del Veneto: pp. 8, 11, 12, 16, 17, 86, 136.
Regione del Veneto e Universit di Padova: pp. 18.
QBGHUHNCH2S@SNCH5DMDYH@FF    
(autorizzazione in corso di rilascio / dovoljenje za objavo v teku)
(RSHSTSN&DNFQ@BN,HKHS@QD(&,3@UNKDETNQHSDRSN
(autorizzazione in corso di rilascio / dovoljenje za objavo v teku)
Immagini realizzate ed elaborate nellambito delle convenzioni
SQ@1DFHNMDCDK5DMDSND4MHUDQRHSCH/@CNU@ #HO@QSHLDMSNCH&DNFQ@@ 
Universit Ca Foscari Venezia - Centro Interdipartimentale I.D.E.A.S.,
Universit IUAV di Venezia (DGR 2939 del 14/12/2010) e Universit
Ca Foscari Venezia - Dipartimento di Management (DGR 1612 dell11/10/2011).
%NSNFQ@IDHYCDK@MDUNJUHQTRONQ@YTLNULDC#DDKN5DMDSNHM4MHUDQYNU/@CNUH
.CCDKDJY@FDNFQ@IN 4MHUDQYN"@%NRB@QHU!DMDSJ@G LDCNCCDKM@RKTA@
I.D.E.A.S., Univerzo IUAV v Benetkah (DGR 2939 z dne 12/14/2010 ) in Univerzo
"@%NRB@QHU!DMDSJ@G .CCDKDJY@TOQ@UKI@MID#&1YCMD
Riproduzione vietata.
Reprodukcija prepovedana
2S@AHKHLDMSNSHONFQ@BN
3HONFQ@I@
Biblos srl - Cittadella (PD)
Ringraziamenti
Zahvale
2HQHMFQ@YH@MNK@#HQDYHNMD!DMH"TKSTQ@KH K@#HQDYHNMD/H@MHB@YHNMD3DQQHSNQH@KDD2SQ@SDFHB@ K@#HQDYHNMD4QA@MHRSHB@D/@DR@FFHN
K4MHSCH/QNFDSSN2HRSDL@(MENQL@SHUN3DQQHSNQH@KDD"@QSNFQ@@CDKK@1DFHNMDCDK5DMDSNDHK"NLTMDCH0T@QSNC KSHMN
Si ringraziano inoltre Enti e cittadini che hanno contribuito a vario titolo alla realizzazione di questa pubblicazione.
9@GU@KITIDLNRD#HQDYHNMD!DMH"TKSTQ@KH #HQDYHNMD/H@MHB@YHNMD3DQQHSNQH@KDD2SQ@SDFHB@ #HQDYHNMD4QA@MHRSHB@D/@DR@FFHN 4MHSCH/QNFDSSN
2HRSDL@(MENQL@SHUN3DQQHSNQH@KDD"@QSNFQ@@CDKK@1DFHNMDCDK5DMDSN NAHM@0T@QSNC KSHMN
/NKDFSDF@RDDKHLNY@GU@KHSHURDLTRS@MNU@LHMNA@MNL JHRNM@Q@YKHMDM@HMDOQHRODU@KHJQD@KHY@BHIHOTAKHJ@BHID
/TAAKHB@YHNMDM@MYH@S@MDKK@LAHSNCDK/QNFQ@LL@ODQK@"NNODQ@YHNMD3Q@MREQNMS@KHDQ@(S@KH@ 2KNUDMH@  
dal Fondo europeo di sviluppo regionale e dai fondi nazionali.
/QNIDJSRNM@MBHQ@MUNJUHQT/QNFQ@L@DYLDIMDF@RNCDKNU@MI@2KNUDMHI@ (S@KHI@ 
iz sredstev Evropskega sklada za regionalni razvoj in nacionalnih sredstev.
La presente pubblicazione reperibile in formato elettronico allindirizzo:
Publikacija je na voljo v elektronski obliki na naslednjem naslovu:
http://www.regione.veneto.it/web/cultura/ue-per-la-cultura e http://parsjad.regione.veneto.it/
2013 Regione del Veneto
ISBN 978-88-6448-057-2

Archeologia e paesaggio nellarea costiera veneta:


conoscenza, partecipazione e valorizzazione
QGDNKNFHI@HMJQ@IHM@M@NA@KMDLNALNIT5DMDS@
spoznati, podeliti in ovrednotiti

La Regione assume la programmazione come metodo dintervento per la


QD@KHYY@YHNMDCDKKDOQNOQHDM@KHS SQ@KDPT@KHQHDMSQ@K@U@KNQHYY@YHNMDCDK
patrimonio culturale regionale, quale leva per lo sviluppo sostenibile del terQHSNQHNMDHRTNHLNKSDOKHBHOQNKH@LAHDMS@KD BTKSTQ@KD DBNMNLHBN O@DR@FFHstico e urbanistico.

9@ CDDKMN TOQ@UN OQDCRS@UKI@ M@QSNU@MID DMDF@ NC M@HMNU TJQDO@MI@Y@QD@KHY@BHINK@RSMHGBHKIDU LDCJ@SDQDRDTUQ@STCHUQDCMNSDMID
CDDKMDJTKSTQMDCDCHHMDJNSUYUNCY@SQ@IMNRSMHQ@YUNINYDLKI@UURDG
RUNIHGNJNKIRJHG JTKSTQMHG FNRONC@QRJHG JQ@IHMRJHGHMTQA@MHRSHMHGONdobah.

Il Progetto Parco Archeologico dellAlto Adriatico PArSJAd, approvato


con il Programma per la cooperazione Transfrontaliera Italia-Slovenia 20072013, ha lobiettivo di valorizzare il patrimonio archeologico dellarea costiera dellAlto Adriatico, dal litorale emiliano a quello sloveno, in unottica uniS@QH@DSQ@MREQNMS@KHDQ@ HMCHUHCT@MCNMDKK@OH@MHB@YHNMDBTKSTQ@KDTMNRSQTmento di governo dellintervento pubblico a favore dellattrattivit e della
competitivit di tale territorio.

Cilj projekta Arheoloki park Severnega Jadrana PArSJAd, potrjeMDF@UNJUHQT/QNFQ@L@DYLDIMDF@RNCDKNU@MI@(S@KHI@ 2KNUDMHI@


 IDNUQDCMNSHSH@QGDNKNJNCDCHHMNNA@KMDF@NALNI@2DUDQMDF@
Jadrana od obal pokrajine Emilije do slovenskega Primorja z enotnim
HMDYLDIMHLOQHRSNONLSDQNOQDCDKHSHJTKSTQMNM@QSNU@MIDJNSNQNCID
upravljanja, nadzora in koordinacije javnih posegov z namenom razvoja
OQHUK@MNRSHHMJNMJTQDMMNRSHSDF@NYDLKI@ 

+@ CDMHYHNMD D KTRN CH RSQTLDMSH CH OH@MHB@YHNMD HMSDFQ@SH  @SSH @KKN
sviluppo del territorio a partire dalle potenzialit culturali archeologiche,
costituiscono un criterio fondamentale in unarea, quale quella costiera
adriatica interessata dal progetto, estremamente ricca di siti ed evidenze
archeologiche.

.OQDCDKHSDUHMTONQ@A@BDKNRSMDF@NQNCI@Y@M@QSNU@MID M@LDMIDMDF@NYDLDKIRJDLQ@YUNITYHYGNCHDLUMIDFNUDLJTKSTQMDLHM@QGDNKNJDLONSDMBH@KT OQDCRS@UKI@SDLDKIMNLDQHKNM@OQNIDJSMDLNALNIT


obal Severnega Jadrana, ki se ponaajo z izjemnim tevilom arheolokih
M@ICHHMCNJ@YNUHYOQDSDJKNRSH 

RRTLDMCNTM@UHRHNMDHMMNU@SHU@CDKKNDQS@@QBGDNKNFHB@OQDRDMSDMDKKDCHUDQRD@QDD LTKSHCHRBHOKHM@QDDLTKSHRDSSNQH@KD RHSDMS@SNCHCDMHQDTM@


metodologia atta ad avviare un processo organico connesso alla predisposiYHNMDCHRSQTLDMSH@RTOONQSNCDKK@OH@MHB@YHNMDCDKKD@LLHMHRSQ@YHNMHQDFHNM@KDDKNB@KHHMCHUHCT@MCNMDKKNDQS@@QBGDNKNFHB@OQDRDMSDRHSH LTRDH 
aree) una diversa centralit da cui partire nella predisposizione degli atti di
OH@MHB@YHNMDDCHFDRSHNMDCDHKTNFGH

9HMNU@SHUMHLOQHRSNONLCN@QGDNKNJDF@ONSDMBH@K@M@Q@YKHMHGUDCHRBHOKHM@QMHGHMUDRDJSNQRJHGONCQNIHGRLNONRJT@KHNOQDCDKHSHLDSNde dela, s katerimi bi lahko vpeljali organski proces priprave podpornih


NQNCHIOQHM@QSNU@MITCDK@CDDKMHGHMKNJ@KMHGTOQ@UNARSNIDNONMTCAN @QGDNKNJDF@ FQ@CHU@ M@ICH@  LTYDIH  @QGDNKNJN Y@MHLHU@ ONCQNI@RLNTQDCHKHUCQTF@DMUYNQDB JHOQDCRS@UKI@HYGNCHDY@OQHOQ@UN
M@QSNU@KMHGHMTOQ@UMHG@JSNUY@JQ@IDY@QGDNKNJHLONSDMBH@KNL

3@KH@SSHUHSCH@M@KHRHDCDMHYHNMDLDSNCNKNFHB@RNMNRS@SDRUHKTOO@SD 
su incarico della Regione, da un gruppo interdisciplinare composto dallUniversit di Padova - Dipartimento di Geoscienze, dallUniversit Ca Foscari
Venezia - Dipartimento di Studi Umanistici e Dipartimento di Management,
C@KK4MHUDQRHS(T@UCH5DMDYH@ #HO@QSHLDMSNCH/QNFDSS@YHNMDD/H@MHB@YHNMDHM@LAHSHBNLOKDRRHBNMK@BNKK@ANQ@YHNMDCDHCHUDQRHTBHQDFHNM@KHCDH
settori coinvolti.

9@CDI@UMNRSH@M@KHYDHMOQHOQ@UDLDSNCNKNFHIDCDK@ID#DDKM@TOQ@U@Y@CNKHK@LDCCHRBHOKHM@QMNRJTOHMNUMIDIRNRNCDKNU@KHRSQNJNUMI@JH
4MHUDQYDU/@CNUH .CCDKDJY@FDNKNJDYM@MNRSH 4MHUDQYD"@%NRB@QHU
!DMDSJ@G .CCDKDJGTL@MHRSHMHGHM.CCDKDJY@TOQ@UKI@MID 4MHUDQYD
(T@U .CCDKDJY@M@QSNU@MIDHMTQA@MHYDLUJNLOKDJRMDLNJNKIT SDQ
Q@YKHMHOQHRSNIMHNCCDKJH#DDKMDTOQ@UD 

"HRH@TFTQ@BGDPTDRSNK@UNQNONRR@BNMSQHATHQD@KK@CDMHYHNMDCHOQ@SHche gestionali supportate da un approccio interdisciplinare, adeguato a cogliere la complessit che una crescita intelligente e inclusiva, a partire dalla
cultura quale motore dello sviluppo locale, invita a fare.

4O@LN  C@ AN M@ SQTC OQHRODU@K J NAKHJNU@MIT OQ@JSHMHG LDSNC


upravljanja, podprtih z meddisciplinarnim pristopom, ki bo lahko dojel,
J@JNJNLOKDJRM@IDQ@YTLM@HMURDNARDF@IN@Q@RS JHHYG@I@HYJTKSTQD
kot pogonske sile razvoja lokalnih stvarnosti.

On. Marino Zorzato

@RS ,@QHMN9NQY@SN

Vice Presidente della Regione del Veneto


RRDRRNQD@K3DQQHSNQHN @KK@"TKSTQ@ @FKH @QH&DMDQ@KH

/NCOQDCRDCMHJ#DDKD5DMDSN
Odbornik za ozemlje, kulturo in splone zadeve

Sommario

1. Depotenziare il potenziale?
'DOODWXWHODGHOVLWRDOODWXWHODGHOSDHVDJJLR1XRYLDSSURFFLQHO
ULFRQRVFLPHQWRHQHOODQDOLVLGHOODULVRUVDDUFKHRORJLFDWHUULWRULDOH
2. Paesaggi antichi e potenziale archeologico

Kazalo



1. Depotencirati potencial?
2G]DLWHQDMGLDGRYDURYDQMDRNROMD1RYLSULVWRSL
NGRORDQMXLQDQDOL]LWHULWRULDOQHDUKHRORNHGHGLLQH



19

2. Starodavne pokrajine in arheoloki potencial

19

1. (

19

1. 4

19

2.+4/ / 
2.1 UPA di Pegolotte - Po 1
2.2 UPA di Adria - Po 2
2.3 UPA di San Basilio - Po 3
2.4 UPA di Porto Tolle - Po 4
2.5 UPA di Candiana - Ad 1
2.6 UPA di Ca Emo - Ad 2
2.7 UPA di Cavarzere - Ad 3
2.8 UPA del Tartaro - Ta

22
22
22
24
24
24
26
26
26

2 $ // 
2.1. EAP Pegolotte - Pad 1
2.2. EAP Adria - Pad 2
2.3. EAP Sv. Bazilij - Pad 3
2.4. EAP Porto Tolle - Pad 4
2.5. EAP Candiana - Ad 1
2.6. EAP Ca' Emo - Ad 2
2.7. EAP Cavarzere - Ad 3
2.8. EAP Tartaro - Ta

23
23
23
25
25
27
27
27
27

3. +4/ !3
3.1. UPA di Mestre - Br 1
3.2. UPA di Camponogara Br 2 e del Cornio - Cr
3.3. UPA di Arzergrande - Br 3
3.4. UPA del Brenton - Br 4
3.5. UPA di Dolo - Br 5
3.6. UPA di Delta Brenta - Br 6
3.7. UPA del Sile - Sl e del Dese - Zero - Ds
3.8. UPA di Meolo - Pv 1
3.9. UPA di Grassaga - Pv 2
3.10. UPA di Cittanova - Pv 3
3.11. UPA di Caposile - Pv 4
3.12. UPA di San Don - Pv 5
3.13. UPA del Piavon - Pv 6
3.14. UPA di Torre di Mosto - Lv 1
3.15. UPA di Caorle - Ca
3.16. UPA di Lison - Tl 1a e di Torresella - Tl 1b
3.17. UPA di Alvisopoli - Tl 2
3.18. UPA di Lugugnana - Tl 3
3.19. UPA di Concordia - Tl 4
3.20. UPA di Latisana - Tl 5

28
28
28
30
32
34
38
38
40
40
40
42
42
44
46
48
48
48
48
52
52

3 $ /!3
3.1. EAP Mestre - Br 1
3.2. EAP Camponogara Br 2 in Cornio Cr
3.3. EAP Arzergrande - Br 3
3.4. EAP Brenton - Br 4
3.5. EAP Dolo - Br 5
3.6. EAP Delta Brenta-Br 6
3.7. EAP Sile - SI in Dese - Zero - Ds
3.8. EAP Meolo - Pv 1
3.9. EAP Grassaga - Pv 2
3.10. EAP Cittanova - Pv 3
3.11. EAP Caposile Pv 4
3.12. EAP San Don - Pv 5
3.13. EAP Piavon - Pv 6
3.14. EAP Torre di Mosto - Lv 1
3.15. EAP Caorle - Ca
3.16. EAP Lison - Tl 1a in Torresella - Tl 1b
3.17. EAP Alvisopoli - Tl 2
3.18. EAP Lugugnana - Tl 3
3.19. EAP Concordia - Tl 4
3.20. EAP Latisana - Tl 5

27
27
29
31
33
35
39
39
41
41
41
43
43
45
51
51
51
51
53
53
53

4. +UPA Co 1 - Co 15

52

4 $ / Co 1 - Co 15

53

5. +4/ 
5.1. UPA di Adria
5.2. UPA di Jesolo
5.3. UPA di Altino
5.4. UPA di Concordia Sagittaria

56
56
56
58
58

5 $ /
5.1. EAP Adria
5.2. EAP Jesolo
5.3. EAP Altino
5.4. EAP Concordie Sagittarie

57
57
57
59
59

6. +
6.1. Jesolo
6.2. Il territorio di Adria
6.3. Adria: valutazione del potenziale archeologico urbano
6.4. San Basilio di Ariano Polesine
3UREOHPDWLFKHHGRSSRUWXQLWPDQDJHULDOL
SHUODYDORUL]]D]LRQHGHOSDWULPRQLRDUFKHRORJLFR
(

1 (
1.1. Il prodotto museale
2. 
3.(
4.+
5. 
6."
7. -
/ 2)
&RPXQLWGLSURJHWWRQHOODOWLQDWH
8QHVSHULHQ]DGLSLDQLFD]LRQHFXOWXUDOHDYDOHQ]DDUFKHRORJLFD

60
60
66
74
76


87
87
88
94
94
94
96
98
100



6 /
6.1. Jesolo
6.2. Ozemlje Adrie
6.3. Adria: ocena mestnega arheolokega potenciala
6.4. Sv. Bazilij v Arianu Polesine
3RVORYQHSUREOHPDWLNHLQSULORQRVWLSUL
YUHGQRWHQMXDUKHRORNHGHGLLQH
4

1. 
1.1 Muzejski produkt
2. ,
3. 1
4. /
5 #
6. 2
7. -
/ 2)
3URMHNWQDVNXSQRVWDOWLQDW
,]NXQMDNXOWXUQHJDQDUWRYDQMD]DUKHRORNLPSRPHQRP

59
59
67
73
75


87
87
89
95
95
95
97
99
99



1. /
2. 4
3. "  
3.1. Charrette
3.2. Portfolio di comunit: oltre la cultura dellordinario
4. 2

103
103
106
106
112
116

1. /
2. $
3. 2  
3.1 Charrette
3.2 Mapa skupnosti: ez meje kulture obiajnega
4. 2

103
103
107
107
111
113

5. (

5.1 Cinque mosse
5.2 Condizioni e risorse di contesto
5.3 Rischi
5.4 Connessioni
5.5 Parco agro-naturalistico

120
120
120
124
124
126

5. /

5.1 Pet potez
5.2 Pogoji in viri v kontekstu
5.3 Tveganja
5.4 Povezave
5.5 Kmetijsko-naravoslovni park

117
117
117
117
119
119

6. /
6.1. Valori e grammatiche
6.2. Nuovo museo come pivot
6.3. Accesso
6.4. Osservazione e monitoraggio
6.5 Conclusioni

128
128
128
128
128
130

6. 
6.1 Vrednote in gramatika
6.2 Novi muzej kot pivot
6.3 Dostop
6.4 Opazovanje in spremljanje
 9@JKITJH

128
128
128
131
131


%LEOLRJUDD



%LEOLRJUDMD



11

1
Depotenziare il potenziale?
'DOODWXWHODGHOVLWRDOODWXWHODGHOSDHVDJJLR
1XRYLDSSURFFLQHOULFRQRVFLPHQWRHQHOODQDOLVL
della risorsa archeologica territoriale
Sauro Gelichi

Come noto, la nostra normativa nel settore dei beni archeologici


prevede una tutela di carattere puntiforme ed essenzialmente basata
sul principio patrimoniale. Ci che i
codici dellantica legge 1089, tranRHS@SHRDMY@PT@RHLNCHB@MDK3DRSN
Unico dei Beni Culturali (CAMMELLI
2000), prevedono lindividuazione
di un bene, sul quale poi si agisce attraverso tutta una serie di strumenti
di natura vincolistica (ibid, pp. 4229). Eccetto i beni di propriet di enti
pubblici, gli altri vengono sottoposti
@C TM@ MNQL@SHU@ RODBHB@ RNKN RD
linteresse, dal punto di vista archeologico, viene esplicitamente dichiarato: il privato diventa in parte anche
pubblico, dunque, ma nel momento
in cui lo si riconosce.
Il riconoscimento di un valore pubblico del bene archeologico
fa parte di un percorso di carattere
culturale che stato tracciato per
mettere in opportuna evidenza tutS@ K@ RT@ RODBHBHS ADMD OTAAKHBN
come bene comune (SETTIS 2013).
Si tratta, peraltro, di un principio che
condividiamo pienamente e che non
va negoziato, anche se non in tutti i
Paesi la legislazione prevede un tale
trattamento per i beni archeologici.
KSQNUDGNCDMHSNK@MNRSQ@KDFFDCHSTSDK@@DSS@C@TMRHMSNLNBGD
ONSQDLLNBGH@L@QDCHBNLOQDMRHNne tardiva o, con Sciascia (1975 p.
 CHTM@RODBHDCHOQDBNBHSQHS@Qdata al possibile, cio della capacit
di riconoscere solo a posteriori linteresse di un bene (GELICHI 2011,
p. 57). Per quanto vi siano autorevoli
sostenitori della bont di questa legFDTM@FQ@MCDKDFFDCHSTSDK@CA
RANDINI 2012, p. 111), alcuni princi[

OHBGDPT@KHB@MNHADMH@QBGDNKNFHBH
in quella sede, e dai quali discendono norme giuridiche e strumenti operativi, risultano decisamente
ETNQH RHMBQNMN QHRODSSN @K BNMBDSSN
di bene archeologico che la comuniSRBHDMSHB@G@DK@ANQ@SNMDFKHTKSHLH PT@Q@MS@MMH  0TDRSN MTNUN BNMcetto ha fatto s che venga riconosciuta, sempre di pi, la necessit di
operare in prevenzione piuttosto che
in reazione (SCHNAPP 1984). Non
un caso, allora, che la Direzione Generale per le Antichit abbia promulgato una circolare sullarcheologia
preventiva che va in questa direzione, costituendo un passo in avanti
sul piano sia legislativo che proceduQ@KDD MDKKNRSDRRNSDLON @AAH@BNR
esplicitato la necessit di unazione
preventiva sul bene (Circolare n. 10
del Ministero dei Beni Culturali, Direzione Generale per le Antichit, del
15 giugno 2012).
Anche il rapporto bene archeologico - paesaggio e ambiente stato
da tempo riconosciuto, almeno da
quando con la legge Galasso (n. 431
del 8 agosto 1985) si sono cominciati a rubricare anche i beni archeologici allinterno di quei Piani Paesistici che le Regioni sono tenute a redigere. Le prime azioni, tuttavia, hanno
comportato solo la meccanica introduzione dei beni vincolati allinterno
di questo nuovo strumento di pianiB@YHNMDTQA@MHRSHB@ RDMY@BGDPTDsti stessi beni cambiassero in qualche modo di statuto o la loro presenza introducesse un ripensamento sul
KNQNRHFMHB@SNHMTMMTNUNRO@YHNCH
tutela. Tale rapporto rischia allora di
declinarsi nella formulazione banale
della mera sommatoria (il paesaggio

1
Depotencirati potencial?
2G]DLWHQDMGLDGRYDURYDQMDRNROMD
1RYLSULVWRSLNGRORDQMXLQDQDOL]LWHULWRULDOQH
DUKHRORNHGHGLLQH
Sauro Gelichi

Kot je znano, italijanski predpisi


M@ ONCQNIT @QGDNKNJD CDCHHMD
OQDCUHCDU@IN MDJ@JMN SNJNUMN
porazdeljeno varstvo, ki dejansko
RKNMH M@ M@DKHG OQDLNDMIRJHG Q@YLDQHI  #NKNAD RS@QHMRJDF@ Y@JNM@
iz leta 1089, ki so skoraj brez sprememb prele v Enotno besedilo zaUNC@ Y@ U@QRSUN JTKSTQMD CDCHHMD
(CAMMELLI 2000), predvidevajo formalno opredelitev arheoloke dobrine, s katero se nato upravlja s pomoINUQRSDTJQDONUNLDIHSUDMDM@Q@UD
(ibidem, str. 42-29). Z izjemo dobrin
v lasti javnih ustanov so vse ostale
OQDCLDSRODBHMHGOQDCOHRNUR@LN
v primeru, da se izrecno opredelijo
JNS Y@MHLHUD Y @QGDNKNJDF@ UHCHJ@
zasebno postane torej do neke mere
I@UMN @KD DRDNBDMHJNSCNAQHM@Y
arheolokim pomenom.
Priznanje javne vrednosti doloDMD@QGDNKNJDCNAQHMDIDCDKJTKSTQMDF@OQNBDR@ Y@QS@MDF@YM@LDnom, ustrezno prikazati vse posebMNRSH SD CNAQHMD I@UMN ID HRSN@RMN
tudi skupno (SETTIS 2013). V resnici
FQD Y@ M@DKN  R J@SDQHL RD U BDKNSH
strinjamo in o katerem se ne smemo
ONF@I@SH  DOQ@U S@JD NAQ@UM@UD @QGDNKNJHG CNAQHM U LMNFHG CQ@U@G
zakonodaja ne predvideva.
Nekje drugje sem o naem zakonu o spomenikem varstvu dejal, da
boleha za simptomom, ki bi ga lahko
NYM@HKHJNSON@RMNCNIDL@MID@KH 
kot to opredeli Sciascia (1975 p. 22),
JNSMDJ@JMNOQDC@RMNCNIDL@MID
RJ@QM@IUDINLNMNY@LTCN SNQDI
RONRNAMNRS  C@ UQDCMNRS CNKNDMDga dela prepoznamo ele, ko je za
SN D OQDONYMN GELICHI 2011, str.
  DOQ@U RN OQHUQDMBH TRSQDYMNRSH SDF@ Y@JNM@ ONLDLADM Y@JNM

o spomenikem varstvu: CARANDI


NI 2012, str. 111) vredni vsega spoSNU@MI@  O@ MDJ@SDQ@ M@DK@  JH IHG
Y@JNM NCQDI@ Y@ CNKN@MID @QGDNKNkih dobrin in ki za seboj potegnejo zakonske predpise in operativne
prijeme, nedvomno niso usklajena s
pojmom arheoloke dobrine, ki so ga
strokovni krogi razvili v zadnjih tirih
desetletjih. Ta novi pojem je privedel
CN UDCMN UDIDF@ Y@UDC@MI@ N ONtrebi po preventivi namesto reakcije
(SCHNAPP   -H SNQDI M@JKITID 
da je Glavna uprava za arheoloke
CNAQHMD HYC@K@ NJQNMHBN N OQDUDMtivni arheologiji, ki podpira to tezo,
in postavila nove mejnike na zakoMNC@IMDL HM ONRSNOJNUMDL MHUNIT
HRSN@RMN O@ ID M@ S@ M@HM HYQ@YHK@
tudi potrebo po preventivni obravM@UH @QGDNKNJHG CNAQHM .JQNMHB@
t. 10 Ministrstva za kulturne dobrine, Generalna uprava za starine, 15.
junij 2012).
Tudi odnos med arheoloko dobrino ter pokrajino in okoljem okoli
MIDRDOQHYM@U@DOQDBDICNKFN UR@I
od tedaj, ko so se z zakonom Galasso
S YCMD@UFTRS@Y@DKD
popisovati tudi arheoloke dobrine
U NJUHQT SHRSHG JQ@IHMRJHG M@QSNU  Y@
J@SDQHGHYCDK@UNRNY@CNKDMDCDDKne uprave. Vendar so prvi ukrepi na
SDLONCQNITOQDCUHCDU@KHR@LNLDG@MRJNUJKITHSDUY@HSDMHGCNAQHMU
MNUN NQNCID TQA@MHRSHMDF@ M@QSNvanja, ne da bi se zaradi njih kakorkoli spremenil statut ali bi prilo do miselnega premika o njihovem vrednotenju v tem novem kontekstu varstva
JTKSTQMDCDCHHMD 9@Q@CHSNUQRSMDF@
odnosa torej tvegamo, da bodo spremembe izzvenele v banalno formulo
setevanja (pokrajina je vrsta ohija,

13

una sorta di contenitore che racchiude tutta una numerosa e variegata congerie di beni di pari valore
che vanno salvaguardati).
Lazione di tutela, dunque, pur
con apprezzabili correttivi, torna ad
essere essenzialmente applicata al
manufatto o, al massimo, a quellinsieme di manufatti che compongono
un contesto insediativo, altrimenti
CDMHSNRHSN ,@PT@MSNHBNMMHCDK
sito siano labili ed imprecisi (naturalmente imprecisi?) lo dimostra anche
il dibattito che, per qualche anno, ha
coinvolto molti archeologi che lavoravano sul territorio. Nelle pratiche
CDKKD QHBNFMHYHNMH CH RTODQBHD HK QHconoscimento tra ci che si pu deMHQD  @OOTMSN  RHSN site) e cosa no
(R VLWH) (FOLEY 981), implica non
RNKN TM@ RODBHB@ DK@ANQ@YHNMD CDK
concetto di visibilit per correggerMD RDONRRHAHKD FKHDDSSHTERRENA
TO   L@ Q@SHB@ TM@ NFFDSSHU@
CHBNKS @MBGD NKSQD K@ QHBNFMHYHNne) ad assegnare statuti insediativi
CHDQDMYH@SH@KKDENQLDCHNBBTO@YHNMDSDQQHSNQH@KDBHNBNLONQS@K@CDcisione di attribuire categorie nette
DRNOQ@SSTSSNBNMMHOQDBHRH@PT@Kcosa che spesso in quelle categorie
non si riconosce del tutto e i cui conMH@OO@HNMNCDBHR@LDMSDRSQDSSH 

14

Tutta questa discussione potrebAD@OO@QHQDOTQ@LDMSD@BB@CDLHB@


(nel senso, in genere deteriore, che
si assegna al termine), soprattutto se
lassociassimo alla necessit di applicare comportamenti, di carattere
vincolistico, che le strutture di tutela
sono tenute a perseguire. Comportamenti che, al contrario, tendono
@ CDMHQD D CDKHLHS@QD  HLONMDMCN
una decisione netta e sicura (che
pu solo sfociare nellindividuazioMD @KL@RRHLN CHTM@RNQS@CHBNQdone sanitario sfocato intorno al
bene da tutelare, la c.d. area di rispetto), nella consapevolezza che il
bene resta qualcosa di ben visibile
e riconoscibile nelle sue forme materiali e architettoniche e nella sua
estensione spaziale. Tutto ci che
quelle forme non riproduce, perch
non le riproduce pi, o perch non
le ha mai riprodotte, resta indiscutibilmente al di fuori della sfera del
vincolo, e dunque di una possibilit
oggettiva di essere in qualche modo
tutelato.
I concetti di VLWHRVLWH, riandan-

do ad una sorta di improbabile realt


binaria, producono comunque uninUNKNMS@QH@QHDRRHNMDRTKK@M@STQ@CDK
record archeologico e, soprattutto,
sul senso che noi dobbiamo attribuirgli quando parliamo, in relazione ad
esso, di tutela. Alla luce di tutto queRSN MSQNOONDUHCDMSDBGDKDB@tegorie culturali che stanno alla base
del concetto di bene archeologico,
e che erano in perfetta sintonia con
le leggi di tutela della prima met
del secolo scorso, appaiano oggi in
CDBHRN@@MMN  AAH@LNCHBNKS@
credere, infatti, che ancora si possa
immaginare una tutela strettamente
@OOKHB@S@ @KKNFFDSSN N @K RHSN BGD
non vi si riconosca, in essa, quello
smaccato collegamento che unisce,
HM TM KTMFGHRRHLN KN QNRRN  H O@Q@digmi che hanno improntato la 1089
@HCDSS@LHCHTM@MSHPT@QH@FKH@@RT@
UNKS@RDLOKHBN NUUHNCDKBNKKDYHNnismo. E, dunque, non ci si possa sentire, almeno un po, a disagio di fronte ad un accostamento che ci porta
molto lontano dallattuale modo di
intendere la nostra disciplina.
Nella pratica, infatti, gli archeologi percorrono unaltra strada.
Aderendo in maniera oramai generalizzata alle severe leggi della straSHFQ@@  @MBGD H OH QHNSSNRH CH E@SSN
praticano, o tentano di praticare, le
ATNMD QDFNKD  0TDRSD ATNMD QDFNle impongono di concettizzare, e poi
tradurre in qualcosa che riproducibile, quei sistemi di relazioni che
BNLONMFNMN TM@ RSQ@SHFQ@@ @QBGDologica: individuando un prima e un
dopo (la temporalit delle azioni) e
riconoscendo funzioni (il loro signiB@SNSQ@CTBDMCNCHE@SSNBHBGD
inanimato (la materialit fossile di un
deposito archeologico) in qualcosa
che si muove lungo la scala del tempo (il processo). Oggi si soliti dire
BGDHKSDQQDMNBDK@RSNQHDDK@QBGDologo deve essere in grado di raccontarle (e, aggiungo, di raccontarle
bene). Se questo divenuto (certo
in forme estremamente articolate e
complesse ai pi alti livelli) il lavoro
dellarcheologo (comunque dellarcheologo che opera alla fonte, dunque di quello che ha la responsabilit prima dellindividuazione e della
trascrizione delle parti che compongono il racconto), viene da chiedersi
a che cosa debba applicarsi la tutela e come, questa tutela, possa dirsi
DB@BD D  RH ONSQDAAD @FFHTMFDQD 

utile per la collettivit). Dunque il


problema passato dallapplicare
ENQLDCHBNMSQNKKN@ADMHRHB@LDMte individuabili (i depositi archeologici) per conservare pi a lungo una
parte di ci che li componeva (i muri,
FKH NFFDSSH  @ ADMH  RDLOQD RHB@mente individuabili (i depositi) ma
ODQ SQ@CTQQD HK RHFMHB@SN CDK KNQN
contenuto in qualcosa che non pi
conservabile ma sia riproducibile. Si
comprende, dunque, come lazione
su quel bene preveda lutilizzo e la
declinazione del concetto di conservazione gi al momento della consapevolezza dellesistenza stessa di
quel bene.
Ma come conservare e cosa conservare? Si pu agire su un deposito
archeologico solo in due forme. Non
toccandolo oppure intervenendo
su di esso. Non toccandolo, ovvio,
il bene, in tutte le sue potenzialit
euristiche, rimane inalterato oppure
viene sottoposto a processi naturali
di degrado (che sono inevitabili). In
questa maniera, conoscendone lesistenza ma non indagandolo, la comunit si assume la responsabilit di
mantenere in vita un bene che posRH@LNCDMHQDHMONSDMY@ +@KSQ@NOzione quella di intervenire sul quel
bene. In questo caso, la comunit si
assume la responsabilit di rimuovere quel sistema di relazioni che componeva il bene stesso (e che permette di indagarne e comprenderne
HKRHFMHB@SNODQONHSQ@CTQKNHMCTD
tipologie di memorie a loro volta
BNMRDQU@AHKH H L@MTE@SSH BNLOQDRH
@MBGD FKH DBNE@SSH BGD BNRSHSTHRBNno il precipitato di quel bene (quelle
che si potrebbero metaforicamente
CDMHQD RBNQHD D HK Q@BBNMSN  BHN
tutto quello a cui siamo stati in grado di dare un senso e che abbiamo
poi trasferito in sistemi di comunicazione riproducibili. Dunque, una
volta rimosso, il deposito archeologico pone altri tipi di problemi legati alla conservazione. Si tratta di
conseguenze decisamente rilevanti
per la collettivit. Negli ultimi anni
la necessit di conservare (anche
nel senso attivo del termine, quello
cio non solo di evitare la dispersione e la corruzione, ma anche di
rendere utili quei beni per la societ) ha posto problemi molto seri. La
FDRSHNMDCDKKDRBNQHD HME@SSH MNM
@@SSNRDLOKHBDHLONMDKTNFGH@CD-

guati, metodi di conservazione idonei, dunque investimenti e risorse


che sono apparsi immediatamente
fuori scala rispetto alle peraltro maFQD M@MYD BGD HK &NUDQMN CDRSHM@
ai Beni Culturali (una litania, questa,
che nella banalit della ripetizione
rischia di depotenziare il senso pi
politicamente censurabile delle politiche di questo Paese, direi da sempre). Ma qui il problema , soprattutto, quello di riconoscere e gestire lo
scarto, come acutamente ha messo
in evidenza da tempo Andreina Ricci (1996). Lo scarto, infatti, si rende
necessario nel momento in cui si
@LOKHB@MN FHTRS@LDMSD KDB@SDFNrie di beni archeologici, sia in senso
tipologico-qualitativo che cronologico. La nostra collettivit incapace
CHE@QEQNMSD@HL@KHCDKK@AANMC@Mza non solo per un cronico ritardo
culturale, ma anche perch il peso
di questi beni oggettivamente insostenibile. Inoltre, in una sorta di
paradosso, lo scarto non si pu eliminare (GELICHI 2008, pp. 7-8), anzi
 TMNOYHNMD RNBH@KLDMSD R@KTS@QD
si pu, al massimo, colpevolmente
eludere. Ma, cos facendo, i problemi
rimarranno, come sono, irrisolti.
Poich quelli che abbiamo di
fronte sono beni sia materiali (ci
che rimane di un deposito, che pu
vivere anche di vita propria perch
magari contiene in s valori che la
comunit gli riconosce indipendentemente dal fatto di essere appartenuto ad un sistema) sia immateriali
(quello che si ottiene nel passaggio
C@Monumentality versus Research,
seguendo CARVER 2003, pp. 40-41),
la collettivit dovrebbe considerare
di agire su di essi in forma coordinata: prevenzione e valorizzazione,
dunque, sono due momenti di unazione che dovremmo cominciare a
riconsiderare come unitaria. La divisione di competenze tra Ministero e
Regioni in materia di Beni Culturali,
con un decentramento che ha delegato di fatto ai Governi locali il ruolo
di promotori e organizzatori (non da
soli, ovvio) del proprio patrimonio,
MNMG@@KBTM@FHTRSHB@S@Q@FHNMDCH
natura culturale. Tende invece a riprodurre, vecchio vizio nostrano, una
logica meramente spartitoria. Tuttavia non ci interessa, in questa circostanza, ricompattare competenze per
QHOQHRSHM@QD TM UDBBGHN LNMNONKHN
ci interessa, invece, mettere in evi

v katerem so se znali tevilni in raznoliki enakovredni kosi arheolokih


M@ICA JHIHGIDSQDA@Y@HSHSH 
Spomeniko varstvo se je torej,
DSTCH Y TONSDU@MI@ UQDCMHLH ONpravki, vrnilo na stopnjo, na kateri
RDUAHRSUTY@HSHONR@LHMH@QSDE@JS
ali v najboljem primeru skupek artefaktov, ki sestavljajo naselbinski
kontekst, imenovan tudi arheoloJN M@ICHD   J@JN NGK@OMD HM MDM@S@MMD M@Q@UMN MDM@S@MMD RN
SDLDID I@RMNJ@DSTCHONKDLHJ@ U
katero so se nekaj let dolgo zapleS@KH SDUHKMH @QGDNKNFH  Y@CNKDMH Y@
delo na terenu. V delovni praksi doKN@MID SDF@  J@Q AH K@GJN CDMHQ@KH
JNS  JNS D QDDMN  M@ICHD site) in
SHRSDF@  JH RH SDF@ M@YHU@ MD Y@RKTH
(RVLWH) (FOLEY MDUJKITTID
R@LNRODBHMDHYCDK@UDONIL@Q@YUHCMNRSHYM@LDMNL ONOQ@UHSHDID
SN LNFND MIDM UOKHU TERRENATO
  SDLUD NCOQ@UH STCH NAIDJSHUMN SD@UN J@SDQD CNLDS FQD DY
LDIN HYJKITMDF@ OQDONYM@U@MI@ M@
terenu), da bi zasedbenim oblikam
NYDLKI@ OQHOHR@KH Q@YKHMD M@RDKAHMRJD RS@STRD OQDCUHCDU@ SNQDI NCKNHSDUNCNKN@MITI@RMNNOQDCDKIDMHG
J@SDFNQHIOQDCURDLO@I@RMNY@QS@MHGLDI@MDDLT J@QRDONFNRSNMD
istoveti s tako razmejenimi kategoriI@LHHMDR@QLDIDRNOQDBDINIDNC
predvidenih.
/NKDLHJ@ RD K@GJN YCH HYJKITMN
akademske narave (v slabalnem
ONLDMTSDF@HYQ@Y@ DYK@RSH DIN
YCQTHLN R ONSQDAN ON NLDIHSUDnih ukrepih, ki jih morajo dosledno
upotevati ustanove za varstvo kulSTQMDCDCHHMD 3NUQRSMNNAM@@MID
O@  M@ROQNSMN  SDH J CNKN@MIT HM
omejevanju in obvezuje k jasnim in
U@QMHL NCKNHSU@L J@Q K@GJN U M@Iboljem primeru pripelje do prepoznavanja nekaknega zabrisanega
U@QMNRSMDF@ O@RT NJNKH CNAQHMD 
JHINM@LDQ@U@LNY@HSHSH S@JNHLDMNU@MDF@ NATSKIHUDF@ NALNI@ Y
zavedanjem, da je dobrina nekaj jasno razvidnega in prepoznavnega
po svoji materialni in arhitektonski
NAKHJHSDQONONKN@IT JHF@Y@UYDL@
v prostoru. Vse tisto, kar teh izraznih
oblik ne poustvarja, jih ne poustvarI@UD@KHIHGMHJNKHMHONTRSU@QI@KN O@
MDHYOQNRMNNRS@I@HYUDMNALNI@Y@konskih omejitev in torej brez objekSHUMDLNMNRSH C@AHF@AHKNLNFND
J@JNQJNKHY@HSHSH 


Pojma VLWHRVLWH sobivata v nekakni neizvedljivi binarni realnosti,


a vendarle vodita do nehotenega
razmiljanja o naravi arheolokega
bogastva ter zlasti o tem, na kaken
M@HMLNQ@LNNRLHRKHSHSNUQRSMNANgastvo, kadar je v povezavi z njim
FNUNQ@ N MIDFNUH Y@HSH  &KDCD M@
povedano je seveda jasno, da kulturne kategorije, na katerih temelji pojem arheolokih dobrin in ki
so bile povsem usklajene z zakoni
o njihovem varovanju iz prve polovice preteklega stoletja, danes doADRDCMN GK@RS@IN Y@ YQ@JNL  3DJN
M@LQDUDQI@LDLN C@K@GJNC@MDR
JCNDLDMH C@IDONSQDAMNY@HSHSHDMR@LOQDCLDS@KHM@ICHDC@
v njem ne prepozna tiste okrnjene
ONUDY@UD  JH RD JNS CNKF@ QCD@ MHS
UKDDLDCO@Q@CHFL@LH JHRNY@JNM
iz leta 1089 oblikovale po pravilih
starinskega potomca (seveda poenostavljam) ljubiteljskega zbirateljstva. Torej nam mora biti vsaj malo
MDOQHIDSMNNASNUQRSMHYCQTAH JHM@R
ONODKIDYDKNC@KDNCRDC@MIDF@M@HM@CNIDL@MI@M@DF@ONJKHB@ 
V praksi pa arheologi ubirajo druF@MD ONSH  5DHM@ MIHG ID U BDKNSH
ROQDIDK@ RSQNF@ OQ@UHK@ RSQ@SHFQ@ID 
HM D M@IUDIH TONQMHJH LDC MIHLH U
resnici uporabljajo ali vsaj poskuaIN TONQ@AHSH OQ@UHK@ CNAQD OQ@JRD 
V skladu s temi pravili dobre prakse
je potrebno za sisteme razmerij, ki
NAKHJTIDIN @QGDNKNJN RSQ@SHFQ@IN 
najprej izdelati koncepte, nato pa
le-te prevesti v nekaj, kar je mogoD ONTRSU@QHSH CNKNHSH ID SQDA@ Q@YLDQIDLDCOQDIHMONSDL@RNUna umestitev dejanj) in prepoznati
M@Q@UNR@LHGCDI@MIMIHGNUONLDM
CDI@MRJN FQD Y@ SNKL@DMID MDHUD
narave predmetov (snovnost fosila
M@ @QGDNKNJDL M@ICHT U MDJ@I 
J@QRDONLHJ@ON@RNUMHBHOQNBDR 
Danes pogosto pravimo, da zemlja v
RDAHRJQHU@YFNCAD JHIHGLNQ@@Qheolog pripovedovati (k temu bi dodal e: kakovostno pripovedovati).
D ID SN RDUDC@ M@ HYIDLMN Q@YKDMIDM HM JNLOKDJRDM M@HM M@ UHRNJH
stopnji) postalo delo arheologa (vsaj
arheologa, ki dela na samem viru arheolokih podatkov, torej tistega, ki
je odgovoren za to, da najprej poHD  M@SN O@ OQDOHD CDKJD  JH RDstavljajo pripoved), se nam porodi
UOQ@@MID LTIDSNQDIM@LDMIDMN
U@QRSUN HM JC@I K@GJN ROKNG QDDLN 
C@IDS@JMNU@QRSUNTHMJNUHSNCN-

damo pa lahko tudi, kdaj je takno


varstvo koristno skupnosti). Problem
RDIDSNQDIHYHYJKITMDTONQ@ADNAKHJ
nadzora nad dobrinami, ki jih je bilo
LNFND YHMN CNKNHSH @QGDNKNJD
M@ICAHMD HM ONRJTRNU HLANKI CNKgotrajnega ohranjanja njihovih sestavnih delov (zidovi, predmeti) preselil na dobrine, ki jih sicer e vedno
YHMN CNKNHLN M@ICAHMD  UDMC@Q
zato, da prevedemo pomen njihove vsebine v nekaj, kar ni namenjeno
YFNKIJNMYDQUHQ@MIT SDLUDONMNUMH
upodobitvi. Zlahka torej razumemo,
da je za rokovanje s taknim predLDSNL ONSQDAM@ TONQ@A@ HM HRSN@sni zaton koncepta o konzerviranju
D U SQDMTSJT Y@UDC@MI@ N NARSNIT
predmeta.
Toda kako in kaj ohraniti? Z arheNKNJHLM@ICHDLK@GJNTOQ@UKI@LN
R@LNM@CU@M@HM@@KHRDF@ROKNG
MD CNS@JMDLN @KH O@ U@MI ONRDDLN DANLNM@ICHDOTRSHKHMDCNtaknjeno, bo dobrina, z vsem svojim
GDUQHRSHMHLONSDMBH@KNL NRS@K@MDspremenjena ali pa bo zaradi naravnega (in neogibnega) poteka stvari
ONRSNONL@ OQNO@CK@  -@ S@ M@HM 
SNQDI D ID RDYM@MIDM@ Y NARSNIDL
CNAQHMD  @ ID MD OQDTH  RJTOMNRS
OQDUY@LDNCFNUNQMNRSY@UYCQDU@MID CNAQHMD  JH IN K@GJN CDMHQ@LN
JNS iMDHYHUDSNy  #QTF@ LNMNRS
predvideva poseg na dobrini. V tem
primeru skupnost prevzame odgovornost za dejansko odstranitev sistema odnosov, ki je tvoril dobrino
HM JH NLNFN@ ONCQNAMDIN NAQ@Unavo in razumevanje pomena), ki ga
nato prevede v dve vrsti spominov,
JHITIDRODSLNFNDiJNMYDQUHQ@SHy
@QSDE@JSH UJKITMN Y iDJNE@JSHy  JH
predstavljajo oborino dobrine (torej
tisto, kar bi se lahko v prenesenem
ONLDMT NYM@HKN JNS iNRS@MJDy HM
iOQHONUDCy  SNQDI URD SHRSN  DLTQ
smo lahko vrnili smisel in kar smo
lahko prenesli v komunikacijske sisSDLD JHNLNFN@INMIDMNQDOQNCTJcijo. Tak arheoloki depozit po tem,
ko ga odstranimo, torej odpre vrsto
CQTF@MHG OQNAKDL@SHJ NGQ@MI@MI@ 
Gre za izjemno pomembne posledice za skupnost. V zadnjih letih je
zaradi potrebe po ohranjevanju (tudi
v aktivnem pomenu besede, torej ne
R@LN U RLHRKT OQDOQDDU@MI@  C@ AH
se arheoloke dobrine porazgubile
HM OQNO@CKD  SDLUD STCH U RLHRKT
prizadevanj, da bi postale uporab-

ne za skupnost) prilo do precej reRMHG SD@U  4OQ@UKI@MID Y iNRS@MJHy


M@LQDMHJ@JNQMHDMNRS@UMN R@IRN
za njihovo hrambo potrebne ustreYMD KNJ@BHID  OQHLDQMH M@HMH JNMzerviranja, torej investicije in viri, ki
so se takoj izkazali za prekomerne v
primerjavi z borno mero sredstev, ki
jih vlada namenja ministrstvu za varRSUNJTKSTQMDCDCHHMDRDUDC@FQD
za litanijo, ki bo menda zaradi banalnosti lastnega ponavljanja oslabila
ONKHSHMNNONQDMNNONYNQHKNNONKHSHJH  JH  AH QDJDK  D NC MDJC@I UK@C@
UCQ@UH 3NC@JNMJQDSMNOQDCRS@UKI@
M@IANKI ODQDN SD@UN  J@JN OQDONznati in upravljati z ostanki, kot je
D OQDC @RNL OQNMHBKIHUN ONTC@QHK
Andreina Ricci (1996). Ostanki so
M@LQD ONSQDAMH U SQDMTSJT  JN RD 
TOQ@UHDMN Q@YHQHINJ@SDFNQHID@QGDolokih dobrin glede na tipoloko-kakovostno in kronoloko porazdelitev. Naa skupnost se ni sposobna
spoprijeti s problemom izobilja,
MD R@LN Y@Q@CH JQNMHMDF@ Y@LTI@MI@M@ONCQNITJTKSTQD SDLUDSTCH 
JDQIDAQDLDSNKHJMDJNKHHMDCNAQHM
CDI@MRJN MDUYCQMN  /NKDF SDF@ O@
teh ostankov paradoksalno ni mogoDTMHHSHGELICHI 2008, str. 7-8), saj
SNYUHCHJ@CQTADMHROQDIDLKIHUN 5
najboljem primeru jih lahko z obTSJNLJQHUCDROQDFKDC@LN 5DMC@Q
O@M@S@JM@HMOQNAKDLNUMDANLN
reili.
Ker imamo opravka tako z materialnimi dobrinami (vse tisto, kar ostaMDNCM@ICH@HMJ@QK@GJNR@LNRSNIMN HUH M@OQDI  R@I LNFND URDATID
UQDCMNSD  JH LT IHG ID CQTA@ OQHznala ne glede na dejstvo, da je bilo
MDJNCDKMDJDF@RHRSDL@JNSSTCHY
nematerialnimi dobrinami (vse tisto,
J@Q ID QDYTKS@S S H  OQDGNC@ Monumentality versus Research, kot navaja
CARVER 2003, str. 40-41), bi morala
skupnost razmisliti o koordiniranem
pristopu do obeh zvrsti: preventiva
in ovrednotenje sta torej dve sestavini dejavnosti, ki jih bomo moraKH Y@DSH RODS TONSDU@SH JNS BDKNSN 
Za delitev nalog med ministrstvo in
CDDKDM@ONCQNITU@QRSU@JTKSTQMD
CDCHHMD Y CDBDMSQ@KHY@BHIN  Y@Q@CH
katere se je lokalnim upravam (seveda poleg ostalih akterjev) dejansko
dodelila vloga pobudnikov in organiY@SNQIDUK@RSMDJTKSTQMDCDCHHMD MH
MNADMDF@TOQ@UHDMDF@Q@YKNF@YM@@I@ &QDO@Y@DDMNQ@YKHHBM@D
CNAQD RS@QD Q@YU@CD  M@LQD KNFHJD

15

16

denza una proposta di natura squisitamente culturale, che non pu trovare attuazione se non in unazione,
appunto, coordinata di gestione del
patrimonio (e con esso del territorio) (MANACORDA 2007, pp. 86-92).
Dunque la necessit di tornare al territorio, non quella di trovare uno
spazio dove sommare conoscenze e
competenze (e far scontrare poteri),
L@ HCDMSHB@QD HK RNFFDSSN BGD OT
dare ragione ed ordine anche alla
nostra azione di tutela.
Nel tragitto che ha portato allapplicazione di una norma sullarcheologia preventiva, quello che oggi
si chiama, con un eufemismo tutto
HS@KH@MN  ONSDMYH@KD @QBGDNKNFHBN 
ha giocato un ruolo decisamente
ambiguo. Una valutazione preliminare di dove fossero e di che cosa
contenessero i depositi su cui bisognava (e bisogna) praticare unazione preventiva, infatti concetto che
circola da tempo in ambito europeo
(una sintetica storia del dibattito in
GELICHI 1999). Tuttavia i tentativi di
applicarlo, e praticarlo, con lo scopo di costruire strumenti che fossero funzionali allazione preventiva,
hanno conosciuto unalterna fortuna
nel nostro Paese, lasciando pi di un
sospetto sulla resistenza ad utilizzare procedure che, una volta validate,
avrebbero fortemente condizionato
a priori le politiche di tutela.
Inoltre, i pochi esempi che sono
stati realizzati in Italia a partire dai
primi anni 80, sulla scia dellentusiasmo che sembrava aver investito
buona parte dellEuropa, sono stati
essenzialmente applicati alle citt:
dunque a spazi archeologici in qualBGD LNCN RSNQHB@LDMSD CDMHSH N
CDMHAHKH HMBTHK@YHNMD@MSQNOHB@
pi facilmente riconoscibile e le cui
dimensioni sono pi gestibili. Non a
caso, la sperimentazione in questo
RODBHBN@LAHDMSDG@OQNCNSSNLNdelli sempre pi perfezionati e precisi. Il passaggio al territorio, e dunque ad un cambio di scala, ha invece
introdotto tutta una serie di problemi con i quali larcheologo ha pi difBNKS@BNMEQNMS@QRH "NR DRODQHDMze che abbiano avuto lambizione di
confrontarsi con il territorio e che
non siano risultate mere carte archeologiche, sono pochissime (MALNA
TI 2011). Ancora meno quelle, come
lesperienza modenese (CARDAREL
LI e altri 2001), che si siano tradotte

in politiche condivise di tutela territoriale da parte dei vari organi che,


a diverso titolo, ne hanno legittimit
(Stato, Regioni e Comuni).
Tuttavia il passaggio da uno spazio urbano al territorio non comportava solo un cambio di scala, ma
anche, lo abbiamo detto, il riconoscimento di una diversa concezione del bene archeologico. Mentre
le citt possono considerarsi, entro
certi limiti, un unico grande sito, il
SDQQHSNQHNMNMG@BNMMH@QBGDNKNFHci e presenta comunque una maggiore discontinuit, anche quando
si voglia aderire, come pure noi facciamo, ad un concetto di paesaggio
come continuum di attivit sociali
e culturali (LOCK, HARRIS 2006, pp.
42-45). Nel territorio, poi, hanno
L@FFHNQDODRNHBNRHCCDSSHDBNE@SSH 
la disponibilit di risorse, la morfologia del terreno ma soprattutto le
dinamiche geologiche, che formano
RODRRDBNKSQHCHRDCHLDMSHNRTODQBH
CH DQNRHNMD HM FQ@CN CHMTHQD RTKK@
nostra percezione del sepolto e, soprattutto, sulla sua conservazione
(GELICHI, NEGRELLI 2008b, p. 269).
Si tratta di un modello di approccio
che stato tentato pochi anni fa, affrontando dopo la citt (GELICHI, AL
BERTI, LIBRENTI 1999) anche il territorio comunale di Cesena (qui lunit
territoriale base di riferimento aveva
una sua legittimit amministrativa:
GELICHI, NEGRELLI@NEGRELLI
2008). E si tratta di un modello che,
con diversi correttivi e lintegrazione
nel team di ricerca di geologi (che
nel frattempo avevano sperimentato
originali e promettenti modalit di
approccio al territorio interfacciando
levidenza archeologica con la storia
geologica dei territori), stato alla
base del progetto PArSJAd.
Il riconoscimento di Unit di Paesaggio Antico (UPA) stata la chiave con la quale il gruppo di ricerca
G@ @QNMS@SN K@M@KHRH CDKKDUHCDMY@
archeologica sul territorio. NaturalLDMSD KG@ E@SSN BNM TM@ Q@M@SDYY@ CH CDSS@FKHN CHUDQRHB@S@  TR@MCN
@OONRHS@LDMSDRB@KDCHDQDMYH@SDCH
attenzione. Lobbiettivo del progetto, infatti, era quello di tarare modelli, non di analizzare storicamente
e in maniera compiuta territori (per
quanto luna cosa non escluda laltra). Il risultato produce una mappatura nella quale si sono tentati
di integrare ovvi dati puntiformi (il

noto secondo procedure catalogiche


tradizionali) con dati spaziali che tenessero conto sia delle coperture
sedimentarie (dunque la visibilit
associata alla profondit che produce valori induttivamente misurabili)
RH@CDKK@QDSDHCQNFQ@B@@MSHB@ CDKK@
posizione della costa e della laguna.
0TDRSNBNMK@M@KHSMNMCHHMCHUHduare puntiformi aree a rischio, ma
di circoscrivere quegli areali che, in
associazione con i principi elaborati
dallarcheologia predittiva (VERHA
GEN 1996), pi di altri potessero
aver accolto il popolamento antico.
Poich lobbiettivo, dunque, era
quello di elaborare uno strumento
che introducesse un concetto che
appartiene alla sfera del possibile (la previsione) per sostituirlo con
un altro della sfera della certezza (la
BDQSHB@YHNMDCHTMADMD CNAAH@LN
avere la consapevolezza che si tratta
di un percorso che porta alla formulazione di un mezzo altamente perfettibile ed integrabile che, per essere opportunamente utilizzato, ha
la necessit di essere inserito in procedure di tutela diverse da quelle
attuali. Un cambiamento di prospettiva nel riconoscimento del bene archeologico, inoltre, porterebbe con
s anche un salutare mutamento
RDL@MSHBN@KKDROQDRRHNMDU@KNQHYY@zione del patrimonio culturale (dunque anche archeologico) che, non
troppo casualmente, si sente usare
con sempre maggiore frequenza. Il
patrimonio cultuale, infatti, viene inteso sempre pi come una risorsa da
ROQDLDQD  BNLD TM@ QHRDQU@ CH BTH
prevale il valore monetario (SETTIS
2002, p. 40), piuttosto che come un
bene di pubblica utilit. Naturalmente non possiamo che essere daccordo nel censurare questa pericolosa
deriva, ma non dovremmo neppure
meravigliarcene. I nostri Musei sono
SQNOONOHDMHCHBNRDTSHKHYY@SDRODRso come feticci, per non comprendere come il rapporto tra le comunit
e il proprio passato, che transita anche attraverso larcheologia, non ne
venga in qualche modo corrotto. Ri@MMNC@QDPTDRSNKN QDBTODQ@QDTM
sano atteggiamento che ci aiuti a ritrovare la nostra memoria collettiva,
passa anche da un modo diverso di
guardare alla fonte archeologica e di
utilizzarla.

porazdelitve. Vendar nas ob tej priKNMNRSHMDY@MHL@YCQTDU@MIDOQHRSNIMNRSHYM@LDMNLUMNUHMDUYONRS@UHSUD RS@QDF@ LNMNONK@ Q@ID AH


HYONRS@UHKH OQDCKNF HYJKITMN JTKSTQMDM@Q@UD JHF@MHLNFNDTQDRMHHSH
CQTF@D JNS Y TRJK@IDMHL TOQ@UKI@MIDL JTKSTQMD CDCHHMD Y MIHL O@
tudi ozemlja) (MANACORDA 2007,
OO     /NSQDA@ ON UQ@@MIT M@
ozemlje torej ni enaka tisti po prostoru, v katerem bi setevali znanja
in usposobljenosti (in kjer bi prihaI@KNCNLDQIDMI@LNH SDLUDSDHJ
CNKN@MITRTAIDJS@ JHK@GJNNRLHRKH
in uredi tudi nae dejavnosti varstva
arheolokih dobrin.
Na poti do uporabe predpisa o
preventivni arheologiji je element,
JH F@ C@MDR R SHOHMHL HS@KHI@MRJHL
DUEDLHYLNL HLDMTIDLN @QGDNKNki potencial, igral precej dvomljivo
vlogo. Predhodna ocena o tem, kje
se nahajajo in kaj vsebujejo arheoloki depoziti, ki jih je bilo (in jih je e)
ONSQDAMNOQDUDMSHUMNY@HSHSH IDM@LQDONIDL JHIDDMDJ@I@R@OQHsoten v evropskem prostoru (kratek
povzetek polemike lahko najdete v
GELICHI 1999). Vendar pa poskusi
uveljavitve in uporabe tega pojma z
M@LDMNL HYCDK@SHNQNCID JHAHRKTHlo namenu preventivnega ravnanja,
niso bili vedno enako uspeni v Italiji, tako da so vzbudili marsikaken
dvom o tem, zakaj je toliko odpora
CNONRSNOJNU JHAH DAHAHKHONSQIDni, bistveno vplivali na politiko varRSU@JTKSTQMDCDCHHMDOQHM@R 
Poleg tega pa so se malotevilni
ONRJTRH NOQ@UKIDMHU(S@KHIHNCY@DSka osemdesetih let prejnjega stoletja naprej v duhu navduenja, ki je
preveval dobren del Evrope, izvedli
RJNQ@IC@ HYJKITMN U TQA@MHG M@RDljih, torej v arheolokem okolju, ki je
M@MDJM@HMDCNCNAQ@CDMHQ@MN
@KH F@ ID LNFND CDMHQ@SH  JIDQ RD
YK@GJ@ OQDONYM@IN @MSQNOHMH UOKHUH
in kjer je manevrski prostor omejen
in ga je enostavno nadzorovati. Ni
M@JKITID  C@ RN AHKH UYNQMH LNCDKH
DJRODQHLDMSNU U SDL RODBHMDL
okolju vedno bolj izpopolnjeni in naS@MMH  /QDGNC M@ NYDLKID HM Y MIHL
sprememba merila pa sta uvedli vrsto problemov, s katerimi se arheoKNF SDID RNN@  3NUQRSMHG HYJTDMI
na ozemlju, ki niso izpadle samo kot
@QGDNKNJ@ J@QSNFQ@I@  ID Y@SDF@delj izjemno malo (MALNATI 2011).
e manj je taknih, kot je na primer


modenska izkunja (CARDARELLI et


al. 2001), ki so jih pretvorili v skupno
politiko ozemeljskega varstva s straMHQ@YKHMHGOQHRSNIMHGTRS@MNUCQ@U@ CDDKDHMNAHMD 
Prehod iz urbanega v teritorialno
okolje pa ni predstavljal samo preRJNJUCQTFNLDQHKN SDLUDSTCH JNS
RLNDQDJKH OQHYM@MIDNCQTF@MDL
CNIDL@MIT @QGDNKNJD CNAQHMD  D
K@GJN CN CNKNDMD LDID NYM@HLN
LDRS@JNSDMNR@LNUDKHJNM@ICHD 
pa ozemlje tovrstnih arheolokih
meja nima oziroma je v vsakem primeru veliko bolj nepovezano, tudi taJQ@S JNDKHLNONJQ@IHMHOQHOHR@SHUSHR
continuuma socialnih in kulturnih
dejavnosti (LOCK, HARRIS 2006, pp.
42-45). Na ozemlju imajo poleg tega
UDINSDNS@JNHLDMNU@MHDJNE@JSH Q@YONKNKIHUNRSUHQNU LNQENKNFHI@
terena, predvsem pa geoloke dinamike, ki izoblikujejo debele plasti
usedlin ali erozijskih povrin, ki vplivajo na nae dojemanje vkopanin,
predvsem pa na njihovo ohranjanje
(GELICHI, NEGRELLI 2008b, str. 269).
&QDY@M@HMOQHRSNO@ JHRDIDONRJTsil opraviti pred nekaj leti po izkunji
v urbanem okolju (GELICHI, ALBERTI,
LIBRENTI 1999) tudi na ozemlju obHMD"DRDM@STIDHLDK@NYDLDKIRJN
Y@CNKDM@ DMNS@ STCH TOQ@UMN OQHstojnost: GELICHI, NEGRELLI @
NEGRELLI 2008). In res gre za model,
JHID DSTCHYQ@YKHMHLHONOQ@UJHHM
dopolnitvami dejavnosti geologov
JH RN U SDL @RT DJRODQHLDMS@KMN
OQDHYJTRHKHHYUHQMDHMNADS@UMDM@Hne pristopa do ozemlja s prepletanjem arheolokih dokazov z geoloko zgodovino) predstavljal izhodiDY@HYUDCANOQNIDJS@/ Q2) C 
Uradno priznanje Oddelka za starodavno pokrajino (Unit di paesaggio antico  $MNSD MSHMD /NJQ@IHMD
4/ IDAHKJKITMHCDI@UMHJ M@NRMNvi katerega je raziskovalna ekipa zaDK@ Y @M@KHYN @QGDNKNJHG CNJ@YNU
na ozemlju. Seveda je svoje delo
NOQ@UHK@ OQDMIDMN HM OQHK@FNIDMN
podrobnostim, saj je za vsakega od
RODBHMHG OQHLDQJNU TONQ@AHK@ ONsebej prilagojena merila pozornosti.
"HKI OQNIDJS@ ID M@LQD AHK J@KHAQHranje modelov, ne pa zgodovinska
HM BDKNRSM@ @M@KHY@ NYDLKI@ DOQ@U
se oba pristopa medsebojno ne izJKITTIDS@  1DYTKS@S OQHY@CDU@MI ID
izdelana karta, na katero so poskuRHKH UMDRSH D YM@MD SNJD YM@MD U
RLHRKTJK@RHMDF@M@HM@J@S@KNFHQ@-

nja) s prostorskimi podatki, ki bi upotevali tako sedimentne plasti (torej


razvidnost v razmerju do globine,
J@SDQD UQDCMNRS ID LNFND HYLDQHSH
z meritvami induktivnosti) kot tudi
RS@QNC@UMN UNCMN NLQDID  ONKN@I
NA@KMD QSD HM K@FTMD  -@LDM OQNIDJS@MHAHKCNKNHSHSNJNUMNNFQNDM@ NALNI@  O@ O@ NOQDCDKHSH SHRSD
povrine, na katerih bi bilo glede na
M@DK@ JHIHGIDQ@YUHK@UDI@@QGDNKNkih predvidevanj, bolj verjetno, da
so jih v preteklosti naselila starodavna ljudstva (VERHAGEN 1996).
Ker je bil torej cilj projekta izdeK@SHNQNCID JHAHTUDCKNONIDLLNMDF@ OQDCUHCDU@MID HM Y MIHL
M@CNLDRSHKONIDLFNSNUDF@ONSQditev dobrine), se moramo zavedati,
C@FQDY@M@HMCDK@ OQHJ@SDQDLRD
oblikuje orodje, ki se lahko e bistveno izpopolni in dopolni Da pa bi se
K@GJN TONQ@AHKN M@ OQHLDQDM M@HM 
AHF@AHKNSQDA@UJKITHSHUONRSNOJD
varstva, ki se precej razlikujejo od
NARSNIDHG 2OQDLDLA@ODQRODJSHUD
pri prepoznavanju arheoloke dobrine bi poleg tega s seboj prinesla tudi
YCQ@UNRDL@MSHMNROQDLDLANHYQ@Y@NUQDCMNSDMIDJTKSTQMDSNQDISTCH
@QGDNKNJD CDCHHMD  JH RD  J@Q MH
M@JKITID  URD ONFNRSDID TONQ@AKI@ 
*TKSTQM@CDCHHM@RDM@LQDONFNRSNQ@YTLDJNSUHQ JHF@IDSQDA@HYQO@SH JNSQDYDQU@ UJ@SDQHOQDUK@CTje vidik denarne vrednosti (SETTIS
2002, str. 40) nad vidikom skupnosti
koristne dobrine. Seveda se moramo
strinjati, da je potrebno ta nevarni
odklon cenzurirati, a nas vseeno ne
RLDROQ@UHSHUY@TCDMID -@HLTYDIHRNOQDUDONKMHRSU@QH JHRDONFNsto uporabljajo kot fetii, da nam ne
bi postalo jasno, da se lahko zaradi
taknega odnosa vez med dananjo
CQTAN HM MIDMN OQDSDJKNRSIN  JH ONteka tudi skozi arheologijo, postopoL@ YQ@GKI@  9@ UMNUHMN TSQCHSDU SD
vezi in za zdrav odnos do preteklosti,
ki nam bo spet pomagal obnoviti kolektivni spomin, je potrebno pogleC@SH @QGDNKNJD UHQD Y CQTFHLH NLH
HMRDM@THSHMNUHGM@HMNUTONQ@AD 

17

Immagine aerea dellarea archeologica di Altino (da NINFO et alii 2009).

2
Paesaggi antichi e potenziale archeologico
A cura di Paolo Mozzi e Claudio Negrelli, con contributi di: Tiziano Abb (ta),
Silvia Cadamuro (sc), Elisa Corr (ec), Alessandro Fontana (af),
Cecilia Moine (cm), Paolo Mozzi (pm), Claudio Negrelli (cn), Andrea Ninfo (an),
Sandra Primon (sp), Lara Sabbionesi (ls)

, pm, cn)


+@SSHUHS CH QHBDQB@  RS@S@ M@lizzata allanalisi diacronica dei paesaggi che hanno caratterizzato, nel
corso dei millenni, la bassa pianura
alluvionale e costiera dellAlto Adriatico1. Lobiettivo era di costruire un
sistema complesso di relazioni tra
assetto geomorfologico2 e situazione archeologica, sia in riferimento
@KK@ONRHYHNMDRSQ@SHFQ@B@@KKHMSDQMN
del modello geologico, sia in termini
di conservazione e fruibilit del potenziale archeologico.
Il telerilevamento aereo e satellitare e lanalisi di modelli digitali
del terreno (DEM - Digital Elevation
Model) hanno permesso la detezione e lo studio delle tracce relative a
insediamenti e percorsi viari sepolti,
O@QSHYHNMH@FQ@QHDQDKHSSD @KUDHTUH@KH
e canali lagunari abbandonati, dossi
alluvionali e cordoni litoranei.
K MD CH CDMHQD KDUNKTYHNMD
del paesaggio nel corso degli ultimi
RDBNKHRS@S@TSHKHYY@S@K@B@QSNFQ@@
storica, a partire dalle prime levate
CDKKD S@UNKDSSD (&, MD 7(7  HMHYHN
77RDBNKN *QHDFR*@QSD  
carta del Lombardo-Veneto (1833) e
@KSQHCNBTLDMSHHM@QDDRODBHBGDQHR@KDMSHMN@K75(RDBNKN
La schedatura dei siti archeologici e degli elementi del paesaggio
agrario antico provenienti da una riBDQB@AHAKHNFQ@B@RTKMNSN ONSDMdo usufruire anche di alcuni recenti
contributi di sintesi, ha consentito
di basare lattivit di ricerca su una
messe di dati ingente, per quanto
non sistematica. Lo scopo della catalogazione dei siti e delle tracce edite
[

non era quello di ottenere un regesto esaustivo della situazione archeologica del noto (possibile peraltro
solo attraverso limplementazione
del sistema col dato proveniente
dagli archivi, in primis quelli della
Soprintendenza per i Beni Archeologici del Veneto), quanto quello della
raccolta di un certo numero di dati a
carattere statistico, con particolare
riferimento alle caratteristiche straSHFQ@BGDDCHOQNENMCHSCDKK@QHRNQsa archeologica, consapevoli anche
del fatto che consimili lavori di catalogazione sono gi stati eseguiti e in
corso di svolgimento da parte di altri
gruppi di ricerca (si vedano ad esempio BONDESAN, MENEGHEL 2004 e
FURLANETTO 2011). La realizzazione di un archivio GIS dei siti e delle
tracce archeologiche stata considerata come operazione preliminare
al progetto di ricerca in generale ed
in particolare allattivit sul campo.
2T RODBHBGD @QDD CH CDSS@FKHN N
aree campione) sono state infatti effettuate attivit di rilevamento geologico e geomorfologico, con lo studio
di carotaggi geognostici e di sezioni
RSQ@SHFQ@BGD D KDRDBTYHNMD CH C@tazioni radiometriche. Le attivit di
campagna sono state associate a survey archeologico, secondo un metodo
estensivo in grado di coprire porzioni
di territorio relativamente estese.
Lanalisi integrata dei diversi elementi ha permesso di suddividere lintera area di studio in Unit di
/@DR@FFHN MSHBN 4/   0TDRSD BNstituiscono degli ambiti territoriali
BGD RH RNMN ENQL@SH HM RODBHBGD nestre cronologiche (es. et romana,
alto medioevo) ad opera di determinati processi geomorfologici (es.

2
Starodavne pokrajine in arheoloki potencial
Pripravila Paolo Mozzi in Claudio Negrelli, prispevki: Tiziano Abb (ta),
Silvia Cadamuro (sc), Elisa Corr (ec), Alessandro Fontana (af),
Cecilia Moine (cm), Paolo Mozzi (pm), Claudio Negrelli (cn),
Andrea Ninfo (an), Sandra Primon (sp), Lara Sabbionesi (ls)

8 (pm, cn)


Cilj raziskovalnih dejavnosti je
CH@GQNMHM@@M@KHY@ONJQ@IHM JHRNU
SDJTSHRNKDSHIY@YM@LNU@KDONOK@UMH
MHHMRJHHMNA@KMHRUDSNA2DUDQMDL
Jadranu1  "HKI ID AHK HYCDK@SH Q@YKDnjen sistem odnosov med geomorfoloko podobo2 in arheolokim staMIDLYUHCHJ@RSQ@SHFQ@ERJDF@ONKN@ja znotraj geolokega modela v velikem merilu ter z vidika ohranjanja in
izkoristka arheolokega potenciala.
2 ONLNIN YQ@MHG HM R@SDKHSRJHG
posnetkov ter analize digitalnih modelov ozemlja (DEM - Digital ElevaSHNM ,NCDK RLN NCJQHKH HM OQDTHKH
RKDCHQ@YKHMHGONJNO@MHGM@RDKAHM
in poti, ostaline starodavnih kmetijRJHGO@QBDK@BHI RS@QHGQDMHGJNQHSHM
NOTDMHGJ@M@KNUUK@FTMH ONOK@Unih grebenov vzpetin in obalnih kordonov.
Pri opredelitvi razvoja pokrajine
v zadnjih nekaj stoletjih smo si pomagali z zgodovinskimi zemljevidi
HY @QGHUNU  Y@DMH R OQUHLH J@QS@LH
(&,JNMDB Y@DSDJ RSNKDSI@ 
s KriegsKarte (1798-1805), zemljevidom Lombardije in Veneta (1833)
SDQCQTFHLHCNJTLDMSHY@RODBHMD
predele od 16. stoletja dalje.
/NOHR@QGDNKNJHGM@ICHHMDKDmentov starodavne kmetijske pokraIHMD HYG@I@INHGHYHRJ@MI@AHAKHNFQ@ERJHG Y@OHRNU N ONYM@MDL OQH SDL
smo si lahko pomagali tudi z nekaSDQHLHRUDHLHONUYDSJHIDNLNFNHK
OQHOQ@UN HYQOMD  DSTCH MDRHRSDL@SHMDA@YDONC@SJNUJNSHYGNCHD
Y@ Q@YHRJ@UN  -@ICAH HM D YM@MHG
ostalin nismo katalogizirali z namenom, ustvariti celovit pregled arhe-

olokega stanja poznanega (ki ga je


STCH RHBDQ LNFND CNKNHSH R@LN Y
uporabo sistema arhivskih podatkov,
predvsem podatkov iz arhiva Uprave
Y@U@QRSUN@QGDNKNJHGCNAQHMCDDKD
5DMDSN O@O@YAQ@SHCNKNDMNSDUHKN RS@SHRSHMHG ONC@SJNU R ONRDAnim poudarkom na stratigrafskem
OQNKTHMFKNAHMHKDH@@QGDNKNJHG
UHQNUOQHSDLRLNRDCNAQNY@UDC@KH 
da so se podobna dela katalogizacije
DNOQ@UHK@@KHIHGQ@UMNJ@QNOQ@UKI@jo druge raziskovalne skupine (glej
na primer BONDESAN, MENEGHEL
2004 in FURLANETTO 2011). IzdelaUN&(2@QGHU@@QGDNKNJHGM@ICHHM
arheolokih ostalin smo upotevali
samo kot predpripravo na celoten
projekt in, bolj podrobno, na delo na
terenu.
-@ CNKNDMHG ONCQNAMHG @KH
UYNQMHG NALNIHG RLN M@LQD
opravili geoloke in geomorfoloke meritve, ki predvidevajo analizo
FDNFMNRSHMHG UQSHM HM RSQ@SHFQ@ERJHG
RSNKOBDUSDQQ@CHNLDSQHMNC@SHQ@MID 
Delo na terenu smo dopolnili z arheoloko tudijo po ekstenzivni metodi, s katero smo pokrili relativno obRDMDCDKDNALNI@
9@Q@CH BDKNRSMD @M@KHYD Q@YKHMHG
DKDLDMSNU RLN OQNIDJSMN NALNID
Q@YCDKHKHUONR@LHMD$MNSD MSHMD
Pokrajine (EAP). Te sestavljajo deli
NALNI@  JH RN RD Q@YUHKH U RODBHMDL@RNUMDLNACNAITMOQ QHLRJN
obdobje, zgodnji srednji vek) kot poRKDCHB@ CNKNDMHG FDNLNQENKNJHG
OQNBDRNU QDMHG  K@FTMRJHG HSC  HM
@KH RN IHG @MSHMH OQDAHU@KBH TONQ@bljali v posebne namene (npr. naselbine, poljedelstvo, rokodelstvo itd.).
2 ONLNIN $ / AN LNFND CNKNHSH
UQRSN HM URDAHMRJN NADKDID NALN-

19

20

Tav. 1 - Carta delle unit di paesaggio


antico (UPA) della pianura costiera veneta, settore meridionale (1a) e nordorientale (1b).
7DE=HPOMHYLGHQRWDQWLQHSRNUDMLQH ($3  EHQHNH REDOQH QLLQH MXQL
(1a) in severovzhodni sektor (1b).

21


2.2. UPA di Adria - Po 2

Fig. 1 - Composizione a falsi colori di


immagine satellitare Landsat (composizione B7_5_1, marzo 2002, fonte: U.S.
Geological Survey), in trasparenza sul
DEM della pianura veneta. La maggiore
ULHWWDQ]D GHL GHSRVLWL VDEELRVL ULVXOWD
in toni pi chiari nellimmagine (elaborazione A. Ninfo).
6O   3ULND] ] ODQLPL EDUYDPL QD VDtelitskem posnetku Landsat (B7_5_1,
marec 2002), prosojno na DMV BeneNHJD QLDYMD Y UGHL MH YLGQR REPRMH
raziskave.
1

22

TUH@KH  K@FTM@QH DN OQDRDMS@MN


particolari vocazioni duso antropico antico (es. insediativo, produttivo,
commerciale). Le UPA permettono
di discretizzare e concettualizzare
HKSDQQHSNQHN@KMDCDKK@U@KTS@YHNMD
preventiva della risorsa archeologica, fornendo indicazioni sulla potenziale collocazione di siti archeologici
HM RTODQBHD D MDK RNSSNRTNKN  2NMN
CH@TRHKHN@KK@CDMHYHNMDCDKKDQDK@zioni che intercorrono tra i lacerti dei
paesaggi antichi e il mosaico territoriale attuale, mettendo in luce criticit e opportunit per la valorizzazione e lo sviluppo. Alcune particolari
UPA, meno estese delle altre, corrispondono a singoli siti archeologici
di grandi dimensioni, a vocazione
TQA@M@DOKTQHRSQ@SHB@SH PT@KH CQH@ 
Altino, Jesolo e Concordia Sagittaria.
+@ KNQN CDKHMD@YHNMD B@QSNFQ@B@ 
stata eseguita sulla base dei dati disponibili in letteratura e dei risultati
del telerilevamento, dellanalisi di
DTM e del survey geo-archeologico.
Attraverso uno stretto confronto
tra geomorfologi e archeologi stato possibile sviluppare dei modelli
di valutazione preventiva della risorsa archeologica non o parzialmente
nota, sia nelle singole UPA sia nelle
aree di dettaglio.

/83$3$
(an, cn, pm, ls)
2.1. UPA di Pegolotte - Po 1
LUPA denominata Po 1 corrisponde al tratto di pianura attribuibile al ramo pi settentrionale del
Po (o Po di Saline-Cona) (CASTI
&+(.-(  /(.5 - et alii 2010).
In questa area si individua un perBNQRNTUH@KDRS@AHKDBGDG@BNRSQTito il dosso tuttora percepibile da
#$,FF  MDKQDRSNCDKK@QD@RH
individuano numerose tracce paleoiCQNFQ@BGD LHMNQH OQHMBHO@KLDMSD
canali/ventagli di rotta) associate a
divagazioni temporanee dal percorRN OQHMBHO@KD  0TDRSN Q@LN TUH@KD
del Po stato attivo tra la seconda
LDS CDK SDQYN D K@ MD CDK RDBNMdo millennio a.C. La determinazione
dellet dovuta alle datazioni al raCHNB@QANMHNDDSST@SDRTQDRSHNQF@nici trovati nella sequenza stratigraB@ CDK O@KDN@KUDN PIOVAN et alii
2010). Essa inoltre coadiuvata dalla presenza di insediamenti protostorici localizzati lungo questo ramo
TUH@KD  @C DRDLOHN 2@KHM@ D "NM@ 
0TDRS@ONQYHNMDCHOH@MTQ@@MSHB@
ricoperta nella parte pi meridionale
dai depositi dellAdige, qui attivo in

epoche successive (UPA Ad 3).


Le tracce romane individuate da
telerilevamento durante il progetto via Annia (MOZZI, NINFO 2009,
NINFO et alii 2011), confermano ulteriormente let di questUPA. In effetti le strutture e i livelli di et romana sono i pi numerosi e spesso
HM ONRHYHNMD @NQ@MSD  3Q@BBD CDKK@
viabilit romana da Adria verso N
(via perilagunare per Altino) ed un
nucleo di ritrovamenti di et romana
nei pressi di Agna (ad es. FRASSINE
2010) testimoniano di un popolamento che potrebbe essere strutturato secondo la centuriazione adriese, quella orientata principalmente
sui limites di Villadose (MARAGNO
1993). Per quanto concerne le epoche precedenti, i dati a disposizione
parlerebbero a favore di un insediamento posto a scarsa profondit almeno a partire dallet del Bronzo
Recente. Per queste aree stata gi
da pi parti segnalata la particolare rilevanza archeologica dei dossi,
BGDONSQDAADQN@UDQBNRSHSTHSNMC@
epoche preromane un fattore di attrazione insediativa (cos anche FUR
LANETTO 2011, pp. 194-196).

LUPA denominata Po 2 occupa un


tratto di pianura limitato a nord dai
depositi medievali e moderni dellAdige (UPA Adige 3) e a sud da sedimenti del medesimo periodo del Po
4/ /NB 0TDRS@O@QSDCHOH@MTQ@ 
in cui sorge Adria, attribuibile ad
un antico ramo del Po detto appunto
Po di Adria (VEGGIANI 1972, 1974,
1985). Let di questo ramo viene
CDMHS@  RTKK@ A@RD CDH QHSQNU@LDMSH
archeologici, ad unattivit almeno
OQDBDCDMSD@K7((RDB@ " 0TDRS@QD@
caratterizzata dallintreccio di due
dossi ben pronunciati: uno che passa a nord di Adria e termina la sua
QHKDU@MY@ SNONFQ@B@  ONBN @ MNQC
di Adria stessa, in localit Tiro a seFMNK@KSQNOHDF@UDQRNRTCKTMFNHK
Canal Bianco e lambendo la citt terLHM@ HM KNB@KHS "@ +@AH@ FF   
4). La parte nordovest presenta nuLDQNRD SQ@BBD O@KDNHCQNFQ@BGD KD
maggiori indicano che un ramo del
Po attraversava questo tratto di pianura con un andamento meandriforme circa OE terminando in prossimit
dei sistemi costieri Co1-Co2, dove
ora scorre lAdige, che ivi si incanala
verso la foce. I dati per la determinazione dellet di questo tratto di pianura sono legati allimportante storia del Porto di Adria, di fondazione
etrusca che conobbe in epoca romana una notevole espansione docuLDMS@S@C@HLNKSDOKHBHDRHFMHB@SHUH
ritrovamenti archeologici. Tracce archeologiche romane (principalmente si individuano scoline agrarie e
RSQ@C@KHDCDKDLDMSHO@KDNHCQNFQ@BH
sono stati mappati in dettaglio nella
campagna circostante Adria (MOZZI
NINFO 2009, NINFO et alii 2011), ed
in generale su tutta la UPA in esame,
arricchendo il quadro gi evidenziato da autori precedenti quali PERET
TO (1993).
Nella pianura a nord della citt
K@O@KDNHCQNFQ@@OQHMBHO@KDDUHCDMSDHMF QHRTKS@MNMOH@SSHU@FH
in epoca romana. Si avuta una recente validazione delle tracce telerilevate dai dati archeologici di scavo
(BACCI et alii, 2011). Dalla stratigra@DLDQFDBNLDHMFQ@MO@QSDCDKK4PA Po 2 le tracce romane stradali e
agrarie risultino in parte erose dallaQ@STQ@ LNCDQM@  (M DDSSH HM /N  RH
nota un fatto decisamente saliente:
la perfetta visibilit, in sostanziale
@NQ@LDMSN CDKKDCTDBDMSTQH@YHN

Fig. 2 - Unit di paesaggio antico (UPA)


appartenenti allAdige-Po e ai sistemi
costieri associati (per la legenda vedere
Tav. 1).
6O($3QDR]HPOMXUHN$GLD3DGLQ
povezanih obalnih sistemov.
2

I@Y@OQDUDMSHUMNNBDMNMIDFNUDF@
arheolokega potenciala, saj bodo
ponudile podatke o morebitnih loJ@BHI@G @QGDNKNJHG M@ICH M@ ONUQHMHHMONCMIN $MNSDRNUONLN
OQH CNKN@MIT NCMNRNU LDC NRS@MJH
@MSHMD ONJQ@IHMD HM SQDMTSMHL NYDmeljskim mozaikom in osvetljujeIN JQHSHM@ UOQ@@MI@ SDQ OQHKNMNRSH
za ovrednotenje in razvoj. Nekatere
L@MID $ / RNUO@C@IN Y NARDMHLH
UDOK@RSMHLH@QGDNKNJHLHM@ICHHY
TQA@MHLNADKDIDL JNSRN CQH@  Ktino, Jesolo in Concordia Sagittaria.
Njihovo zemljepisno razmejitev smo
opravili na podlagi podatkov v literarnih virih ter rezultatov daljinskih
meritev, DTM analize in geo-arheoloke tudije.
V tesnem sodelovanju z geomorfologi in arheologi nam je uspelo razviti modele preventivne ocene e nepoznane ali le delno poznane arheoKNJDCDCHHMDUONR@LDYMHG$ /HM
M@ONCQNAMHGNALNIHG

($33$
(an, cn, pm, ls)
($33HJRORWWH3DG
Enota EAP, imenovana Pad 1, soUO@C@ Y CDKNL MHHMRJDF@ RUDS@ NA
M@IRDUDQMDIDL QNJ@UT QDJD /@C
(Pad Saline - Cona) (CASTIGLIONI
 PIOVAN in drugi, 2010). Na
SDL ONCQNIT ID UHCDSH RS@AHKMH QDni tok, ki je oblikoval izgonski greben, e vedno razviden z DEM anaKHYNRK  M@OQDNRS@KDLONUQIT
je opaziti tevilne manje paleo-hidrografske sledi (predvsem kanaKHO@GKI@@RSH Y@UNIH  M@RS@KD Y@Q@CH Y@@RMHG OQDTRLDQHSDU FK@UMDF@
QDMDF@SNJ@ 3@QDMHQNJ@U/@C@ID
bil aktiven v zadnji polovici tretjega
HMJNMDBCQTFDF@SHRNKDSI@OQ M S 
-IDFNUNRS@QNRSRLNCNKNHKHYQ@CHNkarbonsko datacijo organskih ostankov, najdenih v stratigrafskem zapoQDCIT RS@QNC@UMDF@ QDMDF@ JNQHS@
(PIOVAN in drugi, 2010). Podpirajo jo
tudi ostanki naselbin iz predzgodovinskega obdobja, ki se nahajajo ob
SDL QDMDL QNJ@UT  M@ OQHLDQ 2@KHMDHM"NMD 3@CDKRS@QNC@UMDMHHMD
IDUMIDMDLITMDLCDKTOQDJQHU@IN
M@OK@UHMD CHD JHIDONMIDISDJK@U
kasnejih obdobjih (EAP Ad 3).

Ostaline iz rimskega obdobja, ki


RN RD NCHS@KD Y C@KIHMRJHL Y@YM@vanjem v okviru projekta Via Annia
(MOZZI, NINFO 2009, NINFO in drugi,
2011), e dodatno potrjujejo zgodovinsko starost te enote. V resnici so
objekti in sloji iz rimskega obdobja
najtevilneji in jih je pogosto moFND M@ISH M@ ONUQIT  2KDCNUH QHLskih cest iz Adrie na sever (cesta ob
laguni v smeri proti Altinu) in sklop
najdb iz rimskega obdobja pri Agni
(npr. FRASSINE  OQH@IN N ONseljevanju, ki bi lahko potekalo po
vzorcu adrijske centurizacije, predURDL SHRSD U AKHHMH limites (meja)
Viladosse (MARAGNO 1993). Kar zadeva predhodna obdobja, govorijo
Q@YONKNKIHUH ONC@SJH U OQHC OKHSJN
pokopani naselbini vsaj iz obdobja
konca bronaste dobe. Poseben arheoloki pomen v teh predelih imajo
grebeni, saj so strokovnjaki mnenja,
C@RNDUOQDCQHLRJDLNACNAITOQHUK@HKHRS@QNRDKBDS@JNSTCH%TQK@MDSto 2011, str. 194-196).
($3$GULD3DG
Enota EAP, imenovana tudi Pad
  Y@RDC@ CDK MHHMD  JH F@ M@ RDUDru omejujejo srednjeveki in novoCNAMH M@MNRH QDJD CHD $ / CH@
3), na jugu pa sedimenti reke Pad iz

istega obdobja (EAP Pad4c). Ta del


MHHMD M@J@SDQDLRDIDQ@YUHKNLDsto Adria, je nastal ob starem rokavu
QDJD /@C  HLDMNU@MDL /@C CQHD
(VEGGIANI 1972, 1974, 1985). Obdobje aktivnosti rokava lahko na
osnovi arheolokih najdb datiramo
vsaj v 12. stol. pr. n. t. ali prej. ZnaHKMNRSONCQNI@RS@CU@OQDOKDS@IN@ RD  CNAQN HYQ@DM@ FQDADM@ OQUH
poteka severno od Adrie in se s toONFQ@ERJDF@ UHCHJ@ Y@JKITH RDUDQMN
NCLDRS@UJQ@IT3HQN@RDFMNCQTgi se vije proti jugu ob kanalu Canal
Bianco in zaobide mesto, nato pa se
UJQ@IT"@+@AH@ROTRSHCNQ@UMHMD
(sl. 3, 4). Na severozahodu so prisotne tevilne paleo-hidrografske sleCHUDHM@IHGM@J@YTID C@IDDCDMNC
SNJNUQDJD/@COQDJ@KS@CDKMHHMD
v meandrih v smeri Z-V in svojo pot
Y@JKITHK U OQHNA@KMHG RHRSDLHG "N "N JIDQC@MDRSDD CH@ JHRDM@
SDISNJHTRLDQHOQNSHRUNIDLTTRSIT 
/NC@SJH Y@ CNKN@MID RS@QNRSH SDF@
CDK@MHHMDRNONUDY@MHRONLDLAMNYFNCNUHMNOQHRS@MH@ CQHDLDRSN Y Y@LDSJH HY @R@ $SQT@MNU RD
je razcvetelo v rimskem obdobju, o
HLDQ OQH@IN SDUHKMD HM ONLDLAne arheoloke najdbe. Rimske arheoloke ostaline (predvsem poljski
in cestni jarki) in paleo-hidrografski

23

Fig. 3 - Ortofoto 2009 centrata su Adria.


Sono evidenti i depositi sabbiosi del
ramo del Po di Adria e le tracce di paleoLGURJUDDQHOODUHDD12
6O2UWRSRVQHWHNRVUHGRWRHQ
QD$GULR5D]YLGQHVRSHHQHXVHGOLQH
3R GL $GULD LQ VOHGL SDOHRKLGURJUDMH
QD6=REPRMX
3

24

ni a N di Adria (quella orientata NS


e quella orientata N36NO, la coRHCCDSS@ BDMSTQH@YHNMD CH 5HKK@CNse, MARAGNO 1993). Nel caso della centuriazione di Villadose, come
noto, i limites sono correlati ad una
particolare frequenza dellinsediamento di et romana, notevole proprio nellUPA in questione. Tale frequenza, che spicca decisamente rispetto alle zone circostanti, acquista
TM CTOKHBD RHFMHB@SN C@ TM@ O@QSD
attesta la lunga attivit di ricerca sistematica portata avanti dal gruppo
archeologico di Villadose, dallaltra
il fatto che si tratta di siti facilmente rintracciabili mediante survey, e
dunque di un insediamento sostanYH@KLDMSD @NQ@MSD  +@ RHST@YHNMD
dellUPA Po2 non tuttavia univoca,
infatti nelle vicinanze del centro urbano di Adria la situazione si complica per via di un maggiore alluvionaLDMSN ONRSQNL@MN  @MBNQ@ CHBHKD
da cartografare per poter tracciare
un limite preciso nei confronti della
pi recente UPA Ta.
Il quadro di Adria centro urbano
(UPA Adria) stato separato dal resto del territorio come si fatto anche nel caso di Jesolo, di Altino e di
"NMBNQCH@ OQNOQHNODQK@RODBHBHS
CHSHOHBNCDONRHSNOKTQHRSQ@SHB@SNRH
veda infra).

83$GL6DQ%DVLOLR3R
LUPA denominata Po 3 un area
molto limitata, localizzata nella campagna circostante San Basilio, in sinistra Po. Essa costituita da depositi
TUH@KH BGD PTH RH RNMN RNUQ@OONRSH
alle paleodune su cui sorge la chiesa medievale di San Basilio. In queste aree vi sono i resti di un insediamento costiero dellet del Ferro che
prosegue e si sviluppa in et romana, quando probabilmente trova qui
collocazione una stazione di posta
KTMFN HK SQ@FHSSN DMCNK@FTM@QD C@
Ravenna ad Aquileia. Ulteriore continuit si ritrova in et tardoantica ed
altomedievale, come mostra limportante ritrovamento di un complesso
religioso paleocristiano (si veda infra, area di dettaglio di San Basilio,
BNMAHAKHNFQ@@ 
2.4. UPA di Porto Tolle - Po 4
LUPA di Porto Tolle riferita alla
pianura alluvionale e deltizia del Po
di et medievale e moderna ed
suddivisibile in tre sub-unit.
La sub-unit Po 4a costituita dai
RDCHLDMSH TUH@KH CDK /N CH DS LDCHDU@KD  0TDRSH CDONRHSH RNMN HM OHBcola parte (soprattutto allinterno e
nei pressi dellarea golenale) ricoperti
dalle alluvioni recenti dovute al corso

attuale del Po. A Sud di Adria queste


alluvioni creano un piccolo dosso la
cui parte distale ricopre con spessore
inferiore al metro un sottile livello di
torba che, a sua volta, sigilla il livello agrario romano sottostante. In foto
aerea sono ben osservabili, tramite il
fenomeno dei cropmarks, le antiche
scoline riferibili a questultimo livelKNF  #@SHLNKSNHMSDQDRR@MSHOQNvengono dagli scavi di via Spolverin
a Adria (BONOMI, PERETTO, TAMASSIA
1993), che hanno mostrato la sovrapposizione di una necropoli ellenistica
BNODQS@ C@ TM@ RSQ@SHB@YHNMD CH DS
romana sotto un modesto alluvionamento ed un livello di torbe. La zona
comunque stata approfondita mediante larea campione Adria 2, cui
si rimanda (si veda infra, aree di dettaglio). Sembra insomma trattarsi di
unarea a scarsa capacit di drenaggio che ha conosciuto un impaludamento importante in et postromana
ed in seguito un modesto alluvionaLDMSN 0TDRSNG@ODQLDRRNK@ATNM@
conservazione di un paesaggio cenSTQH@KDENRRHKDCHFQ@MCDHLONQS@MY@ 
La sub-unit Po 4b costituita
dai sedimenti deltizi del Po deposti
SQ@D@MMHE@ 0TDRS@4/ 
ENQSDLDMSDHMTDMY@S@C@KKDLNCHcazioni antropiche avvenute in epoca storica. In particolare nel 1604,

il taglio di Porto Viro diede un forte


impulso alla sedimentazione, cambiando radicalmente la conformazione del delta del Po. In circa 2 secoli,
HMSDQBNQRH SQ@ HK S@FKHN D K@ MD 75(((
secolo, la propaggine terminale del
delta del Po avanz di circa 26 km. I
nuovi territori che si crearono furono
HMSDMR@LDMSDBNKNMHYY@SHDANMHB@ti anche nei secoli successivi.
La sub-unit denominata Po 4c
costituisce la porzione pi avanzata
CDK CDKS@ CDK /N F    0TDRS@QD@
costituita da depositi alluvionali
recenti (ultimi 200-250 anni) alternati ad ampi spazi lagunari racchiusi dalla sottile linea di costa attuale
(!.-#$2 -23$% -( 5(-"$-
9("(!(- et alii 2009). Oltre ai
dati geologici appena citati let di
questa UPA facilmente derivabile
C@KK@M@KHRHCDKK@B@QSNFQ@@RSNQHB@
2.5. UPA di Candiana - Ad 1
LUPA di Candiana comprende il
tratto di bassa pianura attribuibile al
TLD CHFD BGDHUHDQ@@SSHUNC@KKDt del bronzo allet romana (PIOVAN
et alii  0TDRS@O@QSDCH
bassa pianura si caratterizza per la
presenza di diversi dossi abbastanza marcati che presentano un andamento generale circa OE. Il pi meQHCHNM@KD  HK OH @MSHBN D BNMTHU@
2

Fig. 4 - Il territorio di Adria nella


Kriegskarte (1798-1805). Sulla carta
sono sovrapposti in giallo i dossi del Po
di Adria desunti da DTM. Si noti la distribuzione delle aree palustri nelle aree di
interdosso.
Sl. 4 - Adria na Kriegskarte (17981805), z rumeno so naneseni con grebeni reke Po di Adria, pridobljeni iz
DMR. Opazna je prostorska razporeditev
PRYLUQLKREPRLMPHGJUHEHQL
4

elementi so podrobno popisani na


ONCDDKITNJNKH CQHDMOZZI, NINFO
2009, NINFO in drugi 2011), pa tudi
RHBDQM@BDKNSMH$ / RHLDQRLND
dodatno obogatili podobo stare pokrajine, ki jo navajajo predhodni avtorji, na primer PERETTO (1993).
2S@QNC@UMH QDMH RHRSDL MHHMD
severno od mesta starodavno poreID UHCDMM@RK   DUQHLRJDLNACNAITMHAHKUD@JSHUDM  QGDNKNJ@
izkopavanja so pred kratkim potrdila
rezultate daljinskih zaznavanj (BACCI
in drugi, 2011). Iz stratigrafske analize izhaja, da so v velikem delu EAP
Pad 2 ostaline rimskih poti in kmeSHIRJHGONUQHMCDKNL@TMHDMDY@Q@di modernega oranja zemlje. V enoti
/@CIDLNFNDNO@YHSHYDKNY@MHLHU
ONC@SDJCUDNCKHMNQ@YUHCMH CDKNma odkriti centuriji severno od Adrie
(prva v smeri S-J, druga, imenovana tudi centurija Villadose, pa s 36
odklonom od smeri S-V, MARAGNO
1993). V primeru centurije Villadosse so limites, kot je znano, povezaMD R ONRDAMN HU@GMN NAHRJ@MNRSIN
v rimskem obdobju, opazno prav v
navedeni EAP. Ta obiskanost, ki zagotovo izstopa v primerjavi z okolikim
ONCQNIDL IDCUNIMDF@ONLDM@M@
DMH RSQ@MH OQH@ N CNKFNSQ@IMH CDI@Unosti sistematskih raziskav, ki jo je
opravila skupina arheologov v kraju


Villadose, na drugi pa o dejstvu, da


FQDY@YK@GJ@RKDCKIHU@M@ICH@RONLNIN STCHID HM SNQDI Y@ M@RDKAHMN 
ki se v bistvu nahaja na povrju.
Vendar pa stanje ni enako v vsej
DMNSH $ / /@C U AKHHMH LDRSMDF@
IDCQ@ CQHD RD M@LQD RHST@BHI@ Y@plete zaradi pogostejih poplav v
obdobju po koncu rimskega imperija
in je zaradi tega delo kartografov e
OQDUDY@GSDUMN C@AHK@GJNY@QS@KH M@S@MMN LDIN Y LK@IN RNRDCMIN
enoto EAP Ta.
.ALNID LDRSMDF@ IDCQ@ CQHD
$ / CQH@RLNKNHKHNCOQDNRS@KDF@
ozemlja, enako smo, prav zaradi speBHMNRSH YM@HKMHG UDOK@RSMHG TRDdlin (glej infra), naredili tudi V primeru Jesola, Altina in Concordie.
($36Y%D]LOLM3DG
$MNS@$ / HLDMNU@M@/@C KDH
M@ YDKN NLDIDMDL NALNIT M@ ONCDDKITNJNKHJQ@I@2U !@YHKHIKDUNNC
/@C@ 2DRSNIHHYQDMHGM@OK@UHM JHRN
se odlagale v pasove med starodavnimi sipinami, na katerih stoji srednjeveka cerkev Sv. Bazilija (11. stoKDSID -@SDLNALNITRNOQ@JSHMN
na povrju dobro vidni ostanki prioA@KMD M@RDKAHMD HY DKDYMD CNAD S@
se kasneje nadaljuje in razvije v rimskem obdobju, ko se je tu verjetno

M@G@I@KN ONHU@KHD NA NAK@FTMski cestni povezavi med Raveno in


Oglejem. Kasneje dokaze o obstoju
naselbine najdemo v pozni antiki in
zgodnjem srednjem veku, kakor izOQHTIDONLDLAMNNCJQHSIDO@KDNJQ@MRJDF@UDQRJDF@JNLOKDJR@FKDI
infra ONCQNAMNNALNIDRU !@YHKHI@ 
YAHAKHNFQ@IN 
($33RUWR7ROOH3DG
Enota EAP Porto Tolle se nanaa
na srednjeveko in moderno poplavMNMHHMNHMTRSIDQDJD/@CHMINK@Gko razdelimo v tri pod-enote.
/NC DMNSN/@C@RDRS@UKI@INQDne naplavine Pada iz srednjega veka.
Majhen del teh naplavin (zlasti v noSQ@MINRSH HM U AKHHMH Y@LNUHQIDMHG
travnikov) je prekrit z naplavinskimi
nanosi nedavnih poplav ob izlitju
C@M@MIDF@SNJ@QDJD/@C )TMNNC
Adrie so te poplave oblikovale slabo
HYQ@DM FQDADM  M@ J@SDQDF@ M@IANKI
oddaljenem delu plast, tanja od
enega metra, pokriva tanek sloj ote,
ta spet pa pod seboj skriva plast
kmetijske zemlje iz rimskega obdoAI@  -@ YQ@MDL ONRMDSJT RN Y@Q@CH
THMJ@ cropsmarks jasno vidni stari
poljski jarki, izdelani v tem zadnjem
sloju (sl. 5). Zelo zanimivi podatki prihajajo iz izkopavanj v ulici via
Spolverin v Adrii (BONOMI, PERETTO,

TAMASSIA), saj so med njimi nali


MDJQNONKNHYGDKDMHRSHMDCNAD OQDkrito s slojem iz rimskega obdobja, ki
sta ga skrivali tanki plasti naplavin in
NSD  .ALNID RLN ONCQNAMN @M@lizirali v okviru vzorca Adria 2 (glej
v nadaljevanju  ONCQNAMNRSH  *@D
SNQDI  C@ FQD Y@ RK@AN CQDM@MN NALNID  JH ID AHKN U NACNAIT ON JNMcu rimskega imperija precej zamoUHQIDMN DJ@RMDIDO@RDIDRNNHKN
STCH Y MDJ@I L@MI NARDMHL ONOK@vljanjem. To zaporedje dogodkov je
NLNFNHKN CNAQN NGQ@MIDMN ENRHKHzirano rimsko centurijsko pokrajino
velikega pomena.
/NC DMNSN/@CARDRS@UKI@INQDni sedimenti ustja Pada, ki so se tu nalagali v obdobju od 600 do 200 let
M@Y@I  -@ SN $ / RN LNMN UOKHU@KD
@MSQNONFDMD ROQDLDLAD U Q@YKHMHG
zgodovinskih obdobjih. Leta 1604
ID Y@Q@CH HYJNO@U@MI Y@ OQHRS@MHD
Porto Viro prilo do izrazitega pojava
sedimentacij in korenite spremembe
HYFKDC@ CDKSD /@C@  5 OQHAKHMN CUDG
RSNKDSIHGNC@R@HYJNO@U@MICNJNMB@
osemnajstega stoletja je glava delte
Pada napredovala kar za 26 km. Novonastala ozemlja so prebivalci tudi
v kasnejih stoletjih intenzivno poseljevali in izsuevali.
Pod-enota, imenovana Pad 4c,
predstavlja zadnji del delte reke

25

Fig. 5 - Ortofoto con tracce della suddivisione agraria di probabile et romana


a sud di Adria.
Sl. 5 - Ortoposnetek s sledovi razporediWYHNPHWLMVNLK]HPOMLYULPVNHPREGREMXMXQRRG$GULH

Fig. 6 - UPA Po 4c (limite in viola) e Po


4b (limite in rosso), su composizione a
falsi colori (Landsat 7, 2002, fonte: U.S.
Geological Survey). In retinato giallo i
depositi costieri, in nero le dune litoranee desunte da telerilevamento.
6O($33RF PHMDYYLMROLQLEDUYL 
LQ3RE PHMDYUGHLEDUYL QDSULND]X
]ODQLPLEDUYDPL/DQGVDW=UXPHQRPUHRVRR]QDHQHREDOQHXVHGOLQHVUQRSDREDOQDOLQLMDYSUHWHNORVWL
6

nel Po di Saline (Po1). Alcuni di questi dossi convergono presso ConselUD ONBN@DRSCDKK@QD@CHRSTCHN 0TH
sono stati condotti dei sondaggi con
datazioni radiocarbonio che indicano una piena attivit di questi antichi percorsi dellAdige in et romana
(PIOVAN 2008PIOVAN et alii 2010,
 0TDRS@4/ BNMM@DHMO@QSD
si sovrappone a quella del Po 1. Le
tracce della via Annia si interrompono in corrispondenza di questi tracciati dellAdige romano (MOZZI, NIN
FO 2009).
83$GL&D(PR$G

26

LUPA di Ca Emo comprende una


sottile striscia di pianura (~11 km2),
localizzata a N di Adria, caratterizzata dalla presenza di un dosso minore che occupa circa la met del area.
Esso attribuibile allattivit sediLDMS@QH@ CDKK CHFDSSN LDCHNDU@KD
le fonti storiche riportano la sua presenza in questo tratto, alimentato da
una derivazione dellAdige per buoM@O@QSDCDK,DCHNDUNC@K7@K75(((
sec. (BALISTA 2004). La copertura al-

luvionale sul piano romano non pare


di spessore costante, nondimeno nel
quadro centuriale/insediativo qui
presente (centuriazione di Villadose ben individuabile in Po 2) si nota
una rarefazione dellinsediamento in
corrispondenza di questa fascia di
territorio (si veda ad esempio MARA
GNO 1993).
83$GL&DYDU]HUH$G
LUPA di Cavarzere costituita dal tratto di pianura interessaSN C@KK@ RDCHLDMS@YHNMD CDK TLD
Adige dallalto medioevo allattuale.
Lazione sedimentaria dellAdige in
questi secoli ha costruito un dosso sabbioso rilevato di alcuni metri, percepibile tramite lanalisi del
microrilievo. Esso inoltre ben individuabile nelle immagini satellitari e
@DQDDF BNLDCDONRHSNR@AAHNRN@C@KS@QHDSS@MY@HMBNMSQ@RSNBNM
HCDONRHSHOHMHKHLHD@QFHKKDNQF@niche) tipici della piana modale con
maggior grado di umidit. Allinterno
di questUPA recente permangono, a costituire il piano campagna

attuale, alcuni limitati lembi di pianura pi antica. Essi sono stati individuati da telerilevamento (NINFO
2009) incrociato con dati archeoloFHBHCHRTODQBHD 4MDRDLOHNC@SN
C@KKHMRDCH@LDMSNQNL@MNHMF D
alcuni ritrovamenti attribuiti allet
del Ferro in prossimit di limitati depositi costieri relitti in sinistra Adige
(MOZZI, NINFO 2009). Su un piano
pi generale non tuttavia possibile dire quanto linsediamento romaMNRH@DDSSHU@LDMSDRDONKSN HME@SSH HK C@SN @QBGDNKNFHBN RSQ@SHFQ@BN
da questo punto di vista carente.
Stando alla carta del noto ed al telerilevamento le strutture agrarie e
il popolamento antico sembrano comunque abbastanza visibili e relativamente frequenti.
83$GHO7DUWDUR7D
Il Tartaro-Canal Bianco-Po di LeU@MSDTMTLDLHMNQD@KHLDMS@SN
C@KKD QHRNQFHUD M@RBD @ /NUDFKH@MN
Veronese e dopo circa 150 chilometri sfocia nel mare Adriatico, tra le
foci dellAdige e del Po.

Nel tratto iniziale di circa 53 chiKNLDSQHHKRTNBNQRNM@STQ@KDHKSQ@Sto centrale (Canalbianco) e quello


terminale (lungo il ramo del Po di LeU@MSDRNMNHMUDBD@QSHBH@KH +DENMti riportano che il Tartaro lambiva
lateralmente Adria passando a nord
della stessa in una posizione analoga a quella dellAdigetto.
In seguito alle numerose alluvioni tardo-antiche per alcuni secoli si
perdono le informazioni su questo
TLD BGD OQNA@AHKLDMSD @KHLDMS@va una delle numerose paludi poste tra i dossi dellAdige e del Po. Il
3@QS@QN G@ HMMD RDFTHSN TM SQ@SSN
del ramo del Po di Adria (VEGGIANI
1972, 1974). Il Canalbianco raggiunFD K@ BNMFTQ@YHNMD @SST@KD UDQRN
K@ LDS CDK 75(( RDBNKN  CHUDMS@MCN
lunico distributore delle acque del
3@QS@QN MDK 7(7 RDBNKN BHQB@  /QHL@ H
CDTRRH UDMHU@MN O@QYH@KLDMSD CDrivati nel canale del cosiddetto Castagnaccio che per dava spesso
OQNAKDLH HCQ@TKHBH F    HM PT@MSN
sottodimensionato alla portata. La
parte di foce stata incanalata in un
antico braccio del Po chiamato Po di


/@CRK  3NNALNIDSUNQHINOQDBDI


RUDD @KTUHI@KMD M@OK@UHMD Y@CMIHG
200-250 let), ki jih tu in tam prekiMI@INNARDM@NALNI@K@FTMD NLDjene s tankim pasom dananje obale
(BONDESANSTEFANI, VINCEN
ZICIBIN in drugi 2009). Poleg
upotevanja pravkar omenjenih geolokih podatkov je starost te EAP
LNFNDDMNRS@UMNTFNSNUHSHHYYFNdovinskih zemljevidov.
($3&DQGLDQD$G
$ /"@MCH@M@NARDF@CDKMHHMD 
JH ID QDYTKS@S @JSHUMNRSH QDJD CHD
ta je tu tekla med bronasto dobo in
rimskim obdobjem (PIOVAN in drugi
    9@MIN RN YM@HKMH SDUHKMH OQDBDIHYQ@YHSHQDMHFQDADMH JH
UDHMNL@ONSDJ@INURLDQHNCY@GNC@OQNSHUYGNCT -@IITMDIHHMGJQ@SH
tudi najstareji se je izlival v Pad Saline (Po1). Nekaj izgonskih grebenov
RDYCQTHUAKHHMHJQ@I@"NMRDKUD MDkoliko bolj vzhodno od projektnega
NALNI@  3TJ@I RN RD NOQ@UHKD Q@YHskave z radiokarbonskim datiranjem,
ki potrjujejo, da so bili ti starodavni
QDMH SNJH CHD YDKN @JSHUMH U QHLskem obdobju (PIOVAN  PIO
VAN in drugi 2010, 2012). EAP meji
in delno sovpada z enoto Po 1. Sledi
rimske ceste via Annia se pri starih
QDMHGRSQTF@G CHDOQDJHMDINMO
ZZI, NINFO 2009).

Fig. 7 - Ortofoto 2009 del territorio di


Cavarzere, attraversato dal dosso dellAdige (Ad 3). Al limite orientale dellimmagine sono evidenti i sistemi costieri
relitti Co 1 e Co 2. Sono inoltre ben visibili le tracce di numerosi canali di rotta.
6O2UWRSRVQHWHNRVUHGRWRHQ
QD&DYDU]HUH5D]ORQRMHYLGHQJUHEHQ
$GLH $G LQRSXHQLREDOQLVLVWHPL
&RLQ&R Y6=GHOX=HORXLQNRYLWR
je tudi prepoznavanje manjih elemenWRY SDOHRKLGURJUDMH NRW VR PDQMH
XVHGOLQHUGHNDVWHEDUYHNLMLKYHUMHWQR
lahko pripiemo reki Frassine.
7

$ / "@ $LN UJKITTID NYDJ O@R


MHHMRJDF@ RUDS@ ] JL2) severno
NC CQHD J@SDQDF@OQHAKHMNONKNUHBN
Y@RDC@L@MIHQDMHHYFNMRJHFQDADM 
Nastal je zaradi dejavnosti srednjeUDJDF@ SNJ@ QDJD CHFDSSN N MIDI
OQH@IN YFNCNUHMRJH UHQH  Y UNCN O@
naj bi ga dober del srednjega veka
od 10. do 18. stoletja napajal eden
NC QNJ@UNU CHD  BALISTA 2004).
Naplavinski nanos na sloj iz rimskega obdobja ni enakomeren, pa vendar se v centurijsko - naselbinski podobi krajine (centurija Villadose je
dobro vidna v enoti Po 2) opazi, da
se poseljenost na tem ozemeljskem
O@RT YQDCH FKDI M@ OQHLDQ MARA
GNO 1993).

odlaganjem naplavin v teh stoletjih


oblikovala nekaj metrov visok peDMHM@RHO JHF@IDLNFNDOQDONznati z analizo mikro-reliefa. Poleg
tega je greben dobro viden tudi na
R@SDKHSRJHG HM YQ@MHG ONRMDSJHG RK 
 JNS UHRNJNNCANIMH ODDMH CDpozit, v izrazitem nasprotju z bolj
drobnozrnatimi depoziti (mulj in orF@MRJDHKNUHBD JHRNRHBDQYM@HKMHY@
UK@MDIN ONOK@UMN Q@UMHBN  -@ SDI
LK@IH $ / SUNQHIN SQDMTSMN ONUQje pokrajine tudi nekateri prostorsko
NLDIDMHEQ@FLDMSHMHHMDHYRS@QDIDF@NACNAI@ .CJQHKHRNIHGRONLNIN
kombinacije daljinskega zaznavanja
(Ninfo 2009) in povrinskih arheolokih podatkov. Tak primer je rimska
naselbina na sl. 8 in nekatere najdbe
U AKHHMH NA@KMHG M@OK@UHM M@ KDUDL
AQDFT CHD  JH IHG @QGDNKNFH TLD@INUDKDYMNCNANMOZZI, NINFO
2009). V irem pomenu pa ni mogoDTFNSNUHSH JNKHJNQHLRJDM@RDKAHMD
je dejansko pokopane pod povrjem,
saj so arheoloki stratigrafski podatki pomanjkljivi. Glede na zemljevide
poznanih elementov in na daljinska
zaznavanja pa smo mnenja, da sta
kmetijska ureditev in poseljenost iz
@MSHMDF@ NACNAI@ OQDBDI Y@RSNO@MH
in razmeroma gosto posejani.

($3&DYDU]HUH$G

($37DUWDUR7D

EAP Cavarzere predstavlja del


MHHMRJDF@ RUDS@  JH ID M@RS@K HY M@OK@UHMQDJD CHDUNACNAITNCRQDCMIDF@ UDJ@ CN C@MDR  CH@ ID Y

Tartar-Canal Bianco-Po di LevanSD ID L@MI@ QDJ@ Y HYUHQNL U MHHMH


izvira v Poveglianu Veronese in se po
OQHAKHMNJHKNLDSQHGLDCTRSID-

($3&D(PR$G

L@QDJ CHDHM/@C@HYKHU@U)@CQ@Msko morje.


5RUNIDLY@DSMDLCDKT CNKFDL
OQHAKHMN  JHKNLDSQNU  ID MIDM SNJ
naraven, srednji (Canalbianco) in zaJKITMH NCRDJ NA QNJ@UT /N CH +Dvante) pa sta umetna. Viri navajajo,
C@ RD ID 3@QS@QN HYNFMHK CQHH HM IN
obel severno v podobnem poteku,
kakren je tisti, ki ga danes zavzema reka Adigetto. Zaradi tevilnih
ONYMN@MSHMHG ONOK@U RD ONC@SJH N
tej reki za nekaj stoletij dolgo izguAHIN ON URDI UDQIDSMNRSH ID M@O@I@K@
DMNSDUHKMHGLNUHQHILDCRSQTF@L@
CHDHM/@C@ 3@QS@QNIDURUNIDLY@JKITMDLNCRDJTRKDCHKCDKTQDMDF@
rokava Pada Adrie (Po di Adria) (5$&
GIANI 1972, 1974). Svoj dananji
izgled je Canalbianco dobil na polovici sedemnajstega stoletja, samo
dve stoletji kasneje (v 19. stoletju)
pa je postal edini vir napajanja TarS@Q@ /QDCSDLRDIDQDM@UNC@CDKMN
OQDTRLDQI@K@UJ@M@K"@RS@FM@BBHN 
RJ@SDQHLO@RNAHKDONFNRSNSD@UD
RK  R@IIDAHKOQDL@IGDMY@JNKHHno vode, ki je vanj dotekala. Del ustja
se je v 19. stoletju preusmeril v staQNC@UMHQNJ@U/@C@ HLDMNU@M/NCH
levante.
EAP Tartaro je torej prostorsko
NLDIDM@ M@ MHHMRJH RUDS ITMN NC
CQHD JIDQRNUHCMDRKDCHMDC@UMDga nalaganja naplavin tega manjDF@UNCNSNJ@ 9@DMNSNIDYM@HKM@
neprekinjena vrhnja plast, ki prekriU@ ONC MIN KDDD RKNID HY QHLRJDF@
NACNAI@ CDADKHM@ OK@RSH MHG@ HM ID

lahko ponekod precej izrazita (do


2-3 metre nad spodnjim rimskim
RKNIDL  3N ID LNFND NO@YHSH OQH
RK@UMHG GDKDMHRSHMHG HM QHLRJHG MDJQNONK@G U JQ@IHG "@ &@QYNMH  "@M@K
Bianco in Piantamelon, ter na nekaSDQHGM@ICHHGHYQHLRJDF@@R@ONUYDSDJ HY OQDCGNCMD AHAKHNFQ@ID U
MIMMO 2006). Naa raziskovanja na
UYNQMDLNALNIT CQH@RONLNIN NBDMD M@OK@UHMRJHG M@MNRNU HY
obdobja po koncu rimskega imperija
in po koncu srednjega veka so nam
NLNFNHK@ CNC@SH NARSNIDHL D
nova dognanja (glej v nadaljevanju,
ONCQNAM@NALNI@

 ($3 %  7
(sp, cn, sc, cm, af, pm)
($30HVWUH%U
$ /,DRSQDRNUO@C@YCDKNLMHHne med reko Sile in kanalom Brenta,
ki spadata med bolj oddaljene rokave sedimentacijskega sistema Brente
(veliki naplavinski sistem - megafan
U!@RR@MT @RY@CMIDF@ONUD@MI@
tega poplavnega sistema sega v zadnjo ledeno dobo (LGM - Last Glacial
Maximum). V obdobju pred 26.000
HM KDSHRNUR@LNMDJ@ISHRNletij nastali precej metrov debeli naMNRHRDC@MIHONUQHMRJHHYFKDCMHHMD
IDQDYTKS@SSDF@NARDMDF@RDCHLDMtiranja iz pozne pleistocenske dobe.
Celotni sistem je zaradi vpliva vrhnjih plasti megafana v predgorskem

27

Fig. 8 - Tracce di un insediamento romano nei pressi di Cavarzere (CAV, IV, 1994,
p. 117) (da NINFO 2009).
Sl. 8 - Sledi rimske naselbine v okolici
kraja Cavarzere (CAV, IV, 1994, str. 117,
44) (iz NINFO 2009).
8

KDU@MSDRDLOQDMDK7(7RDBNKNBHQB@
LUPA del Tartaro dunque limitata spazialmente alla parte di bassura a sud di Adria che mostra segni
di attivit sedimentaria recente
attribuibile a questo corso dacqua
LHMNQD  0TDRS4/  RH RNUQ@OONMD
costantemente ai livelli di et romana, pur con variazioni di spessore,
che a tratti appaiono assai marcate
MN @  L C@K O C B   "H OT
essere constatato nel caso delle famose necropoli ellenistiche e romane di Ca Garzoni, del Canal Bianco
e di Piantamelon, oltre ad alcuni siti
di et romana (sintesi con bibliogra@OQDBDCDMSDHMMIMMO 2006). Le
nostre esplorazioni nellarea campione Adria 3 ci hanno permesso di
aggiungere altre osservazioni al riguardo, mediante la valutazione di
apporti alluvionali postromani ed
anche postmedievali (si veda infra,
aree di dettaglio).

/83$%
7
(sp, cn, sc, cm, af, pm)
83$GL0HVWUH%U

28

LUPA di Mestre corrisponde alla


porzione di pianura compresa tra
Sile e Naviglio Brenta che ricade
nelle propaggini distali del sistema
deposizionale tardopleistocenico
del Brenta (megafan di Bassano). Il
momento di ultima aggradazione
di questo apparato alluvionale da
ascriversi allUltimo Massimo Glaciale (LGM - Last Glacial Maximun).
Tra 26.000 e 17.500 anni fa ci fu
la deposizione di parecchi metri di
sedimenti in poche migliaia danni:
K@SST@KD RTODQBHD CDKK@ OH@MTQ@ 

il risultato di questo grande evento


sedimentario tardo-pleistocenico.
La disattivazione dellintero sistema avvenne per incisione dellapice
del megafan nellarea pedemontana, in un intervallo temporale indicativamente compreso tra 17.500
e 11.000 anni fa (FONTANA et alii
BONDESAN et aliiMOZ
ZI et alii 2013). Al momento della
formazione della laguna, circa 6000
anni fa, la pianura in questo settore
non era dunque pi attiva, ed stata
in parte passivamente ricoperta dai
depositi lagunari. Durante lOlocene
FKH TMHBH RHRSDLH TUH@KH @SSHUH RNMN
stati quelli dei corsi dacqua di risorgiva: Sile, Zero, Dese e Marzenego.
0TDRS@4/ QHBNODQS@C@KKD4/ 
di Dolo e di Camponogara (depositi
olocenici del Brenta) a sud e dallUPA del Sile a nordest. Oltre la conterminazione lagunare, lunit di Mestre
continua al di sotto dei depositi lagunari e dei riporti antropici, che la
ricoprono per spessori di alcuni metri. In particolare, i depositi recenti
dellunit di Dolo non hanno coperto completamente i sedimenti pleiRSNBDMHBH  K@RBH@MCN @NQ@QD @KBTMD
piccole aree dellunit di Mestre anche a sud del Naviglio Brenta.
Lintera area caratterizzata dal
RTRRDFTHQRH CH CNRRH TUH@KH D @QDD
interdossive. I dossi sono strutture
piuttosto ampie, con larghezze mediamente comprese tra 500 e 1000
m, e altezze rispetto alla pianura
circostante normalmente inferiori
@  L BNLOKDRRHU@LDMSD LNRSQ@MN
un andamento generale NO-SE, che
al margine orientale e meridionale
dellunit tende a divenire ovest
est. Il dosso di Scorz tra le strutture pi estese dellintero megafan di
Bassano, presentando una lunghez-

za complessiva di circa 40 km tra la


localit di origine (Resana) e la terminazione nei pressi dellaeroporto
Marco Polo.
(MDDSSH ODQPT@MSNBNMBDQMDKD
E@RH OH @MSHBGD C@K ,DRNKHSHBN MN
allet del Bronzo), si registrano scelte preferenziali per tali aree dossive.
Le testimonianze preclassiche sembrano concentrarsi inoltre in riferimento ai paleoalvei del Carmason e
del Dese, e attorno al comprensorio
altinate, oltre che sui rilevati dei dosRH CH 2BNQY D CH ,NFKH@MN ,@QBNM
anche la fascia perilagunare vicina
alla via Annia sembra aver determinato alcune scelte insediative. Let
del Ferro segna un netto concentrarsi di insediamenti e necropoli nellarea urbana e suburbana di Altino,
anche in riferimento ad una viabilit che sembra in seguito ripresa in
et romana (vie Claudia Augusta e
Annia).
Let romana, oltre al potenziamento del comprensorio urbano
altinate, vede la presenza di alcune lineazioni territoriali a carattere
centuriale che rispecchiano sia un
RHRSDL@ @KSHM@SD RDSSDMSQHNM@KD CH
recente individuazione (BONDESAN,
MENEGHEL 2004, p. 253), sia un siRSDL@ LDQHCHNM@KD  RH@ HMMD KDLAH
della pertica di Padova nord-est (a
S del dosso di Spinea). La presenza
di diversi sistemi parcellari, unitamente alla relativa frequenza di attestazioni, ha portato allinterpretazione di un insediamento romano
capillarmente distribuito, che, pur
risentendo delle suddivisioni centuriali, sembra ancora trovare nella presenza di corsi dacqua e nella
viabilit uno dei fattori distributivi.
La recente attenzione per le successive epoche postclassiche si con-

centrata sullarea urbana di Altino, in


concomitanza con una serie di studi
volti ad accertarne il destino in et
altomedievale soprattutto in rapporto con Torcello e la nascente Venezia
(CALAON 2006a). Per let medievale importante segnalare il centro
storico e larea urbana di Mestre, oggetto negli ultimi anni di alcuni interventi di archeologia urbana che
si sono concentrati soprattutto sugli
aspetti urbanistici di et bassomedievale e moderna.
83$GL&DPSRQRJDUD%U
e del Cornio - Cr
+4/  CH "@LONMNF@Q@ @NQ@
ampiamente nel settore centromeridionale del territorio provinciale
veneziano e in piccola parte in quello padovano, indicativamente tra le
KNB@KHSCH"@KBQNBHD"NQSD MN@KK@
BNMSDQLHM@YHNMDK@FTM@QDF   
nord-est lunit sepolta al di sotto
dei depositi dellUPA di Dolo formatasi nel corso dellultimo millennio,
mentre a sud coperta dai depositi
del Brenta di et del Ferro e romana
(UPA di Arzergrande).
Lunit caratterizzata dallalternarsi di zone dossive e aree depresse interdossive formatesi a seguito
dellattivazione e disattivazione dei
U@QHQ@LHCDKTLD!QDMS@BGDG@MMN
costruito questa porzione di bassa
pianura.
Esternamente allarea Parsjad
F    OQDRDMSD TM CNRRN BGD
attraversa Tombelle e si biforca nei
pressi di Vigonovo proseguendo verso est sino a Camponogara (dosso
di Foss), e verso sud-est sin quasi
a Premaore (dosso di Vigonovo), per
poi perdere di evidenza morfologica
e interrompersi. Lungo il medesimo
asse, circa 1 km a sud-est di Camponogara, inizia un altro sistema dossivo molto articolato, passante per
Campagna Lupia e allungato verso
Lova (dosso di Campagna Lupia).
La presenza di estesi corpi sabbiosi nella soluzione di continuit tra il
dosso di Foss e il dosso di Campagna Lupia suggerisce la possibilit
che le due strutture, pur separate dal
punto di vista morfologico, siano in
realt segmenti di un unico apparato
CDONRHYHNM@KD TUH@KD  5DQRN LNMte il dosso che passa per Tombelle
non sembra in continuit morfologica con il dosso di Stra (appartenente
allunit di Dolo di formazione pi


NALNIT C@M@MIDF@ /HDLNMS@ OQDMDG@KCDKNU@SHUNJUHQMDL@RNUMDL


obdobju od 17.500 do 11.000 leti
nazaj (FONTANA in drugiBON
DESAN in drugiMOZZI in drugi
 5@RTM@RS@I@MI@K@FTMDOQDC
OQHAKHMNKDSSNQDIMHHMRJHRUDS
M@SDLONCQNITMHAHKUD@JSHUDMHM
so ga deloma pasivno prekrile lagunske naplavine. Med holocenom so
AHKH DCHMH @JSHUMH QDMH SNJNUH SHRSH Y
MHHMRJHLHJQ@JHLHHYUHQH2HKD 9DQN 
Dese in Marzenego.
EAP sovpada na jugu z enotami
EAP Dolo in Camponogara (holocenski nanosi Brente), na severovzhodu
pa z EAP Sile. Enota Mestre se onstran meje z laguno nadaljuje pod
K@FTMRJHLH HM @MSQNOHMHLH M@MNRH 
katerih sloj je debel nekaj metrov.
Nedavni nanosi v enoti Dolo niso v
celoti prekrili pleistocenskih naplaUHM Y@SNRNL@IGMDONUQHMDUITMN
od plovnega kanala Brente v enoti
Mestre na povrju.
9@ BDKNSMN NALNID RN YM@HKMH
QDMH HYFNMRJH FQDADMH HM LDC MIHLH
KDD@ NALNI@  &QDADMH RN OQDBDI
NJ@SH  R@I ID MIHGNU@ ONUOQDM@
irina med 500 in 1000 m, viina v
OQHLDQI@UNYNJNKHJHLMHHMRJHLQDKHDENLO@NAH@IMNL@MIJNSCU@LDSQ@ UDHM@ IHG ONSDJ@ U RLDQH 29 )5 
NA UYGNCMH HM ITMH LDIH DMNSD O@
se nekoliko usmerijo proti Z-V smeri. Greben v Scorzeju je med najveIHLH RSQTJSTQ@LH BDKNSMDF@ RHRSDL@
bassanskega megafana, saj je njeFNU@RJTOM@CNKHM@J@QJLLDC
1DR@MN JIDQ RD FQDADM Y@DMI@ HM
Y@JKITJNL U AKHHMH KDS@KH@ ,@QBN
Polo.
Pravzaprav so staroselci iz najstarejih obdobij (od mezolitika do
bronaste dobe) za poselitev najraID HYAHQ@KH OQ@U ONANI@ SDG FQDADMNU  *@D O@ STCH  C@ RN OQHDU@MI@
HY OQDCJK@RHMD CNAD ONFNRSDI@ U
AKHHMHRS@QHGQDMHGRSQTF"@QL@RNM@
in Deseja, okoli vzpetin dananjega
Altina ter na grebenih pri Scorzeju in
,NFKH@MT ,@QBNMTO@STCHNALNID
NAK@FTMHUAKHHMHJ@RMDIDUHD MMHD
IDNHSMNOQHU@AHKNMDJ@SDQDRS@QNRDKBD JHRNRDM@MIDLTRS@KHKH 5DKDYMH
dobi je prilo do izrazite rasti naselbin in nekropol v mestnem in primeRSMDLNJNKIT KSHM@ NDLDQOQH@IN
tudi zgrajene cestne povezave, ki so
jih po vsej verjetnosti obnovili v rimskem obdobju (cesti via Claudia Augusta in via Annia).


Fig. 9 - Particolare della Corographia


dello Stato di Ferrara con le vicine parti
delli altri Stati che circondano di Giambattista Aleotti (1603), Ferrara, Vittorio
Baldini Stampator Camerale, Biblioteca
Ariostea di Ferrara, mappe serie XIV-41.
Sl. 9 - Podrobnost iz Corographia dello
Stato di Ferrara con le vicine parti delli
altri Stati che circondano (Krajepis DrDYH )HUUDUH LQ EOLQMLK GHORY RNROLNLK
GUDY  DYWRUMD *LDPEDWWLVWD $OHRWWLMD
(1603).
9

V rimskem obdobju je poleg irjenja mestne zasnove Altina prilo


tudi do nekaterih linearnih razmejitev v obliki centurij, ki so lepo vidne
v kratkim odkritem sistemu severneF@ CDK@ NALNI@ NJNKH KSHM@ BON
DESAN, MENEGHEL 2004, str. 253),
O@ STCH ITMDL RHRSDLT HM L@IGMHG
odsekih severovzhodno od Padove
(severno od grebena v Spinei). PriRNSMNRS Q@YKHMHG RHRSDLNU CDKHSUD
zemlje je poleg pogostih dokazov o
poseljenosti privedla do domneve o
kapilarni zasnovi rimske naselbine, ki
se kljub delitvi na centurije zdi predURDLNCUHRM@NCQDMHGSNJNU NAJ@terih se je irila. Nedavno zanimanje
Y@ NACNAI@  JH RKDCHIN JK@RHMH CNAH 
RD ID NRQDCNSNHKN M@ ONCQNID LDRSMDF@IDCQ@ KSHM@SNUQRSMDQ@YHRJ@ve sovpadajo z vrsto tudij, katerih
namen je bil ugotoviti, kakna je bila
njegova usoda v srednjem veku, zlasti v odnosu s Torcellom in nastajajoHLH !DMDSJ@LH CALAON 2006a). Iz
srednjevekega obdobja je zanimivo
staro mestno jedro in mestno tkivo
Mester (Mestre), kjer so nekateri posegi urbane arheologije zadnjih letih
posebno pozornost namenili urbaniRSHMHLQDHSU@LRQDCMIDUDJDHMRNdobne mestne zasnove.
($3&DPSRQRJDUD%U
in Cornio - Cr
EAP Camponogara pokriva velik
CDKRQDCMIDF@HMITMDF@RDJSNQI@NALNI@ ONJQ@IHMD !DMDSJD SDQ L@MIH
CDK NALNI@ ONJQ@IHMD /@CNU@ LDC
kraji Calcroci in Corte pa vse do meje
z laguno (sl. 10). Na severovzhodu
KDH ONC RKNIDL M@MNRNU DMNSD $ /

#NKNHYY@CMIDF@SHRNKDSI@ UMIDMDL
ITMDLCDKTO@INONJQHU@INM@OK@UHMD QDJD !QDMSD HY DKDYMD HM QHLRJD
dobe (EAP Arzergrande).
9@DMNSNRNYM@HKMHOQDGNCHLDC
izgoni in depresijami, ki so nastali
JNSONRKDCHB@CDKNU@MI@Q@YKHMHGQNkavov reke Brente, glavnega akterja
OQHNAKHJNU@MITJNMMDONCNADSDF@
CDK@O@CRJDMHHMD 
9TM@I LDI@ NALNHI OQNIDJS@
Parsjad (glej sl. 10) se nahaja greben,
JHOQDJ@3NLADKKDHMRDUAKHHMH5HFNMNU@ Q@YCDKH M@ CU@ CDK@ OQUH RD
nadaljuje proti vzhodu do Camponogare (nanos Fosso), drugi pa proti jugovzhodu skoraj do Premaora (nanos
5HFNMNUNHMRDS@LROTRSHCNMHHMD 
-@HRSHNRH OQHAKHMNJLITFNUYGNCMNNC"@LONMNF@QD RDY@MDCQTF 
YDKN Q@YKDMIDM FQDADMRJH RHRSDL  JH
poteka ob Campagni Lupii in se nadaljuje proti Lovi (greben Campagne
+TOHD  .ARDMD R@LNRSNIMD ODDne gmote med grebenom Fosso in
FQDADMNL "@LO@FM@ +TOH@ J@DIN
M@ LNMNRS  C@ RS@ NAD Y LNQENKNJDF@UHCHJ@KNDMHRSQTJSTQHUQDRMHBH
CDKDMDF@R@LDF@RHRSDL@QDMHGM@OK@UHM 9@DSMHCDKFQDADM@UAKHHMH
3NLADKK MD J@D  C@ AH AHK LNQENKNko povezan z grebenom Stra (ki pripada enoti Dolo in je nastal kasneje),
R@IRS@RKDCMI@LDCRDANIKNDM@
V smeri proti jugu v kraju Liettoli
naletimo na greben, katerega glavna
os se nadaljuje proti vzhodu mimo
Boiona skoraj do Love (greben Boion), njegov manji krak pa se usmeri
nekaj kilometrov bolj jugovzhodno
mimo kraja Campolongo Maggiore in
se porazgubi pri kraju Corte (vzpetina Campolongo). Grebenoma Boion

HM "@LONKNMFN RD OQHOHRTID UDI@


starost kot veji, ki se odcepi pri Noventi Padovani in se nadaljuje proti
"@LHMT RKDCMI@ RD J@RMDID Q@YBDOH
M@UDCDKNU OQUHOQH5HKK@SNQH CQTFHO@OQH2@MS MFDKTCH/HNUDCH2@cco (cfr. EAP Arzergrande).
S kronolokega vidika lahko enoto Camponogare uvrstimo v obdobje
med srednjim in poznim holocenom.
Domneva o starosti se opira na neJ@SDQ@ M@ SDL NALNIT NOQ@UKIDM@
datiranja 14. V geolokem preseku,
NOQ@UKIDMDL OQDMN M@ ONSDJ FQDbena Camponogara (BONDESAN in
drugi 2008) je dobro vidna velika peDM@ FLNS@ J@M@K@ HQHMD M@IL@MI
 L HM CDADKHMD UD JNS  L M@
podlagi datiranja organskih materialov v velikem glinenem koritu v gloAHMH LDSQNUIDAHKNLNFNDCNKNHSHRS@QNRSoKDS!/RK  D
interpretiramo ta naravni bazen kot
NOTDMN QDMN JNQHSN  U J@SDQN RN
se nalagali kasneji sloji, ta datacija
J@D M@ YFNCNUHMRJH SQDMTSDJ  JN ID
ONC MIHL KDDH J@M@K OQDMDG@K CDlovati.
Tudi datacija vzorca, ki je pripaC@KODDMHQDMHFLNSHHMRNF@NCvzeli v levem kanalu Brente v globini
-1,9 metra pod povrjem, ob osi grebena Campolongo, je pokazala podobno starost kot vzorec iz grebena
"@LONMNF@Q@ SNQDIoKDS!/
(TOSI in drugi 2007).
Leseni fragment iz globin lagune
O@IDC@SHQ@MUoKDS!/M@KH
smo ga v globini osmih metrov pod
CMNLK@FTMDLDCODDMHLHM@OK@UHM@LHHYQDMDF@TRSI@UJQ@IT5@KKD
Averto (TOSI in drugiEQ@FLDMS
J@DM@OQHRNSMNRSM@IRS@QDIHGGNKN-

29

30

recente) presentandosi staccato da


questultimo.
Spostandosi verso sud, presso la
localit Liettoli, si incontra un dosso
che prosegue con un tracciato prinBHO@KDUDQRNDRSODQ!NHNMMNPT@si a Lova (dosso di Boion), mentre
uno secondario si dirige per qualche
chilometro verso sud-est per Campolongo Maggiore morendo a Corte
(dosso di Campolongo). Ai dossi di
Boion e Campolongo viene attribuita
unet pi antica rispetto al periodo
di attivazione del ramo che si stacca da Noventa padovana dirigendosi verso Camin e che giunge, dopo
essersi suddiviso in pi rami, prima
presso Villatora e poi a SantAngelo
di Piove di Sacco (cfr. UPA di Arzergrande).
Dal punto di vista cronologico,
lunit di Camponogara ricade in un
arco temporale compreso tra lOlocene medio e lOlocene superiore.
Tale attribuzione si basa sullet risultante da alcune datazioni 14C effettuate in questarea. In una sezione
geologica eseguita trasversalmente
al dosso di Camponogara (BONDE
SAN et alii 2008) ben riconoscibile
un grosso corpo sabbioso di canale,
largo almeno 400 m e con spessore
superiore a 5 m: la datazione di maSDQH@ NQF@MHB@ CHTR@ @KKHMSDQMN CH
una lente argillosa presente tra 2 e
L G@ENQMHSNTMDSCHo
anni BP. Interpretando tale lente
come la base del riempimento residuale di un alveo abbandonato, la
C@S@YHNMD HCDMSHB@ HK LNLDMSN CH
disattivazione del sottostante corpo
di canale.
Anche la datazione di un campioMD@OO@QSDMDMSD@TMBNQONTUH@KD
sabbioso, prelevato in sinistra Brenta
a 1.9 m dal piano campagna, lungo
la direttrice del dosso di Campolongo, ha fornito unet simile a quella
rilevata per il dosso di CamponogaQ@ O@QH@o@MMH!/TOSI et
alii 2007).
Allinterno del bacino lagunare,
HMUDBD K@C@S@YHNMD@o@MMH
BP di un frammento ligneo rinvenuto alla profondit di circa otto metri
@KKHMSDQMN CH R@AAHD TUH@KH CH @Lbiente deltizio in localit Valle Averto (TOSI et alii 2007), indica la preRDMY@ CH RDPTDMYD TUH@KH NKNBDMHche pi antiche nel sottosuolo della
K@FTM@ OQNROHBDMSD K@QD@KD CH @Nramento dellunit di Camponogara.

Allinterno dellUPA di Campogara stata delineata lUPA del Cornio.


Il corso del Cornio, che attualmente
corrisponde a un modesto canale di
scolo destinato a scaricare in laguna leccedenza delle acque piovane
riversatesi sulla pianura, deve aver
conservato attraverso il tempo sempre la medesima funzione e la stessa
ONRHYHNMD K@KUDN CDK "NQMHN RH RUHluppa, infatti, lungo una depressione interdossiva e il suo corso corrisponde al tragitto pi breve per arrivare da Padova al margine lagunare.
Giunge in laguna nei pressi del sito
di Lova e prosegue quindi come canale lagunare in direzione della bocB@ CH ,@K@LNBBN MDK 75( RDBNKN G@
@MBGDQ@BBNKSNHCDTRRHCDK!QDMS@ 
La delineazione di questa UPA limitata allintorno del canale attuale.
Il quadro archeologico mostra
indicativamente due situazioni, una
riscontrabile a nord del dosso di Boion, laltra a sud. Per la parte nord vi
una certa scarsit di attestazioni
pre-protostoriche, mentre quelle relative allet del Ferro sono maggiori.
Recenti ricerche attuate e pubblicate soprattutto nel comune di Campagna Lupia (GORINI 2011) hanno
mostrato che i livelli protostorici
SDMCDQDAADQN @C @NQ@QD  ODQ@KSQN
con reperti che si concentrano nella seconda et del Ferro. Come gi in
numerose altre zone risulta particolarmente ben attestata la presenza
di materiale romano, per lo pi da
Q@BBNKSD CH RTODQBHD  (M O@QSD RDLbra attribuibile ad un territorio profondamente romanizzato, ed organizzato, oltre che dal punto di vista
infrastrutturale/viario (portuosit,
ma solo ipotetica, collegata al Meduacus Minor e probabile passaggio
della via costiera) anche da quello
territoriale e rurale per la presenza
CH TM MTLDQN RHFMHB@SHUN CH HONSDSHBHDCHBHQTRSHBH 4M@O@QSHBNK@QDNQganizzazione del territorio richiama
lalveo del Cornio, un corso minore
nel quale potrebbe aver transitato
uno dei rami del Medoacus, in particolare quello attivo dallet del
Ferro allet augustea (BONDESAN,
MENEGHEL 2004, pp. 294-295. Si
veda anche MATTEAZZI 2011, p. 69).
(MDDSSHK@YNM@ DHKRTOONRSN@KUDN 
interessata da alcune tracce molto importanti: una concentrazione di
rinvenimenti ad est di Lova, forse un
insediamento itinerario (et prero-

L@M@DQNL@M@HKR@MST@QHNCH+NU@ 
risalente al II secolo a.C. (BONOMI,
MALACRINO 2011) in chiaro collegamento con una via dacqua attiva
@KLDMN MN @KK@ OQHL@ DS HLODQH@KD HMMD KHMRHDLD CDKKHMRDCH@LDMto di et altomedievale e medievale,
come messo in luce dalle recenti ricerche (CORR 2008-2009).
Nel settore S si rimarcano le attestazioni pre-protostoriche sul dosso
di Boion, ed altre pertinenti allet
del Ferro. Anche in questo caso, relativamente allet romana, pu essere notato un fenomeno di evidente
concentrazione dei siti direttamente proporzionale allo sviluppo delle
ricerche. La recente pubblicazione
della carta archeologica di Campagna Lupia (GORINI 2011) mostra sia
lungo la frangia lagunare attuale, sia
nellentroterra ad ovest della fascia
occupata dalla Via Annia, un chiaro
concentrarsi dei rinvenimenti di et
QNL@M@ PT@RHSTSSHHMRTODQBHD
83$GL$U]HUJUDQGH%U
LUPA di Arzergrande corrisponde
alla porzione del territorio provinciale padovano situata allintorno del
dosso di Arzergrande, lungo la direttrice Arzergrande - Vallonga - CodeUHFN  +@QD@ RH DRSDMCD @ RTC MN @K
dosso che si sviluppa lungo il corso
attuale del Bacchiglione, mentre a
nord il limite marcato dal contatto
con i depositi dellUPA pi antica di
Camponogara.
Larea caratterizzata dalla presenza dellampio dosso di Arzergrande, con direzione ovest-est, che a
"NCDUHFN RTODQ@ HK BNQRN @QSHBH@KD
CDK!QDMS@DRHROHMFDMN@KK@SST@KD
conterminazione lagunare attraverso due diramazioni: il dosso della
Morosina verso nord e il dosso della
Fogolana verso sud.
Poco a ovest dellabitato di ArYDQFQ@MCD  C@K @MBN RDSSDMSQHNM@le del dosso principale si dipartono
due dossi minori, lunghi solo qualBGD BGHKNLDSQN  HCDMSHB@AHKH QHRODStivamente da ovest a est come dosso
di Piove di Sacco e dosso di TognaM@  KK@RSDRR@@KSDYY@ L@RTK@MBN
meridionale, si innesta un altro dosRN BGD RH CHQHFD UDQRN RTC DRS F 
12) in direzione di Pontelongo, per
poi piegare verso ESE parallelamente allattuale corso del Bacchiglione
CNRRNCH/NMSDKNMFN 0TDRS@RSQTStura rappresenta il limite del sistema

CDONRHYHNM@KDCDK!QDMS@ BNMM@MSD
a sud con i dossi pi settentrionali
del sistema Adige-Po.
Sulla continuazione della direttrice del dosso della Fogolana, in sinistra Brenta, troviamo le strutture
CNRRHUD CDKK@ !NMHB@ #DKS@ !QDMS@ 
In particolare si riconosco due dossi
principali, ampi e poco rilevati, che si
dipartono uno verso nord-est e laltro verso sud-est a partire dallarea
CH"NMBGD +@M@KHRHCDKK@B@QSNFQ@@
storica porta a riconoscere in questo
sistema il risultato dellattivit di sedimentazione del Brenta quando, tra
il 1840 e il 1896, fu fatto sfociare in
questo settore della laguna (cfr. UPA
Delta Brenta - Br 6). Si fa per notare
come, in questarea, sia stato possibile riconoscere anche lo sviluppo
dei dossi precedenti a questultimo
evento morfogenetico (dossi in laFTM@ C@ B@QSNFQ@@ RSNQHB@ L@MSDnendo il nome originario preso dalK@ B@QSNFQ@@ RH QHBNMNRBD F   
partendo da nord verso sud, il dosso
dellAgugiaro (lungo il canale Scirocchetto), il dosso del Bosco Scuro (attraverso Corte Fogolana) e il dosso
dellInferno (nei pressi di Conche).
0TDRSD@MSHBGDENQLDTUH@KH BGDRH
spingevano ben oltre lattuale conterminazione lagunare, sono tratte
C@ B@QSD RSNQHBGD CDK 75( D 75(( RDBNKN  25$  2D@ #HUDQRH  CR   
ASVE, Misc. Mappe, ds. 112 A).
I dossi di Arzergrande e di PonteKNMFN Q@OOQDRDMS@MN HK SQ@SSN M@KD
CDK RHRSDL@ O@KDNHCQNFQ@BN BGD RH
stacca dal dosso di Stra a Noventa
Padovana e si biforca a valle di Camin. Il percorso pi orientale continua attraversando Saonara per poi
suddividersi nei pressi di SantAngelo: il ramo settentrionale sembra proseguire per Boion e Lova, quello meridionale per Brugine e Arzergrande.
Relativamente alla et di formazione
di questo sistema, landamento della
Q@FFHDQ@CHCNRRHTUH@KHBGDRHCHO@Qtono allaltezza di Noventa rende palese che esso si formato a opera di
CHU@F@YHNMHCDKTLDBNMMDRRDBNM
un tracciato che passava a nord-est
di Padova, per Vigodarzere e Ponte
di Brenta, come avviene attualmenSD  0TDRS@ CHQDSSQHBD CH CQDM@FFHN
rappresenta la continuazione verso
valle del decorso per Carturo e Piazzola, gi attivo nel I millennio a.C.,
com testimoniato da alcune datazioni al radiocarbonio eseguite su


censkih naplavin pod dnom lagune v


AKHHMH OQDCDK@ DMNSD "@LONMNF@Q@ 
kjer so prisotni povrinski geoloki
pojavi.
Znotraj EAP Campogara smo odCUNIHKH$ /"NQMHN 1DMHSNJ"NQMH@ 
sedanjega skromnega odvodnega
kanala, skozi katerega se izliva voda
iz lagune, kadar je je zaradi padavin
U MHHMH U MIDI OQDUD  ID M@IAQ SN
svojo funkcijo in tudi lego ohranil
RJNYH YFNCNUHMN RSQTF@ "NQMH@ M@LQD SDD NA CDOQDRHIH LDC CUDL@
grebenoma, tako da njegov tok sovpada z najkrajo potjo od Padove
CNHYKHU@UK@FTMN 5K@FTMNOQHSDDU
AKHHMHM@ICH@+NUDHMNCS@LJNSK@gunski kanal nadaljuje svojo pot do
HYKHSI@UK@FTMNOQH,@K@LNBBTUOQDteklosti je s seboj odnaal tudi odpadno vodo iz Brente. Ta enota pokriva
NALNIDC@M@MIDF@ONSDJ@J@M@K@
Arheoloki pregled je pokazal
dve situaciji, prvo severno od greADM@ !NHNM@  CQTFN ITMN NC MIDga. V severnem delu je dokazov iz
predzgodovinskega obdobja precej
L@KN  UD IHG ID HY NACNAI@ DKDYMD
dobe. Nedavne raziskave, ki so jih
NOQ@UHKH OQDCURDL U NAHMH "@LO@gna Lupia, so pokazale, da se predYFNCNUHMRJH RKNIH Y@DMI@IN ON@RH
pojavljati na povrju, med drugim
celo z najdbami iz druge polovice
DKDYMDCNAD *NSM@LMNFHGCQTFHG
ONCQNIHG ID STCH ST D YK@RSH UDKHJN
najdb iz rimskega obdobja, ki jih je
UDHMNL@LNFNDM@ISHM@ONUQHMH 
Njihovo pogostost lahko deloma priOHDLNCDIRSUT C@IDAHKNNALNID
ONC LNMHL UOKHUNL 1HL@  O@ STCH
razvitosti infrastrukture in prometnih povezav na njem (tu naj bi se
CNLMDUMNM@G@I@KNOQHRS@MHDMeduacus Minor, LNMN O@ ID STCH  C@
ID NALNID OQDJ@K@ NA@KM@ BDRS@ 
razvitosti ozemlja in poljedelstva,
saj se je tu nalo precejnje tevilo
CNLMDUMNJLDJHGONRKNOHI 2SQTF@
"NQMH@ ID D DM S@J CNJ@Y ONRDAMD
NQF@MHY@BHID NALNI@ FQD Y@ L@MIi vodotok, po katerem bi lahko potekal eden od rokavov Medoacusa,
predvsem tisti, ki je bil aktiven skozi
URDNACNAIDNCDKDYMDCN@UFTRSNvske dobe (BONDESAN, MENEGHEL
 RSQ  FKDISTCHMATTE
AZZI 201 , str. 69). V resnici je na obLNITHMUCNLMDUMHNOTDMHQDMH
strugi prisotnih nekaj zelo pomembnih sledi: gosto posejane najdbe
UYGNCMNNC+NUD LNQC@ONHU@KHD


Fig. 10 - Unit di paesaggio antico di


Camponogara (Br 2). Sono evidenziati
L GRVVL XYLDOL H OH XELFD]LRQL GHOOH GDtazioni al radiocarbonio (et non calibrate). In rosso sono riportate le tracce
viarie antiche desunte da fotointerpretazione. Per la legenda delle UPA vedere
tav. 1, pp. 16-17.
6O(QRWDDQWLQHSRNUDMLQHYNUDMX
&DPSRQRJDUD2]QDHQLVRUHQLJUHEHni in lokacije radioogljikovega datiranja.
10

ONSTINHGRS@QNRDKBDUNACNAIDOQDC
HM U @RT 1HL@ RUDSHD U +NUH HY
2.stol. pr. n. t. (BONOMI, MALACRI
NOHMKNFHM@ONUDY@U@Y@JSHUMNOKNUMNONSINUR@ICNY@DSJNU
NACNAI@QHLRJDF@HLODQHI@MDM@Y@dnje pa e zgodnje- in srednjeveka
naselbina, kot so pokazale nedavne
raziskave (CORR 2008-2009).
V severnem delu izstopajo dokazi iz obdobja pred prazgodovinskim
obdobjem na grebenu Boion ter
M@ICAD HY DKDYMD CNAD  3TCH U SDL
OQHLDQTRNOQHRNSM@SDUHKM@M@ICH@
iz rimskega obdobja, ki so neposredno povezana z razvojem raziskav.
Na nedavno objavljenem arheolokem zemljevidu Campagne Lupie
(GORINI 2011) je jasno vidna koncentracija najdb iz rimske dobe (skoraj vseh na povrju) ob sedanji obalMH QSH K@FTMD HM U Y@KDCIT Y@GNCMN
od trase, ki jo je v rimskem obdobju
zasedala Via Annia.
($3$U]HUJUDQGH%U
EAP Arzergrande sovpada z delom pokrajine Padova ob grebenu
Arzergrande in cestni povezavi Arzergrande - Vallonga - Codevigo. ObLNIDKDHITMNNCFQDADM@ JHONSDJ@NARDC@MIDLQDMDLSNJT!@BBGHgliona, severno mejo pa zaznamuje
stik z depoziti stareje enote - EAP
Camponogara.
Enoto zaznamuje irok greben
Arzergrande s potekom v Z-V smeri,
JH U "NCDUHFT OQDJ@ TLDSMH J@M@K
reke Brente in se, razcepljen v dve

veji, nadaljuje vse do sedanje meje


YK@FTMNFQDADM,NQNYHM@ONSDJ@U
smeri proti severu, greben Fogolana
pa v smeri proti jugu.
Nekoliko zahodneje od kraja ArYDQFQ@MCD RD NC RDUDQMDF@ ONANI@
glavne gmote odcepita dva manja
FQDADM@  CNKF@ KD MDJ@I JHKNLDSQNU
zahodnega poznamo po imenu Dosso di Piove di Sacco, vzhodnega pa
po imenu Dosso di Tognana. V isti
UHHMH KDM@ITMDLANJT RDNCRHRSDL@KNHDDMFQDADM JHRDTRLDQH
proti jugovzhodu v smeri Pontelonga, nato pa zavije proti V-J-V (sl. 12)
UYONQDCMNRRDC@MIHLQDMHLSNJNL
Bacchigliona (Dosso Pontelongo). Ta
struktura predstavlja mejo naplavinskega sistema Brente in na jugu meji
RRDUDQMHLHFQDADMHRHRSDL@ CHDHM
Pada.
V nadaljevanju glavne osi grebena Fogolana naletimo na grebene
!NMHBGD#DKSD!QDMSD DYK@RSHRS@
Q@YONYM@UM@CU@UDI@ HQNJ@HMMHYJ@FQDADM@ JHRDUNALNIT"NMBGD
razcepita: prvi se usmeri proti severovzhodu, drugi pa proti jugovzhodu. Zgodovinski zemljevidi ta sisSDLNYM@TIDINJNSQDYTKS@SM@MNRNU
Brente v letih med 1840 in 1896, ko
so jo preusmerili v ta del lagune (cfr.
EAP Delta Brenta - Br 6). Zanimivo
O@ID C@IDM@SDLONCQNITLNFND OQDONYM@SH STCH FQDADMD HY @R@
pred tem zadnjim morfogenetskim
dogodkom (vzpetine v laguni v zgodovinskih zemljevidih): z njihovim
originalnim imenom lahko v zemlje-

vidih (sl. 12) od severa proti jugu


prepoznamo Dosso dellAgugiaro (ob
kanalu Schirochetto), Dosso Bosco
Scuro JH OQDJ@ "NQSD %NFNK@M@ HM
Dosso dellInferno (Peklenski greben,
U AKHHMH JQ@I@ "NMBGD  3D RS@QNC@UMDHYFNMRJDQDMDRSQTFD JHRNSDJKD
veliko dlje proti morju v primerjavi s
RDC@MINNA@KMNQSNK@FTMD RNUQHR@ne v zgodovinske zemljevide iz 16.
in 17. stoletja (ASVE, Sea Diversi, ds.
  25$  Q@YMH YDLKIDUHCH  CR 
112 A).
Izgonska grebena Arzergrande in
Pontelongo predstavljata zadnji odsek paleo-hidrografskega sistema, ki
RD U -NUDMSH /@CNU@MH KNH NC FQDbena Stra in se za Caminom razcepi
na dve veji. Najbolj vzhodni del nadaljuje svojo pot skozi Saonaro, nato
O@RDUAKHHMH2@MS MFDK@RODSQ@Ydeli na dvoje: severna veja se verjetno nadaljuje v smeri Boiona in Love,
ITM@ O@ U RLDQH JQ@IDU !QTFHMD HM
QYDQFQ@MCD  &KDCD M@ O@GKI@@RSH
razcep izgonov, ki se razdelijo pri
Noventi, je jasno, da je sistem nastal
zaradi pogostega spreminjanja toka
reke, ki je tekla severovzhodno od
Padove, mimo Vigodarzera in kraja
Ponte di Brenta, kakren je tudi daM@MIH SNJ  3@ CQDM@M@ RSQTF@ ID U
resnici nadaljevanje toka reke mimo
"@QSTQ@ HM /H@YYNKD  D @JSHUMDF@ U
OQUDL SHRNKDSIT OQ  M  S  JNS OQH@jo nekatere radiokarbonske datacije
na velikih deblih, ki so jih nali v peDMN OQNCM@SHGRDCHLDMSHGUAKHHMH
Cartura (PELLEGRINI in drugi 1984)

31

32

tronchi di notevoli dimensioni rinvenuti in sedimenti sabbioso-ghiaiosi


nei dintorni di Carturo (PELLEGRINI
et alii 1984) e di Piazzola (CASTI
GLIONI PELLEGRINI 1981).
Per quanto riguarda il periodo di
attivit del settore situato a valle di
Noventa, ci sono alcune indicazioni
da studi precedenti. La presenza di
un ponte di epoca romana nei pressi di Camin (PESAVENTO MATTIOLI
1986) indica che il paleoalveo del
Brenta posto sulla sommit del dosso sabbioso era attivo in questo periodo. Inoltre, due datazioni al radiocarbonio eseguite su tronchi sepolti
@ Lo@MMH!/ DSB@KHAQ@S@ @ " D Lo
anni BP, et calibrata 450-860 d.C.)
di profondit nei sedimenti alluvionali nelle vicinanze di Saonara,
quindi sul ramo orientale della biforcazione, indicano che il Brenta
passava di qui nella prima met del
I millennio a.C. e che interess nuoU@LDMSDK@QD@SQ@HK5DHK(7RDBNKN
d.C. (CASTIGLIONI et alii 1987). Sulla
A@RDCHPTDRSHC@SHRHOT@DQL@QD
BGD K@ CHQDSSQHBD TUH@KD -NUDMS@ 
"@LHM 2@NM@Q@RS@S@@SSHU@SQ@HK7
RDBNKN@ " DHK(7RDBNKNC " "HMNM
porta necessariamente a ipotizzare
TMTRRNRS@AHKDMDKKHMSDQNHMSDQU@Klo, in quanto eventi di avulsione agli
snodi posti a monte di Noventa e di
Saonara potrebbero avere attivato e
disattivato svariate volte sia il tratto
Noventa - Camin, sia quello Saonara
SantAngelo. comunque unindicazione che i dossi di Arzergrande e
di Pontelongo, posti a valle di Saonara a costituire le porzioni terminali
di questo sistema dossivo, possono
essere stati attivi in questo arco temporale.
Anche in prossimit della terminazione settentrionale del dosso di
Arzergrande (dosso della Morosina) disponibile una datazione radiometrica (LEVORATO  
BONDESAN et alii 2003b). Essa stata eseguita su sedimenti torbosi posti a - 3,4 m di profondit dal piano
campagna in prossimit di un paleoalveo del Brenta: let dei resti orgaMHBH BNRSHSTDMSH K@ SNQA@  o
anni BP (et calibrata 968-544 a.C).
#@KK@ RSQ@SHFQ@@ CDH CDONRHSH @KKTvionali presenti nellarea, si desume
che la datazione indica let di ripresa della sedimentazione nella piana
di esondazione prima della messa in

ONRSN CDK O@KDN@KUDN HM RTODQBHD 


0TDRSHOQHLH@OONQSHRDCHLDMS@QHONSQDAADQN QHDSSDQD KD E@RH HMHYH@KH CH
formazione del dosso di Arzergrande, che risulterebbero dunque coeve
BNMHCDTRRHSDRSHLNMH@SHHMPTDRSN
stesso periodo a monte, presso Saonara. Il paleoalveo analizzato ubicato sulla prosecuzione del dosso di
Arzergrande, fatto che rappresenta
una buona indicazione del legame
genetico intercorrente tra le due forLD RH  ODQ OQDRTLHAHKLDMSD ENQmato in concomitanza con le fasi terminali di attivit del dosso, dato che
costituisce lultimo evento sedimentario nellarea.
Altre informazioni relative allet
dei depositi che costituiscono lunit
descritta, sono contenute allinterno
delle note illustrative della Carta
Geologica del foglio 148-149 Chioggia-Malamocco (TOSI et alii 2007). In
particolare, in questo studio viene
RODBHB@SN BGD MDK RDSSNQD RTCNBBHdentale del foglio (coincidente con
larea del dosso di Arzergrande e di
Pontelongo) alcuni campioni di torba datati, prelevati in localit diverse a profondit variabili tra 0,6 m e
-1,2 m dal piano campagna, risalgono allet del Ferro e, di conseguenY@   OQNA@AHKD BGD H CDONRHSH @Nranti in corrispondenza di questi siti
siano pre-romani (TOSI et alii 2007).
In un sondaggio (ISES 26) eseguito
sulla continuazione del dosso della Fogolana, stato datato un campione di torba prelevato a -3,3 m
dal piano campagna, al di sopra del
quale presente un livello sabbioso collegabile alladiacente sistema
dossivo. Let della torba risultata
O@QH@o@MMH!/ BNMEQNMS@AHle con quella riscontrata per il dosso
della Morosina.
(MMD  C@K BNMEQNMSN BNM H C@SH
presenti in letteratura, possibile
ipotizzare il periodo di attivit anBGDODQHCNRRHHCDMSHB@SH @SSQ@UDQRN K@M@KHRH CDKK@ B@QSNFQ@@ RSNQHB@ 
nel settore lagunare che si trova in
continuit con lunit di Arzergrande.
Come precedentemente accennato,
questi dossi attualmente sono sepolti sotto i pi recenti depositi del
Brenta e Bacchiglione che hanno forL@SNK@!NMHB@#DKS@!QDMS@NOOTQD
sono coperti dai sedimenti lagunari,
ma la loro presenza testimoniata
FHMDKKDB@QSDCDK75(RDBNKN -DKKD
note illustrative della Carta Geologi-

ca Chioggia-Malamocco indicata la
presenza in laguna, nella zona della
5@KKD,NQNRHM@@MNQCCDKK@!NMHB@
Delta Brenta, di sedimenti organici
palustri e di barena di genesi deltiYH@@KBTMHB@LOHNMHC@S@SH OQDKDU@SH
in questarea a profondit inferiori a
un metro dal fondo lagunare, risultano avere unet tardo-romana e
medievale. I relativi depositi poggiano su un substrato continentale, generalmente torboso, di et romana
(TOSI et alii 2007).
La ricerca archeologica mette in
evidenza il fatto che lungo questo
dosso non sono attestati ritrovamenti di et preromana, nemmeno
nelle vicinanze. un dato che sembra molto importante, pur senza perdere di vista il fatto che si tratta di un
argomento e silentio dovuto in parte
a carenza di attestazioni archeologiche (BONDESAN, MENEGHEL 2004,
p. 291). Se dunque ipotizzabile che
in questa zona vi siano livelli di copertura alluvionale (pi o meno consistenti) sullet del Ferro (ed epoche precedenti), va sottolineato daltra parte che linsediamento romano
sembra attirato proprio dal sistema
dossivo, il quale nello stesso periodo sembra ospitare anche un importante corso dacqua, verosimilmente
C@ HCDMSHB@QD BNM TMN CDH Medoacus nominati dalle fonti ed oggetto
CHHMMHSDCHRBTRRHNMHC@O@QSDCDFKH
storici del mondo antico (sintesi in
BONDESAN, MENEGHEL 2004, pp.
282-284).
La stessa qualit delle fonti suggerisce che il tratto caratteristico
della UPA in esame fosse proprio
quello di una consistente presenza
di infrastrutture direttamente o indirettamente collegabili agli aspetti
CDKK@ M@UHF@YHNMD TUH@KD   HM O@Qticolare il comparto di Vallonga che
RH RDFM@K@ ODQ K@ OQDRDMY@ CH O@KHcate e strutture formate da blocchi
lapidei squadrati, interpretabili sia
pure ipoteticamente, come appreRS@LDMSH TUH@KH D @QFHM@STQD RO
SADA 1980, 2003). Il tutto associato
a rinvenimenti di tipo funerario, ma
anche a elementi architettonici e costruttivi di carattere residenziale.
83$GHO%UHQWRQ%U
LUPA del Brenton corrisponde al
ramo del Brenta attivo prima della
CDUH@YHNMD CDK TLD @UUDMTS@ HMtorno al 1142 d.C.

Oltre alla segnalazione di un Xvius Brintesia nella Tabula Peutingeriana, il Brenta viene citato per la
prima volta con questo nome in un
documento risalente al VI sec. d.C.
(BORTOLAMI 2003). Venanzio Fortunato (Vita Sancti Martini, IV, 677)
UDQRN HK  C "  O@QK@ CH TM TLD
Brinta quando ricorda di aver compiuto uno spostamento da Padova
a Ravenna navigando per un tratto
lungo questo corso dacqua. Entrambi i documenti indicherebbero quindi per il Brenta un percorso, tra il IV e
il VI sec. d.C., diretto a sud di Padova.
BORTOLAMIRODBHB@BGDM
C@HRDBNKH@KSNLDCHDU@KHHKTLD@Bquist rilevanza nella suddivisione
del territorio padovano. Ad esempio
tutto il settore di campagne situato
a nord e nord-est della citt veniva
designato come Oltrebrenta e, gi
MDK (7 RDBNKN  RH TR@U@ CDKHLHS@QD HK
comparto sudorientale della provincia nota con il nome di Saccisica, faBDMCN QHEDQHLDMSN @H TLH "NQMHN D
Brenta.
Esistono molti documenti storici che permettono di localizzare il
corso del Brenta nei secoli intorno
al mille nel territorio compreso tra
Noventa e il porto di Brondolo (BRU
NELLO 1993). Sembra, infatti, che il
TLDO@RR@RRD@DRSCH/@CNU@DC@
villa de Noventa scorresse attraverso il Piovado (territorio di Piove di
2@BBNMN@KK@KNB@KHSle Bebe, per
sfociare poi nei pressi del porto de
Brondolo, come cita Marco Cornaro,
Savio alle acque della Serenissima
UHRRTSNMDK75RDBNKNScritture sulla Laguna  0TDRS@RHST@YHNMD
CNBTLDMS@S@MN@K @MMNHM
cui il Brenta venne deviato dal suo
corso originario allaltezza di NovenS@ODQE@QKNTHQDHMCHQDYHNMDCH5Dnezia lungo lalveo conosciuto oggi
con il nome di Naviglio.
Si tentato di individuare il possibile percorso altomedievale del
Brenta o, per lo meno, di risalire
@KKTKSHLN @KUDN TSHKHYY@SN C@K TLD
prima della diversione, facendo riEDQHLDMSN @KK@ B@QSNFQ@@ RSNQHB@ D
ai documenti sopracitati. Gi FAVE
RO, SERANDREI e BARBERO (1978)
HCDMSHB@U@MNK@MSHBNB@M@KDCDMNminato Brenton Vecchio, situato a
sud dellattuale Bacchiglione, come
il percorso pi meridionale del Brenta. In una carta anonima della met
CDK 75( RDBNKN  25$  2D@ +@FTM@ 


ter v Piazzoli (CASTIGLIONI, PELLE


GRINI 1981).
. @JSHUMDL NACNAIT QDMDF@
odseka nizvodno od Novente so na
UNKINONQNHK@MDJ@SDQHGOQDCGNCMHG
raziskav. Most iz rimskega obdobja v
AKHHMH "@LHM@ PESAVENTO MATTI
OLI) je dokaz, da je bilo starodavno
QDMN JNQHSN !QDMSD M@ UQGT ODDnega izgonskega grebena v tem obdobju dejavno. Poleg tega pa dve radiokarbinski dataciji debel, pokopaMHGUFKNAHMH LoKDS!/ 
umerjena starost 1000-625 pr.n.t.)
HM U FKNAHMH  L  o  KDS
BP, umerjena starost 450-860) med
ONOK@UHMRJHLH M@MNRH U AKHHMH 2@Nnare, torej v vzhodni veji razcepljeMHGFQDADMNU J@DS@ C@ID!QDMS@U
OQUH ONKNUHBH OQUDF@ SHRNKDSI@ OQ  M 
S SDJK@SNCHMC@IDM@NALNIDRODS
Y@DK@ UOKHU@SH U NACNAIT LDC   HM
9. stol. (CASTIGLIONI in drugi 1987).
Na osnovi teh podatkov lahko potrCHLN C@IDAHK@QDM@ONS-NUDMS@-Camin-Saonara dejavna v dolgem
obdobju med 10. stol. pr. n. t.in 9.
stol. n. t. Ni nujno, da je bil pretok
UDR@RSDF@NACNAI@RS@AHKDM R@IMD
FQD HYJKITHSH  C@ ID Y@Q@CH OQDTRLDritve reke v rokave vije od Novente
HM2@NM@QDUDJQ@SOQHKNCNOQDRHG@nja in ponovnega pretoka vode tako
v odseku med Novento in Caminom
kot tudi v tistem med Saonaro in
2@MS MFDKNL  *KITA SDLT O@ FQD Y@
pokazatelja, da sta bili izgonski strugi Arzergrande in Pontelongo, ki sta
od Saonare proti morju predstavljaKHY@JKITMDNCRDJDSDF@HYFNMRJDF@
RHRSDL@  UDQIDSMN U SDL @RNUMDL
obdobju prehodni.
3TCH Y@ RDUDQMH Y@JKITDJ HYFNM@
Arzergrande (izgon Morosina) so na
UNKIN ONC@SJH Q@CHNLDSQHMDF@ C@SHranja (LEVORATO   BON
DESAN in drugi 2003b). Datiranja so
se opravila na nanosih ote v globini -3,4 m pod povrino starodavneF@ QDMDF@ JNQHS@ !QDMSD NBDMIDM@
starost organskih ostankov ote je
 o  KDS !/ TLDQIDM@ RS@QNRS
968-544 pr. n. t.). Na podlagi stratigrafskih podatkov za aluvialne naMNRDM@SDLNALNITK@GJNCNLMDU@LN  C@ C@S@BHI@ NYM@TID NACNbje ponovnega nalaganja naplavin
U NALNIT ONOK@UMD Q@UMHBD OQDC
CNJNMMN ONUQHMRJN UYONRS@UHSUHINQDMDRSQTFD 3HYFNCMIHM@MNRHAH
K@GJNNCQ@@KHY@DSMDE@YDM@RS@I@nja izgonske struge Arzergrane, ki bi


Fig. 11 - Carta anonima della met del


XVI secolo (ASVE, Sea Laguna, ds. 129),
da DORIGO PRGLFDWR 
Sl. 11 - Anonimni zemljevid iz sredine
16. stoletja (ASVE, Sea Laguna, ds. 129).
11

SNQDI@RNUMNRNUO@C@KDYHYOQH@MHLHNCSNJHUAKHHMH2@NM@QDHYHRSDF@
NACNAI@ 2S@QNC@UMNQDMNJNQHSNRD
nahaja v nadaljevanju izgonske struFD QYDQFQ@MCD SN CDIRSUN ID Y@MDsljiv pokazatelj genetske povezave
LDC NADL@ NAKHJ@L@ QDMD RSQTFD
po vsej verjetnosti pa je nastalo isto@RMNYY@JKITMNE@YNCDKNU@MI@HYgonske struge, saj gre za zadnji pojav
M@MNRNUUSDLNALNIT 
Ostale informacije o starosti naMNRNU M@ NOHR@MDL NALNIT K@GJN
najdete v pojasnilih geoloke karte,
na listih t. 148-149 Chioggia-Malamocco (TOSI et alii 5OQHTINH
tudiji e posebej omenjamo, da so
nekateri vzorci ote iz jugozahodnega dela predela (ki sovpada z obmoIDL HYFNMRJD RSQTFD QYDQFQ@MCD
HM /NMSDKNMFN  NCUYDSH M@ Q@YKHMHG
KNJ@BHI@GHMUQ@YKHMHGFKNAHM@GNC
- 0,6 m in -1.2 m pod povrjem) izhaI@INHYDKDYMDCNAD Y@SNIDONURDL
verjetno, da so nanosi, ki so se pomaknili na povrje na teh lokacijah,
HY@R@OQDCQHLRJHLNACNAIDLTOSI
in drugi 2007). V raziskavi (ISES 26)
izgonske struge Fogolana se je datiral eden od vzorcev ote iz globine
-3.3 m pod nivojem okolike ravniBD  M@C J@SDQN RD CUHFTID ODDM@
UYODSHM@ JHAHK@GJNAHK@CDKAKHMID
izgonske struge. Starost ote je bila
NBDMIDM@M@oKDS!/ J@QID
primerljivo s starostjo grebena (izgonske struge) Morosina.
Nenazadnje pa je s primerjavo
Q@YONKNKIHUHG ONC@SJNU HY KHSDQ@STQD
LNFND OQDCONRS@UHSH NACNAID CDjavnosti izgonskih strug, ki jih navajajo zgodovinski zemljevidi v obmoITK@FTMDUM@C@KIDU@MITDMNSD QYDQFQ@MCD *NSRLNDNLDMHKH RNSH
izgoni danes pokopani pod mlajimi

nanosi rek Brenta in Bacchiglione, ki


RS@NAKHJNU@K@!NMHBN#DKSD!QDMSD 
ali pa so jih prekrili lagunski nanosi, a
MIHGNUNARSNIIDAHKONSQIDMDM@YDmljevidih iz 16. stoletja. V pojasnilih
na geoloki karti Chioggia-Malamocco se navaja prisotnost organskih
RDCHLDMSNU HY LNUHQM@SHG HM RK@MJ@RSHG NALNHI CDKSD U CDKT K@FTMD
U AKHHMH 5@KKD ,NQNRHMD RDUDQMN NC
!NMHBGD#DKSD!QDMSDMDJ@SDQHC@tirani vzorci, zbrani v globini manj
kot meter pod dnom lagune, pa so
iz poznorimskega in srednjevekega
NACNAI@ 3HM@MNRHKDHINM@OQDSDMN
otastem celinskem substratu iz rimskega obdobja (TOSI et alii 2007).
Arheoloke raziskave so osvetlile
dejstvo, da ob grebenu in v njegovi
AKHHMHMHY@RKDCHSHM@ICAHYOQDCQHLskega obdobja. Gre za precej poLDLAMNCDIRSUN DSTCHNAMIDLMD
FQDY@MDL@QHSH C@RDNSDISDLHLNKH
deloma tudi zaradi pomanjkljivih arheolokih dokazov (BONDESAN, ME-$&'$+ RSQ  DSNQDIK@Gko domnevamo, da so na tem obmoITANKI@KHL@MINARDMHM@OK@UHMRJH
RKNIH HY DKDYMD CNAD SDQ HY NACNAHI
OQDCMIN O@IDHRSN@RMNSQDA@ONTdariti, da so Rimljani svoje naselbine
postavili prav na sisteme izgonskih
RHRSDLNU JHRNUSDL@RTDUDCMN
FNRSHKH UDID UNCNSNJD  LNQDAHSH J@terega od Medoacusov, ki jih navaI@IN UHQH HM JH RN OQDCLDS MDRJNMnih Q@YOQ@UYFNCNUHM@QIDU@MSHMDF@
sveta (povzetek v BONDESAN, ,$-$
GHEL 2004, str. 282-284).
Enakovredni viri menijo, da je
posebnost analizirane EAP prav obstoj dobro razvite infrastrukture, neposredno ali posredno povezane z
JNMSDJRSNL QDMD OKNUAD  D YK@RSH
DKHLN NONYNQHSH M@ NCRDJ OQH 5@K-

KNMFH  JIDQ RN RD M@G@I@K@ JNKH@ HM


strukture, izdelane iz kvadratnih kaLMHSHG AKNJNU  JH IHG ID  DOQ@U YDKN
GHONSDSHMN  LNFND Q@YK@F@SH JNS
priveze ali nasipe (ROSADA 1980,
2003). Povezali bi jih lahko s pogrebnimi najdbami, pa tudi z arhitekturnimi in gradbenimi elementi prebiU@KH 
($3%UHQWRQ%U
EAP Brenton sovpada z rokavom
Brente, ki je bil pred preusmeritvijo
QDJDNJNKHKDS@CDKTIN
 /NKDF M@UDCAD TUHTR !QHMSDRH@
(reke Brintesie) v Puntingerjevi tabuli RD!QDMS@OQUHNLDMI@RSDLHLDnom v dokumentu iz 6. stoletja (Bortolami 2003). Venantius Fortunatus
(Vita Sancti Martini, IV, 677) okoli leta
565 govori o reki Brinti, ko se spominja potovanja iz Padove v Raveno,
katerega del je preplul po njej. Oba
dokumenta torej v zvezi z Brento v
obdobju med 4. in 6. stoletjem opiRTIDS@RSQTFN JHM@IAHONSDJ@K@ITno od Padove. BORTOLAMI (2003)
navaja, da se je pomen reke pri deKHSUHO@CNU@MRJDF@NYDLKI@JQDOHKD
od prvih stoletij srednjega veka. Tako
RDIDM@OQHLDQBDKNSMNNALNIDONKI
severno in severovzhodno od mesta
HLDMNU@KN.KSQDAQDMS@ M@NMHRSQ@MH!QDMSD HMDU RSNK RDIDY@ITgovzhodni del pokrajine uporabljal
naziv Saccisica, ki se je nanaal na
reki Cornio in Brento.
tevilni zgodovinski dokumenSH RN U ONLN OQH CNKN@MIT ONSDJ@
Brente v stoletjih okoli leta 1000 na
ozemlju med Novento in pristaniDLU!QNMCNKTBRUNELLO 1993).
9CHRDM@LQD C@IDQDJ@SDJK@UYGNdno od Padove, se vila mimo vile v

33

34

ds. 129) si riconosce chiaramente


il corso di questo canale a partire
C@KK@MSHB@ENBDMN@KK@KNB@KHS"HU
F    (K SQ@SSN SQ@ "HU D HK Canal
delle Bebe viene denominato Brenton, mentre la parte terminale viene
CDMHS@ Canal de Lombardia. Nella
mappa si vede molto bene ci che rimane della foce del Brenta, attiva in
PTDRS@YNM@MN@K7((RDBNKNBHQB@ 
In una carta di Nicol dal Cortivo del 1540 (ASVE, Sea Brenta, ds.
3) rappresentata la continuazione
del BrentonNKSQDK@BNMTDMY@BNM
il Bacchiglione (Bachion). Il tratto
che presso Brenta dellAbb collega i due corsi dacqua lungo lattuale Bacchiglione, conserva ancora un
andamento naturale, probabilmente
coincidente con il percorso originale dellantico Brenton. Nella mappa,
a nord del Bachion il corso dacqua
scorre attraversando Castelcaro e
5@KKNMF@ MN @ "NQSD MDK 75( RDBNlo questo tratto era conosciuto con
il nome di Brentella Vecchia. Lantico
ODQBNQRNMNQ@CDRBQHSSNRHOTQHBNMNRBDQDRTKSDQQDMNC@!QNMCNKNMN
a Civ per la presenza di un paleoalUDNADMCDMHSN BGH@Q@LDMSDHCDMSHB@AHKDMDKKDENSN@DQDD LDMSQDQHmane traccia della Brentella Vecchia
negli attuali scoli Altipiano, Acque
Straniere, Cavaizza di Codevigo, Cavaizza di Corte e Cornio Nuovo.
Pi problematica, invece, risulta
lindividuazione dellantico percorso
utilizzato dal Brenta nel tratto compreso tra Padova e Corte. possibile
BGD HK TLD TSHKHYY@RRD @MBNQ@ K@Kveo che scorreva lungo il dosso di
Noventa - Saonara - SantAngelo di
Piove di Sacco (sicuramente attivo
SQ@HK5DHK(7RDBNKNC " CASTIGLIO
NI et alii 1987) dato che BORTOLAMI
(2003) fa notare che a sud di Camin,
OQDRRN 5HKK@SNQ@  FH C@K 7(( RDBNlo era presente un sito denominato
Brentasecca.
Ulteriori informazioni provengono
dalla Cronaca sulla guerra di Chioggia  E@SSN @UUDMTSN @KK@ MD CDK 7(5
secolo. Il cronista che descrive lepisodio, cita un corso dacqua utilizzato dal Signore di Padova per giungeQDBNMKDRTDM@UHMN@"@RSDKB@QND
qui contrapporsi al Podest di Chioggia (BRUNELLO 1993). Il corso dacqua viene chiamato Fiume vecchio o
Brenta vechia e, al tempo, era ancora
BGH@Q@LDMSD M@UHF@AHKD  2D @KK@ MD
CDK7(5RDBNKNDRHRSDU@TMTLDM@-

UHF@AHKDBGDRBNQQDU@C@/@CNU@MN
a Castelcaro possibile che questo
corrispondesse allantico tracciato altomedievale del Brenta che sfociava
a Brondolo, successivamente abbanCNM@SN @ E@UNQD CDK Q@LN BGD THU@
verso Fusina. probabile che lalveo
abbandonato nel 1142 sia rimasto
comunque attivo per qualche secolo
tanto da essere ancora cartografato
MDKKDL@OODCDK75(RDBNKN
83$GL'ROR%U
LUPA di Dolo corrisponde allarea interessata dai depositi alluvionali del Brenta formatisi successiU@LDMSD @KK@ CDUH@YHNMD CDK TLD
avvenuta intorno al 1142 d.C. Larea limitata a nord-ovest dal dosso che si sviluppa lungo il corso del
Naviglio Brenta mentre verso nord si
estende oltre questo corso dacqua
MN @KK@ YNM@ HMCTRSQH@KD CH /NQSN
Marghera. In parte, i depositi relativi
a questa unit si trovano attualmenSD @K CH RNSSN CDH QHONQSH @QSHBH@KH  (K
limite orientale dellarea coincide
con il margine lagunare interno del
75( RDBNKN  HCDMSHB@SN LDCH@MSD
K@M@KHRH CDKK@ B@QSNFQ@@ RSNQHB@ HK
limite occidentale si colloca in corrispondenza dellantico corso dacqua
denominato Sborador di S. Bruson
(lattuale scolo Brenta Secca) attivaSN@QSHBH@KLDMSDMDK
A sud il limite dellarea meno
preciso in quanto si trova attualmente allinterno del bacino lagunare.
stato preso come margine il corso
del canal Chornio (ora canaletta del
Cornio), i cui argini hanno avuto una
funzione di barriera per i sedimenti
depositati dal Brenta in questarea, e,
di seguito, il corso dellantico canal
Mazor (canale Maggiore). Durante il
75( RDBNKN  HME@SSH  @SSQ@UDQRN PTDRSH
due canali, le acque del Brenta veniU@MNE@SSDCDTHQDUDQRNK@ANBB@CH
porto di Malamocco.
I depositi dellunit di Dolo poggiano su quelli di et pleistocenica
dellunit di Mestre e, nella porzione pi occidentale, ricoprono
in parte i depositi di et olocenica
pi antichi, appartenenti allunit di
Camponogara.
Lunit di Dolo caratterizzata
dalla presenza di un ampio dosso
TUH@KDCNRRNCH2SQ@BGDRHRUHKTOO@ HM RDMRN .2. $-$ C@ 2SQ@ MN
a Oriago, con direzione concorde
allandamento del Naviglio Brenta

FF   0TDRSNCNRRNG@TMQHlievo massimo di 2-3 m rispetto alla


pianura circostante e unampiezza
generalmente compresa tra poche
centinaia di metri e 1 km.
La naturale continuazione verso
U@KKDCDKCNRRNCH2SQ@ MN@KKNRANBco in laguna presso Fusina, rappresentata dal dosso di Malcontenta,
meno espresso in senso sia planimetrico sia verticale, e con un netto
cambio dellorientazione che, attraverso una brusca svolta nei pressi di
Oriago, diventa NO-SE. I dossi minori
BGDRHCHO@QSNMNC@K@MBNLDQHCHNnale del dosso di Stra hanno tutti andamento complessivo NO-SE. Allaltezza di Dolo si intesta il dosso di
Lugo, che si estende, con unampia
BTQU@STQ@ MN@+TFGDSSN  KK@ODQHferia occidentale di Mira prende forma un dosso che, allaltezza di Piazza Vecchia, sembra dividersi in due
rami. Uno punta decisamente verso
est, correndo, con uninterruzione,
parallelo allidrovia che congiunge il
Taglio Nuovissimo con il Canale Bondante (dosso di Dogaletto). Laltro
si dirige a sud, insinuandosi tra gli
specchi lagunari di Lago Stradoni e
5@KKD ,H@MD  0TDRSTKSHL@ RSQTSSTQ@ 
seguita in gran parte del suo sviluppo dallo Sborador de Gambarare,
gi nota come dosso delle Giare. Alla
periferia orientale di Mira inizia un
altro piccolo dosso, che non giunge
alla laguna, ma dalla cui terminazione si dipartono dei paleoalvei che
proseguono verso valle lungo la medesima direttrice.
Si presume che lunit si sia formata principalmente durante lultimo millennio, a seguito dellavulsione del Brenta allaltezza di Ponte di
Brenta, attribuita dalle fonti storiche
al 1142 d.C. Lunica datazione 14C disponibile nellarea, relativa a un limo
torboso presente tra 2,10 e 2,35 m
di profondit al di sotto del cosiddetto dosso delle Giare, ha fornito
TM@C@S@CHo!/BONDESAN
et alii   0TDRSN KHUDKKN NQF@MHco ricoperto da una sequenza che
passa verso lalto da sabbia medio
FQNRRNK@M@@R@AAH@KHLNR@DHMMD 
nellultimo metro, a limo sabbioso.
Calibrando la data, ci indica che
la ripresa della sedimentazione in
facies di canale e la formazione del
dosso sarebbero successivi ad un
LNLDMSN ONRSN @ B@U@KKN SQ@ K7( D
HK7((RDBNKNC " @SSQHATYHNMDBQNMN-

RSQ@SHFQ@B@CDKSTSSNBNDQDMSDBNMK@
data dellavulsione del Brenta fornita dai documenti storici.
Allinterno della grande UPA di
Dolo possibile distinguere alcuni
settori che si comportano diversamente dal punto di vista del potenziale archeologico.
Il dosso di Stra coincide con la
parte altimetricamente pi elevata
di questa formazione. Il ritrovamento di Sambruson, a monte di Mira,
mostra un insediamento preistorico
(et del Bronzo?) collocato a 2,5 m
di profondit, il che potrebbe essere indicativo della crescita stratigraB@ CDK CNRRN C@KK@ OQD OQNSNRSNQH@
@KKDS BNMSDLONQ@MD@  /H CHBHKD
giudicare la posizione dellinsediamento di et romana, anche se va
sottolineato che potrebbe trattarsi
di rinvenimenti in massima parte afNQ@MSH N BNLTMPTD RDONKSH C@ TM@
coltre alluvionale contenuta. I rinvenimenti sembrano contraddittori: se
ad esempio esaminiamo il comparto
tra Dolo e Sambruson scopriamo che
i siti di et romana sembrano riguarC@QD S@MSN ONRRHAHKH @NQ@LDMSH C@
arature quanto scassi, purtroppo non
sappiamo a quale profondit. Verso
Mira e da qui a Porto Menai altri rinvenimenti sembrano riguardare potenti alluvionamenti, ma probabilmente riferibili solo a casi particolari
(come quello di un sito medievale a
B@Q@SSDQD TUH@KD  2@LAQTRNM  UH@
Carezzioi). Per quanto poi concerne
lultimo tratto da Oriago a Fusina, il
RHSN OH RHFMHB@SHUN  CDBHR@LDMSD
la probabile necropoli di Lizza FusiM@ BNMHKQHMUDMHLDMSNCHDOHFQ@
funerarie di et romana a ca. 3,4 m
di profondit. Ci sembrerebbe comprovare il fatto che il dosso in parola potesse essere quello pi recente dei tre tratti analizzati, posteriore
appunto ai secoli centrali del medioevo. Un discorso a parte merita larea
di Dogaletto - SantIlario (CALAON,
FERRI 2008), da collocarsi storicamente alla foce di un tratto altomedievale del Brenta. Il sito del monastero stato messo in relazione con
un paleoalveo che passerebbe a sud
del medesimo, a sua volta in chiara
continuit con il dosso che si stacca da Mira Porte (BONDESAN, ME
NEGHEL 2004, p. 293). Sul versante
opposto, quello lagunare, tracce di
alvei collegati sono state rintracciaSDMN@%TRHM@ CNUDOQNA@AHKLDM

Noventi, skozi Piovado (ozemlje okoli kraja Piove di Sacco) do kraja le


!DAD JIDQRDIDM@SNUAKHHMHOQHRS@MH@!QNMCNKNHYKHU@K@ULNQIDS@JN
vsaj navaja Marco Cornaro, nadzornik voda v republiki Serenissimi, ki
IDHUDKU RSNKDSITScritture sulla
Laguna, 1919). Tak potek Brente se
omenja vse do leta 1142, ko so njen
SNJ U AKHHMH -NUDMSD OQDTRLDQHKH
tako, da je tekla proti Benetkam po
strugi, ki je danes poznana kot Naviglio (plovni kanal).
2 ONLNIN YFNCNUHMRJHG YDLKIDvidov in navedenih dokumentov
smo poskusili poiskati morebitni
srednjeveki tok Brente ali vsaj zbrati podatke o zadnji uporabljeni strugi
pred njeno preusmeritvijo.
D FAVERO, SERANDREI, BARBE
RO  O@ NLDMI@IN @MSHMH J@nal, imenovan Brenton Vecchio, ki
KDH ITMN NC C@M@MIDF@ !@BBGHFKHNM@ JNSM@IITMDIHQNJ@U!Q@MSD -@
anonimnem zemljevidu s sredine 16.
stoletja (ASVE, Sea Laguna, ds. 129)
je jasno prepoznaven potek tega kaM@K@ Y@DMH NC RS@QNC@UMDF@ TRSI@
do zaselka Civ (sl. 11). Odsek med
zaselkom Civ in kanalom delle Bebe
se imenuje Brenton Y@JKITMHNCRDJ
pa Canal de Lombardia. Na zemljevidu se zelo dobro vidijo ostanki ustja
Brente, ki je tekla v tem delu vse do
12. stoletja.
Na zemljevidu avtorja Nicoloja
dal Cortivo iz leta 1540 (ASVE, Sea
Laguna, ds. 3) je vrisano nadaljevaMIDSNJ@!QDMSNM@ONRNSNITYUNCNtokom Bacchiglione (Bachion). OdRDJ JHOQH!QDMSHCDKK AAONUDYTID
oba vodotoka skozi dananji Bacchiglione, je e vedno ohranil svoj naQ@UMHQDMHSNJ JHONURDIUDQIDSMNRSH
RNUO@C@YHYUHQMHLSNJNL@MSHMDF@
Brentona -@YDLKIDUHCTSDDRDUDQno od Bachiona  OQDJ@ "@RSDQB@QN
in Vallongo in nadaljuje svojo pot
CN JQ@I@ "NQSD U   RSNK  ID AHK S@
tok poznan po imenu Brentella Vecchia (Stara Brentella). Ravnokar opiR@MN RS@QN RSQTFN ID LNFND U HUN
opazovati med krajema Brondolo in
"HU R@IIDRS@QNQDMNJNQHSNUSDL
odseku dobro ohranjeno, jasno pa je
STCH Q@YUHCMN M@ YQ@MHG ONRMDSJHG 
Od oStare Brentelle pa so ostale le
DRKDCH Q@YUHCMDUC@M@MIHGQDMHG
odtokih Altipiano, Acque Straniere,
Cavaizza di Codevigo, Cavaizza di
Corte e Cornio Nuovo.
-DJNKHJNANKISD@UMNIDCNKN@

nje stare struge, po kateri je Brenta


tekla med Padovo in lokacijo Corte.
,NMNID C@IDQDJ@DUDCMNTONQ@AKI@K@JNQHSN JHIDONSDJ@KNUYCNK
izgonske struge Noventa- Saonara
 2@MS MFDKN CH /HNUD CH 2@BBN Y@FNSNUN CDKTIND LDC   HM   RSNK 
CASTIGLIONI et alii 1987), saj BOR
TOLAMINONY@QI@ C@ITMNNC
"@LHM@ OQH 5HKK@SNQH D NC   RSNK 
stoji zaselek, imenovan Brentasecca.
Dodatni podatki prihajajo iz Kronike o vojni v Chioggi, do katere je
prilo v poznem 14. stoletju. Pisec,
ki opizuje to epizodo, omenja tudi
QDMH SNJ  JH F@ ID &NRONC /@CNUD
s svojo vojsko uporabil za plovbo
do Castelcara, kjer se je uprl poglavarju Chioggie (BRUNELLO 1993).
3@QDMHSNJIDYM@MONHLDMTStara
reka ali Stara Brenta in je bil v tistem
@RT NHSMN D UDCMN OKNUDM  D ID
ob koncu 14. stoletja res obstajala
plovna reka, ki je povezovala PadoUNR"@RSDKB@QNL IDLNMN C@IDRNvpadala s staro srednjeveko strugo
Brente, katere ustje je bilo v Brondolu in ki so jo kasneje opustili v prid
struge v smeri proti Fusini. Verjetno
IDQDMNJNQHSN JHRNF@RHBDQNOTRSHKH
leta 1142, kljub temu ostalo prehodno e nekaj stoletij, saj je v zemljevidih iz 16. stol. e vedno vrisano.
($3'ROR%U
$ / #NKN RNUO@C@ Y NALNIDL 
JH RN F@ NAKHJNU@KD QDMD M@OK@UHMD
Brente po preusmeritvi reke okoli leta 1142. Na severozahodu meji
na izgonsko strugo ob toku plovnega kanala Naviglio Brenta, na severu
pa sega onstran tega vodotoka vse
do industrijske cone Porto MargheQ@ -@MNRHUSDLNALNITRNCDKNL@
prekriti z umetnimi nasutji. Vzhodna
LDI@ NALNI@ RNUO@C@ Y MNSQ@MIHL
robom lagune iz 16. stoletja, ki smo
F@CNKNHKHY@M@KHYNRS@QHGYDLKIDUHCNUY@GNCM@LDI@ONSDJ@ONRS@QNdavnem vodnem toku, imenovanem
Sborador di S. Bruson (sedanji odtok
Brenta Secca), rezultatu umetnega
izkopa iz leta 1457.
)TM@LDI@NALNI@IDL@MIM@S@MM@  R@I ONSDJ@ ON MNSQ@MINRSH
K@FTMD  9@ NLDIHSDU NALNI@ RLN
izbrali kanal Chornio (zdaj kanal CorMHN  J@SDQDF@ AQDFNUH RN RKTHKH JNS
Y@HS@OQDCM@MNRH JHIHGSTNCK@F@K@
Brenta, kasneje pa starodavni kanal
Mazor (Maggiore). V 16. stol. so naLQDS@CU@J@M@K@TONQ@AKI@KHY@NC-

vajanje vode iz Brente skozi razirjeMHHYGNCHYOQHRS@MH@U,@K@LNBBT 


-@MNRHUDMNSH#NKNKDHINM@OKDistocenskem sloju enote Mestre, v
svojem najbolj zahodnem delu pa
deloma pokrivajo stareje holocenske nanose EAP Camponogare. Za
$ /#NKNIDYM@HKM@OQDBDIHQNJ@HYgonska struga (greben Stra), ki poteka v smeri ZJZ-VSV od Straja do Oriaga vzporedno s plovnim kanalom
Brente (glej sl. 12, 13). Viina grebeM@IDM@IUD LFKDCDM@NJNKHJN
MHHMN  MIDFNU@ HQHM@ O@ RD ROQDLHnja od nekaj sto metrov do enega kilometra.
Naravni podaljek omenjenega
HYFNM@URLDQHQDMDF@SNJ@NC2SQ@I@CNHYKHU@UAKHHMH%TRHMDUK@FTMHID
MHIHHMNIHHYFNMRJHFQDADM,@KBNMSDMSD  JH U AKHHMH .QH@F@ MDM@CNL@
ostro zavije v smeri proti SZ - JV. Vsi
L@MIHHYFNMH JHRDNCBDOHINNCITMDF@ANJ@HYFNM@2SQ@ SDDINURLDQH
29 )5 5AKHHMH#NK@RDURHRSDLUJKITH FQDADM +TF@  JH U HQNJDL Y@UNIT
poteka do Lughetta. Na zahodnem
NAQNAIT ,HQD RD Y@DMI@ FQDADM  JH
se pri Piazzi Vecchi razdeli v dve veji.
Prva izrazito zavije vzhodu in s preJHMHSUHIN SDD UYONQDCMN R OKNUMN
potjo, ki povezuje Taglio Nuovissimo
s kanalom Bondante (izgon Dogaletta). Druga se obrne proti jugu in se
zvija med naravnimi vodnimi zajetji
v laguni med krajema Lago StradoMHHM5@KKD,H@MD 3@UUDIDLCDKT
njegovega poteka mu sledi Sborador
de Gambarare) je znan pod imenom
Dosso di Giare (Greben Giare). Na
UYGNCMDL NAQNAIT ,HQD RD Y@MD
DDML@IGDMUYFNM JHRDMDJNM@
U K@FTMH  SDLUD RD U MIDFNUDL Y@JKITMDL CDKT NCBDOHIN RS@QD QDMD
struge, ki se nadaljujejo v isti smeri
proti laguni.
Predvideva se, da se je enota
oblikovala predvsem v zadnjem tiRNKDSITJNSONRKDCHB@OQDTRLDQHSUD
!QDMSDUAKHHMHJQ@I@/NMSDCH!QDMS@ 
JHINYFNCNUHMRJHUHQHTLD@INUKDSN
1142. Edina datacija 14 na tem poCQNITRDM@M@@M@UYNQDBNSMDF@
mulja iz globine od 2,10 in 2,35 m
pod t.i. izgonom Giare, ki je pokazal
RS@QNRS  o  !/ !.-#$2 - in
drugi 2008). Organska plast je prekrita s slojem srednje grobega peRJ@  LTKI@RSDF@ ODRJ@  M@SN O@ MN
YQM@SDF@ ODDMDF@ LTKI@  D J@KHbriramo datum, to pomeni, da je do
M@K@F@MI@M@OK@UHMM@QDMDAQDFNUD

in do formiranja izgona prilo na prehodu med 11. in 12. stol., kar kronoloko povsem sovpada z datumom
preusmeritve Brente, ki ga navajajo
zgodovinski viri.
9MNSQ@INARDMDDMNSD$ /#NKN
so prepoznavni nekateri deli, ki se
NAM@@IN Q@YKHMN Y UHCHJ@ @QGDNKNkega potenciala.
Greben Stra sovpada z vijimi
KDF@LH SD FLNSD  5 M@ICHT U 2@Lbrusonu severno od Mire so odkrili
predzgodovinsko naselbino (bronasta doba?) v globini 2,5 m, kar bi lahko kazalo na stratigrafski razvoj izFNM@NC@R@OQDCOQ@YFNCNUHMRJHL
NACNAIDLCNC@MDR !NKISD@UMNID
NBDMHSHONKN@IQHLRJDM@RDKAHMD Dprav je treba opozoriti, da bi lahko
KNY@M@ICAD JHRNUDHMNL@ONFKDdale na povrje ali so bile prekrite s
tanjim slojem naplavin. Najdbe so
MDJNKHJN OQNSHRKNUMD D M@ OQHLDQ
OQNTTIDLN NCRDJ LDC #NKNL HM
Sambrusonom, ugotovimo, da so
M@ICH@HYQHLRJDCNADK@GJNONFKDdala na plano zaradi oranja zemlje ali
Y@Q@CH OKDMIDMI@  @ @K MD UDLN  M@
kakni globini se nahajajo. Najdbe
v smeri proti Miri in od tod do lokacije Porto Menai so morebiti posleCHB@ NARDMHG ONOK@UKI@MI  JH O@ RN
verjetno vplivala samo na nekatere
od njih (kot na primer srednjeveko
M@ICHD QDMDF@ SHO@  2@LAQTRNM 
via Carezzioi). Najpomembneje najCHD U Y@CMIDL CDKT LDC .QH@FNL
in Fusino pa je nedvomno nekropola
na lokaciji Lizza Fusina, kjer so se v
FKNAHMHOQHAKHMN LM@KHSQHIDM@grobni napisi iz rimskega obdobja.
Ta najdba bi lahko podprla dejstvo,
da je navedeni izgonski greben verjetno najmlaji od treh analiziranih
odsekov, in sicer bi ga lahko datirali
v obdobje poznega srednjega veka.
/NRDAMNONYNQMNRSRHY@RKTHONCQNID #NF@KDSS@  2U  (K@QHID CALAON,
FERRI 2008), ki se je v preteklosti
nahajalo ob ustju srednjevekega
QDMDF@ SNJ@ !QDMSD  /NKN@I R@LNRS@M@IDONUDY@MRRS@QNC@UMNQDMN
RSQTFN  JH M@I AH ONSDJ@K@ ITMN NC
MIDF@ JNS KNFHMH ONC@KIDJ HYFNMRJDF@FQDADM@ JHRDNCBDOHNC,HQ@
Port (BONDESAN, MENEGHEL 2004,
str. 293). Na nasprotni strani, kjer
se razteza laguna, so se odkrile sledi pritokov vse do Fusine, kjer so se
verjetno nahajali pristaniki objekti (infra). Opozoriti je treba, da je iz
zgodovinsko - arheolokega vidika

35

)LJ'RVVLXYLDOLULFRQRVFLXWLDOOLQterno delle unit di paesaggio antico reODWLYH DO XPH %UHQWD SHU OD OHJHQGD
delle UPA vedere Tav. 1).
6O5HQLJUHEHQLSUHSR]QDQL]QRWUDM(QRW$QWLQH3RNUDMLQHNLVHQDQDajo na reki Brenta in Bacchiglione.
12

36

)LJ/HSULQFLSDOLGLUHWWULFLGLGHXVso oloceniche del Brenta nellarea compresa tra Naviglio Brenta e Bacchiglione
(da BONDESAN, MENEGHEL 2004, moGLFDWR 
Legenda: margine interno lagunare e liQHDGLFRVWDGHVXQWLGDFDUWRJUDDVWRULFD   VHFROR ;9, H   DQQR   
limite della spiaggia intertidale desunto
GD FDUWRJUDD VWRULFD DQQR    
DQWLFR FRUVR XYLDOH GHVXQWR GD FDUWLJUDD VWRULFD ;9, H ;9,, VHFROR   
GRVVLGHO%UHQWD 2ORFHQH  GRVVRXYLDOH LQ ODJXQD GHVXQWR GD FDUWRJUDD
VWRULFD   GRVVL GHOO$GLJH H GHO 3R  
limite della carta geomorfologica della
3URYLQFLDGL9HQH]LD GLUHWWULFLGLGHXVVR VH]LRQHVWUDWLJUDFD GDtazioni 14C.
Sl. 13 - Glavne smeri odtokov reke BrenWD QD REPRMX PHG SORYQLP NDQDORP
Brenta in reko Bacchiglione v holocenu
(iz BONDESAN, MENEGHEL 2004, spremenjeno).
Legenda: notranji lagunski rob in obalna linija so povzeti iz zgodovinske karWRJUDMH    VWRO LQ   OHWR 
  PHMD SODH QD REPRMX SOLPRYDQMD
SRY]HWD L] ]JRGRYLQVNH NDUWRJUDMH
OHWR  QHNGDQMLWRNUHNHSRY]HW
L] ]JRGRYLQVNH NDUWRJUDMH  LQ 
VWROHWMH    JUHEHQL UHNH %UHQWD +RORFHQ  UHQLJUHEHQYODJXQLSRY]HWL]
]JRGRYLQVNHNDUWRJUDMH JUHEHQLUHN
$GLDLQ3DG PHMDJHRPRUIRORNHJD
zemljevida Pokrajine Benetke 9) smeri
odtokoY   VWUDWLJUDIVNL SUHVHN  
datacije 14C.
13

37


38

te esistevano delle strutture portuali


(infra). Va sottolineato come, su di un
piano squisitamente storico archeologico, stata da tempo riconosciuta al monastero altomedievale di S.
Ilario pure una funzione tipicamente
itineraria ed economica, ponendosi
HMBNKKDF@LDMSNTUH@KDBNMKDMSQNterra e con la laguna (CALAON, FERRI
2008).
La parte meno elevata dei depositi di Br 5 mostra, soprattutto a Sud,
una particolare quantit di rinvenimenti di et romana, in qualche caso
BNM BNMSHMTHS MN @KK@ 3@QC@ MSHBGHS RNMN ODQ KN OH CNUTSH @C @ENQ@LDMSHDCTMPTDBNKKNB@SH@RB@QRDOQNENMCHS (MDDSSH@KKHLHSD2TC
di questa UPA, in prossimit di Br2,
DLDQFD TM@ RTODQBHD +&, BK@RRHcata ancora come B1, oltre ad altre
zone dello stesso genere inglobate
al suo interno. Non mancano peraltro tracce di rinvenimenti protostorici, in realt segnalazioni generiche,
tanto che si ha la sensazione che la
seconda et del Ferro possa essere
qui rappresentata da giaciture sostanzialmente simili alle romane.
Dunque in modo ancor pi marcato
che a nord, il settore pi meridionale
RDLAQ@MNM@UDQBNMNRBHTSNRHFMHcativi apporti postromani, esistendo
PTHK@QFGDONQYHNMH@NQ@MSHCHSDQQHtorioper le ricognizioni si veda GO
RINI 2011).
Unaltra area che conviene considerare a parte coincide con i depositi deltizi del bacino di Malamocco.
/TQ DRRDMCN HM AHAKHNFQ@@ CHRONMHbili pochissimi dati, vanno citati i rinvenimenti di probabili strutture portuali in legno e soprattutto il comparto del monastero bassomedievale di San Leonardo in Fossa Mala,
oggetto di interventi di scavo che
hanno evidenziato, tra laltro, un ediBHNDBBKDRH@RSHBN@C@ARHCHHMRBQHSSD
(FERSUOCH 1995). proprio questa
larea nella quale possono potenzialmente concentrarsi rinvenimenti
KDF@SH@CTMNCDHS@MSHODQBNQRHK@FTnari del Brenta in et protostorica e
storica, tema che ha dato origine ad
una vasta letteratura di ipotesi pi
o meno attendibili. Per quanto concerne il quadro protostorico alcune
direttrici del Brenta sembrano concentrarsi nella zona di Lova (supra),
sede del santuario di et romana
repubblicana, per poi proseguire ad
est della gronda lagunare nei trac-

ciati del canal Cornio e del canal Mazor, e di qui raggiungere larea di San
Leonardo in Fossamala. Dopo uno
iato di attivit cui sarebbe stato soggetto il sito durante let romana, sia
pure del tutto da chiarire, il comparto di San Leonardo avrebbe ripreso
lattivit nel VI-VII secolo, ben prima
della fondazione del monastero (riassunto in BONDESAN, MENEGHEL
2004, pp. 287-298 e 315-320).
83$GL'HOWD%UHQWD%U
LUPA Delta Brenta appartiene
alla porzione terminale del sistema
deposizionale olocenico del Brenta.
quindi costituita da depositi alluUHNM@KHQDBDMSHCHPTDRSNTLDTKSHmi 500 anni) con minori apporti da
parte del Bacchiglione.
A ovest di Chioggia presente
il delta endolagunare formato dal
!QDMS@ MDK 75( RDBNKN !Q @ D MDK
periodo compreso tra il 1842 e il
1896 (Br 6b), a seguito di diversioMH @QSHBH@KH DDSST@SD C@H UDMDYH@MH
(ZUNICA 0TDRSN@MSHBNCDKS@ 
@SST@KLDMSDANMHB@SNDCDMNLHM@SN!NMHB@#DKS@!QDMS@ Q@OOQDRDMS@
il settore pi esteso dellUPA Delta
Brenta. Oltre ai corsi attuali dei due
TLH HMPTDRS@TMHSUHDMDE@SSNQHcadere anche il paleoalveo visibile
a sud della foce del Brenta-Bacchiglione, allinterno dellunit costiera,
corrispondente a un ramo del Brenta (Brenta Vecchio@SSHUNC@KK@MD
CDK 75(( RDBNKN MN @KK@ CDUH@YHNMD
del 1842 (Br 6c). Dopo la deviazione
del Brenta, lalveo fu ripreso dal BacBGHFKHNMDD@AA@MCNM@SNCDMHSHU@mente nel 1896 a seguito dellattivazione della foce attuale.
83$GHO6LOH6OHGHO'HVH
Zero - Ds
LUPA del Sile si formata nel
punto di giunzione tra la porzione medio-distale del megafan del
Brenta di Bassano e i megafan del
Piave di Montebelluna e di Nervesa: questarea caratterizzata da
TM@ A@RRTQ@ TUH@KD HMBHR@  RTBBDRsivamente riempita dai depositi di
B@M@KD D CH @QFHMD MN @ BNRSHSTHQD
una dorsale allungata che si eleva
sulla pianura. In questa porzione di
territorio, infatti, il dosso del Sile costituisce lelemento morfologico di
L@FFHNQ ROHBBN DKDU@MCNRH MN @KK@
quota di 7 m s.l.m. Il dosso stretto
(larghezza massima di circa 500-600

m) e allungato ed marcato dalla


presenza delle sabbie che seguono
STSSN HK BNQRN TUH@KD HM CDRSQ@ D HM
sinistra.
Un carotaggio condotto in prossimit dellargine sinistro del Sile ha
consentito di individuare depositi
sabbiosi collegabili a una occupazione dellalveo da parte del Piave
durante lOlocene. I sedimenti occupano unincisione profonda circa
12 m rispetto alla circostante piana
pleistocenica e larga meno di 600 m:
il tetto del riempimento sabbioso
RS@SNC@S@SNo@MMH!/BON
DESAN et alii 2008). Pi a monte, nei
pressi di Casier (TV), MOZZI (1995,
1998) segnala la deposizione ancora attiva delle ghiaie del Piave almeMNMN@o@MMH!/ BNLDRH
evince dalla datazione 14C eseguita
su di una ceppaia seppellita allinterno dei depositi ghiaiosi. Pertanto,
RDLAQ@OQNU@SNBGDSQ@K@MDCDK(((
e linizio del II millennio a.C. il Piave
RH@CDTHSN@KKHMSDQMNCDK2HKD LDMtre lipotesi che il primo seguisse
questo percorso anche in epoca Romana non trova, per ora, un riscontro
MDHC@SHRSQ@SHFQ@BH 
Il superamento del Sile da parte della via Annia e la scoperta dei
resti di un ponte romano, in corrispondenza dellattraversamento, depongono a favore di una sostanziale
RS@AHKHSCDKSQ@BBH@SNTUH@KD (KE@Sto che la via Annia sia visibile anche
sopra i sedimenti del dosso potrebbe essere imputato alla continuit
CTRN CDKK@ RSQ@C@ OQNSQ@SSNRH MN @
qualche secolo fa (BONDESAN et alii
2008).
Lestensione della fascia di recente alluvione in destra Sile si protende talora in modo irregolare verso sud, mentre in sinistra le alluvioni
sono chiaramente delimitate al piede del dosso sabbioso. Lestrema variazione di questo limite legata al
fatto che il Sile verso sud si spinto
in laguna con pi rami: le acque di
OHDM@CDKTLD DRNMC@MCNRTKSDQreno circostante, hanno via via colmato aree che precentemente appartenevano allambiente lagunare.
COMEL (1964) riporta che ai
SDLOH CH ,@QBN "NQM@QN 75 RDBNKN
il Sile sfociava in laguna attraverso
un delta formato da sette bocche,
cio sette rami ricordati anche nei
Passionarii aquileiesi (PAVANELLO
1919). I nomi delle sette bocche era-

no: Dolce - Duxia - Manco - Dumorso - Follinico - Siletto - Siloncello


(CAGNAZZI 1979). Alcuni di questi
Q@LH RNMN STSSNQ@ QHBNMNRBHAHKH F 
14): il Canale Silone (in passato detto anche Siglone, Canal Dolce, Sione), il Canale Siloncello (detto anche
Sionzello, Sioncello, Sioncelo) e il
Canale Siletto (o Sileto). Altri vennero abbandonati (ad esempio il Canale dei Lanzoni) o furono occupati da
TLHLHMNQH@CDRDLOHNK@ENBDCDK
#DRD COMEL   ( CDKS@ TUH@KH
endolagunari di questi antichi rami
CDK2HKDF RNMNRS@SHHCDMSHB@ti a sud di Altino, nella fascia interna alla laguna a ridosso del margine
lagunare attuale (BONDESAN, MENE
GHEL 2004).
Tra il Dese e lo Zero (UPA del
#DRD  9DQN  DQ@MN OQDRDMSH MN @
qualche decennio fa delle aree paludose (COMEL 1964) e ci sono evidenze, basate su recenti rilevamenti
pedologici (GIANDON et alii 
ARPAV 2005), che le esondazioni di
questi due corsi dacqua hanno interessato tratti limitati di pianura ubicati in prossimit del margine laguM@QD  4M@ RDYHNMD RSQ@SHFQ@B@ @M@lizzata in occasione della messa in
opera del Passante di Mestre (MAR
CHESINI et alii 2009), ha evidenziato la presenza di depositi legati a
DUDMSHCHSQ@BHL@YHNMDDCHQNSS@Tviale, indici di una moderata attivit
DRNMC@SHU@CDHTLHCHQHRNQFHU@ +@
datazione 14C di resti vegetali situati
allinterno di questi depositi a 2,60
m di profondit dal piano campagna
in prossimit dello Zero, ha fornito
TMDSO@QH@o@MMH!/ BNMEDQL@MCN K@ OQDRDMY@ CDK TLD HM
PTDRS@QD@MC@K5(( 5(((RDBNKNC "
Dal punto di vista archeologico
deve essere rimarcato soprattutto il
fatto che Il sistema dei delta endolagunari riconoscibili a sud e a est
dellarea altinate formato dagli
@OONQSH TUH@KH CDK 2HKD D CDK #DRD 
apporti che invasero lo spazio lagunare formando ambienti paludosi
con barene e torbiere. La datazione
di tali depositi fa leva sullevidenza del passaggio da unarea francamente lagunare a una barenicola di
emersione negli ultimi 1500-1000
@MMH  0TDRSN RHFMHB@ BGD C@K OTMto di vista geomorfologico limpaludamento dellarea tra Torcello e il
margine lagunare iniziato a partiQDC@KK@MDCDKODQHNCNQNL@MNDC

D CNKFN YM@MN LMDMID  C@ ID HLDK


srednjeveki samostan S. Ilarija tudi
ETMJBHIN ONHU@KH@ HM SQFNURJDF@
RQDCH@ R@IIDRS@KM@OQNLDSMHONvezavi plovne poti med laguno in zaledjem (CALAON, FERRI 2008).
-HIHCDKM@OK@UHMM@ONCQNIT!Q
 OQDCURDL U RUNIDL ITMDL CDKT
URDATID OQDBDIMIN JNKHHMN NRS@KHM
iz rimskega obdobja, ki se v nekaterih primerih neprekinjeno nadaljuIDIN URD CN ONYMD @MSHJD FQD OQDCvsem za povrinske najdbe, ki torej
KDHIN AKHYT ONUQI@  #DI@MRJN RD ID
M@ ITMH LDIH SD DMNSD U NCRDJT !Q
2 na povrju pojavila ledenika ploRJDU JHRLNINJK@RHBHQ@KHJNS! ONleg nje pa so zanimiva e druga v njo
UJKITDM@ HRSNUQRSM@ ONCQNI@  SDvilne so tudi sledi predzgodovinskih
NRS@KHMUQDRMHBHFQDY@KDY@M@UDCAD
splone narave, tako da opazovalec
CNAHNATSDJ C@RN@QSDE@JSHHYCQTFDONKNUHBDDKDYMDCNADOQDBDIONdobni tistim iz rimskega obdobja. Za
ITMHCDKSNQDIDANKINCRDUDQMDF@
velja, da na njem po koncu rimskega
obdobja ni prilo do bistvenih nanosov materiala, saj tu obstajajo obseMHOQDCDKH J@SDQHGRONCMIDOK@RSHRN
pogledale na povrje (za pregled glej
GORINI 2011)
#QTFN ONCQNID  JH RH Y@RKTH ONsebno obravnavo, sovpada z nanosi
iz delte v naravnem zajetju MalamoBB@  DOQ@U ID U KHSDQ@STQH M@ UNKIN
zelo malo podatkov, navajamo najCH@KDRDMHGRSQTJSTQ JHRNUDQIDSMN
OQHO@C@KH OQHRS@MHT  OQDCURDL O@
del samostana Sv. Leonarda v Fossi
Mali iz poznega srednjega veka, kjer
se je med izkopavanji poleg ostalega odkrilo tudi cerkveno poslopje
z popisanimi apsidami (FERSUOCH
  /Q@U M@ SDL NALNIT AH RD
lahko morebiti nahajale tevilne
M@ICAD ONUDY@MDYDMHL@KHUDK@FTMRJHLH QDMHLH SNJNUH !QDMSD U
OQNSN HMYFNCNUHMRJDLNACNAITKHterature na to temo je veliko, domneve o njej pa so bolj ali manj zanesljive. Kar zadeva predzgodovinsko obCNAID RDYCH C@RDM@IUDCNLMDUMHG RSQTF !QDMSD M@G@I@ U NALNIT
+NUDFKDIYFNQ@I RDCDTRUDSH@HY
obdobja rimske republike, ter da se
nato nadaljujejo vzhodno od roba
lagune po strugah kanala Cornia in
J@M@K@ ,@YNQI@  NC JNCDQ CNRDDIN
NALNID2U +DNM@QC@HM%NRR@L@KD 
/N NACNAIT UQHLRJDL @RT  JN RN
RS@QNRDKBH KNJ@BHIN Y@OTRSHKH DOQ@U


je to domnevo treba e razjasniti) je


ONCQNID 2S  +DNM@QC@ ONMNUMN ONstalo dejavno v 6. - 7. stol., torej precej pred gradnjo samostana (povzetek v BONDESAN, MENEGHEL 2004,
str. 287-298 in 315-320).
($3'HOWD%UHQWD%U
EAP Delta Brenta pripada zadnjemu odseku holocenskega naplavinskega sistema Brente. Sestavljajo jo
SNQDI MDC@UMD QDMD M@OK@UHMD SD
reke (zadnjih 500 let) z manjimi nanosi reke Bacchiglione.
Zahodno od Chioggie se v notranjem delu lagune nahaja delta, ki jo
je Brenta izoblikovala v 16. stol. (Br
6a) in v obdobju med letoma 1842
HM!QA JNRN!DMD@MHTLDtno preusmerili njen tok (ZUNICA
1974). Ta starodavna delta, zdaj izsuena in imenovana %RQLFD 'HOWD
Brenta, OQDCRS@UKI@ M@IANKI NARDMN
NALNIDDMNSD$ /Delta Brenta. Poleg dananjih tokov obeh rek spada
RDL STCH RS@Q@ QDM@ RSQTF@  UHCM@
U MNSQ@MINRSH NA@KMDF@ O@RT ITMN
od ustja Brente-Bacchigliona, ki soUO@C@YDMHLQDMHGQNJ@UNU!QDMSD
(Brenta Vecchio - Stara Brenta), aktivnim od konca 17. stol. do umetne
preusmeritve leta 1842 (Br 6 c). Po
tej preusmeritvi Brente je staro struFNHYJNQHRSHK!@BBGHFKHNMD CNJNMMN
pa so ga opustili leta 1896 po odprtju trenutnega ustja.
($36LOH6,LQ'HVH=HUR'V
$ /2HKDIDM@RS@K@NARNQDITLDC
distalnim in srednjim delom megafana Brente del Bassano in megafana
Piave di Montebelluna in Nervese:
Y@ ONCQNID ID YM@HKDM M@OK@UHMRJH
MHHMRJHRUDSYUQDY@MHLHQDMHLHJNriti, v katera so se nalagale naplavine iz kanalov in jih postopoma dviFNU@KDM@CNJNKHJHMHHMRJHRUDSURD
do nastanka izgonskih strug. Na tem
delu ozemlja prav struga reke Sile
pedstavlja najbolj viden morfoloki
element, saj se mestoma dvigne tudi
do 7 metrov nadmorske viine. Izgon
je ozek (v najirem delu meri okoli
 LHMQ@YSDFMIDMONBDKNSMH
CNKHMHF@M@KDUDLHMCDRMDLAQDFT
obdaja pesek.
Iz analize vrtine na levem bregu
2HKD RN Q@YUHCMH ODDMH M@MNRH  JH
J@DIN C@IDRSQTFNUGNKNBDMTTONrabljala reka Piava.
Sedimenti segajo do globine 12
m v primerjavi z okoliko pleistocen-

RJNMHHMNHMRNHQNJHL@MIJNS
L 2S@QNRSJQNUMDF@RKNI@ODDMDF@
M@MNR@IDC@SHQ@M@M@oKDS
BP (BONDESAN in drugi 2008). Vije
OQNSHQDMDLTSNJT UAKHHMH"@RHDQja (TV), MOZZI (1995, 1998) opozarja na e aktivno nalaganje prodnih
nanosov Piave, z ocenjeno starostjo
UR@IoKDS!/ J@QCNJ@YTje datiranje 14 C panja, vkopanega v
prodnatih depozitih. Zdi se torej, da
se je na prehodu med koncem 2. in
Y@DSJNL   SHRNKDSI@ OQ  M  S  /H@U@OQDKHK@U2HKNCNLMDUD C@M@IAH
se v tej strugi nahajala e v rimskem
obdobju, pa stratigrafski podatki zaenkrat e niso potrdili.
Dokazi o tem, da je via Annia
OQDJ@K@ 2HKN HM M@ICAD NRS@MJNU
QHLRJDF@LNRSTM@LDRSTOQDJ@MI@
FNUNQHINUOQHCOQDBDIRS@AHKMDF@QDnega toka. Dejstvo, da je via Annia
vidna tudi na naplavinah vrh izgonRJD RSQTFD  UDQIDSMN J@D M@ MDOQDkinjeno uporabo ceste vse do obdobja pred nekaj stoletji (BONDESAN in
drugi 2008).
Po nedavnih poplavah desnega
brega Sile se je poplavna ravnica
razirila, tako da se zdaj na nekaterih mestih neenakomerno izteza
proti jugu, poplave na levem bregu
O@ RN NLDIDMD HYJKITMN M@ UYMNID ODDMDF@ HYFNM@  (YQ@YHSN UDKHJD
spremembe te meje so povezane z
dejstvom, da se je Sile na svoji poti
OQNSH K@FTMH M@ ITFT Q@YBDOHK@ U UD
QNJ@UNULDCONOK@UKI@MIDLIDUNC@
ONRSNONL@HYONKMHK@ONCQNI@ JHRN
prej pripadala sistemu lagune.
COMEL  ONQN@  C@ RD ID
U @RT ,@QB@ "NQM@Q@   RSNKDSID
Sile iztekala v laguno skozi delto, v
kateri je bilo sedem ustij, torej sedem
QDMHG SNJNU  JH IHG NLDMI@IN STCH U
Oglejskih pasijonarjih - Passionarii
aquileiesi (PAVANELLO 1728). Imena
sedmih ustij so bila: Dolce - Duxia Manco - Dumorso - Follinico - Siletto
- Siloncello (CAGNAZZI 1979). NekaSDQD NC SDG QDMHG UDI RN D C@MDR
vidne (sl. 10): Kanal Silone (v preteklosti imenovan tudi Siglone, Canal
Dolce, Sione), kanal Siloncello (imenovan tudi Sionzello, Sioncello, Sioncelo) in kanal Siletto (ali Sileto). OstaKH RN NOTDMH M@ OQHLDQ J@M@K CDH
Lanzoni) ali pa so jih zasedli manji
UNCNSNJHM@OQHLDQTRSIDQDJD#DRD
COMEL 1DMDCDKSDSDG@MSHnih tokov Sile v notranjosti lagune
RK RNNCJQHSDITMNNC KSHM@M@

MNSQ@MIDL NAQDIT C@M@MID K@FTMD


(BONDESAN, MENEGHEL 2004).
Med rekama Dese in Zero (EAP
Dese-Zero) so se do pred nekaj deRDSKDSIH M@G@I@K@ LNJQH@ COMEL
 M@ ONCK@FH MDC@UMHG ODCNlokih raziskav (GIANDON in drugi
 1/ 5NARS@I@INCNJ@zi, da je poplavljanje teh dveh vodoSNJNUUOKHU@KNM@MDJ@SDQ@NALNI@
MHHMRJHG OQDCDKNU U AKHHMH QNAT K@gune. Stratigrafski prerez, ki so ga
analizirali med gradbenimi deli obvoznice v Mestrih (MARCHESINI in
drugi 2009) je prikazal obstoj nanosov, ki so posledica poplavljanj in
OQDTRLDQHSUDQDMDF@SNJ@ J@QJ@D
na zmerno poplavno aktivnost rek
krakega izvora. Datiranje14C ostankov rastlinskega izvora v notranjosti
teh depozitov v globini 2,60 m pod
MHUNIDLNJNKHJDMHHMDUAKHHMHQDJD
9DQNJ@DM@RS@QNRSoKDS
BP, kar potrjuje prisotnost reke na
SDLONCQNITNC  RSNKDSI@C@KID 
Z arheolokega vidika je potrebno poudariti predvsem dejstvo, da
sta sistem delt v notranjosti lagune,
UHCDM ITMN HM UYGNCMN NC ONCQNI@ KSHM@  TRSU@QHKH QDJH 2HKD HM #DRD
s svojimi naplavinami. Te so vdrle v
K@FTMNHMUMIDIONUYQNHKDM@RS@MDJ
LNJQHYONCQNIHRK@MJ@RSDUNCDHM
NSHH #@S@BHI@SDGM@MNRNURDNOHra na dokaz o prehodu iz jasno izraDMDF@ NJNKI@ K@FTMD U ONKRK@MJ@RSH
habitat z dvignjenimi povrinami v
zadnjih 1500-1000 letih. To pomeni,
C@RDIDOQNBDRONRSNOMDF@LNUHQIDMI@ONCQNI@LDC3NQBDKKNLHMQNbom lagune z geomorfolokega vidiJ@Y@DKNCJNMB@QHLRJDF@NACNAI@
in se nadaljeval e skozi ves srednji
vek. ele po preusmeritvi reke Sile,
JHRNF@NOQ@UHKH!DMD@MHKDS@
zaradi bojazni, da bi lahko prilo do
Y@LNUHQIDMI@ K@FTMD NJNKH 3NQBDKK@ 
se je postopek nanosa naplavin zaJKITHK M@Q@UMHA@YDMK@FTMDO@RDID
RODSY@DKHQHSH 
Ta posebni geomorfoloki poKN@I K@FTMD ID MDCUNLMN UDKHJDF@
pomena e posebej iz vidika povezanosti obeh glavnih zgodovinskih
RQDCH KSHMNM@RDUDQTHM3NQBDKKN
na jugu) tik zunaj meja EAP. Gre torej
Y@OQDGNCMNNALNID Y@J@SDQDF@ID
YM@HKDM CNADQ M@ANQ NRS@KHM  JH IHG
LNFNDANKI@KHL@MISDRMNONUDY@SH
YCNKNDMHLHYFNCNUHMRJHLHNACNAIH
OQDCURDL R ONYMN@MSHMHL HM RQDdnjevekim) razvoja severne lagune,

39

Fig. 14 - Unit di paesaggio antico dei


XPL6LOH'HVHH=HUR,QD]]XUURVRQR
evidenziati i tracciati antichi (XVII secoOR GHLFRUVLGDFTXDWUDWWLGDFDUWRJUDD
VWRULFDSHUODOHJHQGDGHOOH83$YHGHUH
Tav. 1.
6O(QRWDDQWLQHSRNUDMLQHUHN6LOH
'HVHLQ=HUR9PRGULEDUYLVRR]QDHQH
stareje trase (17. stol.) vodotokov, pov]HWLL]]JRGRYLQVNHNDUWRJUDMH
14

40

continuato per tutto il Medioevo.


Solo dopo il taglio del Sile, operato
C@ 5DMDYH@ MDK  @K MD CH DUHtare limpaludamento della laguna
di Torcello, il processo deposizionale
cessa, con conseguente nuova fase
di espansione del bacino lagunare.
0TDRS@ O@QSHBNK@QD RHST@YHNMD
geomorfologica sembra rivestire un
grande interesse, soprattutto nella
prospettiva di un collegamento tra
le due entit storiche principali della zona, poste appena al di fuori dei
limiti di questa UPA, ovvero Altino a
N e Torcello a S. Si tratta dunque di
una zona di passaggio caratterizzata
da una buona serie di rinvenimenti,
che a vari gradi sembrano collegabili
@RODBHBGDE@RHBQNMNKNFHBGDMDKKDvoluzione della Laguna N, soprattutto quella tardoantica ed altomedieU@KD  D @C TM@KSQDSS@MSN RODBHB@
funzione idroviaria.
4M@ RODBHB@ E@RD CH @SSHUHS CH
tutto il comparto, a parte il problema
delle presenze classiche, riguarda in
particolare let tardoantica ed altomedievale, quando al segnale di inizio di una frequentazione stabile e
strutturata a Torcello (dal IV-V secolo) corrisponde lattenuazione delle
strutture portuali di Altino, ma non
K@RT@MDBNLDBDMSQNTQA@MNCHQHferimento economico e politicoGE
LICHI   OO    GELICHI
2010). Da questo momento il collegamento tra Altino e Torcello, e probabilmente altri siti attivi nello stesso periodo nella Laguna Nord, avvie-

ne mediante una serie di idrovie che


possono essere sintetizzate da una
parte nella prosecuzione verso sud
dellalveo del Sioncello-Santa Maria,
dallaltra nella continuazione del Sile
(nella stessa direzione, ma secondo
una direttrice parallela collocata pi
ad E), attraverso il Sile Vecchio. Nel
primo caso saremmo in presenza di
una via di diretto collegamento tra
la zona portuale di Altino e lemporio di Torcello, nel secondo caso tra
la zona di Porte Grandi ed una serie
CHQHMUDMHLDMSHK@FTM@QHBNLDPTDKli pertinenti alla barena del Vigno e a
SantAriano, per quanto questi ultimi
vadano ancora sottoposti ad un approfondita valutazione critica.
Gli ultimi dati provenienti da ricerche recentissime o ancora in corso sembrano comprovare una fase
di rilevante intensit insediativa
dallet romana e poi ancora tra VI
D 7 RDBNKN  BNLD QHRTKS@ C@ 2@M +Nrenzo di Ammiana (GELICHI, MOINE
2012, pur essendo un sito propriamente appena al di fuori della UPA
in questione) e come constatato ad
esempio nel caso di Santa Cristina,
canale Alfonso a N della medesima
isola, dove ricerche subacquee hanMNLNRSQ@SNK@OQDRDMY@CHO@KHB@SD
di fondazione associate ad una straSHFQ@@C@AHS@SNBORTOLETTO et alii
Un ultimo periodo da mettere
in luce riguarda linsediamento pieno e tardomedievale, percepibile anche attraverso le istituzioni religiose
e monastiche ed una documentazio-

ne archeologica ancora frammentaria. Numerose comunque le attestazioni, come nella stessa S. Ariano o
nella vicina Santa Cristina.
83$GL0HROR3Y
LUPA di Meolo si rinviene nel
settore compreso tra lunit del
Sile e lunit di San Don, e in piccoli lembi isolati lungo il margine
settentrionale dellarea Parsjad tra
/H@UDD+HUDMY@ 0TDRSNSQ@SSNCHOH@nura costituito da depositi plavensi dispersi lungo la fascia orientale
del megafan di Nervesa. Let della
pianura relativamente antica con
terreni appartenenti al Pleistocene
superiore, ai quali sono sovrapposti
lembi ristretti ed esigui di coperture
OH QDBDMSH CDONRSD C@H TLH CH QHsorgiva, in particolare Musestre, Vallio e Meolo.
Nel settore nord-orientale si posRNMN HMCHUHCT@QD CTD OH@MD TUH@KH
incise nella pianura, collocate tra i
dossi del Sile e del Piave attuale: la
prima si trova in corrispondenza del
TLD,DNKNBGDRBNQQD@KRTNHMSDQno, mentre la seconda, situata pi a
est, si sviluppa lungo il corso dacqua
denominato Scolo Correggio. In corrispondenza dellabitato di Meolo,
un lembo di pianura LGM rimasto
isolato tra le due incisioni risultando
cos pi elevato rispetto al territorio
circostante.
Il settore corrispondente alla Tenuta di C Tron caratterizzato dalla
presenza di un sistema di tracce di

antichi corsi dacqua legati alle ultime fasi di formazione della pianura
da parte di un ramo del Piave passante probabilmente per San Cipriano durante lultima glaciazione. In
particolare, uno di questi antichi percorsi pleistocenici (paleoalveo della
Canna) stato in seguito ripreso sia
dalle acque di risorgiva sia dalle acPTDCHQTRBDKK@LDMSNRTODQBH@KD (K
paleoalveo attraversa due percorsi
della via Annia in corrispondenza
dei quali sono stati rinvenuti i resti
di due ponti e di un insediamento
rustico (BUSANA, GHEDINI 2004).
83$GL*UDVVDJD3Y
LUPA di Grassaga corrisponde ai
depositi sedimentati dalla direttrice
del Piave che si allunga in direzione NO-SE passando fra gli abitati di
Santa Teresina e Grassaga. Si tratta
di depositi alluvionali costituiti da
limi argillosi, argille e argille organiche, sabbie e sabbie limose. Essi
corrispondono a facies di canale abbandonato correlate ad alvei relativamente incisi rispetto alla pianura
pleistocenica e, secondariamente,
a facies di piana desondazione. Al
centro dellunit riconoscibile la
traccia molto evidente di un paleoalveo meandriforme, mentre le altre
tracce di alvei abbondonati, molto
numerose, sono caratterizzate da
una marcata frammentariet. Sono
inoltre riconoscibili alcune lineazioni riconducibili ad antichi percorsi
stradali sovraimposte sia ai depositi
dellunit di Grassaga sia a quelli pi
@MSHBGHCDKKTMHSCH,DNKNF 
83$GL&LWWDQRYD3Y
LUPA di Cittanova rappresenS@S@ C@K CNRRN TUH@KD BGD C@K BDMtro abitato di S. Don si dirige verso
DRSMN@"HSS@MNU@CNRRNCDK/HUDran). Si tratta di un dosso poco rilevato, sul quale si riconosce la traccia
di un paleoalveo che attualmente
coincide con un fossato di modeste
dimensioni (canale Piveran) e prosegue poi lungo il canale Grassaga.
A partire da Cittanova il dosso cambia direzione dirigendosi verso sud
perdendo quasi completamente levidenza morfologica (dosso di Cittanova): si riconosce, infatti, solo la
traccia di un paleoalveo, molto eviCDMSDMDKKDENSNFQ@D@DQDD MN@KK@
localit Pradiviso a sud di C Turcata. Sempre allaltezza di Cittanova,

SDQ R OQ@U S@JN RODBHMN ETMJBHIN


plovnih poti.
Posebna faza dejavnosti na celoSMDLOQNIDJSMDLNALNITJKITASD@U@L Y@Q@CH OQHRNSMHG @QGDNKNJHG
NRS@KHMHYJK@RHMDCNADIDM@LDMIDM@ ONYMN@MSHMDLT HM YFNCMIDRQDCMIDUDJDLTNACNAIT JNHRSN@RMN
s stabilnim in organiziranim poseljeU@MIDL 3NQBDKK@    RSNKDSID Y@nejo peati pristanike dejavnosti
Altina, ne pa tudi njegova funkcija
FNRONC@QRJDF@ HM ONKHSHMDF@ RQDCH@GELICHI RSQ  GE
LICHI 2010). Od tega trenutka se vezi
med Altinom in Torcellom (verjetno
pa tudi med drugimi istodobnimi
RQDCHH M@ RDUDQT K@FTMD Y@MDIN
razvijati po tevilnih plovnih poteh,
ki jih lahko povzamemo kot podaljek vodnih tokov Sioncella-Sante
Marie na eni ter kot nadaljevanje Sila
(v isti smeri, a po vzporedni poti nekoliko bolj vzhodno) po toku Starega
Sila na drugi strani lagune. V prvem
OQHLDQTRLNOQH@MDONRQDCMHONUDY@UHLDCOQHRS@MHJNDSQSIN KSHM@HM
emporiumom TorcellaUCQTFDLOQHLDQTONUDY@UHLDCNALNIDL/NQSD
&Q@MCHHMUQRSHK@FTMRJHGM@ICA JNS
so tiste iz polslankaste lagune (zatoJ@5HFM@HM2U  QH@M@ DOQ@UANCN
LNQ@KDRKDCMIDAHSHONCUQDMDSDLDKIHSHHMJQHSHMHNBDMH
Zdi se, da zadnji podatki iz najnovejih raziskav ali raziskav, ki e
vedno potekajo, potrjujejo fazo intenzivnega poseljevanja od rimskega obdobja naprej, kasneje pa spet
med 6. in 10. stoletjem, kot je razvidno na primeru San Lorenza di Ammiana (GELICHI, MOINE, 2012, kljub
temu, da gre za lokacijo, ki se nahaja
za las zunaj meja obravnavane enote) in kot se je to na primer potrdilo
v primeru kanala Alfonso na severu
otoka Sv. Kristine, kjer so podvodne
Q@YHRJ@UD ONSQCHKD NARSNI JNKH  ONvezanih s stratigrafskim prikazom naselbine (BORTOLETTO in drugi 2010).
9@CMIDNACNAID JHF@DKHLNNRUDSKHti, se nanaa na naselbino iz srednjega in poznega srednjega veka, katere
obstoj so potrdile tudi verske in samostanske ustanove, arheoloki doJ@YHNMIDIO@RN@KDUDCMNMDONONKMH  5DKHJN ID SNQDI OQHDU@MI  LDC
njimi tudi najdbe v Sv. Arianu ali na
AKHMIH2U *QHRSHMH

Fig. 15 - Immagine satellitare del 6 giugno 2003 tratta dal sito Google Earth,
relativa al territorio di Ceggia. Sono evidenziate alcune lineazioni corrispondenti ad antichi tracciati stradali.
Sl. 15 - Satelitski posnetek z dne 6. junij 2003, zajet s spletne strani Google
(DUWK 2]QDHQH VR QHNDWHUH OLQLMH NL
ustrezajo trasam starih cest.
15

($30HROR3Y
$ / ,DNKN RD M@G@I@ U NALNIT
med enoto Sile in enoto San Don
ter v majhnih izoliranih jezikih ob
severnem robu projektnega obmoI@/@QRI@CLDC/H@UNHM+HUDMYN 3@
OQDCDK MHHMRJDF@ RUDS@ SUNQHIN M@nosi reke Piave, ki so razpreni po
celotnem vzhodnem pasu megafana
-DQUDRD  -HHM@ ID OQDBDI RS@Q@  R@I
nekateri njeni predeli segajo v obdobje poznega pleistocena, prekrivajo pa jih omejene in skromne plasti novejih nanosov, ki so jih s seboj
prinesle reke krakega izvira, zlasti
Musestre, Vallio in Meolo.
V severovzhodnem delu enote
RS@ UHCMH CUD ONFKNAKIDMH QDMH JNriti, ki se nahajata med dananjima
izgonskima grebenoma rek Sile in
/H@UDONOQUDLSDDQDJ@,DNKN ON
CQTFDL  JH KDH  MDJNKHJN ANKI UYGNdno, pa vodotok Scolo Correggio. V
AKHHMH Y@RDKJ@ ,DNKN KDH HYNKHQ@MH
CDK MHHMD HY NACNAI@ KDCDMD CNAD
(LGM) med dvema poglobljenima
JNQHSNL@ONRKDCHMNRDCUHFTIDM@C
nivo terena okoli njega.
9@NALNIDONRDRSU@3DMTS@CH"
3QNMIDYM@HKDMRHRSDLNRS@MJNU@MSHMHGQDMHGSNJNUHYY@JKITMDE@YDM@RS@I@MI@MHHMD JHF@IDNAKHJNU@KDCDM
od rokavov Piave. ko je v obdobju zadnje poledenitve po vsej verjetnosti
tekel mimo San Cipriana. Po enem od
SDGRS@QNC@UMHGOKDHRSNBDMRJHGQDMHG
SNJNURS@QNC@UMNQDMNJNQHSN"@MMD
so kasneje tekle reke krakega izvira,
pa tudi manji povrinski odtoki. Sta-

Q@QDM@RSQTF@CU@JQ@SOQDJQH@ONSUHH
MMHM@SDLLDRSTRNM@ICDMHNRS@MJH CUDG LNRSNU HM JLDJD M@RDKAHMD
(BUSANA, GHEDINI 2004).
($3*UDVVDJD3Y
EAP Grassaga sovpada z nanosi
glavnega toka Piave, ki v smeri SZ )5 SDD LHLN M@RDKHI 2U  3DQDYHMD
in Grassage. Gre za naplavinske nanose iz ilovnatega mulja, ilovice in
organske gline, peska in muljastega
ODRJ@ JHTRSQDY@INE@BHDRNOTDMDF@J@M@K@ ONUDY@MHGYQDMHLHJNQHSH 
vrezanimi naravnost v pleistocensko
MHHMN CQTFNSMNO@Y@E@BHDRONOK@Une ravnice. Po sredini enote se vije
zelo opazna sled starodavnega me@MCQHMDF@ QDMDF@ JNQHS@  SDUHKMH
CQTFH NRS@MJH NOTDMHG QDMHG JNrit pa so izrazito razdrobljeni. Poleg
tega je vidnih nekaj linearnih sledi,
UDQIDSMN NRS@MJNU @MSHMHG BDRSMHG
povezav na nanosih enote Grassage,
pa tudi na starejih nanosih enote
Meola (sl. 15).
($3&LWWDQRYD3Y
Najpomembneji element EAP
"HSS@MNU@IDHYFNMRJ@QDM@RSQTF@ JH
od naselja S. Don vodi proti vzhodu do Cittanove (izgon Piverana). Gre
Y@RK@ANHYQ@DMHFQDADM M@J@SDQDL
je razpoznaven ostanek starodavneF@QDMDF@JNQHS@ JHC@MDRRNUO@C@
z jarkom skromnih dimenzij (kanal
Piveran), in kasneje nadaljuje svojo
pot po kanalu Grassaga. Za zasel-

kom Cittanovo izgon spremeni smer


TRLDQHOQNSHITFTUSDLNCRDJTRJNraj popolnoma izgubi svojo morfoKNJN HYQ@DMNRS FQDADM "HSS@MNUD
OQDONYM@UM@ NRS@MD M@LQD R@LN
RKDCRS@QNC@UMDF@QDMDF@JNQHS@ JH
je dobro opazna na posnetkih iz zraJ@FQDADMRDONQ@YFTAHUJQ@IT/Q@CHUHRN ITMNNCKNJ@BHID"3TQB@S@ 
5AKHHMH"HSS@MNUDRDNCMIDF@NCBDOHUDI@ JHM@C@KITIDRUNINONSUYCNK
sedanjega poteka kanala Briana in se
UJQ@IT2SQDSSHJQH@YHYFNMNL JHOQHG@I@HYRLDQH2S@NK@ /NUDY@U@LDC
NADL@MHI@RM@ DOQ@UAHAHKNY@Q@CH
RS@QNC@UMDF@ QDMDF@ JNQHS@  Y@ J@SDQDF@RDYCH C@OQDJ@HYFNM2S@NK@  LNFND CNLMDU@SH  C@ ID SHRSH  JH
prihaja iz Cittanove, mlaji (morda je
njegov potek povezan s spremembo
RLDQH (YFNMRJHFQDADMKDHM@OKDHstocenski in holocenski podlagi, saj
prekriva nanose v enoti Meolo ter tiste v enoti Grassage.
Dva geoloka prereza, opravljeM@UOQDMHRLDQHFQDADM@UNCNSNJ@
Piverana (ob kanalu della Veneziana)
in izgona Cittanove (na lokaciji Safai)
sta pokazala obstoj kanala, ki je vdolADKRUNIDOQHAKHMNLHQNJNJNrito v enoti Piave LGM. Prva faza presihanja korita je datirana okoli peteF@SHRNKDSI@OQ M S 
 !/ 
OQDMHOQDQDY/HUDQ@M
 !/ 
OQDMH OQDQDY "HSS@MNU@  .BDMITID
se, da sega druga faza dejavnosti vodotoka na izgonu Piveran v obdobje

 !/ M@HYFNMT"HSS@MNUD
O@ U NACNAID 
 !/  J@Q

41

83$GL6DQ'RQ3Y

)LJ3DUWLFRODUHGHOODIRWRJUDDDHrea del volo della Regione Veneto anno


1983. Si osservi la traccia molto evidente corrispondente al paleoalveo di Caposile.
6O3RGUREQRVW]]UDQHIRWRJUDMH
SRVQHWHQDSROHWXSUHNR'HHOH9HQHWR
OHWD2SD]LWLMH]HORUD]ORQRVOHG
nekdanje struge blizu kraja Caposile.
16

42

una diramazione del dosso sembra


continuare lungo lattuale corso del
canale Brian, incrociandosi, presso
la localit Stretti, con il dosso proUDMHDMSDC@2S@NKN -NMBGH@Q@K@
correlazione tra i due eventi, anche
se la presenza di un paleoalveo che
RDLAQ@ S@FKH@QD HK CNRRN CH 2S@Nlo, suggerirebbe unet pi recente
per quello proveniente da Cittanova (forse legato a una rotta). Il dosso
QHBNOQDK@RTODQBHDOKDHRSNBDMHB@D
olocenica antica in quanto si sovrappone sia ai depositi dellunit di Meolo sia a quelli dellunit di Grassaga.
#TDRDYHNMHFDNKNFHBGDDDSST@te trasversalmente al dosso del Piveran (lungo il canale della Veneziana)
e a quello di Cittanova (presso Safai)
hanno evidenziato la presenza di un
corpo di canale che ha inciso lunit
del Piave LGM per una larghezza di
circa 200 m. Una prima fase di chiusura dellalveo stata datata intorno
@K 5 LHKKDMMHN @ "  
  !/ 
SQ@MRDSSNCDK/HUDQ@M
 !/ 
transetto di Cittanova). Una seconda
fase di attivit del corso dacqua
stata datata per il dosso del Piveran

 !/DODQPTDKKNCH"HSS@MNU@
 !/ SDRSHLNMH@MCN
una riattivazione dellalveo durante
il III e il II millennio a.C. (BONDESAN
et alii 2008).
A nord di Cittanova e del canale
Grassaga, le alluvioni che hanno formato il dosso sembrano ricoprire i
resti di un insediamento che risale al
Bronzo Recente (BLAKE et alii 1988).
Inoltre, lungo il canale Grassaga, in
corrispondenza con lattraversamento della via Annia, nel 1922 vennero
scoperti i resti di un ponte ritenuto di et romana: la lunghezza del
ponte, non superiore a 25 m, porta
a ipotizzare che, al tempo della sua

costruzione, lattivit del paleoalveo


del Piave fosse gi in fase di estinzione. Il canale rimase comunque attivo come elemento di drenaggio e
BNLDB@M@KDK@FTM@QDMN@KLDCHNevo (BLAKE et alii 1988).
Gli elementi archeologici presenti allinterno di questa UPA sembraMN ADM B@Q@SSDQHYY@SH D PT@KHB@MN
TM ONONK@LDMSN CHTRN M C@KK@
pre-protostoria, in particolare dallet del Bronzo. Il dato di profondit
HMSDQDRR@MSD@HMNRSQHMH HME@SSHS@KD
frequentazione, in questa zona, sarebbe coperta da alluvioni sabbiose
al di sopra delle quali si trovano i livelli romani (BONDESAN, MENEGHEL
2004, p. 223). Gli altri elementi a nostra disposizione parlano a favore
CDKK@NQ@LDMSN CDKK@ E@RD QNL@M@
e altomedievale. Il comparto di Cittanova costituisce lelemento di maggior spicco dellUPA in questione,
oggetto di numerose ricerche negli
anni Ottanta del secolo scorso, recentemente riprese entro ununitaria
analisi territoriale (CALAON 2006b,
BNMAHAKHNFQ@@OQDBDCDMSD 5@DUHdenziata una notevole concentrazione insediativa sul dosso del paleoalveo, che interessa tutta questa fascia territoriale con orientamento da
nord a sud. Se in questa zona il dosso
si formerebbe a partire dallet del
Ferro, a partire dallet romana che
linsediamento si caratterizza anche
per il collegamento con opere di sistemazione agraria. Punto saliente
nella vicenda storica di tutta larea
comunque il passaggio alla fase altomedievale di Civitas Nova, dotata
CHTMPT@QSHDQDDOHRBNO@KDDDSSHU@mente rintracciato sul versante nord.
Tutto lo spalto, per quasi 1.500 metri
verso sud, occupato da una serie
di tracce da foto aerea controllate

attraverso successive campagne di


sondaggi e survey, che inserite allinterno di un recente quadro interpretativo (CALAON 2006b), possono essere ipotizzate come struttura
urbanistica tipicamente legata agli
emporia altomedievali. Cittanova si
inserisce dunque appieno nel complesso quadro evolutivo della laguna
altomedievale, con Torcello e Jesolo.
In conclusione va evidenziato, oltre
al dato di profondit delle fasi in
PTDRSHNMD @NQ@MSH RTK CNRRN  @Mche il fattore attrattivo legato allalto
morfologico e alla lineazione dellalveo orientato verso sud, da interpretarsi come via dacqua navigabile in
attraversamento della zona lagunare
e in comunicazione, in ultima analisi,
con la costa.
83$GL&DSRVLOH3Y
LUPA di Caposile coincide con la
traccia di un paleoalveo, molto eviCDMSDMDKKDENSNFQ@D@DQDDF  
che si stacca dal dosso della Piave
Vecchia a monte della localit CaONRHKD  0TDRSN @MSHBN ODQBNQRN MNM
conserva alcun rilievo morfologico,
ma la sua connessione genetica con
lalveo della Piave Vecchia sembra
essere suggerita dallo sviluppo planimetrico dei due rami.
Il paleoalveo, largo pi di 100 m,
taglia due orizzonti torbosi suborizzontali: il livello inferiore di torba stato datato con il metodo del
radiocarbonio e ha fornito unet
CH o @MMH !/ BONDESAN et
alii 2008). Il paleoalveo corrisponde
quindi a un antico percorso del Piave, probabilmente legato geneticamente al ramo del Piave di S. Don,
attivatosi durante il II millennio a.C.

LUPA di S. Don fa capo principalmente allampio dosso del Piave


attuale (dosso di S. Don) e a tre sue
diramazioni che si dipartono a valle
del centro abitato di S. Don. La principale costituita dal Piave di Cortellazzo (dosso del Taglio della Piave) che si unisce ai depositi del Taglio del Re, mentre spostandosi verso sud-ovest troviamo il ramo della
Piave Vecchia (ora alveo del Sile).
Non vi sono datazioni disponibili che consentano di determinare
con certezza lattivazione del ramo
attuale del Piave che da Nervesa
scende verso San Don. Le datazioni
eseguite lungo i rami a valle, in particolare quello di Cittanova, indicano
BGDHKODQBNQRNDQ@@SSHUN@KK@MDCDK
IV millennio a.C., anche se non si pu
escludere a priori che a monte di San
#NMHKODQBNQRNCHDQHRRDC@PTDKKN
attuale .
Il nome Plavem si rinviene per la
prima volta in un testo di Venanzio
Fortunato (nato a Valdobbiadene nel
530 d.C. circa) che lo incluse nelleKDMBN CDH TLH UDMDSH E@SSN ODQ K@
relazione di un viaggio (CAGNAZZI
1979): de Ravenna progrediens Padum, Athesis, Brintham, Plavem, Liquentiam Tagliamentumque. Inoltre in Vita Sancti Martini (IV, 668),
da lui scritta verso il 565, appare lespressione Cives Duplavenses utilizY@S@ODQHCDMSHB@QDHBHSS@CHMHCH5@Kdobbiadene. Espressione che riporta
alla possibile coesistenza di due percorsi del Piave: il ramo del Piavon e il
ramo di San Don (probabilmente in
corso di disattivazione uno a seguito
dellattivazione dellaltro).
Il ramo del Piave di San Don (corrispondente al suo percorso attuale
e associato al Plavis Major dei docuLDMSH LDCHDU@KH CAGNAZZI 1979),
da San Michele, a valle di Nervesa, si
dirige verso Ponte di Piave, Noventa
CH/H@UDDFHTMFDMN@2@M#NM  
partire da questa localit lapparato
TUH@KD@RRTLDTM@ENQL@Q@LHB@ta assimilabile a quella del Piavon a
sud di Cessalto (BLAKE et alii 1988).
+@ Q@LHB@YHNMD OH NBBHCDMS@le corrisponde al dosso della Piave
Vecchia (Pv 5a) per il quale confermata unet medievale-moderna (radiodatazione di Caposile, 530-680
C " BONDESAN et alii 2008). In alcuni documenti medievali (scritti tra
il 1112 e il 1227) viene indicata la


OQH@ N ONMNUMDL @JSHUHQ@MIT QDMD


RSQTFDLDC HM SHRNKDSIDLOQ M 
t. (BONDESAN in drugi 2008).
Severno od Cittanove in od kanala Grassaga so poplave, ki so ustvarile izgonski greben, verjetno prekrile
tudi ostanke naselbine iz pozne bronaste dobe (BLAKE in drugi 1988).
Poleg tega so ob kanalu Grassaga na
LDRSTOQDJ@MI@UHD MMHDKDS@
odkrili ostanke mostu, po vsej verjeSMNRSH HY QHLRJDF@ NACNAI@ MIDFNU@
CNKHM@MDOQDRDF@L Y@Q@CHDR@Q K@GJN CNLMDU@LN  C@ ID U @RT
njegove izgradnje prvotna struga
/H@UD D Y@DK@ OQDRHG@SH  *@M@K RN
kljub temu do srednjega veka uporaAKI@KHJNSCQDM@MHI@QDJHMJNSK@FTMski kanal (BLAKE in drugi 1988).
Prisotni arheoloki elementi EAP
RNCNAQNNOQDCDKIDMHHMJ@DINM@FNRSNONRDKIDMNRSDNCOQDCYFNCNUHMRJDF@NACNAI@ DONRDADIO@HY@R@
bronaste dobe. Najbolj nas seveda
Y@MHL@ FKNAHMRJH ONC@SDJ CNJ@YD
N ONRDKIDMNRSH SDF@ ONCQNI@ RN M@LQDONURDIUDQIDSMNRSHOQDJQHKHODDMH M@OK@UHMRJH M@MNRH  M@C J@SDQHLHKDHINRKNIHHYQHLRJDF@NACNAI@
(BONDESAN, MENEGHEL 2004, str.
 .RS@KHQ@YONKNKIHUHDKDLDMSHRN
bolj naklonjeni pojavljanju ostalin iz
rimskega in zgodnjesrednjevekega
obdobja. Predel Cittanove predstavlja najpomembneji arheoloki poSDMBH@KNAQ@UM@U@MDDMNSDUNRDLdesetih letih prejnjega stoletja je
AHKOQDCLDSNARDMHGQ@YHRJ@U 3DRN
se pred kratkim nadaljevale v okviru poenotene prostorske analize obLNI@CALAON 2006b, s predhodno
literaturo). Poudariti velja zelo gosto poseljenost izgonskega grebena
RS@QD QDMD RSQTFD UYCNK BDKNSMDF@
ozemeljskega pasu v smeri od severa
OQNSHITFT &QDADMRDIDY@DKHYNAKHJNU@SH D U DKDYMH CNAH  U QHLRJDL
obdobju pa so naselbine ob njem
dobile tudi cestne povezave in ureIDM@JLDSHIRJ@YDLKIH@ /NLDLADM
SQDMTSDJUYFNCNUHMHNALNI@OQDCstavlja prehod v zgodnjesrednjeveko ureditev mesta s takratnim imenom Civitas NovaUSDLNACNAITID
M@LQD CNAHKN STCH JNIRJN DSQS 
ki so jo dejansko odkrili v severnem
delu mesta. Celotni pas ozemlja v
CNKHMH RJNQ@I   L OQNSH ITFT ID
ONKM NRS@KHM  OQDUDQIDMHG Y YQ@MHLH
posnetki ter kasnejimi raziskavami
in tudijami. Analizirane sledi lahko
v skladu z novim interpretativnim


Fig. 17 - Particolare di una carta del


1639 (ASVE, Sea Piave, 15A), da BONDESAN, MENEGHEL 2004.
Sl. 17 - Podrobnost zemljevida iz leta
1639 (ASVE, Sea Piave, 15A), (BONDESAN, MENEGHEL 2004.)
17

pristopom (CALAON AQ@YKNHLN JNS TQA@MHRSHMN RSQTJSTQN  JH ID


AHK@NAH@IMNONUDY@M@RRQDCMIDUDkimi emporiumi. Cittanova se torej
supaj s Torcellom in Jesolom v celoti
TUQ@UQ@YKDMIDMNONCNANQ@YUNI@
lagune v zgodnjem srednjem veku.
.AY@JKITJTDKHLNONTC@QHSH C@ID
poleg globinskega podatka za obravnavana obdobja (ki se pojavljajo na
povrju grebena) pomemben tudi
CDI@UMHJOQHUK@MNRSH ONUDY@MYCUHFMIDMNHMQ@UMN M@ITFUNCDNRSQTFN  J@Q K@GJN SNKL@HLN JNS OKNUMN
ONS JHOQDJ@K@FTMNHMONUDDLNQsko obalo s kopnim.
($3&DSRVLOH3Y
EAP Caposile sovpada z ostanJNLOQUNSMDF@QDMDF@JNQHS@ CNAQN
Q@YUHCMDF@M@YQ@MHGONRMDSJHGRK 
16), ki se odcepi od izgonskega grebena Stare Piave vije od Caposila
NAQDMDLSNJT 3@@MSHM@RSQTF@MH
izgonskega tipa, toda njena genetska
ONUDY@U@YQDMNRSQTFN2S@QD/H@UD
nam da misliti, da gre za dva rokava
iste reke.
2S@QNQDMNJNQHSN HQNJNUDJNS
100 m, prepolavlja dva vzporedna
horizonta ote v dveh vzporednih
ravninah: spodnjemu sloju ote se je
z datiranjem po radiokarbonski meSNCHCNKNHK@RS@QNRSoKDS!/
(BONDESAN in drugi .OTDMN QDMN JNQHSN SNQDI RNUO@C@ R RS@rodavno strugo Piave, ki je verjetno
genetsko povezana z odcepom Piave
CH2 #NMHY SHRNKDSI@OQ M S

($36DQ'RQ3Y
EAP S. Don sovpada zlasti s iroJN@MSHMNRSQTFNRDC@MIDQDJD/H@UD
(izgon S. Don) in tremi njenimi rokavi, ki se razcepijo nizvodno od mesta
San Don. Glavni odcep se imenuje
Piava Cortellazzo (greben Taglio delK@ /H@UD JH RD YCQTH Y M@MNRH U KNkaciji Taglio del Re, nekoliko bolj jugozahodno pa najdemo rokav Stare
Piave (zdaj struga reke Sile).
Podatkov, s katerimi bi lahko z
FNSNUNRSIN CNKNHKH M@RS@MDJ C@M@MIDRSQTFD/H@UD JHSDDHY-DQUDRDU
smeri proti San Don-ju, nimamo na
voljo. Datiranje vzorcev v spodnjem
SNJTQDMHGQNJ@UNU YK@RSHSHRSDF@OQH
"HSS@MNUH  J@DIN  C@ RN AHKH RKDCMIH
JNMDB   SHRNKDSI@ OQ  M  S  @JSHUMH 
DOQ@U MH LNFND UM@OQDI HYJKITHSH
LNMNRSH C@IDOQDCOQHGNCNLU2@M
#NM QDJ@ TAHQ@K@ CQTF@MN ONS NC
sedanje.
Prvo navedbo imena Plavem najdemo v besedilu Venanzia Fortunata
(roj. leta 530 v kraju Valdobbiadene),
ko jo uvrsti v seznam venetskih rek
v svojem potopisu (CAGNAZZI 1979):
de Ravenna progrediens Padum,
Athesis, Brintham, Plavem, Liquentiam
Tagliamentumque. Tudi v dokumentu Vita Sancti Martini (iv, 668), ki ga je
napisal leta 565, se pojavi izraz Cives
Duplavenses, s katerim poimenuje
prebivalce Valdobbiadena. Izraz nas
lahko napelje na domnevo o dveh
strugah reke Piave: rokav Piavon in
rokav San Don (ki sta se verjetno izLDMHMN@JSHUHQ@K@HMTRHG@K@

Rokav Piave di San Don (ki


ustreza svojemu dananjemu toku in
ga srednjeveki dokumenti istovetijo
s Plavis Majorjem CAGNAZZI 1979),
RD Y@MD OQH JQ@IT 2@M ,HBGDKD  MHYvodno od Nervese, in se nato usmeri
mimo naselij Ponte di Piave in Noventa di Piave vse do mesteca San
#NM 3TRDQDMHRHRSDLQ@YUDIHONCNAMNJNS/H@UNMITMNNC"DRR@KS@
(Blake et alii 1988).
Najbolj zahodni rokav sovpada z
izgonsko strugo Stare Piave (Pv 5a),
katere potrjena starost sega v srednjeveko - moderno dobe (radioLDSQHM@ C@S@BHI@ U "@ONRHKT  
C " BONDESAN et alii 2008). V
nekaterih srednjevekih dokumentih
(spisanih med letom 1112 in letom
IDONKN@ITRSI@/H@UDM@IOQDI
OQHJ@Y@M UHID NA QDMDL SNJT M@C
zaselkom Villafranca, kasneje pa niYUNCMN NC MIDF@ R@L Y@RDKDJ RHBDQ
MDNARS@I@UD RDIDO@MDJC@IM@G@jal med Caposilom in Jesolom (CESSI
  .C SHRSDF@ @R@ M@OQDI RD ID
verjetno izoblikoval celotni sistem
2S@QD/H@UD JHIDMDJNCDKHK@@MSHMN
K@FTMN $Q@BKDD NC ADMDJD K@FTMD
vzhodna meja eraklejske lagune je
sovpadala z izgonsko strugo Livenze.
Na enem svojih zemljevidov iz leta
 ID -HBNK C@K "NQSHUN NYM@HK
kraj z imenom Portexin: tu se je verjetno nahajal privez, do katerega je
vodil stareji rokav Piave, od tod naOQDIO@RNRS@QNRDKBHOKTKHDYK@FTMN
do morja (BLAKE et alii 1988).
Sl. 17 prikazuje detajl zemljevida

43

Fig. 19 - Estensione della laguna di Jesolo e Eraclea durante la costruzione


del Taglio del Re (area in bianco compresa tra i dossi del Piave e i sistemi litoUDQHLLQEOXOHWUDFFHGLSDOHRLGURJUDD
per la legenda delle UPA vedere Tav. 1).
Sl. 19 - Obseg lagune v Jesolu in Eraclei
med izgradnjo kanala Taglio del Re.
Fig. 18 - Estensione della laguna di Jesolo e Eraclea prima della costruzione del
Taglio del Re (area in bianco compresa
WUDLGRVVLGHO3LDYHHLVLVWHPLOLWRUDQHL
LQEOXOHWUDFFHGLSDOHRLGURJUDDSHU
la legenda delle UPA vedere Tav. 1).

Fig. 20 - Estensione della laguna di Jesolo e Eraclea dopo la costruzione del


Taglio del Re (area in bianco compresa
WUDLGRVVLGHO3LDYHHLVLVWHPLOLWRUDQHL
LQEOXOHWUDFFHGLSDOHRLGURJUDDSHUOD
legenda delle UPA vedere Tav. 1).

Sl. 18 - Obseg lagune v Jesolu in Eraclei


pred izgradnjo kanala Taglio del Re.

Sl. 20 - Obseg lagune v Jesolu in Eraclei


po izgradnji kanala Taglio del Re.

RBGDL@ O@KDNHCQNFQ@BN CDKK@QD@


SQ@/H@UDD+HUDMY@MDK75((D75(((RDcolo tratto dal confronto tra le tracce
rilevate dalla fotointerpretazione e
HKQDSHBNKNHCQNFQ@BNOQDRDMSDMDKK@
B@QSNFQ@@ RSNQHB@ CH PTDK ODQHNCN 
Le tracce degli antichi corsi dacqua,
solo in parte coincidenti con percorsi attuali, corrispondono probabilmente agli originari canali lagunari,
prima, e successivamente palustri,
che caratterizzavano la laguna di Jesolo e Eraclea trasformatasi poi in
ambiente palustre.
(M F    QHONQS@S@ K@ B@QS@ CH
Angelo Dal Cortivo del 1532 in cui
si pu osservare quale doveva esRDQD KNQHFHM@KD QDSD HCQNFQ@B@ MDK
75( RDBNKN  RBGDL@SHYY@S@ HM F  
e messa a confronto con lo schema
O@KDNHCQNFQ@BN OQDBDCDMSDLDMSD
BHS@SNF HMF 
Dal punto di vista archeologico
la UPA 5a a mostrare maggiori caratterizzazioni. Un primo settore, pi a
monte (impostato sul centro di San
Don di Piave), sembra interessato
dalla presenza di rinvenimenti rarefatti rapportabili allet romana,
probabilmente interessati da un cerSN @KKTUHNM@LDMSN HK RDBNMCN  OH
a valle, si restringe sensibilmente a
coincidere con gli apporti alluvionali
di un dosso ben delineato e nettamente coincidente con la cosiddetta
Piave Vecchia, il cui apporto sabbioso principia a partire dal VI-VII secoKN (MPTDRSTKSHLNBNLO@QSNHMDDSti linsediamento sembra installarsi

solo a partire dalla tarda antichitaltomedioevo, dopo la formazione


del dosso. Un problema particolare
sollevato dal rapporto con il sito di
Jesolo, Le Mura, oggetto di una UPA
a s stante (infra) in quanto tipico
mound di carattere antropico.

18

44

posizione della foce del Piave localizzata prima a monte e poi a valle di
Villafranca, localit ora non pi esistente ma posta in passato tra Caposile e Jesolo (CESSI 1943). Da questo
momento in poi, probabilmente, si
formato lintero apparato del dosso
della Piave Vecchia che un tempo divideva lantica laguna di Eraclea da
PTDKK@CH5DMDYH@HKKHLHSDNQHDMS@KD
della laguna di Eraclea corrispondeva al dosso del Livenza. In una carta
di Nicol dal Cortivo del 1547, si individua la localit denominata Portexin: qui era posizionata una bocca
di porto, collegata a un ramo pi antico del Piave, che manteneva aperto il collegamento tra la laguna e il
mare (BLAKE et alii 1988).
(MF QHONQS@SNTMO@QSHBNK@re di una carta del 1639 (ASVE, Sea
Piave, 15A) in cui viene evidenziato
il territorio formato in quel momento dai dossi del Piave e del Livenza,
pi elevato rispetto alle paludi circostanti. La carta stata georeferenziata e presa come riferimento per segnare i limiti tra le subunit del Piave
di S. Don (Pv 5a, Pv 5b e Pv 5c), limiSHCHBHKLDMSDQHBNMNRBHAHKH@SSQ@UDQso la sola indagine sul terreno.
A sinistra del dosso della Piave
5DBBGH@RHQHMUHDMDK@RDBNMC@Q@LHcazione del Piave di San Don. Si tratta del ramo del Taglio del Re (Pv 5b)
che fu attivato nel 1565 come scolmatore delle piene del Piave, mentre
si manteneva attivo il corso principaKDCDKTLDKTMFNK@/H@UD5DBBGH@

La diramazione pi orientale del


Piave di San Don, coincidente con
HKBNQRN@SST@KDCDKTLD RHHCDMSHca con il dosso del Taglio della Piave
(Pv 5c), attivato nel 1664 a seguito
CHTM@CDUH@YHNMD@QSHBH@KD (KMTNUN
corso del Piave fu costruito a partire
dalla localit IntestaduraMN@KK@Mtico canale Cin. Da questo punto in
ONHHKTLDTSHKHYYFKH@KUDHCDHB@nali preesistenti per disperdere le
RTD @BPTD  (M RHMHRSQ@ HCQNFQ@B@ RH
sviluppano numerose diramazioni (presso Palazzetto, Tombolino e
Eraclea): si tratta di piccoli dossi che
si inoltrano per un breve tratto nelle depressioni circostanti. In destra
HCQNFQ@B@  KD @KKTUHNMH CDK CNRRN
del Taglio della Piave si uniscono a
quelle del Taglio del Re, coprendo
KD SQ@BBD CH DUDMST@KH Q@LHB@YHNMH
precedenti. Si individua solo lalveo
della Vecchia Cava Zuccherina corrispondente alla riattivazione, tra
il 1440 e il 1540, dellantico canal
dArco.
+D FF     D  QH@RRTLNMN
K@ RHST@YHNMD OQDBDCDMSD F   
BNMSDLONQ@MD@ F   D ONRSDQHNQDF @KK@BNRSQTYHNMDCDK3@FKHN
del Re (1565), mettendo in evidenza
la probabile estensione della laguna
di Jesolo e Eraclea durante il periodo
bassomedievale. Inoltre, si individua
lubicazione della localit di Villafranca, ora non pi esistente, tratta
C@TM@B@QS@CDK75(RDBNKN MFDKN
DAL CORTIVO, 1532).
(M F    HMUDBD   QHONQS@SN KN

83$GHO3LDYRQ3Y
LUPA del Piavon formata dai
depositi di un antico ramo del Piave, avente la direzione dellattuale
canale Piavon, che si snoda da OderYN@"GH@Q@MNMN@"DRR@KSNCNRRN
del Piavon), per poi continuare attraverso la localit di Pra di Levada e
2  M@RS@RHNMN@K+HUDMY@ 4M@KSQN
ramo di questo antico Piave, quello
avente la direzione del Monticano
DBGDFHTMFDU@@MBGDRRNMN@K+Hvenza era stato attivo probabilmente in epoca pre-romana (dosso del
Monticano).
Poco a nord del tracciato della SS
14, circa 1,5 km a ovest del ponte sul
Livenza, un carotaggio ha incontrato
a circa 2 m di profondit dei depositi
palustri, sepolti da sedimenti limosi dellunit del Piavon e che hanno
fornito unet di 1500-1430 anni
a.C. (FONTANA et alii 2012). La datazione 14C indica linizio di attivit
per il ramo del Piavon nella seconda
met del II millennio a.C. confermando in parte lipotesi di FAVERO et alii
  &KH @TSNQH RODBHB@MN BGD
lalveo del Piavon dopo essere stato
abbandonato dalle acque del Piave,
in un periodo precedente allet ro

19

iz leta 1639 (ASVE, Sea Piave, 15A),


na katerem je vrisano ozemlje, ki
RS@ F@ U SHRSDL @RT TRSU@QHKH HYFNMRJHRSQTFH/H@UDHM+HUDMYD .ALNID
LDCQDJ@L@IDS@JQ@SKD@KNUHDNC
NJNKHJHG LNUHQHI  9DLKIDUHC RLN
georeferencirali in ga primerjali pri
NYM@DU@MIT LDI@ LDC ONR@LDYMHmi pod-enotami v okviru enote PiaUD 2  #NM /U @  /U A HM /U B
s samim pregledom na terenu bi jih
M@LQD SDJN CNKNHKH  R@I RN RJNQ@I
neprepoznavne.
Levo od izgonske struge Stare
/H@UDKDHCQTFHNCBDOQDJD/H@UDCH
San Don. Gre za rokav z imenom Taglio del Re (Pv 5b), ki so ga leta 1565
aktivirali, da bi po njem odtekle poplavne vode Piave, ko je bil glavni
rok teke po strugi Stare Piave e vedno aktiven.
Najvzhodneji odcep Piave di San
Don, ki sovpada z dananjo strugo
reke, je izgonska struga Taglio della Piave (Pv 5c), kamor so leta 1664
TLDSMN OQDTRLDQHKH QDMD UNCD 
-NU@RSQTF@QDJD/H@UDRDIDY@DMI@la na lokaciji Intestadura JNM@K@O@
U@MSHMDLkanalu Cin. Od tu dalje so
RD QDMD UNCD ONQ@YCDKHKD ON RSQTF@GDNARSNIDHGJ@M@KNU -@KDUDL
CDKT ONQDI@ RN OQHRNSMH SDUHKMH QNkavi (pri krajih Palazzetto, Tombolino
in Eraclea): gre za majhne izgonske
RSQTFD  JH RD Y@ JQ@SDJ @R UHIDIN ON
okolikih kotanjah. V desnem delu
ONQDI@ RD ONOK@UMD Q@UMHBD HYFNMske struge Taglio della Piave pridruHINSHRSHLNAJ@M@KT3@FKHNCDK1DHM


prekrijejo sledi morebitnih predhodnih rokavov. Opazna je le e stara


struga Vecchia Cava Zuccherina, po
kateri je med letom 1440 in letom
1540 tekel stari canal dArco.
Na slikah 18, 19, 20 je povzetek
stanja pred (sl. 18), med (sl. 19) in po
(sl. 20) izgradnji kanala Taglio del Re
(1565) in domnevnega obsega lagune Jesola in Eraclee v zgodnjem sreCMIDLUDJT 3TIDUQHR@MSTCHONKN@I
zaselka Villafranca na zemljevidu iz
 RSNK JHO@F@C@MDRMHUD MFDlo DAL CORTIVO, 1532).
Na sl. 21 je shematski prikaz staQDF@ ONQDI@ /H@UN HM +HUDMYN U  
HM   RSNKDSIT ONUYDS ID OQHLDQI@UH
posnetkov iz zraka in zgodovinskih
zemljevidov iz tistega obdobja. Stari
vodni tokovi, katerih sledi samo deloma sovpadajo z dananjimi strugami, so bili verjetno najprej lagunski,
J@RMDID O@ LNUHQMHJH J@M@KH K@FTne Jesola in Eraclee, preden se je ta
ROQDLDMHK@ULNUHQID
Na sl. 22 je zemljevid iz leta 1532
(Angelo Dal Cortivo) s prikazom prUNSMDF@UNCMDF@NLQDI@HY RSNKDSI@  2K   J@D RGDL@SRJH OQHJ@Y
NLQDI@  OQ@UJ@Q M@UDCDMN OQUNSMNONQDIDRK O@IDRGDL@SRJN
predstavljeno na sl. 24.
Najbolj zanimiva z arheolokega
vidika je EAP 5a. V prvem segmenST UHID NA QDMDL SNJT  D ONRS@vimo San Don di Piave v sredino
segmenta) se domnevno nahajajo
posamezni artefakti iz rimskega obdobja, ki so bili verjetno v preteklo-

20

RSHONOK@UKIDMHUCQTFDL MHYUNCMDL
RDFLDMST  RD QDJ@ AHRSUDMN YNH HM
sovpada s naplavinskimi nanosi doAQN HYRSNO@INDF@ HYFNMRJDF@ FQDbena, ki v celoti sovpada s strugo t.i.
2S@QD /H@UD  J@SDQD ODDMH M@RHO ID
Y@DKM@RS@I@SHU  RSNKDSIT 5SDL
zadnjem segmentu se je naselbina
Q@YUHK@DKDNCJNMB@ONYMN@MSHMDF@NYHQNL@Y@DSJ@YFNCMIDRQDCMIDvekega obdobja dalje, torej po naRS@MJT HYFNMRJD RSQTFD  -@ICHD +D
,TQ@OQH)DRNKTOQDCRS@UKI@RODBHno situacijo, ki smo jo obravnavali v
samostojni EAP (infra), saj gre za tiOHMNCUHFMIDMNOKN@C@MSQNOHMD
narave.
($33LDYRQ3Y
$ / /H@UNM SUNQHIN M@MNRH @MSHnega rokava Piave s smerjo dananjega kanala Piavon, ki se vije od
Oderza, mimo Chiarana do Cessalta
(izgonska struga Piavona), nato pa
svojo pot nadaljuje skozi kraja Pra
di Levada in S. Anastasio do Livenze.
#QTF@UDI@SD@MSHMD/H@UD TRLDQjena proti Monticanu, je nekdaj prav
tako dosegla Livenzo, a je bila verjetno aktivna v predrimskem obdobju
(izgon Monticana).
Nekoliko bolj severno od trase
CQ@UMD BDRSD 22   OQHAKHMN  
km zahodno od mostu na Livenzi,
smo med vrtanjem v globini pribliMN  L M@KDSDKH M@ M@MNRD L@SDQH@K@ HY LNJQH@  OQDJQHSDF@ Y M@MNRH
mulja z enote Piavon, katerih ocenjena starost je 1500-1430 pr. n.

t. (FONTANA et alii 2012). Datiranje


"J@DM@Y@DSDJ@JSHUMNRSHUDID
Piavon v drugi polovici drugega tiRNKDSI@ OQ  M  S  HM CDKNL@ ONSQITje domnevo avtorjev FAVERO et alii
 3HM@U@I@IN C@IDQDMNJNQHSN
Piavona tudi po tem, ko so ga vode
/H@UDY@OTRSHKD U@RTOQDCQHLRJHL
obdobjem gotovo e precej dolgo
ostal pomemben in v uporabi kot vodna povezava.
Odsek Piavona je nizvodno od
Cessalta razvejan (sl. 25) podobno
kot sedanja Piava (BLAKE et alii 1988).
Prva veja ustvarja izgon, ki malo pred
prihodom v Ceggio spremeni smer in
SDDOQNSH2@MS M@RS@RHT JIDQRDHYKHIDU+HUDMYNSQDMTSMNONHYFNMTSDD
vodotok skromnih dimenzij z imenom jarek Caseratella). Druga veja se
UHIDONHYFNMT JHSDDONONSHRS@QDga kanala Caseratta (bivi canale Polison) skozi kraje Ceggia, Riva Zancani in Pr di Levada do kraja Torre di
,NRSN 3QDSI@UDI@URSQTFH@MSHMDF@
CanalataYC@IF@M@CNLD@TLDSMH
kanal Piavon) v resnici rokav Piave,
R@IJ@D C@IDCanalatNAH@IMHUNCNtok, kot sta na primer kanal Bidoggia
in kanal Grassaga, ki pripadata mreHJ@M@KNUY@NCL@J@MIDHYCDOQDRHI
(BLAKE et alii 1988).
Paleohidrografska shema bi lahko ustrezala opisu, ki ga podaja CA
GNAZZI (1979) hkrati s predlogom
za primerjavo podatkov iz nekaterih
zgodovinskih dokumentov: LiutpranCNU@KHRSHM@HYKDS@ 2S@NKNUOK@cit iz leta 998 in druge srednjeveke

45

)LJ   6FKHPD SDOHRLGURJUDFR


dellarea tra Piave e Livenza nel XVII e
XVIII secolo tratto dal confronto tra le
tracce rilevate dalla fotointerpretazione
H LO UHWLFROR LGURJUDFR SUHVHQWH QHOOD
FDUWRJUDDVWRULFD LOGRSSLRQRPHFKH
caratterizza alcuni canali deriva da carte disegnate a distanza di un secolo). In
rosso le tracce di antichi percorsi stradali (via Annia) o fossati.
Sl. 21 - Paleohidrografska shema obPRMD PHG UHNDPD 3LDYH LQ /LYHQ]D Y
17. in 18. stoletju, izdelana s primerjavo
med trasami, odkritimi na posnetkih in
KLGURJUDIVNRPUHRL]]JRGRYLQVNHNDUWRJUDMH GYRMQR SRLPHQRYDQMH QHNDterih kanalov izhaja iz razbiranja zemljevidov, nastalih pred celim stoletjem).
7UDVH R]QDHQH ] UGHR UWR XVWUH]DMR
starim cestnim povezavam (cesta Annia) ali starim jarkom.

21

46

mana, aveva certamente mantenuto


una funzione idraulica di rilievo ed
rimasto per lungo tempo utilizzato
ODQHBNKKDF@LDMSHTUH@KH
Il ramo del Piavon, a valle di CesR@KSN  OQDRDMS@ CDKKD Q@LHB@YHNMH
F RHLHKH@PTDKKDCDK/H@UD@Stuale (BLAKE et alii 1988). La prima
diramazione forma un dosso che
devia poco prima di arrivare a Ceggia e si dirige verso SantAnastasio
BNMTDMCNMDK+HUDMY@@SST@KLDMSD
il dosso percorso da un fossato di
modeste dimensioni, la fossa Caseratella). La seconda diramazione, invece, si snoda lungo un dosso che attraverso Ceggia, Riva Zancana e Pr
CH+DU@C@@QQHU@MN@3NQQDCH,NRSN
seguendo lantico percorso del canale Caseratta (ex canale Polison).
Una terza diramazione lungo lalveo
dellantico Canalat (ora sostituito
C@KB@M@KD@QSHBH@KD/H@UNMHMQD@KS
non corrisponde a unulteriore ramo
del Piave, in quanto il Canalat sembra essere un tipico corso dacqua,
come il canale Bidoggia e il canale
Grassaga, appartenente alla rete di
drenaggio delle aree depresse (BLA
KE et alii 1988).
+N RBGDL@ O@KDNHCQNFQ@BN QHsultante potrebbe ben corrisponde-

re alla descrizione che CAGNAZZI


(1979) fa di questarea proponendo
un confronto con i dati contenuti in
alcuni documenti storici: nel trattato
di Liutprando del 712, nel Placito di
2S@NKN CDK  D HM @KSQH SDRSH LDdievali. In questi documenti vengono citati gli idronimi Plavam de Sinca, Piavesella e Plavam Siccam ed
possibile che questi corrispondano
alle varie diramazioni del Piavon,
precedentemente descritte, che in
epoca medievale si stavano lentaLDMSD@SQNYY@MCN 
(K Q@LN CDK /H@UNM HCDMSHB@SN
dallautore con lantico Plagionem)
secondo quanto descritto nei documenti, sfociava a Riva Zancana (presso lattuale Ceggia) nella laguna opitergina nota con il nome di Liquentesino. CAGNAZZI (1979), citando vari
autori latini (Strabone, Livio, Plinio,
Columella, Floro, ecc.) fa una sintesi descrittiva di come doveva essere
il paesaggio nellarea compresa tra
Piave e Livenza in unepoca anteriore alla penetrazione romana.
3Q@ H CTD TLH UH DQ@ TMDRSDR@
laguna il cui limite settentrionale si
collocava lungo la linea che collega
gli attuali abitati di San Don, CegFH@D2@MS M@RS@RHNF  DNBBT-

22

O@U@ STSSN HK SDQQHSNQHN MN @K L@QD


un susseguirsi di lidi lunghi e sottili
separavano questultimo dalla laguna (Pineta Maggiore e Pineta Minore PAVANELLO, 1923). La terraferma, caratterizzata dalla presenza dei
CNRRHTUH@KHCDK/H@UDDCDK+HUDMY@ 
era interamente coperta da boschi
che facevano parte di una estesa
selva perilagunare: la Selva Fetontea ricordata da Virgilio (PAVANEL
LO 1923), di cui il Bosco di Olm a
Cessalto rappresenta lesempio pi
noto e meglio conservato. Nellarea
Parsjad lultimo relitto del quercoB@QOHMDSN OK@MHYH@KD FHTMSN MN @H
giorni nostri il Bosco di Lison, un
piccolo boschetto di soli 6 ettari, situato sulla sinistra della linea ferroviaria Venezia-Trieste presso Lison
(SEMENZATO 1990). Una fascia marginale, caratterizzata dalla presenza di secche, velme, barene e foci
DMCNK@FTM@QH CDH TLH CH QHRNQFHU@
e dei rami deltizi del Piave e del Livenza, separava la laguna viva dalla
terraferma.
Il dosso del Piavon, da ritenersi
gi formato in et romana, mostra la
sovrapposizione della via Annia e la
presenza di un popolamento di et
QNL@M@ CHTRN  ODQ PT@MSN OQNA@-

Fig. 22 - Carta di Angelo Dal Cortivo del


1532 (da CAGNAZZI, 1979).
Sl. 22 - Zemljevid avtorja Angela Dal Cortivo iz leta 1532 (iz CAGNAZZI, 1979).

bilmente sottostimato dalla fonte archeologica edita.


83$GL7RUUHGL0RVWR/Y
LUPA di Torre di Mosto presente solo allinterno degli argini del
+HUDMY@ MN @KK@KSDYY@ CDKK@AHS@SN
CH 3NQQD CH ,NRSN OH @ U@KKD KTMHt corrisponde al dosso attualmenSDNBBTO@SNC@KTLDD@HU@QHQ@LH
che si staccano da esso. Molte di tali
direttrici consistono probabilmente
in rami attivati per periodi brevi e
lungo cui sono stati spesso costruiti
dei dossi piuttosto sottili. Fra essi i
pi importanti sono quello esistente tra Torre di Mosto e Stretti (dosso
CH 2S@NKN  PTDKKN SQ@ !NBB@ENRR@ D
Senzielli (dosso di Boccafossa), quello della Livenza Morta (dosso della Livenza Morta), quello tra Ottava
Presa e S. Gaetano (dosso di Ottava
Presa) e quello lungo la parte termiM@KDCDK+HUDMY@@SST@KDF  
La porzione del dosso su cui scorre attualmente il Livenza a monte di
Torre di Mosto stata costruita in
gran parte dai sedimenti trasportati
dal ramo del Piave che ha percorso
la direttrice del Piavon e che si uniRBD @K TLD +HUDMY@ OQDRRN 2@MS nastasio e lungo il dosso di Pr di

24

23

)LJ   6FKHPD SDOHRLGURJUDFR


dellarea tra Piave e Livenza nel XVI
secolo tratto dalla carta di Angelo Dal
&RUWLYR FIUJ GDVRWWROLQHDUHOD
presenza del sito indicato con il nome di
Villafranca (ora non pi esistente), della
scritta coincidente con la posizione del tracciato della via Annia e, inQHGHOOLQGLFD]LRQHGHOODSUHVHQ]DGHO
.

Sl. 23 - Paleohidrografska shema obPRMD PHG UHNDPD 3LDYH LQ /LYHQ]D Y


16. stoletju, povzeto iz zemljevida Angela Dal Cortivo (prim. sl. 22). Poudariti
je treba prisotnost lokacije z imenom
9LOODIUDQFD GDQHVQHREVWDMDYH QDpisa (cesta), ki se ujema s traso
ceste Annia, ter opombe 
(greben, imenovan Arzeron).

Fig. 24 - Confronto tra lo schema paleRLGURJUDFRGHOODUHDWUD3LDYHH/LYHQ]D


nel XVI secolo tratto dalla carta di AngeOR 'DO &RUWLYR FIU JJ    OH WUDFce rilevate dalla fotointerpretazione e il
UHWLFROR LGURJUDFR SUHVHQWH QHOOH FDUWH
storiche posteriori (XVII e XVIII secolo). I
tracciati contraddistinti dalla linea rossa
corrispondono ad antichi percorsi stradaOL YLD$QQLD RDGDQWLFKLIRVVDWLOHOLQHH
EOX WUDWWHJJLDWH LQGLFDQR L WUDWWL XYLDOL
attualmente non visibili. Il dosso tratto da
FDUWRJUDDVWRULFDULSRUWDWRQHOODJXUD
che potrebbe corrispondere a quello indicato dalla scritta , stato individuato nella Kriegskarte e in quella del Lombardo Veneto.

Sl. 24 - Primerjava med paleohidrografVNRVKHPRREPRMDPHGUHNDPD3LDYH


in Livenza v 16. stoletju, povzeto iz zemljevida Angela Dal Cortivo (prim. sl.
22, 23) ter sledmi, odkritimi na posnetNLKLQKLGURJUDIVNRPUHRQDNDVQHMLK
zgodovinskih zemljevidih (17. in 18.
VWROHWMH  7UDVH R]QDHQH ] UGHR UWR
ustrezajo starim cestnim povezavam
(cesta Annia) ali starim jarkom, modre
UWNDQH UWH SD NDHMR RGVHNH UHN NL Y
VHGDQMHPDVXQLVRYLGQL*UHEHQSRY]HWL]]JRGRYLQVNHNDUWRJUDMHLQSULNDzan na sliki, je morda istoveten z tistim
iz napisa  in je
bil ugotovljen tudi na Kriegskarte in na
zemljevidu Lombardije in Veneta.

listine. V njih se navajajo hidronimi


Plavam de Sinca, Piavesella e Plavam
Siccam HM ONURDL LNMN ID  C@ RNUO@C@IN Y Q@YKHMHLH  OQ@UJ@Q NOHR@nimi rokavi Piavona, ki so v srednjeUDJDLNACNAITON@RHDOQDRHG@KH 
Rokav Piavona (avtor ga istoveti z
@MSHMHLPlagionem) se je, kot navajajo listine, izlival v Rivi Zancani (v
sedanji Ceggi) v opiterginsko laguno,
znano po imenu Liquentesino. "
GNAZZI (1979) hkrati z navedbo tevilnih latinskih avtorjev (Strabone,
Livio, Plinio, Columella, Floro, itd.) na

kratko opie domnevni izgled krajine


M@ONCQNITLDC/H@UNHM+HUDMYNU
obdobju pred zasedbo Rimljanov.
,DCNADL@QDJ@L@IDKD@K@NARDM@ K@FTM@  J@SDQD RDUDQM@ LDI@
je sovpadala s povezavo med sedanjimi zaselki San Don, Ceggia in
SantAnastasii (sl. 26) in je zasedala
BDKNSMNNYDLKIDURDCNLNQI@NCK@FTMD F@ ID KNHK MHY CNKFHG HM NYJHG
otokov (lidi) (Pineta Maggiore in Pineta MinorePAVANELLO 1923). Kopno,
katerega posebnost sta bili izgonski
strugi rek Piave in Livenze, je bilo

v celoti poraslo z gozdovi, ki so bili


CDK NARDMDF@ NAK@FTMRJDF@ FNYC@
Selva Fetontea MIDFNUN HLD RD ONjavi tudi v zapisih Virgilia (PAVANEL
LO 1923). Najbolj znan in najlepe
ohranjen primer tega gozda je Bosco di Olm v Cesaltu. Zadnji ostanek
@USNGSNMD MHHMRJD FNYCMD YCQTAD
gradna z belim gabrom (querco-carpinetum) je Bosco di Lison, samo 6
hektarjev velik gozd, ki se nahaja na
OQNIDJSMDL NALNIT /@QRI@C@ KDUN
NC DKDYMHJD OQNFD !DMDSJD 3QRS U
kraju Lison (SEMENZATO 1990). Ob-

QNAMHO@RRHOHMHMAQDFNULNUHQMHG
plitvin, poznanih kot barene in velLD SDQQDMHGTRSHIJQ@JHGQDJHMCDKSD QDJ /H@UD HM +HUDMYD ID KNHK LYR
laguno od kopnega.
Na izgonskem grebenu Piavona,
JH M@I AH M@RS@K D U QHLRJDL NACNbju, najdemo ostanke vie Annie in
NARDMD QHLRJD M@RDKAHMD  J@SDQD
pomen arheoloki viri poznanega
morda podcenjujejo.

47

Levada nei pressi di Torre di Mosto.


Lunit ha subito un notevole
cambio nella sua evoluzione per effetto degli interventi antropici rinaRBHLDMS@KHDLNCDQMHHMO@QSHBNK@QD 
nel 1654 stata realizzata la deviaYHNMD @QSHBH@KD CDK +HUDMY@ C@K RTN
ramo naturale sfociante presso Porto S. Croce (Lv 1a), ora detto Livenza
Morta, a quello di Porto S. Margherita
+UA 0TDRS@CHUDQRHNMD@QSHBH@KD
ha causato linterramento di buona
parte della originaria laguna situata alle spalle dellabitato di Caorle.
(M S@KD RDSSNQD  CNUD @NQ@MN RDCHmenti lagunari, nel primo sottosuolo
sono spesso presenti anche alternanze con i sedimenti alluvionali.
Presso Corbolone di San Stino, nel
BNQRN CDK 77 RDBNKN  RS@SN @MBGD
QD@KHYY@S@K@QDSSHB@YHNMDCDKK@KUDN
del Livenza con creazione del canale
Malgher, che occupa lantico meanCQNCDKTLD
83$GL&DRUOH&D

48

LUPA di Caorle costituisce buona parte del settore compreso tra


la laguna di Venezia e il Tagliamento. Essa coincide in larga parte con
KD@QDDCNUD SQ@K@MDCDK7(7DKHMHYHN CDK 77 RDBNKN  DQ@MN @MBNQ@
presenti zone lagunari e paludi coRSHDQD  RTBBDRRHU@LDMSD ANMHB@SD 
Tutti gli specchi lagunari sono stati
ENQSDLDMSD QHCHLDMRHNM@SH F  
e in molti casi sono stati prosciugati
SNS@KLDMSDRNKNMDKB@RNCDKK@K@FTna di Caorle le acque salmastre sono
ancora presenti.
Nei settori marginali della laguna
di Caorle e del cosiddetto Lago delK@/H@UD NQ@ANMHB@SH HMB@QSNFQ@@
storica e moderna erano rappresentate delle paludi di acqua dolce la
BTHDRHRSDMY@DQ@BNQQDK@S@@KK@CHBNKSCHRBNKNCDKKD@BPTDHMFDMDQD
gli ambienti palustri di acqua dolce
(UPA di Ceggia) passavano gradualmente a quelli schiettamente lagunari. Attualmente di questi settori
palustri non rimangono molte evidenze, dato che i relativi depositi
sono estremamente rari.
A causa delle omogenee caratteristiche sedimentologiche e ambienS@KH KTMHSG@TMRHFMHB@SNFDMDQ@KD
e raccoglie al suo interno tutti i depositi lagunari esistenti tra il Tagliamento e il limite orientale della laguM@CH5DMDYH@ RDMY@CHDQDMYH@YHNMH
BQNMNRSQ@SHFQ@BGDDNA@BHM@KH 

Nelle aree in cui sono presenti


TLH@SSHUH@CDRDLOHNOQDRRNHK3@gliamento, il Livenza e il Piave), lunit pu essere sepolta da depositi
alluvionali. Nelle zone in cui si veQHB@S@ @MBGD MDKK.KNBDMD QDBDMSD
la trasgressione dei depositi costieri,
lunit stata parzialmente erosa e
poi sepolta da corpi sabbiosi litorali
potenti anche 5 m: questa la situazione riconoscibile lungo la costa tra
Caorle e la foce del Piave.
83$GL/LVRQ7OD
e di Torresella - Tl 1b
LUPA di Lison costituita dai sedimenti depositati dal Tagliamento
durante la fase pleniglaciale dellLGM, ossia nel periodo di avanzata del suo ghiacciaio e di stazionamento presso le morene pi esterMD CDKK@MSD@SQN  -DKK@QD@ /@QRI@C
questi sedimenti costituiscono la suODQBHDBGDRHDRSDMCDSQ@HK+HUDMY@
e il Reghena, mentre pi a est sono
sepolti dallunit di Torresella (Tl 1b)
DC@KKDTMHSENQL@SDRHMDKONRS +&,
alcune limitate porzioni dellUPA riL@MFNMN@NQ@MSHONBN@NUDRSCH2 
Michele.
Lo spessore dellunit stimabile
attorno ai 30-35 m nel settore settentrionale del Portogruarese, mentre di circa 15-20 m nella parte
costiera. In varie zone i corsi di risorgiva hanno inciso il loro letto entro
KD @KKTUHNMH +&, MN @  L CH OQNfondit. Verso lattuale area lagunare
lunit coperta dai depositi costieri
DK@FTM@QHMN@KK@A@SHLDSQH@CHBHQca 13-15 m.
In base alle datazioni disponibili nellarea considerata e ai rapporti
RSQ@SHFQ@BHBNMKD@KSQDTMHS @MBGD
al di fuori del territorio provinciale,
lunit di Lison possiede unet compresa tra 24.000 e 18.000 anni BP,
corrispondenti in cronologia calibrata a 28.000-18.000 anni a.C.
LUPA di Torresella anchessa riferibile ai sedimenti LGM del sistema del Tagliamento, depostisi per
quando il ghiacciaio tilaventino aveva cominciato a ritirarsi, abbandoM@MCN OQNFQDRRHU@LDMSD K@MSD@tro morenico presente poco a nord
di Udine. Nellarea Parsjad lunit
@NQ@MSD SQ@ H TLH 1DFGDM@ D +DLDMD D @ DRS CDK TLD +DLDMD SQ@
gli abitati di Cintello, S. Margherita e
Torresella. Altre porzioni sono presenti a est e a sud di Concordia.

Lo spessore dellunit in genere limitato e raggiunge una potenza


massima di 3-5 m allinterno dei paleoalvei, mentre decresce veloceLDMSD@KKNMS@M@MCNRHC@HCNRRH MN
a chiudersi lateralmente. Sulla base
delle datazioni disponibili e dei rapONQSH RSQ@SHFQ@BH KTMHS G@ TMDS
compresa tra 18.000 e 15.000 anni
BP circa.
Comprende gli agri rispettivamente ovest ed est di Concordia e
Portogruaro. Come tutti i territori di
questo tipo (pianure LGM), linsediaLDMSN SDMCD @ LNRSQ@QRH HM RTODQBHD M C@K -DNKHSHBN  BNM ONRRHAHKHS
di ritrovamento pure di situazioni
precedenti. Linsediamento pi antico pu aver risentito di diversi fattori attrattivi, come ad esempio la presenza di corsi dacqua di risorgiva,
ma anche della presenza di paleoalvei tardopleistiocenici come quello,
in UPA 1b, di Torresella.
Soprattutto le epoche romana e
medievale paiono responsabili di
profonde azioni di livellamento e
trasformazione, con i noti interventi
centuriali riguardanti lagro concordiese e con le successive sovrapposizioni del parcellario medievale.
Nella disposizione del popolamento
agiscono fattori distributivi sia in ordine ai quadri dei catasti antichi, ma
anche alla viabilit dellAnnia e delle
altre vie romane che si dipartivano
verso Nord.
83$GL$OYLVRSROL7O
LUPA di Alvisopoli costituita da
numerosi paleoalvei incisi nella pianura LGM, aventi una sinuosit spesRNLNKSNDKDU@S@ (MRTODQBHDRNMN
OQDRDMSH RTNKH HCQNLNQ @ SDRRHSTQ@
argillosa, spesso ricchi di sostanza
organica, che testimoniano lantica
presenza di vaste aree paludose con
CDONRHSH SNQANRH  ANMHB@SD @ O@QSHQD C@K 75((( RDBNKN FONTANA 2004,
2006). A valle della SS14 le tracce
dei paleoalvei scompaiono al di sotto dei depositi dellunit di Lugugnana (direttrice del Tiliaventum Maius)
e, verso est, sono ricoperti da quella
di Latisana.
In localit Frattine, poco a monte
dellautostrada, sono presenti fenomeni di risorgiva (LEVORATO, SCOR
TEGAGNA 2008) e lemersione della
falda deve essere stata favorita dalla
posizione incisa degli alvei abbanCNM@SH  C@KK@ OQDRDMY@ HM RTODQBHD

di depositi argillosi che chiudono


una potente serie ghiaiosa e dalla
vicinanza del Tagliamento attuale
che ricarica il sistema idrogeologico. Dopo il loro abbandono vari paleoalvei dellunit di Alvisopoli sono
RS@SH QHTSHKHYY@SH C@ TLH CH QHRNQFHU@
BGD RNMN ONH RS@SH QDSSHB@SH BNM K@
ANMHB@ D REQTSS@SH BNLD BNKKDSSNQH
principali.
La datazione di un livello torboso incontrato in un sondaggio presso
Cedole, a 2,5 m di profondit, ha eviCDMYH@SNTMDSCHo@MMH!/
(FONTANAMDHOQDRRHCH%Q@SSHna la datazione della base dei depositi torbosi che riempiono il canale
residuale di un paleoalveo ha fornito
TMDSCHo@MMH!/ZANFER
RARI et alii 2008). Data la contemporaneit dei risultati ottenuti e poich
in entrambi i casi le datazioni sono
poste quasi a contatto con le ghiaie
CDKK@KUDN DRRDENQMHRBNMNTM@C@bile datazione dellet di disattivazione.
Il territorio ad ovest di Concordia coincide con formazioni piuttosto antiche, sulle quali ravvisabile
soprattutto il record archeologico di
un insediamento romano sostanzialLDMSD @NQ@MSD  (M PTDRSN B@RN KD
lineazioni di plurimi sistemi agrari
(oltre la centuriazione concordiese
@MBGD@KSQDNQHDMS@SDHMLNCNCHNQme), assieme alla viabilit (via Annia
ed altre vie romane verso N), si compongono con le tracce del popolamento antico, a formare quello che
sembrerebbe un pattern tipico di
quadro centuriale, almeno limitatamente al settore settentrionale.
83$GL/XJXJQDQD7O
LUPA di Lugugnana corrisponde
alla direttrice del Tagliamento che
si snoda per Teglio Veneto, Gorgo,
Fratta, Fossalta, Vado, Giussago e Lugugnana. Da qui si riconoscono pi
rami, fra cui il principale raggiunge localit Villaviera e si dirige poi
verso sud costeggiando il margine
NQHDMS@KDCDKK@K@FTM@CH"@NQKDMN
@KK@ BNRS@ CNRRN CH 5HKK@UHDQ@ TM
@KSQN Q@LN OQNRDFTHU@ HMUDBD MN @
Cesarolo, successivamente stato
rimaneggiato e sepolto dal Tagliamento attuale (dosso di Lugugnana,
BEQ F  +TMHSBNRSHSTHS@OQHMcipalmente da limi sabbiosi, sabbie
e limi e, secondariamente, da ghiaie
e ghiaie sabbiose in corrisponden

Fig. 25 - Unit di paesaggio antico del


Piavon (per la legenda vedere Tav. 1).
6RQR HYLGHQ]LDWH OH UDPLFD]LRQL GHO
WUDWWRQDOHGHOGRVVRGHO3LDYRQ
6O(QRWDDQWLQHSRNUDMLQHYNUDMX
3LDYRQ2]QDHQHVRYHMHNRQQHJDRGseka grebena Piavona.

25

26

27

28

Fig. 26 - Estensione dei depositi lagunari-palustri relativi allantica laguna


GL-HVRORH(UDFOHD $ GHSRVLWLODJXQDUL
GHOODWWXDOHODJXQDGL9HQH]LD % GHSRsiti palustri di acqua dolce (C).
6O   2EVHJ ODJXQVNLKPRYLUQLK
usedlin, povezanih z nekdanjo laguno
SUL-HVROXLQ(UDFOHL $ ODJXQVNHXVHGOLQHVHGDQMHEHQHNHODJXQH % PRYLUske usedline sladke vode (C).

Fig. 27 - Estensione delle aree lagunari


tra Livenza e Tagliamento nel XVII secolo (retino verde) (per la legenda delle
UPA vedere Tav. 1).

)LJ'RVVLXYLDOLULFRQRVFLXWLDOOLQterno delle unit di paesaggio antico reODWLYHDLXPL6LOH3LDYH/LYHQ]DH7Dgliamento.

6O2EVHJODJXQVNLKREPRLM ]HOHQDPUHD PHG/LYHQ]RLQ7LOPHQWRPY


17. stoletju (prim. Tav. 1).

6O5HQLJUHEHQLSUHSR]QDQL]QRWUDM(QRW$QWLQH3RNUDMLQHNLVHQDQDDjo na reke Sile, Livenza in Tilment.

49

29

50

Fig. 29 - Sezione dellincisione sepolta


posta a est di Concordia Sagittaria (da
FONTANA 2006).
/HJHQGD D  VRQGDJJL E  SURLH]LRQH GL
sondaggi poco distanti dalla traccia
GHOODVH]LRQHF VFDYLDUFKHRORJLFLHGLWL
SUHVHQWLOXQJRODVH]LRQHG SURLH]LRQH
GLVFDYLDUFKHRORJLFL SLDQDSOHQLJODFLDOHOLPRVRDUJLOORVD  FDQDOHSOHQLJODFLDOHVDEELRVR SLDQDFDWDJODFLDOH
OLPRVRDUJLOORVD FDQDOHFDWDJODFLDOH
VDEELRVRJKLDLRVR GLDPPD[FP 
 FDQDOHFDWDJODFLDOHVDEELRVR VXRORVHSROWRGHOODVXSHUFLH/*0FRQDEERQGDQWL FRQFUH]LRQL   JKLDLH PHGLH
(2-5 cm) tardoglaciali o dellOlocene
inziale trasportate dal Tagliamento che
form la valle (unit di Cinto CaomagJLRUH  VDEELHHOLPLGHOO2ORFHQHLQ]LDOH WRUEHHGHSRVLWLRUJDQLFLULFFKL
GL IUDPPHQWL YHJHWDOL   VHGLPHQWL

lagunari e palustri (limi argillosi e limi


con frammenti di molluschi lagunari e
IUDPPHQWLYHJHWDOL GHSRVLWLGLURWWD
HFDQDOHIRUWHPHQWHLGURPRU OLPLVDEELRVLHVDEELHQL GHSRVLWLGLWUDFLmazione (limi e limi argillosi con frammenti vegetali e di gasteropodi contiQHQWDOL   GHSRVLWL GL FDQDOH VDEELH
PHGLH GLVSRVWH LQ VWUDWLFD]LRQH LQFURFLDWD H SDUDOOHOD    GHSRVLWL GL GRVVR VDEELH OLPRVH H VDEELH    GHSRsiti antropici legati alla frequentazione
URPDQD D  SUHURPDQL   GHSRVLWL
DQWURSLFLPRGHUQLHDWWXDOL GLVFRQWLQXLW WUD L GHSRVLWL ODJXQDULXYLDOL H
TXHOOLGHO7DJOLDPHQWRGHO9,VHFRORG&
18) discontinuit tra i depositi torbosi e
ODJXQDULRORFHQLFL GLVFRQWLQXLWWUD
L GHSRVLWL XYLDOL GHO 7DJOLDPHQWR FKH
LQFLVH OD YDOOH H LO ULHPSLPHQWR XYLR
lagunare olocenico.

Sl. 29 - Prerez zakrite globeli, ki se nahaja vzhodno od Concordie Sagittarie (iz


FONTANA 2006).
/HJHQGDD VRQGLUDQMDE QDSRYHGDQD
VRQGLUDQMD EOL]X URERY SUHUH]D F  L]YHGHQD DUKHRORND L]NRSDYDQMD Y]GRO
SUHUH]D G  QDSRYHGDQD DUKHRORND L]NRSDYDQMD   SOHQLJODFLDOHQ LORYQDWR
EODWHQ VORM    SOHQLJODFLDOHQ SHHQ
NDQDO NDWDJODFLDOHQLORYQDWREODWHQ
VORM   NDWDJODFLDOHQ SHHQRSURGQDW
NDQDO PD[ SUHPHU  FP    NDWDJODFLDOHQSHHQNDQDO ]DNULWDWODSRvrine zadnje poledenitve z izdatnimi
NRQNUHFLMDPL   VUHGQML SURGL  FP 
L] NRQFD OHGHQH GREH DOL ]DHWND KRORcena, prinesel jih je Tilment, ki je oblikoYDO GROLQR HQRWD &LQWR &DRPDJJLRUH 
  SHVNL LQ PXOM L] ]DHWND KRORFHQD
   RWH LQ RUJDQVNH XVHGOLQ ERJDWH ]
UDVWOLQVNLPL IUDJPHQWL   ODJXQVNH

LQ PRYLUQH XVHGOLQH JOLQDVWL PXOM LQ


PXOM V IUDJPHQWL ODJXQVNLK PHKNXFHY
LQUDVWOLQ XVHGOLQHLQNDQDONLMLKMH
REOLNRYDODUHND SHHQLPXOMLQPLYND
12) usedline zaradi prelivanja (mulj in
ilovnati mulj z rastlinskimi fragmenti in
IUDJPHQWLFHOLQVNLKSROHY XVHGOLQH
v kanalu (srednje grobi peski, razporeMHQLYY]SRUHGQLKLQSUHNULDQLKVORMLK 
14) grebenske usedline (muljasti peski
LQ SHVNL    DQWURSRJHQL QDQRVL L]
DVDULPVNHQDVHOLWYHD SUHGULPVNL
16) sodobni in sedanji antropogeni naQRVL   ORQLFD PHG ODJXQVNRUHQLmi usedlinami in usedlinami Tilmenta
YVWROQW ORQLFDPHGRWQLPL
usedlinami in holocenskimi lagunskimi
XVHGOLQDPL   ORQLFD PHG UHQLPL
usedlinami Tilmenta, ki je vklesal dolino
LQ KRORFHQVNLPL SROQLWYDPL ] UHQLPL
lagunskimi usedlinami.

($37RUUHGL0RVWR/Y
EAP Torre di Mosto se omejuje
R@LNM@RDFLDMSQDMDF@JNQHS@+HUDMYDCNM@RDKI@3NQQDCH,NRSNMHje ob vodnem toku enota sovpada z
izgonskim grebenom, ki ga danes zaseda reka, in s tevilnimi razvejanimi
QDMHLHQNJ@UH -@IAQRNLMNFHLDC
MIHLH AHKH @JSHUMH R@LN JQ@SDJ @R 
MIHGNUHHYFNMHO@RNNAH@IMNOQDBDI
NYJH -@IONLDLAMDIHLDCMIHLHRN
NARSNIDHHYFNMLDCM@RDKIDL@3NQQD
CH ,NRSN D 2SQDSSH FQDADM 2S@NKN 
izgon med zaselkoma Boccafossa in
Senzielli (greben Boccafossa), mrtvi rokav Livenze (greben Livenza
Morta), rokav med zaselkoma Ottava Presa in S. Gaetano (greben OttaU@/QDR@SDQSHRSHUY@JKITMDLCDKT
sedanje struge Livenze (sl. 27). OdRDJ HYFNM@  ON J@SDQDL C@MDR SDD
+HUDMY@URUNIDLQDMDLSNJTUHID
NCJQ@I@3NQQDCH,NRSN RNUDHMNL@
oblikovale naplavine rokava Piave,
ko je ta tekla po strugi Piavona, se
U 2  M@RS@RHT YCQTHK@ Y +HUDMYN HM
nato pri kraju Torre di Mosto nadaljevala svojo pot po izgonski strugi Pr
di Levada.
V obdobju renesanse in moderne
dobe so prebivalci precej posegaKH U M@Q@UMH Q@YUNI DMNSD KDS@ 
so ustje Livenze preusmerili iz njene
naravne struge pri kraju Porto S. Croce (Lv 1a), danes imenovane Mrtvi
kanal Livenze, v umetno ustje v kraju
Porto S. Margherita (Lv 1b). Zaradi te
preusmeritve vodnega toka je prilo
do zasutja dobrnega dela prvotne
lagune na obrobju naselja Caorle.
V tem predelu lagunski sedimenti
KDHIN M@ ONUQIT  ID U RKNIHG SHJ ONC
njimi pa se pogosto izmenjujejo tudiz naplavinskimi sedimenti. V lokaciji Corbolone di San Stino so v 20.
stol. opravili tudi melioracijo struge
Livenze in izdelali kanal, ki zaseda
stari okljuk (meander) reke.
($3&DRUOH&D
EAP Caorle predstavlja dober del
ONCQNI@LDCADMDJNK@FTMNHM3HKLDMSNL  5 UDIDL CDKT RNUO@C@ R
predeli, na katerih so se na prehodu
med 19. in 20. stoletjem e nahajala
NALNI@ K@FTMD HM OQHNAQDMHG LNUHQHI J@RMDIDHYRTDMHG 5NCMDONUQHMDK@FTMDRNRDSNQDILNMNYL@MIale (sl. 27), v nekaterih primerih pa
RNIHGUBDKNSHHYRTHKHRK@MJ@RSHUNCMH
G@AHS@SA@QDM@IDYC@ILNFNDM@ISH
le e v laguni pri Caorlu.


Zgodovinski in moderni zemljevidi prikazujejo v predelih na obrobju


lagune in tako imenovanega Jezera
Piave (predeli so po melioracijskih
delih zdaj izsueni) sladkovodna
LNUHQI@  JH RN M@RS@K@ Y@Q@CH NUHQ@MDF@ HYKHSI@ QDMHG SNJNU U LNQID
NAH@IMNRNS@RK@CJNUNCM@LNJQH@
(EAP Ceggia) postopoma prehajala v
HYJKITMN K@FTMRJH G@AHS@S  3QDMTSMN
NCY@LNUHQIDMHGOQDCDKNUMHNRS@KN
veliko, saj so tudi njihovi sedimentni
nanosi izjemno redki.
Zaradi njenih homogenih sediLDMSNKNJHGHMNJNKIRJHGYM@HKMNRSH
je tudi sama enota precej skladna
Y UHCHJ@ @QGDNKNJDF@ ONSDMBH@K@ U
MIDI RN OQHRNSMH URH NARSNIDH K@FTMRJHM@MNRH STCHRHBDQYM@HKMHY@NALNID LDC 3HKLDMSNL HM UYGNCMN
mejo beneke lagune, brez kronostratigrafskih in/ali bazenskih razlik.
-@ NALNIT C@MDR @JSHUMHG QDJ
(Tilment, Livenza, Piava) so lahko prisotni naplavinski nanosi. V predelih,
kjer je tudi v zadnji fazi holocena prihajalo do meanja plasti obalnih nanosov, je bila enota delno erodirana,
M@SNO@OQDJQHS@YNA@KMHLHODDMHmi gmotami, ponekod debelimi tudi
CNLDSQNUS@JM@IDC@M@MI@ONdoba obale med Caorlem in ustjem
reke Piave.
($3/LVRQ7OD
in Torresella - Tl 1b
EAP Lison sestavljajo sedimenti,
ki jih je nanesel Tilment v pleniglacialni fazi ledene dobe (LGM) oziroL@ U @RT M@OQDCNU@MI@ MIDFNUDF@
KDCDMHJ@ HM JNOHDMI@ L@SDQH@K@ M@
zunanjih morenah ledenikega amSD@SQ@  -@ OQNIDJSMDL NALNIT
Parsjada tvorijo ti nanosi povrje, ki
se razteza med Livenzo in RegheMN  ITMDID O@ RN IHG OQDJQHKH M@MNRH
enote Torresella (Tl 1b) in sloji, ki so
M@RS@KHONJNMBTKDCDMDCNADMDJ@teri manji deli enote so zahodno od
naselja S. Michele e vedno vidni na
povrju.
Ocenjuje se, da plast enote v seUDQMDL CDKT NALNI@ /NQSNFQT@Q@
RDF@CNFKNAHMDOQHAKHMN L U
NA@KMDLCDKTO@OQHAKHMN L
globoko. Krake reke iz artekih stuCDMBDURNUSDLCDKTMHHMDLDCONplavami po koncu ledene dobe marsikje izdolble svojo strugo tudi do
globine sedmih metrov. V delu sedanje lagune je enota pokrita z obalnimi in lagunskimi nanosi, ki lahko se-

gajo tudi do 13-15 m globoko.


Na osnovi podatkov datiranja za
NAQ@UM@U@MN NALNID HM RSQ@SHFQ@ERJHGONQNHKYCQTFHGDMNS STCHSHRSHG
izven meja Pokrajine, se ocenjuje,
da je starost enote Lison nekje med
24.000 in 18.000 let BP, kar kronoloko umerjeno ustreza starosti
28.000-18.000 pr. n. t.
Tudi za enoto EAP Torresella so
YM@HKMH RDCHLDMSH HY KDCDMD CNAD
(LGM), ki jih je nanesel Tilment, le da
RNRDSHY@DKHM@K@F@SHU@RT JNRD
IDMIDFNUKDCDMHJDY@DKTLHJ@SHHM
je za seboj (severno do dananjega
5HCL@ONRSNONL@Y@OT@KLNQDMRJH@LSD@SDQ -@OQNIDJSMDLNALNIT/@QRI@C@IDDMNS@UHCM@M@ONUQju v predelu med rekama Regheno
in Lemeno ter vzhodno od Lemene
med zaselki Cintello, S. Margherita in
3NQQDRDKK@  -DJ@SDQH RDALDMSH KDHIN
STCHUYGNCMNHMITMNNC"NMBNQCHD
#DADKHM@RKNI@DMNSDIDUDHMNL@
NLDIDM@M@M@IUD LUMNSQ@MINsti starih strug, malo dlje od izgonRJHGQDMHGFQDADMNUO@RDOK@RSQ@YLDQNL@GHSQNS@MI@URDCNANMDF@
Y@OQSI@ -@NRMNUHQ@YONKNKIHUHGC@S@BHIHMRSQ@SHFQ@ERJHGONQNHKRDNBDnjuje, da je starost enote nekje med
18.000 in 15.000 let BP.
Zahodno in vzhodno od ConcorCHDHM/NQSNFQT@Q@KDHINOQDCDKHNAdelovalne zemlje. Kot to velja za vsa
NYDLKI@SDF@SHO@KDCDMHJDMHHMD 
segajo prvi dokazi o poseljenosti
DUMDNKHSHJ LNMNO@AHAHKNM@ISH
STCH RS@QDI@ OQHDU@MI@  -@IRS@QDID
naselbine so verjetno nastale pod
UOKHUNL Q@YKHMHG TFNCMHG CDI@UMHkov, kot so lahko reke, ki izvirajo iz
artekih studencev, pa tudi ob starih
strugah iz poznega pleistocenskega
obdobja, kot je tista v enoti 1b - Toresella. Predvsem v rimskem in srednjevekem obdobju pa je prilo
do korenitih sprememb na ozemlju.
.ARDMDOQDCDKDRNHYQ@UM@KHHMQ@YCDKHKHYM@MDRNQHLRJDO@QBDK@BHIDM@
centurije in kasneje srednjeveke
razdelitve zemlje. Poselitveni vzorec
se je oblikoval v skladu s potrebami
ONQ@YONKNKIHUHGNACDKNU@KMHGONUQinah, pa tudi glede na prometne povezave vie Annie in ostalih rimskih
cest, ki so vodile na sever.

($3$OYLVRSROL7O
EAP Alvisopoli sestavljajo tevilne stare struge, ki so si urezale svojo
ONSONKDCDMHJDLMHHMRJDLRUDST 
pogosto v izrazito vijugasto trasi. Tla
so hidromorfna in ilovnate sestave, pogosto so bogata z organskimi
RMNULH J@QOQH@ C@RNAHK@STMDJC@INARDM@LNUHQI@YM@MNRHNSD 
JHRNIHGY@DKHLDKHNQHQ@SHNC RSNK 
dalje (FONTANA 2004, 2006). V zaCMIDL NCRDJT CQ@UMD BDRSD 22
se sledi prvotnih strug porazgubijo
pod nanosi enote Lugugnana (korito
Tiliaventum Maius), na vzhodu pa jih
pokriva sloj enote Latisana.
V kraju Frattine, nekoliko severno od avtoceste, naletimo na arteke
studence (LEVORATO, SCORTEGAGNA
  #UHFT UNCMD HKD RN FNSNUN
botrovala poglobljena korita starih
NOTDMHG QDMHG RSQTF  ONUQHMRJH
nanosi ilovice, ki so zapirali pod njiLH KDDD RKNID ODRJ@  HM AKHHM@ RDdanjega Tilmenta, ki je dovajal vodo
v hidrogeoloki sistem. Po tem, ko so
stare struge enote Alvisopoli presahnile, so jih ponovno izkoristile tevilne krake reke, ki so jih kasneje preusmerili z melioracijskimi deli in jih
uporabili kot glavne zbiralnike vode.
Na osnovi datiranja sloja ote, na
katerega smo naleteli v globini 2,5
m v vrtini pri kraju Cedole, je bilo
LNFND MIDFNUN RS@QNRS NBDMHSH M@
o KDS !/ FONTANA 
C@SHQ@MID UYMNI@ NSMHG CDONYHSNU 
JH RN Y@ONKMHKH NOTDMH J@M@K RS@QD
struge pri Frattini pa je pokazalo na
RS@QNRSo!/KDSZANFERRARI
et alii   9@Q@CH RN@RMNRSH CNbljenih rezultatov in ker so se v obeh
primerih datiranja opravila v delu
sloja, ki se skoraj dotika prodnatega
gradiva stare struge, lahko potrdimo,
da je podatek o tem, kdaj sta vodotoka presahnila, precej verodostojen.
Ozemlje zahodno od Concordie
je precej starega datuma. Izpostavili bi predvsem arheoloke podatke
o rimski naselbini, katere velik del je
viden na povrju. V tem primeru se
linearne razmejitve kmetijskih povrin (poleg centurij Concordie so
vidne e druge kmetijske parcele z
Q@YKHMNTRLDQHSUHINHMBDRSMDONUDzave (via Annia in druge ceste, ki so
vodile na sever) prepletajo z ostanJH@MSHMHGM@RDKAHMHM UR@IURDUDQnem delu enote, skupaj z njimi tvoQHINYM@HKDMUYNQDBONJQ@IHMDU@RT
centurij.

51

52

za dei paleo alvei. A sud di Teglio


i paleoalvei sono di tipo meandriforme e scorrono al centro di un ampio
dosso sabbioso-limoso che in alcuni
settori largo quasi 2 km.
Lo spessore dellunit in genere
di 2-3 m nelle zone di piana alluvionale, mentre raggiunge anche i 1012 m in corrispondenza dei paleoalvei.
+DSQ@BBDO@KDNHCQNFQ@BGDRNMN
state da tempo ricollegate al TagliaLDMSN@SSHUNHMDONB@QNL@M@ CDnito dagli studiosi Tiliaventum Maius sulla base della menzione di Plinio il Vecchio del I secolo d.C. (cfr. da
ultimi FONTANA 2004, 2006) e, per
tale motivo, questa unit talvolta
CDMHS@ @MBGD BNLD HK 3@FKH@LDMSN
romano o di epoca romana. Tale perBNQRNTUH@KD@SST@KLDMSDQHB@KB@to dalla roggia Lugugnana, piccolo
TLD CH QHRNQFHU@ BGD G@ NBBTO@SN
in maniera parassita lultimo alveo
attivo del sistema del Tiliaventum
Maius 0TDRSTKSHLNRHCHR@SSHUSQ@5
D(7RDBNKNODQTM@@UTKRHNMDUDQHcatasi a monte di Cordovado e, avendo lasciato libero il canale residuale
esistente pi a valle, consent alle
acque di risorgiva di sfruttarlo imLDCH@S@LDMSDBNLDUH@CHCDTRRN
preferenziale. probabile che prima
CDKK@E@RDQHBNMNRBHAHKDHMRTODQBHD
vi siano stati anche altri momenti in
cui la direttrice del Tiliaventum Maius venne attivata, ma non vi sono
dati riguardo a tale ipotesi. Sulla
base dellet di disattivazione delle
unit poste a est dellattuale Tagliamento, si pu stimare lattivazione di
quella di Lugugnana almeno a partire dal prima et del Ferro.
2TKK@ RTODQBHD RNMN OQDRDMti siti depoca romana e tardoantica
che testimoniano let pre-romana
CDKK@L@FFHNQO@QSDCDKK@RTODQBHD
dellunit. Infatti la Tl 3 coincide con
i depositi del Tagliamento in epoca
romana (Tilaventum Maius), il quale, secondo molti studiosi, avrebbe
rappresentato un importante alveo
attivo durante let romana ed anche laltomedioevo. Il popolamento
@UQDAADHMPT@KBGDLNCNRDMSHSNK@
grande via dacqua come fattore di
attrazione, cosa che si sarebbe proiettata anche nel sistema dei castelli dei secoli centrali del Medioevo
(Centa di San Martino di Giussago,
Fratta, Fossalta e Cordovado).

83$GL&RQFRUGLD7O
LUPA di Concordia corrisponde a
un ramo del Tagliamento che possedeva la stessa direzione dellattuale
BNQRN CDK TLD +DLDMD K@ RTBBDRsiva attivit del corso di risorgiva ha
parzialmente rimaneggiato i depositi originari. Lunit, che ha portato
al seppellimento della citt romana
di Concordia Sagittaria, stata attiva
SQ@5(D(7RDBNKN CTQ@MSDHKODQHNCN
di avulsioni che ha condotto alla disattivazione dellunit di Lugugnana
e ha attivato lattuale direzione del
Tagliamento. A monte di Portogruaro
i sedimenti dellunit sono contenuti
entro lincisione scavata dal Tagliamento tra il Tardoglaciale e lOlocene superiore. Fino a Bagnarola il
corso del Lemene inciso per 2-3
m allinterno dei sedimenti dellunit di Concordia, mentre pi a valle
HKTLDRBNQQD@KBDMSQNCHTMCNRRN
ereditato dal Tagliamento medievale
CNRRNCH"NMBNQCH@ BEQ F  3@KD
elemento ben evidente presso la
citt di Portogruaro e nel tratto che
FHTMFDMN@"NMBNQCH@ LDMSQDOH
a valle diviene pi sottile e coincide
BNMHKODQBNQRNCDK+DLDMDMN@KNcalit Marango di Caorle. Da localit
Franzona di Concordia si riconosce
anche un altro dosso che prosegue
in direzione sud per oltre 2 km, mentre un altro si diparte da localit Spareda verso sud-ovest e giunge quasi
MN@KTLD+NMBNM
La cronologia relativa allunit si basa essenzialmente sulle osservazioni raccolte nei dintorni di
Concordia e soprattutto sullanalisi
CH TM OQNKN RSQ@SHFQ@BN DDSST@SN
MDHOQDRRHCDKK@QD@CDKKD3DQLDF 
 FONTANA 2006). In questultimo sono riconoscibili i riempimenti
della valle fossile, precedentemente
formata dal Tagliamento tra il TardoFK@BH@KD D KHMHYHN CDKK.KNBDMD DRRH
sono costituiti al fondo da ghiaie e
sabbie ghiaiose depositate precedentemente al 6000 a.C., cui si sovrappongono torbe palustri legate
allabbandono della valle, a loro volS@RDONKSDC@CDONRHSHK@FTM@QHMN@
4-5 m di profondit. Nel corso del I
millennio a.C. la laguna si era leggermente ritirata verso sud e, allaltezza
della citt romana si era instaurato
un ambiente di palude dacqua dolce
che ha lasciato orizzonti torbosi, potenti alcuni decimetri e aventi unet
Q@CHNLDSQHB@ CH o @MMH !/ D

o @MMH !/ FONTANA 2006).


Al di sopra di questi vi sono sabbie e
limi sabbiosi con laminazioni planari e incrociate, tipiche delle facies di
argine naturale e di ventaglio di rotta, sopra cui poggiano le fondazioni
CDKK@A@RHKHB@@SST@KD DCHB@S@@O@Qtire dallVIII secolo d.C. Tali sedimenti hanno uno spessore di 3-4 m e
hanno portato al totale riempimento
delle incisioni preesistenti, alluvionando parzialmente anche la pianura pleistocenica esterna ad esse.
Lambiente protostorico e romano vede dunque un paesaggio lagunare disposto su una fascia nord
-sud, che risparmia il sito di ConcorCH@BNLDHRNK@QHL@RS@OQHL@SQ@KD
profonde incisioni del Tagliamento
OKDHRSNBDMHBN ONHSQ@CTDAQ@BBHCH
carattere lagunare (valle del LemeMD 1DFGDM@ 0TDRSNOT@UDQE@UNrito, come locazione di particolare
rilevanza morfologica ed economica,
sia linsediamento di Concordia (da
RNSSNKHMD@QD HK OQDBDCDMSD OQNSN
urbano in et del Bronzo RecenteFinale), sia lungo le fasce di tali bracci lagunari. Va inoltre evidenziato un
altro fattore sedimentario estremaLDMSD HLONQS@MSD  0TDKKN B@TR@SN
dagli alluvionamenti, compresi tra il
VI e lVIII secolo d.C., che portarono
al quasi completo colmamento dello spazio depresso di carattere lagunare su cui prospettava la stessa
Concordia, che ne risult in parte investita. Ci caus la copertura dei livelli tardoantichi della citt romana:
DRDLOKHB@SHU@  K@ UHBDMC@ RSQ@SHFQ@B@CDKBNLO@QSNCDKK@B@SSDCQ@KD
medioevale, che, come noto, copre i
resti del centro paleocristiano concordiese appoggiandosi su depositi
spessi dai 3 ai 4 m. In altre zone del
territorio e della citt gli spessori si
@RRNSSHFKH@MN MN @ L    CH OQNfondit sui livelli di et romana.
Oltre a Concordia considerata
come esempio di citt abbandonata
DONHQHOQDR@BNM@KSQDETMYHNMHinfra, UPA urbane), lUPA in questione
NQD ONH TM@KSQ@ ONRRHAHKHS KN RSTdio della vicina Portogruaro come
centro di formazione medievale posto nel medesimo comprensorio territoriale.
83$GL/DWLVDQD7O
LUPA di Latisana costituita da
depositi alluvionali legati alla diretSQHBD@SST@KDCDK3@FKH@LDMSN 0TDRSH

depositi formano levidente dosso


OQDRDMSD KTMFN HK BNQRN CDK TLD
CNRRNCH+@SHR@M@ BEQ F  @@MBNCDKPT@KDRHDRSDMCNMNMN@ 
km i sedimenti della piana alluvionale correlata. Il dosso comincia ad essere riconoscibile a valle di Villanova
della Cartera, ma lalveo si mantiene
HMBHRN MDH RTNH CDONRHSH QDBDMSH MN
allaltezza dellautostrada A4. Lunit
particolarmente ampia a valle di
Cesarolo, dove, oltre alla direttrice
RDFTHS@C@KTLD@SST@KD OQDRDMte un percorso di rotta utilizzato pi
volte negli ultimi secoli, gi sfruttato
dalla roggia Lugugnana, e lungo cui
MDK77RDBNKNRS@SNBNRSQTHSNHKB@nale scolmatore Cavrato (FONTANA
 (RDCHLDMSHRNMNODMRHKHMN
alla localit Brigolo Alto, mentre pi
a valle lunit a livello dei depositi
lagunari con cui interdigitata ed ha
unestensione molto limitata.
A valle di S. Giorgio, in numerosi
punti allesterno degli argini stato
riconosciuto un suolo sepolto contenente strutture archeologiche e
manufatti depoca romana che forniscono una buona datazione indiretta dellinizio della deposizione
dellunit di Latisana. In vari punti
questi manufatti si trovano sul suolo
RUHKTOO@SNRH@KSDSSNCDKK@RTODQBHD
pleistocenica.
Del tutto da appurare la natura
della presenza di tracce della centuriazione concordiese anche sul
dosso in parola (sintesi in ROSADA
2001), che peraltro contrasta con la
quasi totale assenza di rinvenimenti
archeologici, compresi quelli relativi
@KKHMRDCH@LDMSN CHTRN CH DS QNmana, soprattutto al confronto con
le aree vicine.

/83$ &&
(sp, an, af, pm)
I cordoni litoranei pi antichi presenti nellarea costiera veneta sono
costituiti dai sistemi dunali dellUPA
Co 1 Motte Cucco. La formazione di
un antico delta del Po nel settore
meridionale della laguna di Venezia,
in un periodo compreso tra il II e il I
millennio a.c. (PIOVAN et alii 2012),
ha causato lavanzamento della linea
di costa (UPA Co 2 Cavanella dAdige). In questa zona doveva situarsi
la foce dellalveo del Po (FAVERO,
SERANDREI, BARBERO 1978), identi

($3/XJXJQDQD7O
EAP di Lugugnana ustreza strugi
Tilmenta, ki se vije med zaselki Teglio
Veneto, Gorgo, Fratta, Fossalta, Vado,
Giussago e Lugugnana. Tu se glavni
SNJQDJDQ@YBDOHM@UDQNJ@UNU -@IONLDLAMDIHLDCMIHLHSDDCN5HKlaviere, nato pa se obrne proti jugu
in ob vzhodnem robu lagune Caorla
nadaljuje svojo pot do morja (greben
5HKK@UHDQ@ CQTFH QNJ@U ID SDJDK CN
Cesarola Kasneje mu je dananji Tilment preusmeril tok in ga zasul (greben Lugugnana, cfr. sl. 28). Enoto seRS@UKI@IN UDHMNL@ ODDMD HKNUHBD 
pesek in ilovica, v nekdanjih strugah
pa e prodniki, sami ali pomeani s
peskom. Nekdanje struge oblikujejo
ITMNNC3DFKH@YM@HKMDLD@MCQDHM
SDDINONRQDCHMHHQNJDF@ODDMN-ilovnatega izgonskega grebena, ki
je ponekod irok skoraj 2 km. DebeKHM@DMNSDIDUDHMNL@ LUOQDCDKHGM@OK@UMDQ@UMHBD UAKHHMHRS@QHGRSQTFO@CNRDDSTCHFKNAHMN
 L  /@KDNGHCQNFQ@ERJ@ OQHDU@MI@
RN D MDJ@I @R@ ONUDY@M@ R RSQTFN
Tilmenta iz rimskega obdobja, ki so
ga strokovnjaki na osnovi navedbe
Plinija Starega iz 1. stol. (cfr. zadnji
FONTANA 2004, 2006) poimenovali
Tiliaventum Maius. Zaradi tega enoSN U@RHG ONHLDMTIDIN J@Q 1HLRJH
Tilment ali Tilment iz rimskega obCNAI@  3@JQ@SMN QDMN RSQTFN C@MDR
uporablja kanal Lugugnana, majhna
reka krakega izvora, ki je v pretekloRSHHYJNQH@K@Y@CMIN@JSHUMNRSQTFN
Tiliaventum Maiusa. Ta je presahnila
v obdobju med 5. in 9. stol., ko se je
Tilment pred Cordovadom preusmeQHKHMOTRSHKY@RDANIOQ@YMNQDMNJNrito. Lugugnana jo je takoj izkoristila
kot najkrajo pot proti morju. OpuDMNRSQTFNTiliaventuma Maiusa so
morda pred Lugugnano uporabljali
tudi drugi vodotoki, vendar nimamo
podatkov, ki bi potrdili to domnevo.
Na osnovi ocene obdobja, v katerem
so presahnili drugi vodotoki vzhodno od sedanjega Tilmenta, lahko
CNLMDU@LN C@ID+TFTFM@M@Y@DK@SDHONMIDFNUHNCLQKHRSQTFHDU
@RTOQDCDKDYMNCNAN 
-@ONUQITKDHINM@ICH@HYQHLRJDF@HMONYMN@MSHMDF@NACNAI@ JH
HYOQHTIDIN C@RNAHKHJQ@IHDMNSDUDHMNL@ONRDKIDMHDOQDCOQHGNCNL
1HLKI@MNU  3K  M@LQD RNUO@C@ Y
nanosi Tilmenta iz rimskega obdobja
(Tilaventum Maius), ki naj bi po mnenju tevilnih strokovnjakov takrat, pa


tudi kasneje v srednjem veku, predstavljal pomembno vodno pot. StaQNRDKBH RN LNQC@ NATSHKH MIDFNUN
OQHUK@MNRHKN J@QM@IAHRDONYM@KN
tudi pri kasneji zasnovi sistema gradov, zgrajenih v osrednjih stoletjih
srednjega veka (Centa di San Martino di Giussago, Fratta, Fossalta in
Cordovado).
($3&RQFRUGLD7O
EAP sovpada z enim od rokavov
Tilmenta, ki je tekel v isti smeri kot
dananja reka Lemene. Kasneje deKTIN@ JQ@J@ QDJ@ ID MDJNKHJN OQDmeala prvotne nanose. Reka, ki je
ONUYQNHK@ Y@RTSID QHLRJDF@ LDRS@
Concordia Sagittaria, je bila aktivna
v obdobju od 6. do 9. stol., torej v
@RT JNRDIDSNJQDJROQDLHMI@K JN
je zaradi tega presahnila Lugugnana
in se je Tilment preusmeril v sedanjo
RSQTFN  .A QDMDL SNJT M@UYFNQ NC
Portogruara so sedimenti omejeni na
QDMNJNQHSN JHF@ID3HKLDMSHYCNKADK
med pozno ledeno dobo in holocenom. Do Bagnarole je struga vrezana
2-3 m globoko v sedimente enote
"NMBNQCH@ MHIDNAQDMDLSNJTO@
QDJ@ SDD ON HYFNMRJDL FQDADMT  JH
ga je podedovala po srednjevekem
Tilmentu (greben Concordia, cfr. sl.
  3@ HYFNM ID CNAQN HYQ@DM AKHzu mestnega jedra Portogruara in v
CDKT  JH CNRDD "NMBNQCHN  MHID NA
toku pa postane se porazgubi in soUO@CD Y QDMN RSQTFN +DLDM@ URD
do kraja Marango di Caorle. V kraju
%Q@MYNM@ CH "NMBNQCH@ ID LNFND
NO@YHSH D DM HYFNM CNKHMD UD JNS
2 km v smeri proti jugu, drugi izgon
pa se odcepi v Sparedi in se v jugovzhodni smeri nadaljuje skoraj do
reke Loncon.
Kronoloka ocena enote se opira
M@ QDYTKS@SD NO@@MI U NJNKHBH "NMcordie, predvsem pa na stratigrafski
stolpec, opravljen na lokaciji Terme
RK FONTANA 2006). Na njem so
prepoznavni nanosi v fosilni dolini,
ki jo je Tilment oblikoval v obdobju
ONYMD KDCDMD CNAD HM Y@DSJ@ GNKNBDM@ RDRS@UKI@ IHG NRMNU@ HY OQNC@ HM ODDMDF@ OQNC@ HY NACNAI@
vsaj 6000 pr. n. t., prekrita s slojem
LNUHQRJD NSD  S@ O@ Y K@FTMRJHLH
nanosi globine do 4-5 m. V teku 1.
SHRNKDSI@OQ M S RDIDK@FTM@TL@JMHK@ MDJNKHJN ITMDID U AKHHMH J@sneje rimske naselbine je nastal
G@AHS@S RK@CJNUNCMDF@ LNUHQI@  JH
je za seboj pustil nekaj centimetrov

debel sloj ote, katerega starost po


Q@CHNLDSQHMH LDSNCH ID o
KDS!/HMoKDS!/FONTANA
  /K@RS M@C MIHL ID UDHMNL@
ODDMD HM HKNUM@SN ODDMD RSQTJSTQD U OKN@SHG HM RSHMHG M@MNRHG 
SHOHMHGY@E@BHDRM@Q@UMDAQDHMDHM
O@GKI@@RSHGRDCHLDMSNUM@NJKITJHG
na tej podlagi stojijo temelji sedanje
A@YHKHJD J@SDQDFQ@CMI@RDIDY@DK@U
8. stoletju. Sedimenti so debeli 3-4
L HM RN U BDKNSH Y@ONKMHKH NARSNIDD
MHID OQDCDKD  Y@Q@CH DR@ ID OQHKN
tudi do delnega poplavljanja okoliJDOKDHRSNBDMRJDMHHMD
V predzgodovinskem in rimskem
NACNAITSNQDIS@OQDCDKJ@DONCNAN
lagunskega tipa. Laguna je pokrivala
priobalni pas od severa do juga, prizanesla je samo Concordii, ki se je
nahajala na nekaknem otoku, najprej med globoko vrezanimi koriti
pleistocenskega Tilmenta, kasneje
pa med dvema krakoma lagunskega tipa (dolina Lemena-Reghene).
Prav to je morebiti ugodno vplivalo
M@ HYAHQN "NMBNQCHD HM AQDHM NADG
lagunskih krakov kot mesto poselitve, in sicer tako iz morfolokega kot
STCHFNRONC@QRJDF@UHCHJ@M@IAQID
zaradi teh ugodnih dejavnikov bila
KNJ@BHI@ONRDKIDM@DURQDCHMHHMNA
koncu bronaste dobe. Opozoriti velja
e na drug, izjemno pomemben dejavnik, ki je vplival na nastanek seCHLDMSNU M@RS@KH RN M@LQD Y@Q@CH
poplav v obdobju med 6. in 8. stoKDSIDL JNRNAHKHMHIHOQDCDKHK@FTMskega tipa, ob katerih se je nahajala
Concordia, skoraj v celoti poplavljeni, deloma pa je bilo pod vodo tudi
R@LN LDRSN  /NYMN@MSHMD OK@RSH
rimske naselbine so takrat izginile
pod novimi naplavinskimi nanosi.
Nazoren primer tega zgodovinskega
dogajanja predstavlja stratigrafski
OQNK CDK@ RQDCMIDUDJD J@SDCQ@KD 
katere temelji, kot je znano, stojijo
M@ NRS@MJHG RS@QNJQ@MRJDF@ RQDCH@  Y@JNO@MHG ONC  @KH  LDSQD
debelim slojem naplavin. Drugje na
ozemlju in po mestu je naplavinski
nanos tanji in meri do 1-1,5 m nad
MHUNIDLHYQHLRJDF@@R@ 
Poleg Concordie, ki teje kot priLDQY@OTDMDF@ J@RMDIDO@ONMNUMN NHUKIDMDF@ LDRS@ Y CQTF@MN
namembnostjo (infra, mestne EAP),
MTCHNAQ@UM@U@M@DMNS@DLNMNRS
OQDTDU@MI@AKHMIDF@RQDCMIDUDJDF@ RQDCH@ M@ HRSDL NYDLKIT  /NQtogruara,.

($3/DWLVDQD7O
EAP Latisana sestavljajo naplavinski nanosi dananje reke Tilment.
3HSUNQHINCNAQNHYQ@DMHYFNMUYCNK
QDMDRSQTFDFQDADM+@SHR@M@ BEQ RK 
28), ob katerem v irini do 1-2 km leHINRDCHLDMSHOQHO@C@INDM@OK@UMD
ravnice. Greben postane prepoznaven v dolini Villanove della Cartera,
@ QDM@ RSQTF@ NRS@MD UCNKAKIDM@ U
njegove nedavne nanose vse do avtoceste A4. Enota je e posebej iroJ@ U RUNIDL QDMDL SNJT MHYUNCMN
od Cesarola, kjer se poleg glavne
dananje struge nahaja tudi obvodni
rokav, ki so ga vodotoki, med njimi
kanal Lugugnana, v teku prejnjih
RSNKDSHI UDJQ@S HYJNQHRSHKH M@ RUNIH
poti, v 20. stol. pa so vzporedno z
njim izdelali tudi odvodni kanal Cavrato (FONTANA 2006). Sedimenti so
izgonskega tipa vse do Brigola Alta,
MHID NA QDMDL SNJT O@ RD DMNS@
spusti v isto ravnino z lagunskimi
nanosi, s katerimi se prepleta v skromnem obsebu.
Nizvodno od S. Giorgia smo na
SDUHKMHG LDRSHG NA QDMHG AQDHM@G
naleteli na vkopano plast, bogato z
arheolokimi strukturami in artefakti
iz rimskega obdobja, na osnovi katerih smo lahko relativno zanesljivo
posredno datirali starost nanosov
enote Latisana. Na tevilnih mestih
se artefakti nahajajo nad pleistocenskim povrjem.
Naravo ostankov centurijske deKHSUDM@ONANITHYFNM@ANONSQDAMN
DCNCNAQ@OQDTHSHONUYDSDJURO
SADA 2001), saj je v nasprotju s sicer
skorajda popolno odsotnostjo arheNKNJHGM@ICA UJKITMNRSHRSHLH JHAH
kazala na poselitev razprenega tipa
iz rimskega obdobja, kar je e zlasti
MDM@U@CMN DCDIRSUNOQHLDQI@LNY
M@ICA@LHM@AKHMIHGONCQNIHG

($3&&
(sp, an, af, pm)
Najstareje obalne grebene na
ADMDJDL NA@KMDL NALNIT RDRS@vljajo sistemi sipin enote EAP Co 1
Motte Cucco. Zaradi nastanka staroC@UMDRSQTFDQDJD/@CUITMDLCDKT
Beneke lagune v obdobju med 2. in
 SHRNKDSIDLOQ M S /(.5 -et alii
2012) je prilo do umika obale proti
morju (EAP Co 2 Cavanella d'Adige).
5SDLOQDCDKTIDAHKNM@LQDNCJQHSN

53

Fig. 30 - Particolare della carta di Nicol


Dal Cortivo del 1539 (ASVE, Misc. MapSHGVGDCANIATO et alii, 1995,
PRGLFDWR /HIUHFFHLQGLFDQRLOFRUGRne litorale con il residuo dellantica pineta (la litus pinetiGHOOHIRQWLDQWLFKH 
si osservano inoltre gli alvei della Cava
Zucarina e pi a sud della fossa vechia.
In alto a sinistra segnalato il centro di
Equilo come era ancora riconoscibile
nel XVI secolo: sono evidenziate le Murazze di Jesolo corrispondenti alle mura
della grande cattedrale del XII secolo, e il
monastero di S. Mauro (S. Moro).
Sl. 30 - Podrobnost zemljevida avtorja
Nicol Dal Cortivo iz leta 1539 (ASVE,
0LVF 0DSSH GV   3XLFH NDHMR
sipino s preostalim delom nekdanjega
borovega gozd (litus pineti v starih virih). Poleg tega so opazne struge dveh
MDUNRY &DYD =XFDULQD LQ MXQHMH IRVVD
vechia(stari jarek). Zgoraj levo je oznaHQ FHQWHU QDVHOELQH (TXLOR NRW MH ELO
UD]SR]QDYHQ H Y  VWROHWMX R]QDHni so Murazze di Jesolo ki se ujemajo z
zidovi velike katedrale iz 12. stoletja ter
samostana Sv. Maura (S. Moro). Iz CA
NIATO et al., 1995, spremenjeno.
30

54

B@SN C@ CASTIGLIONI (1978) come


il ramo pi settentrionale di questo
TLD @SSHUNCTQ@MSDKDSCDK!QNMYN
(PIOVAN et alii 2010).
Successivamente il Po si spostato verso sud (ramo del Po di Adria
@SSHUN MN @KKDS CDK %DQQN D K@KUDN@AA@MCNM@SNC@PTDRSNTLD
stato in parte riutilizzato dallAdige.
Probabilmente in questo settore del
bacino lagunare doveva situarsi lantica foce di questo ramo dellAdige,
@SSHUNMN@KKDSQNL@M@PIOVAN et
alii 2012).
Tra il porto di Brondolo e il porto
di Chioggia, la linea di costa di et
romana (Co 3b) era posizionata lungo lallineamento Brondolo - Forte
di San Felice e solo dopo il 1500 ha
raggiunto la situazione attuale (Co
15) a seguito dellapporto sedimentario congiunto di Brenta/Bacchiglione e Adige.
probabile che precedentemente allepoca romana, il cordone litorale che attualmente corrisponde al
lido di Pellestrina (Co 15) si trovasse in una posizione leggermente pi
arretrata e che si ricongiungesse al
lido di Malamocco allaltezza dellOttagono Abbandonato, dove stata
riconosciuta unantica linea di costa
CHDONB@OQD DSQTRB@ 0TDRSN@MSHBN
lido sarebbe stato superato intorno

al 500 a.C. con lo spostamento del


litorale sullattuale allineamento (FA
VERO, SERANDREI, BARBERO 
CANAL 1998).
Nel settore centrale del bacino lagunare, la linea di costa tra la bocca di
porto di Malamocco e quella del Lido
rimasta pressoch invariata dalleONB@QNL@M@MN@CNFFH"N
Nel settore posto pi a nord, invece, il cordone litoraneo tra il porto
di San Nicol e la foce del Piave ha
subito sensibili cambiamenti. Lattuale Lio Piccolo (Co 4) corrispondeva a una linea di costa di et romana
" - +!.- 1#(et alii 1997)
e forse preromana. Tale allineamento litoraneo pare continuare verso
ovest,a comprendere le attuali isole
di S. Erasmo e Le Vignole (Co 5). A
O@QSHQDC@KK@MDCDK(LHKKDMMHNC " 
lapporto sedimentario da parte del
Piave ha comportato la progradazione del litorale (Co 6 e Co 15).
Da Jesolo a Caorle le sabbie costiere occupano unestesa fascia di
SDQQHSNQHN@LOH@MN@BHQB@JL &KH
allineamenti di dune che caratterizzano questarea attualmente sono
completamente spianati, ma nelle
B@QSD RSNQHBGD CDK 75( RDBNKN UDMHvano rappresentati ancora con il loro
QHKHDUN NQHFHM@KD F    0TDRSH @Mtichi cordoni dunali erano sede del-

le pinete medievali e fungevano da


siti preferenziali per gli insediamenti
(FAVERO 1990).
La pi antica linea di costa ricoMNRBHAHKDHMRTODQBHD"N@NQ@
a est di Jesolo e prosegue probabilLDMSD MN @ 3NQQD CH %HMD HM KNB@KHt Vallesina (CASTIGLIONI, FAVERO
1987). Viene ipotizzato inoltre un
possibile collegamento tra questa linea di costa e i cordoni sepolti allinterno della laguna di Venezia poco a
monte dellallineamento S. Erasmo
- Lio Piccolo - Lio Maggiore, dove il
mare si era fermato circa 6500 anni
fa (FAVERO, SERANDREI, BARBERO
1983). Il sito di Jesolo antica si colloca appena allinterno di tale allineamento.
Tra questa linea di costa e quella attuale sono stati individuati altri
antichi apparati deltizi: uno di questi
(Co 8) si localizza nei pressi di Torre
di Fine con apice a est di Marina di S.
Croce, tra Bosco Verde e la terminazione del canale di S. Croce (CASTI
GLIONI, FAVERO 1987). La datazione
radiometrica di un campione prelevato nella porzione pi settentrionale del paleodelta ha fornito unet
O@QH@o@MMH!/BONDESAN
et alii 2003a). Un altro apparato deltizio (Co 9) si trova in prosecuzione
del dosso del Piave che da S. Don

si dirige verso Cortellazzo e che,


nel suo ultimo tratto, corrisponde
a un percorso pi antico dellalveo
@QSHBH@KD RB@U@SN MDK  BLA
KE et alii 1988). Infatti, a valle di
$Q@BKD@ HK SQ@BBH@SN CDK TLD  OQHL@
perfettamente rettilineo, mostra un
andamento meandriforme naturale e costituisce, probabilmente, la
prosecuzione dei paleoalvei provenienti da nord (area di Cittanova e
Stretti). Lantico apparato deltizio di
Cortellazzo corrisponde allunit di
Jesolo della Carta delle unit geologiche della provincia di Venezia
(BONDESAN et alii 2008). Allinterno
di questa unit viene evidenziata la
presenza di due principali sistemi di
cordoni dunali: il sistema di cordoni
posizionato a cavallo del canale Cavetta (Co 9a) con orientamento circa
DRS NUDRS C@S@SN@o@MMH!/
(BONDESAN et alii 2003a), e un seBNMCN RHRSDL@ "N A BGD RH CHDrenzia dal primo per la diversa orientazione delle dune, circa WNW-ESE,
troncate dallattuale linea di costa.
0TDRSTKSHLNRHRSDL@RS@SNC@S@SN
o@MMH!/BONDESAN et alii
2003a).
I due sistemi sono separati da un
allineamento sabbioso pi evidente
degli altri, descritto molto accuratamente in una carta di Nicol Dal Cor

Fig. 31 - Particolare di una mappa di


anonimo collocabile nella prima met
del XVII secolo (ASVE, Misc. Mappe, ds.
GD DAVID, DAVID 2009). Si osserva
la presenza di una serie di cordoni dunali a ovest di Caorle, ora erosi.
Sl. 31 - Podrobnost zemljevida neznanega avtorja, ki spada v prvo polovico 17. stoletja (ASVE, Misc. Mappe, ds.
100). Opaziti je cel niz sipin zahodno od
&DRUOHMD NL VR VHGDM H VSRGMHGHQH L]
DAVID, DAVID, 2009).
31

RS@QN OQHRS@MHD !QNMCNKN  U AKHHMH


J@SDQDF@ RD ID M@IAQ M@G@I@KN STCH
ustje takratne reke Pad (FAVERO, SE
RANDREI, BARBERO 1978), ki jo Castiglioni (1978) navaja kot najbolj
severni rokav reke, aktiven v bronasti dobi (Piovan et alii 2010).
Kasneje se je Pad preusmeril proSHITFTQNJ@U/@C CQHD CDKTINUDKDYMHCNAH MIDFNUNNOTDMNJNQHSN
O@IDCDKNL@TONQ@AHK@ CH@ -IDMN
staro ustje reke (aktivna je bila do
rimskega obdobja) (PIOVAN et alii
  RD ID M@IAQ M@G@I@KN OQ@U U
tem delu lagune.
,DC OQHRS@MHDL U !QNMCNKT HM
SHRSHLU"GHNFFHIDNA@KM@QS@UQHLskem obdobju (Co 3b) tekla ob povezavi Brondolo - Forte di San Felice
HMIDRUNIRDC@MIHONKN@I M@QDJNU@M
z naplavinami, ki sta jih v laguno
skupaj prinaali reki Brenta/BacchiFKHNMDHM CH@ Y@UYDK@DKDONKDST
1500 (Co 15).
,NMNID C@IDU@RTOQDCQHLskim obdobjem priobalni pas, ki trenutno sovpada z ozkim in dolgim
otokom (lido) Pellestrina (Co 15), le@KMDJNKHJNAKHIDJNOMDLTHMIDAHK
pri kraju z imenom Ottagono Abbandonato povezan z lidom Malamocca.
Na tem mestu se je nala stara obalM@ QS@ HY NACNAI@ OQDC $SQT@MH 
Starodavni otok je izginil ob premiku


obale okoli leta 500 pr. n. t. v svoj


C@M@MIH ONKN@I FAVERO, SERAN
DREI, BARBEROCANAL 1998).
V srednjem delu lagunskega baYDM@ RD NA@KM@ QS@ LDC UGNCNL U
OQHRS@MHD ,@K@LNBB@ HM SHRSHL M@
Lidu od rimskega obdobja pa do danes skorajda ni spremenila (Co 15).
Dananji Lio Piccolo (Co 4) je soUO@C@KYNA@KMNQSNUQHLRJDL" - +  !.- 1#( DS @KHH  
morda pa tudi predrimskem obdobju.
Zdi se, da se je takna poravnava nadaljevala tudi proti zahodu, kjer se
danes nahajata otoka S. Erazem in Le
5HFMNKD"N .CJNMB@ SHRNKDSI@
pr. n. t. dalje je je zaradi naplavin, ki
jih je odlagala reka Pad, prilo do preLHJ@NA@KMDQSDUMNSQ@MINRSJNOMDga (t.i. progradacija) (Co 6 in Co 15).
.A@KMD ODDMD RHOHMD RN YDKN
NARDMD  R@I Y@UYDL@IN STCH CN 
km irok obalni pas med Jesolom in
"@NQKDL  5DQHFD RHOHM  JH RN YM@HKne za to pokrajino, so zdaj v celoti
zravnane z okolico, a v zgodovinskih
zemljevidih iz 16. stol. so bile e vedno vrisane v njihovi prvotni obliki
RK  3HRS@QNC@UMHRHOHMRJHNAQNH
so nudili zavetje srednjevekim borovim gozdovom (pinete) in staroselBDL  JH RN ONCQNID M@ FNRSN ONRDljevali (FAVERO 1990).
Najstareja e razvidna obalna

QS@ "N  RD ONI@UH UYGNCMN NC


Jesola in se po vsej verjetnosti naC@KITID URD CN 5@KKDRHMD U AKHHMH
naselja Torre di Fine (CASTIGLIONI,
FAVERO 1987). Domneva se tudi, da
IDAHK@S@NA@KM@QS@ONUDY@M@RODDMHLH RHOHM@LH M@ LNQRJDL CMT
beneke lagune malo pred sipinskim
kordonom S. Erasmo - Lio Piccolo Lio Maggiore, kjer se je morje ustaUHKNOQDCOQHAKHMNKDSH%@UDQN
Serandrei Barbero 1983). Naselbina
@MSHMDF@)DRNK@RK RDM@G@I@SHJ
znotraj tega niza.
Med opisano in dananjo obalo
RLN M@KH D CQTFD @MSHMD RHRSDLD
QDMHG CDKS DCDM NC MIHG "N  RD
nahaja pri kraju Torre di Fine, z vrhom vzhodno od Marine di S. Croce,
med Zelenim gozdom (Bosco Verde)
HMY@JKITMHLNCRDJNLJ@M@K@2 "QNce (Castiglioni Favero 1987). RadioLDSQHMN C@SHQ@MID UYNQB@  NCUYDSDga v najbolj severnem delu starodavMD CDKSD  J@D M@ RS@QNRS o
let BP (BONDESAN et alii 2003a).
Drugi sistem delte (Co 9) se nahaja
v nadaljevanju grebena Piave, ki od
mesta S. Don vodi proti Cortelazzu
HM U RUNIDL Y@JKITMDL NCRDJT RNvpada s e starejim koritom umetne
struge, izdelane v letu 1664 (BLAKE
et alii 1988). Nizvodno od Eraclee
se vodni tok, ki je do tedaj tekel po

ONONKMNL@ Q@UMH QSH  CDI@MRJN Y@ne zvijati in tvoriti naravne meandre


NJKITJD  J@Q ONSQITID  C@ FQD M@IAQ
za nadaljevanje s severa prihajajoHGRS@QNC@UMHGQDMHGRSQTFOQDCDK
okoli Cittanove in Strettija). Stari sistem delte v Cortelazzu na Zemljevidu geolokih enot pokrajine Benetke (BONDESAN et alii 2008) sovpada
z enoto Jesolo. Znotraj te enote sta
omembe vredna oba glavna sistema
sipinskih pasov, imenovanih kordonov: starost prvega kordona v smeri
vzhod-zahod ob kanalu Cavetta (Co
@ ID C@SHQ@M@ M@ o KDS !/
(BONDESAN et alii@CQTFHRHRtem se od prvega razlikuje po usmeritvi sipin (ZSZ-VJV), ki se prekinejo
ob dananji obali. Starost slednjega
IDC@SHQ@M@M@oKDS!/!.-DESAN et alii 2003a).
.A@RHRSDL@RS@LDCRDANIKNDM@ R ODDMHL FQDADMNL  JH ID OQDcej bolj izrazit od ostalih in ga je leta
1539 zelo podrobno opisal Nicol
Dal Cortivo v svojem zemljevidu (CA
NIATO et alii 1995) kot z rastlinjem
obrasel kordon dun (sipinski pas) (sl.
  JH RD M@G@I@ U AKHHMH TKHBD UH@
/HMDC@ ,NMNIDSTCH C@S@RHOHMRJH
RHRSDL OQHO@C@ RS@QH NA@KMH QSH  R@I
RDIDS@ JNSDQDDMN M@G@I@K@LDC
obema prej opisanima nizoma sipin.
*NID/H@U@JNMDBOQUDF@SHRNKD-

55

32

56

tivo del 1539 (CANIATO et alii 1995)


come un cordone di dune sormonS@SN C@ UDFDS@YHNMD F    BGD RH
localizza allaltezza di via Pineda.
possibile che questo cordone corrisponda a unantica linea di costa situata tra i due sistemi di dune precedentemente descritti.
0T@MCN HK /H@UD  @KK@ MD CDK (
millennio d.C., cambi nuovamente
percorso seguendo il margine della laguna di Venezia, nei pressi di
Jesolo fu costretto a deviare verso
NUDRS MN @KK@KSDYY@ CDKK@ ENBD CH
Piave Vecchia proprio a causa della
presenza di queste antiche cuspidi
deltizie, costruendo cos lapparato
costiero di et medievale (Co 10).
Dalla foce di Piave Vecchia, ora foce
del Sile, si form poi lattuale esteso
litorale di Punta Sabbioni (Co 15).
Nel settore costiero pi orientale, FAVERO et alii (1988) indicano la
presenza di una cuspide deltizia, in
parte erosa, individuata nei pressi di
Caorle. Un tratto di cordone litorale
interno (Co 11) con direzione da NE
a SW segnalato a nord-est di Caorle in localit Case Gottola (VITTURI
 RSQTSSTQD BNM RHLHKD NQHDMS@LDMSN RNMN QHKDU@AHKH HM B@QSNFQ@@
storica nella stessa zona tra il canale
2@DSS@ D K@ BNRS@ F    &KH @TSNQH
attribuiscono, in prima analisi, la forL@YHNMD CH PTDRSN @MSHBN CDKS@ Tviale allazione congiunta di Piave
(probabilmente il ramo del Piavon)
e Livenza.
Spostandosi ancora pi a ovest
verso il Tagliamento, allaltezza di
Bevazzana si individuano dei depo-

siti costieri (Co 12) che corrispondoMN@CTMBNQONCHR@AAHDMHBNM@Abondanti resti di molluschi marini. Si


tratta di un antico apparato costiero
che in foto aerea appare ben riconoRBHAHKDK@QFNONBGDCDBHMDCHLDSQH
ed caratterizzato da un andamento
rettilineo con direzione NE-SW.
Il sistema di dune di Motteron dei
Frati (Co 13), posto a nord di BibioMD D BNMM@MSD BNM K@ 5@KKD &Q@Mde, corrisponde a un altro apparato
costiero deposto dal Tagliamento
precedentemente al periodo romano. Le dune raggiungono laltezza di
12 m slm, che rappresenta il rilievo
massimo di questo tipo di morfologie allinterno dellarea Parsjad.
(MMD  K@SST@KD RHRSDL@ CDKSHYHN
del Tagliamento (attivo dal periodo
QNL@MN MN @C NFFH  "N  ONRsiede una caratteristica morfologia
bialare, di cui larea di Bibione costituisce lala occidentale, che si sviluppata negli ultimi 2000 anni circa
e aveva raggiunto una forma simile a
quella attuale attorno al 1400 (MA
ROCCO 1989). Tuttavia, dallanalisi
CDKK@B@QSNFQ@@RSNQHB@RHMNS@BGDHK
delta ha avuto unimportante fase di
OQNFQ@C@YHNMDSQ@HK75(D7(7RDBNKN 
quando nel settore avanz in alcuni punti anche per circa 1 km (BON
#$2 - ,$-$&'$+%.-3 - 
2004). I cordoni dunali sono caratterizzati da un andamento arcuato
presso la foce del Tagliamento, mentre divengono poi rettilinei e vanno
a saldarsi fra loro verso Porto Baseleghe. Attualmente le dune sono state
in gran parte spianate a causa dello

33

sviluppo turistico e agrario avvenuto


MDKK@RDBNMC@LDSCDK77RDBNKN +D
morfologie originarie si sono preservate solo in alcuni settori dove sono
ancora coperte dalla pineta, come
presso la foce.

gico sia in realt un mound di origine


antropica, in gran parte imputabile
allaccumulo di depositi archeologici, in buona analogia con quanto osservato a Padova, e Altino. Per maggiori dettagli si rimanda al paragrafo
sulla relativa area campione (infra).

/83$

5.2. UPA di Jesolo

(cn, an, sp, af, pm)

LUnit di Paesaggio Antico (UPA)


di Jesolo corrisponde allarea dellattuale zona archeologica incentrata
attorno alle rovine della basilica romanica di S. Maria Maggiore, in localit Le Mura, e del sito dellantica
chiesa di S. Mauro, situato 250 m pi
@MNQCCDKK@A@RHKHB@F 
Lintera area appartenente allUPA di Jesolo si trova in posizione pi
rilevata rispetto ai terreni circostanti,
caratterizzati da una quota minima
O@QH@  LR K L KDQNUHMDCDKK@A@silica si trovano invece a una quota
CH
 LR K L (KCHRKHUDKKNL@RRHLN
dellintera area risulta quindi essere
di circa 2 m. Per maggiori dettagli si
rimanda al paragrafo sulla relativa
area campione (infra).

5.1. UPA di Adria


LUnit di Paesaggio Antico (UPA)
CH CQH@TAHB@S@RTK@MBNLDQHCHNnale di un dosso relitto di et protostorica del Po, antistante la depresRHNMD RDFTHS@ C@K TLD 3@QS@QN F 
32). La sua delineazione si basa sulla
particolare morfologia desunta dallelaborazione del modello digitale del
SDQQDMNF  +HMSDQ@@QD@CDKBDMtro storico infatti rilevata di 1-2 m
rispetto alla pianura circostante.
+@M@STQ@OKTQHRSQ@SHB@S@CDKRHSN
di Adria ben nota e comprende
sequenze archeologiche che vanno
C@KKDSCDKEDQQNMN@KKDSLDCHDvale. probabile che lalto morfolo-

SI@RODSROQDLDMHK@RUNIQDMHSNJHM
stekla ob obrobju beneke lagune,
je bila pri Jesolu prav zaradi teh staQNC@UMHGY@IDCQDMHGCDKSOQHRHKIDM@
zaviti proti vzhodu vse do ustja Stare Piave. Pri tem je izoblikovala srednjeveko podobo obale (Co 10).
Iz ustja Stare Piave (zdaj ustje reke
Sile) je kasneje nastala dananja iQNJ@ ODDM@ NA@K@ /TMS@ 2@AAHNMH
(Co 15).
5ITMDLCDKTNA@KD%@UDQNet alii
(1988) navajajo obstoj deloma erodirane zajede delte, ki so jo odkrili
U AKHHMH "@NQK@  2DUDQNUYGNCMN NC
Caorla v kraju Case Gottola (VITTU
RI 1983) je najden odsek notranjega
obalnega kordona (Co 11) s smerjo
RKDLDM@ 25 )9  -@ HRSDL NALNIT 
med kanalom Saetta in obalo (sl. 31)
RN Y@ADKDDMD RSQTJSTQD R ONCNAMN
usmeritvijo. Avtorji pripisujejo naRS@MDJ SD RS@QNC@UMD QDMD CDKSD
skupnemu delovanju Piave (verjetno
rokava Piavona) in Livenze.
D RD ONL@JMDLN D Y@GNCMDje proti Tilmentu, pri Bevazzani naletimo na obalne nanose (Co 12), ki
RNUO@C@IN Y FLNSN HY MDF@ ODRJ@ 
ONLD@MDF@YUDKHJNJNKHHMNNRS@MJNULNQRJHGLDGJTBDU &QDY@RS@rodavni obalni sistem, dobro prepoYM@UDM M@ YQ@MHG ONRMDSJHG HQNJ
je nekaj desetin metrov, poteka pa v
Q@UMHQSHURLDQH25 )9 
Sistem dun pri Motteronu dei
%Q@SH "N   RDUDQMN NC KDSNUH@
Bibione, ki meji na Valle Grande,
predstavlja e en tak obalni sistem,
ki ga je Tilment naplavil v predrimskem obdobju. Dune dosegajo 12
m nadmorske viine, kar predstavlja
najvijo vzpetino tovrstnih morfoloJHG SUNQA M@ OQNIDJSMDL NALNIT
Parsjad.
Morfoloka posebnost sedanjega
sistema delte Tilmenta (ki je aktiven
NC@R@QHLRJDF@NACNAI@CNC@MDR
- Co 14) je, da je dvokrilen. Predel
NJNKH KDSNUH@ !HAHNMD OQDCRS@UKI@
zahodno krilo, ki se je razvilo v zaCMIHG  KDSHG HM ID D NJNKH KDS@
1400 (MAROCCO  J@Y@KN MH
CNRSHCQTF@MNONCNANNCC@M@MID 
Vendar pa je na osnovi analize zgoCNUHMRJHGYDLKIDUHCNULNFNDNO@YHSH  C@ ID QDM@ CDKS@ U NACNAIT NC
16. do 19. stoletja napredovala ponekod tudi do 1 km (BONDESAN, ME-$&'$+  %NMS@M@   *NQCNMH CTM RD U AKHHMH TRSI@ 3HKLDMS@
krivijo v loku, nato pa se zravnajo in


Fig. 32 - LUPA antropica di Adria.


Sl. 32 - EAP Adrie se razteza med EAP
reke Po di Adria in EAP kanala Tartaro.
Fig. 33 - Ortofoto del centro storico di
Adria con fasce altimetriche desunte
da DTM. Il colore azzurro indica la massima elevazione s.l.m., il colore viola la
minima. Tra la sommit del mound antropico di Adria e la pianura alluvionale
circostante vi un dislivello di circa 2 m
(elaborazione A. NINFO).
6O   6WDUR VUHGLH $GULH QD RUWR
posnetku, prenesenem na DMR. Modra
EDUYDNDHQDMYLMHOHJHQDGPRUVNHYLLQHYLMROLQDEDUYDSDQDMQLMH9LLQVND
razlika med Adrio in okoliko ravnino
]QDDSULEOLQRPHWUDLQMHSRVOHGLFD
ORYHNHJDQDQRVDPDWHULDOD
34

Fig. 34 - LUPA antropica di Jesolo con


tracce di strutture archeologiche desunte da fotointerpretazione (linee rosse).
Sl. 34 - EAP Jesolo.
Fig. 35 - Le UPA antropiche di Altino.
Sl. 35 - EAP Altino z dvema podenotama.

35

se pri Portu Baseleghe spojijo. DanaMID CTMD RN U UDIH LDQH YQ@UM@MD
z okolikim terenom zaradi razvoja
turizma in poljedelstva, ki sta se razcvetela v drugi polovici 20. stoletja.
Prvotna morfologija se je ohranila le
v nekaterih predelih, kjer dune e
UDCMN ONJQHU@ OHMDS@  SDQ U AKHHMH
QDMDF@TRSI@ 

($3
(cn, an, sp, af, pm)
($3$GULD
$MNS@ @MSHMD ONJQ@IHMD $ /
CQHD KDH NA ITMDL M@RHOT RS@QNdavnega grebena iz predzgodovinskega obdobja reke F. Po, pred ze-

meljsko depresijo, na katere drugi


RSQ@MH SDD QDJ@ 3@QS@QN RK    #NKN@ IN ONRDAM@ LNQENKNJ@ RKHJ@ 
ki jo je pokazala analiza digitalnega
LNCDK@S@KRK  "DKNSMNNALNID
RS@QNC@UMDF@ RQDCH@ ID M@LQD U
OQHLDQI@UHYNJNKHJHLMHHMRJHLRUDtom vije za 1-2 m.
5DRKNIM@ M@Q@U@ @QGDNKNJD KNkacije Adrie je dobro poznana in
UJKITTID @QGDNKNJ@ Y@ONQDCI@  JH
RDF@INNCDKDYMDCNADCNRQDCMIDvekega obdobja. Domneva se, da
gre pri tej morfoloki dvignjeni plo@CHUQDRMHBHY@FNLHKN@MSQNONFDne narave, saj naj bi k njenemu nastanku v veliki meri prispevali arheoloki nanosi, podobno kot to velja za
Padovo in Altino.
/NCQNAMNRSHNOQHO@C@INDLUYNQ-

MDL NALNIT RH NFKDISD U TRSQDYMDL


poglavju (infra).
($3-HVROR
$MNS@ @MSHMD ONJQ@IHMD $ /
Jesola sovpada z dananjim arheoKNJHL NALNIDL NJNKH QTDUHM QNmanske bazilike Sv. Marije Velike v
JQ@IT+D,TQ@SDQYNALNIDL@MSHne cerkve Sv. Mavra, 250 metrov severno od bazilike (sl. 34).
"DKNSMN NALNID $ / )DRNKN ID
dvignjeno v primerjavi z okoliko
Q@UMHBN J@SDQDM@IMHI@SNJ@KDH 
metra pod gladino morja, medtem ko
se ostanki bazilike nahajajo na kvoti

 LM@CLNQRJDUHHMD -@IUDI@
viinska razlika v tem delu je torej
kar 2 metra. Podrobnosti o pripada-

57

le evidenze archeologiche osservate


tramite la fotointerpretazione e della presenza di evidenze archeoloFHBGD MNSD HM AHAKHNFQ@@ NINFO et
alii  TIRELLI, CRESCI, MARRO
NETIRELLI et alii 2013). Comprende quindi i terreni alluvionali
depositati dal Brenta durante lLGM.
Solo una piccola porzione interseca
i depositi alluvionali pi recenti del
Sile, lungo la fascia localizzata presso il dosso che si sviluppa lungo latST@KDBNQRNCDKTLD /@QHLDMSHQHB@dono al suo interno I tratti terminali
CDHRHRSDLHTUH@KH9DQN #DRD
Fig. 36 - Le UPA antropiche di Concordia
Sagittaria.
Sl. 36 - EAP Concordia Sagittaria z dvema podenotama.
36

Fig. 37 - Ubicazione delle due aree investigate, Jesolo 1 e Jesolo 2 (linee rosse
tratteggiate), sovrapposte alla carta della unit di paesaggio antico.
Sl. 37 - Lokacije dveh obravnavanih obPRLM-HVRORLQ-HVROR UGHHUWNDQH UWH  SRORHQH QD ]HPOMHYLG (QRWH
DQWLQHSRNUDMLQH
37

58

( RNMC@FFH DDSST@SH HM PTDRS@


zona nellambito del progetto (infra) evidenziano lassenza di sabbia
CHNQHFHMDL@QHM@HMRTODQBHD C@SN
che esclude la possibilit che lalto
morfologico su cui insiste la zona
archeologica di Jesolo si collochi in
corrispondenza di un antico cordone dunoso. Tale ipotesi trova conferma anche nella fotointerpretazione,
dato che nelle immagini analizzate non sono visibili tracce riferibili
allambiente costiero.
Lalto morfologico che caratterizza larea archeologica di Jesolo
sembra quindi essere legato a deONRHYHNMD TUH@KD C@ O@QSD CDK /H@ve, mentre la successiva crescita
UDQNRHLHKLDMSD CNUTS@ @KK@ RSQ@SHcazione di livelli antropici posteriori.

Se si considera la ricostruzione paleoambientale relativa allUPA di S.


Don, la presenza in questarea del
ramo del Piave legato al dosso della
Piave Vecchia (Pv 5a), sembra essere posteriore al I millennio d.C. e, di
conseguenza, probabile che il corso dacqua passante nelle vicinanze
dellantica Jesolo avesse unorigine
diversa. Le successive deviazioni arSHBH@KHCDK/H@UD3@FKHNCDK1DD3@FKHNCDKK@/H@UD-TNU@CDK75((RDBNlo) hanno cancellato completamente
KNQHFHM@KDO@KDNHCQNFQ@@ QHBNMNRBHbile ormai solo attraverso lanalisi
CDKK@B@QSNFQ@@RSNQHB@

83$GL$OWLQR
LUnit di Paesaggio Antico (UPA)
di Altino comprende il vasto e ben
MNSN RHSN OKTQHRSQ@SHB@SN BGD RH 
sviluppato tra let del Bronzo e let
S@QCN@MSHB@F  
LUPA stata suddivisa in due
RNSSNTMHS  0TDKK@ OH HMSDQM@ BNQQHsponde allarea urbana individuata
tramite lanalisi dei dati da telerilevamento (NINFO et aliiMOZZI
et alii  G@ ENQL@ CH TM @LOHN
moundBGDRHDKDU@MN@BHQB@L
sulla circostante pianura. La sottounit pi esterna corrisponde invece
al suburbio e comprende al suo interno le necropoli, i tracciati delle
vie consolari e vicinali che uscivano
dalla citt. I limiti tengono conto del-

5.4. UPA di Concordia Sagittaria


LUnit di Paesaggio Antico (UPA)
di Concordia Sagittaria stata individuata principalmente sulla base
dellanalisi dei dati di scavo (cfr. CRO
CE DA VILLA, DI FILIPPO BALESTRAZ
ZI  DI FILIPPO BALESTRAZZI
/$33$- 5(&.-(2009) e delKNRSTCHNCH@KBTMHRNMC@FFHDDSST@ti allinterno dellarea urbana attuale.
In particolare ha fornito dati rilevanti
il carotaggio CNC4-Teatro eseguito
presso via dei Pozzi romani nellambito del progetto CARG (FONTANA et
alii   +@M@KHRH CDKKD ENSNFQ@D
aeree non ha fornito dati particolarLDMSD RHFMHB@SHUH  HM PT@MSN K@QD@
urbana antica, coincidendo con linsediamento attuale, risulta completamente mascherata dalle strutture
antropiche recenti.
LUPA di Concordia stata sudCHUHR@ HM CTD RNSSNTMHS F   
Lunit pi interna corrisponde allarea urbana individuata dalla pianta
dellantica citt realizzata da Antonio
Bon e pubblicata da Dario Bertolini
nel 1880 nella rivista Notizie degli
Scavi di Antichit (PETTEN, VIGO
NI 2009). Lunit pi esterna corrisponde invece al suburbio ed stata
individuata tramite lanalisi dei dati
archeologici e geologici pregressi e,
solo marginalmente, dai dati forniti
dalla fotointerpretazione.
Larea su cui sorge la citt di ConBNQCH@BNQQHRONMCD@TMSDQQ@YYNTviale largo circa 600 m e lungo poco
pi di 1 km, completamente isolato
dalla pianura circostante da due incisioni successivamente colmate,
entro le quali attualmente scorrono i
TLHCHQHRNQFHU@+DLDMDD1DFGDM@ 
Le due incisioni sono state originate
dal Tagliamento tra il Tardoglaciale
DK.KNBDMDHMHYH@KDCNONK@CHR@SSH

INDL UYNQMDL NALNIT RH NFKDISD


v ustreznem poglavju (infra).
Raziskave, ki smo jih v okviru proIDJS@NOQ@UHKHM@ONCQNITinfra), kaDIN M@ NCRNSMNRS LNQRJDF@ ODRJ@
M@ ONUQHMH  R HLDQ RD HYKN@ LNMNRS  C@ AH LNQENKNJ@ FNLHK@  M@
J@SDQHRDM@G@I@@QGDNKNJNNALNID
Jesola, lahko bila del starega sipinskega grebena. Domnevo potrjujejo
tudi fotografski posnetki, saj njihova
analiza ni pokazala ostankov obalnega geolokega okolja.
*@D SNQDI  C@ ID LNQENKNJ@ FNmila, ki opredeljuje arheoloko obLNID )DRNK@  QDYTKS@S QDMHG M@OK@vin Piave, njena kasneja rast pa je
najverjetneje posledica naknadnih
NRS@MJNUOQHRNSMNRSHKNUDJ@ 
D TONSDU@LN QDJNMRSQTJBHIN
paleo okolja v EAP S. Don, lahko roJ@UQDJD/H@UD JHSDDUSDIDMNSHON
izgonski strugi Stare Piave (Piave VeBBGH@/U@ C@SHQ@LNU SHRNKDSID
naega tetja, kar pomeni, da je bil
vodni tok, ki je oblival obrobje staQDF@ )DRNK@  CQTF@MDF@ HYUNQ@  *@sneje umetne preusmeritve Piave
(Taglio del Re in Taglio della Piave
Nuova v 17. stol.) so v celoti izbrisale
HYUNQMNO@KDNGHCQNFQ@IN JHINK@GJN
danes razberemo samo iz zgodovinskih zemljevidov.
($3$OWLQR
$MNS@@MSHMDONJQ@IHMD$ / KSHM@Y@IDL@NARDMNHMCNAQNONYM@MNUDRKNIMNNALNID JHRDIDSTQ@YUHKN LDC AQNM@RSN HM ONYMN@MSHMN
dobo (sl. 35).
EAP smo razdelili v dve pod-enoti. Notranja sovpada z mestnim tkiUNL  JH RLN F@ CNKNHKH R ONLNIN
analize podatkov daljinskega zaznavanja (NINFO et alii  MOZZI et
aliiFQDY@OQDBDINARDMNFNLHKN JHRDCUHFTIDCNOQHAKHMNL
nad okoliko ravnino. Zunanja pod-enota pa sovpada z obrobjem mesta in vsebuje ostanke konzularnih
in lokalnih cest, ki so vodile iz meRS@  /QH CNKNDU@MIT LDI@ RLN TONSDU@KH@QGDNKNJ@OQHDU@MI@ JHRLN
IHG@M@KHYHQ@KHRONLNINENSNFQ@ERJHG
posnetkov, ter tista, ki se navajajo v
literaturi (NINFO et aliiTIREL
LI, CRESCI, MARRONE  TIRELLI
et alii 2013). Vsebuje torej poplavM@ONCQNI@ M@J@SDQ@IDQDJ@!QDMS@
med ledeno dobo odlagala svoje nanose. Samo na zelo majhnem predeKTNAUYMNITM@RHO@C@M@MIDQDJD


Sile) se slednji umaknejo njenim


mlajim nanosom. Enota zajema tudi
Y@JKITMD NCRDJD QDMHG RHRSDLNU
Zero - Dese.
($3&RQFRUGLH6DJLWWDULH
,DID DMNSD @MSHMD ONJQ@IHMD
(EAP) Concordie Sagittarie smo doKNHKH OQDSDMN M@ ONCK@FH @M@KHYD
podatkov izkopa (cfr. CROCE DA VIL
LA, DI FILIPPO BALESTRAZZI 
DI FILIPPO BALESTRAZZI 
PETTEN, VIGONI 2009) in tudije
nekaterih sondiranj, opravljenih na
NALNITRDC@MIDF@LDRSMDF@IDCQ@ 
Zlasti pomembni so bili podatki vrtine CNC4 - Teatro, opravljene v ulici
Pozzi romani v okviru projekta CARG
(FONTANA et alii  M@KHY@YQ@nih posnetkov ni dala relevantnih
podatkov, saj je staro mestno tkivo,
ki sovpada z dananjo naselbino, v
BDKNSHRJQHSNONCMNUDIHLH@MSQNOHnimi strukturami.
EAP Concordie smo razdelili v
dve pod-enoti (sl. 36). Notranja sovpada z mestnim tkivom, ki smo ga
CNKNHKH M@ NRMNUH YDLKIDUHC@ @MSHnega mesta, ki ga je izdelal Antonio
Bon, objavil pa Dario Bertolini leta
1880 v reviji Notizie degli Scavi di
Antichit (1RYLFH L] DQWLQLK QDMGL)
(PETTEN, VIGONI 2009). Zunanja
pod-enota pa sovpada z primestjem
HMRLNINCNKNHKHM@ONCK@FH@M@KHYD
NARSNIDHG @QGDNKNJHG HM FDNKNJHG
podatkov, le delno pa na podlagi fotografskega materiala.
.ALNID M@J@SDQDLRDIDQ@YUHKN LDRSN "NMBNQCH@  RNUO@C@ Y QDMN SDQ@RN HQHMD OQHAKHMN  L HM
CNKHMD L@KN UD JNS  JL  3DQ@R@
je zaradi dveh kasneje napolnjenih
JNQHS ONJ@SDQHGC@MDRSDDS@JQ@JH
reki Lemene in Reghena, v celoti loDM@NCNJNKHJDQ@UMHMD .ADJNQHSH
je izdolbel Tilment v obdobju med
JNMBDL KDCDMD CNAD HM Y@DSJNL
GNKNBDM@ ON OQDMDG@MIT CDKNU@MI@
QDJD RD ID U MNSQ@MINRSH CNKHM M@IOQDIQ@YUHKNLNUHQID J@RMDIDO@K@gunski geoloki habitat. Po nastanku
K@FTMD "@NQK@ OQDC OQHAKHMN 
KDSH ID M@LQD AQ@JHM@ UNC@ OQDAHK@M@Q@UMDNUHQDHMURSNOHK@UMHHMN
SDQ RD Y@DK@ M@AHQ@SH U NOTDMHG
koritih Tilmenta. Tako je prilo do
M@RS@MJ@ CUDG K@FTMRJHG JQ@JNU 
ki sta postopoma napredovala vse
CN /NQSNFQT@Q@  NAJQNHK@ NALNID
Concordie in jo spremenila v otok.
9MNSQ@I RS@QHG CNKHM ID K@FTMRJN

okolje prevladovalo do prve poloviBDOQUDF@SHRNKDSI@OQ M S J@RMDID


pa ga je nadomestilo sladkovodno
LNJQHD  -@ Y@DSJT DKDYMD CNAD
je bila viinska razlika med obmoIDL M@J@SDQDLIDYQ@RK@OQDCYFNdovinska naselbina, in okolikim ravninskim svetom e vedno okoli 4-7
m, v rimskem obdobju pa je verjetno znaala 3-5 m (FONTANA 2006).
,NQENKNJ@ONCNA@ONCQNI@RDIDU
obdobju med 6. in 9. stol. korenito
ROQDLDMHK@ Y@Q@CH ONM@UKI@INHG RD
ONOK@UKI@MI /NUYQN@KIHGID@JSHUHQ@MHQNJ@U3HKLDMS@ JHID Y@DMHU2@M
Vitu, potekal po dananji strugi reke
Lemene (FONTANA   
Poplave so s seboj prinesle znatne
JNKHHMDM@MNRNU JHRNMHYUNCMNNC
/NQSNFQT@Q@CNJNMMNM@ONKMHKHRS@QNC@UMD NRS@MJD QDMHG JNQHS HM OQH
tem skoraj popolnoma prekrili tudi
ostanke na nekoliko dvignjenih preCDKHG RSNIDDF@ QHLRJDF@ LDRS@ RK 
 9@Q@CHSDGCHM@LHJRNODDMHHM
HKNUM@SNODDMHM@MNRHUMHIHGOQDdelih (na primer nad baziliko, grobnico in v kraju Paludetto) debeli tudi
do 3-5 m, sloji, pod katerimi je pokopano staro mestno jedro (gledaliD HM ENQTL  O@ U CDADKHMN QDCJN
CNRDDINLFONTANA et alii
MIOLA et aliiFONTANA 2006).

3
/NCQNAM@ONCQNI@ M@J@SDQHGRN
se opravili postopki raziskave tal, v
ONUOQDIT LDQHIN MDJ@I JU@CQ@SMHG
JHKNLDSQNU (YAQ@M@RNAHK@JNSUYNQna pokrajina, saj lahko predstavijo
razmerje med zgodovinskimi in kulturnimi posebnostmi ter okoljem,
J@SDQDF@@MSHMNRSQTJSTQNIDLNFND NGQ@MHSH  NAMNUHSH HM @JST@KHYHQ@SH
(gl. supra, uvod).
Raziskave na terenu so se opraUHKDU@RTNCNJSNAQ@CNCDBDLAQ@
 #DK@RS@HRSN@RMNHYU@I@KHCUD
raziskovalni ekipi arheologov in geomorfologov z Univerze Ca Foscari
v Benetkah ter Univerze v Padovi.
Vseh enot EAP, opisanih v prejnjem
ONFK@UIT HYQ@YKHMHGQ@YKNFNUMHAHKN
LNFND UJKITHSH U Q@YHRJ@UD @QGDNKNJ@ MDQ@YONYM@UMNRS CNKNDMHG
predelov (sezona kmetijskih kultur,
JH RN NMDLNFN@KD OQDFKDC ONKI 
nedostopnost nekaterih predelov,
nenazadnje pa dejstvo, da smo se v
teku raziskave v dogovoru z njenimi

ONATCMHJHNCKNHKH C@RDANLNNRQDCNSNHKHKDM@MDJ@SDQDNAQ@UM@U@MD
predele.
Vodilo raziskav podrobnih podroHIIDAHKNCNKNHSHNCMNRLDC@MSHnim okoljem in naselbino v njem ter
oceniti ohranjenost arheolokih depozitov. Nao pozornost smo e posebej namenili nekaterim ciljem:
 Q@YHRJ@SH HM CNKNHSH FK@UMD RLDQH
HQIDMI@ M@RDKAHMD U Q@YKHMHG YFNCNUHMRJHG NACNAIHG M@ UYNQMHG
NALNIHG
 CNKNHSH FKNAHMN O@KDN ONUQI@ Y
ostalinami tudi na mestih, ki se jih
noveji izkopi e niso dotaknili, in
ugotoviti stanje potencialne ohranjenosti arheolokih depozitov,
CNKNHSHFDNKNJDK@RSMNRSHRTARSQ@ta obalnega in lagunskega obmoI@
 CNKNHSH LQDN BDRSMHG HM UNCMHG
poti, v katero je bila naselbina orF@MRJN USJ@M@ NC JK@RHMDF@ HM
srednjevekega obdobja dalje, s
poudarkom na tistih vodnih poteh,
ki se zdijo primerne za tudijo na
podlagi podatkov daljinskega zaznavanja in starejih najdb.
6.1. Jesolo (sp, sc, cn, ta, af, pm)
5)DRNKTRLNHYAQ@KHCUDUYNQMH
NALNIH OQUNRDUDQMNNCTQA@MDF@
M@RDKI@  CQTFN O@ ITMN NC J@M@K@
(glej sl. 37).
9MNSQ@I NALNI@  HLDMNU@MDF@
enota Jesolo 1, se nahaja sedanje arGDNKNJNNALNID)DRNK@ JHRDNRQDCNSN@M@OQDCDKNJNKHNRS@MJNUA@YHKHJDUJQ@IT+D,TQ@ /QHAKHMN
m severno od ruevin se nahajajo
ostanki srednjevekega samostana
Sv. Maura z dokazi o sistemu kanalov, ki so verjetno povezovali lokacijo z obalo.
-@ NALNIT )DRNKN   ITMN NC
Canala Cavetta, je so znani podatki o
obstoju stare struge vodotoka Fossa
5DBBGH@  JH RD M@ YQ@MHG ONRMDSJHG
J@D JNS S@MJ@ LD@MCQHM@ RKDC  -@
OQNTDU@MDL NALNIT SUNQH MDJ@I
okljukov (meandrov), za katere se
zdi, da potekajo po vrhu ostankov
sipinskih kordonov (BONDESAN, MENEGHEL 2004). Ob enem teh meandrov se je nahajal srednjeveki samostan San Giorgio in Pineto. Nizi sipin v okolici stare struge so del kompleksnega obalnega sistema, ki se je
Q@YUHKUQ@YKHMHGE@Y@GM@OQDCNU@MI@
in nazadovanja obalne linije med 6.
HM   SHRNKDSIDL OQ  M  S  !.-#$-

59

U@YHNMD CDK TLD  @KKHMSDQMN CDKKD


due valli si instaur prima un ambiente palustre e successivamente
un ambiente lagunare. Infatti, a seguito della formazione della laguna
di Caorle avvenuta circa 7000 anni
fa, le acque salmastre penetrarono
nellinterno della pianura insinuandosi entro le incisioni abbandonate dal Tagliamento. Si crearono in
questo modo due bracci lagunaQH BGD FHTMRDQN MN @ /NQSNFQT@QN 
lambendo larea di Concordia e trasformandola in unisola. Allinterno
delle antiche incisioni la presenza
della laguna attorno al sito archeoKNFHBNETOQDCNLHM@MSDMN@KK@OQHma parte del I millennio a.C., mentre
venne sostituita successivamente
da un ambiente di palude dacqua
dolce. Allinizio dellet del Ferro, il
dislivello tra larea su cui sorgeva labitato protostorico e le bassure era
ancora di circa 4-7 m, mentre in epoca romana doveva raggiungere i 3-5
m (FONTANA 2006. Laspetto morfologico dellarea sub un notevole
B@LAH@LDMSN SQ@ HK 5( D HK (7 RDBNKN
C "  PT@MCN RH UDQHB TM@ RDQHD CH
alluvioni dovute allattivazione di
un ramo del Tagliamento che da San
Vito segu il percorso dellattuale Lemene (FONTANA    0TDsti eventi causarono la deposizione
di uningente quantit di sedimenti
che, a valle di Portogruaro, riempiroMNCDMHSHU@LDMSDKD@MSHBGDU@KKHD
si deposero anche allesterno delle
bassure, coprendo cos quasi interamente anche i resti della citt romana che si trovavano nelle zone pi
QHKDU@SD F    #H BNMRDFTDMY@ KD
sabbie e le sabbie limose di et alto
medievale hanno uno spessore di
circa 3-5 m in corrispondenza delle
bassure (ad esempio sopra la basilica, sul Sepolcreto e in localit Paludetto), mentre sopra lantico centro
della citt (zona del teatro e del foro)
in genere mancano o non superano
1 m (FONTANA et aliiMIOLA et
aliiFONTANA 2006).

to alla situazione ambientale, in cui


il palinsesto antico possa essere preservato, ricomposto e attualizzato (v.
supra, introduzione).
Le ricerche sul campo sono state
compiute nel periodo compreso tra
K@MDCHNSSNAQDDHKLDRDCHCHBDLbre 2011, congiuntamente tra i due
gruppi di ricerca, archeologi e geomorfologi delle Universit Ca Foscari e di Padova. Per diversi motivi
non stato possibile coprire tutte le
UPA di cui ai precedenti capitoli: per
LNSHUHKDF@SH@KK@UHRHAHKHS@QBGDNKNgica delle aree (colture in atto che
non permettevano la visione delle
RTODQBHCDHB@LOH ODQLNSHUHKDF@ti allaccessibilit alle medesime ed
HMMDODQHKE@SSNBGDMDKBNQRNCDKK@
ricerca si deciso di focalizzare gli
sforzi su alcuni comparti in particolare, in accordo con i promotori della
ricerca.
Nelle aree di dettaglio le ricerche
RNMNRS@SDFTHC@SDC@KMDCHCDSDQminare il rapporto tra ambiente antico e insediamento, nonch lo stato
di conservazione dei depositi archeologici. Alcuni obiettivi in particolare
erano al centro del nostro interesse:
 HMCHUHCT@QD KD CHQDSSQHBH CH DRO@Msione dellinsediamento nelle varie epoche su alcune zone campionate mediante survey,
RS@AHKHQDK@OQNENMCHSCDKKDO@KDNRTODQBH CH EQDPTDMS@YHNMD @MBGD
nelle zone non toccate dai recenti
scavi, e di conseguenza lo stato ed
il grado di conservazione potenziale dei depositi archeologici,
CDSDQLHM@QDKDB@Q@SSDQHRSHBGDFDNlogiche del substrato in riferimento allarea costiera e lagunare,
 HMCHUHCT@QD K@ QDSD HSHMDQ@QH@ MDKK@
quale linsediamento appare organicamente inserito dallet classica e medievale, con particolare
riferimento a quelle vie dacqua
che sembrano indiziate sia dal telerilevamento, sia da vecchi rinvenimenti.
6.1. Jesolo (sp, sc, cn, ta, af, pm)

/

60

Le aree di dettaglio in cui sono


stati eseguiti dei rilievi a terra hanno dimensioni medie di alcuni km2.
Sono state scelte come paesaggi campione in grado di rappresentare
RODBHBHSRSNQHBNBTKSTQ@KHHMQ@OONQ-

Presso Jesolo sono state oggetto


di rilevamento due aree, una posta
a nord del centro abitato, una a sud
CDK"@M@KD"@UDSS@F 
Larea denominata Jesolo 1 contiene al suo interno lattuale zona
archeologica di Jesolo, incentrata
attorno alle rovine delle basiliche
nella localit Le Mura. Circa 250 m

a nord delle rovine si trovano i resti del monastero medievale di San


Mauro, presso il quale documentata la presenza di un sistema di canalizzazioni verosimilmente comunicante con la costa.
Nellarea Jesolo 2, a sud del Canale Cavetta, nota lesistenza del
paleoalveo della Fossa Vecchia, che
nelle immagini aeree appare come
una sottile traccia meandriforme.
Nel sito in esame descrive alcuni
meandri, tagliati dal Canale Cavetta, i quali sembrano sovrapporsi alle
tracce dei cordoni dunali (BONDE
SAN, MENEGHEL 2004). Presso uno
di tali meandri si trovava il monastero medievale di San Giorgio in
Pineto. I cordoni dunali presenti nei
dintorni del paleoalveo fanno parte
di un complesso costiero sviluppatosi con vari episodi di avanzamento
e arretramento della linea costa fra
il VI e il I millennio a.C. (BONDESAN,
MENEGHEL 2004). Il monastero medievale si trovava dunque in posizione prossima alla costa, al riparo di
cordoni di dune preesistenti e servito dal canale della Fossa Vecchia.
Il censimento del noto
Il censimento del noto evidenzia diversi rinvenimenti sporadici
(ubicati per lo pi presso localit Le
Mura e nellarea compresa tra le valli
e la costa), pochi resti in alzato e pochi dati ricavati da indagini archeologiche.
I rinvenimenti sporadici sono leF@SHODQKNOH@CDOHFQ@ @KBTMDCH
notevoli dimensioni, rinvenute tra il
7(7 D K@ LDS CDK 77 RDBNKN D BNMservate in gran parte presso il Museo Archeologico Nazionale di AltiMN  0TDRSH QHMUDMHLDMSH G@MMN RNKlevato, nel corso degli anni, diverse
perplessit circa lorigine romana di
Jesolo, la sua funzione e il grado di
importanza allinterno dei territori
imperiali. Una questione ancora dibattuta e non risolta. Una sintesi sui
materiali lapidei stata elaborata, in
anni recenti, da ELLERO (2008).
Le testimonianze ancora visibili
in alzato sono costituite da due ediBHK@SNQQDCH"@KHFN TAHB@S@KTMFN
il percorso della Piave Vecchia, oggi
occupato dal Sile e sicuramente in
funzione nel Tardo Medioevo, e la
"@SSDCQ@KDCH7(RDBNKN 0TDRSTKSHL@
stata indagata a pi riprese nella
RDBNMC@LDSCDK77RDBNKN

La prima campagna di pulizia e


RB@UN  RS@S@ DDSST@S@ C@KK4MHUDQsit di Basilea nel 1954, lo stesso
anno in cui il Longo, funzionario della Soprintendenza alle Antichit per
le Venezie, coordina lo scavo del Monastero altomedievale di S. Mauro, a
poche centinaia di metri dalla Cattedrale. Nel corso degli anni 60 prima
e degli anni 80 poi, si susseguono
KD HMC@FHMH CH 3NLANK@MH  @@MB@SN
C@KK@ 2B@QE  @KKHMSDQMN CDKKDCHBHN
religioso: sono state rinvenute in sequenza una basilica di VI-VII secolo
dotata di pavimentazione musiva a
decorazione geometrica (TOMBOLA
NI 1985, CUSCITO, SARTORI 2007) e
una auletta di V secolo. Lindagine di
questultima struttura, insieme alla
necropoli che la circondava stata
ultimata negli anni 90 dalla Croce
da Villa (CROCE DA VILLA 2006).
Diversi studiosi, nel corso degli
ultimi decenni, si sono interessati allo studio del territorio jesolano (#.1(&.  &4(.33. 
".-3.-234#().
Telerilevamento
(M F   KD CTD @QDD NFFDSSN CH
studio sono state sovrapposte alla
carta delle Unit di Paesaggio Antico.
Si osserva che la prima area (Jesolo
1) ricade allinterno di una zona clasRHB@S@BNLD QD@O@KTRSQDBNRSHDQ@
ANMHB@S@"@ 4/ CH"@NQKD LDMtre la seconda area (Jesolo 2) ricade quasi completamente allinterno
dellarea costiera (Co 9a).
+@ ENSNHMSDQOQDS@YHNMD F  
relativa alle tracce di tipo naturale ha
evidenziato la presenza di una serie
di canali lagunari-palustri allintorno
dellarea Jesolo 1 e di un paleoalveo.
Lanalisi delle varie immagini allinterno di questarea ha evidenziato la
presenza di tracce di tipo antropico
particolarmente evidenti solo in corrispondenza della localit Le Mura.
Nella seconda area, invece, sono
predominanti le tracce relative alla
presenza di cordoni dunali attualLDMSD BNLOKDS@LDMSD ROH@M@SH  
inoltre ben visibile la traccia del paleoalveo dellantica Fossa Vecchia, a
DRSCDKK@QD@F  (MSTSS@K@QD@
Jesolo 2, e nelle immediate vicinanze, stata rilevata la presenza di numerose lineazioni di tipo antropico,
interpretate come possibili antiche
RTCCHUHRHNMH@FQ@QHDF  
In prossimit del paleoalveo del

SAN, MENEGHEL 2004). Srednjeveki samostan je torej stal blizu obale,


U Y@UDSIT OQDCNARSNIDHG RHOHMRJHG
kordonov in tik ob kanalu Fossa Fossa Vecchia.
Popis poznanega
Popis poznanega je podal podatJDNNARSNITQ@YKHMHG @QDCJHGM@ICA
(predvsem v okolici zaselka Le Mura
HMM@NALNITLDCONUQHMRJHLHCDpresijami in obalo), redkih najdb na
povrju in redkih podatkov, zbranih
med arheolokimi raziskavami.
.A@RMD M@ICAD UJKITTIDIN
OQDCURDL DOHFQ@ED MDJ@SDQH LDC
njimi so precej veliki. Odkrili so jih v
 HMOQUHONKNUHBH RSNK UDHMNma pa so shranjeni v Narodnem arheolokem muzeju v Altinu. Te najdbe so v preteklih letih odprle tevilna vpraanja o rimskem izvoru Jesola, o njegovi funkciji in o pomenu
znotraj cesarskih ozemelj. Vpraanja
so e vedno predmet diskusij in niso
nala odgovorov. Povzetek analize
nagrobnih kamnov je v zadnjih letih
pripravil ELLERO (2008).
DUDCMNUHCM@OQHDU@MI@M@ONvrju se nanaajo na dve poslopji:
stolp v Caligu, ki se nahaja ob struFH2S@QD/H@UD JIDQC@MDRSDD2HKDHM
ki z gotovostjo izvira iz poznega srednjega veka, ter katedrala iz 11. stol.,
JHRNINUCQTFHONKNUHBH RSNK UDkrat raziskali.
/QU@CDK@HDMI@M@ICH@HMHYkopa je opravila ekipa Univerze iz
Basla (vica) leta 1954. Istega leta je
Longo, nadzornik Uprave za starine v
Benetkah, koordiniral izkop zgodnjesrednjevekega samostana S. Maura nekaj sto metrov od katedrale. V
estdesetih, nato pa e v osemdesetih letih prejnjega stoletja sta notraMINRS UDQRJDF@ NAIDJS@ UDJQ@S Q@YHRJ@K@3NLANK@MHHM2B@QNASDIOQHKNMNRSHRS@DMNY@CQTFNM@K@A@YHliko iz 6.-7. stol. s talnim mozaikom
z geometrijskimi vzorci (TOMBOLANI
1985, CUSCITO, SARTORI 2007) in
majhno dvorano iz 5. stol. Raziskavo
SDY@CMID UJKITMNYMDJQNONKN JHIN
IDNAJQN@K@ IDUCDUDSCDRDSHGKDSHG
prejnjega stoletja opravil Croce da
Villa (CROCE DA VILLA 2006).
V zadnjih desetletljih so ozemlje
Jesola raziskovali tevilni strokovnjaki arheologi (DORIGOGUIOTTO
CONTONSTUDI 1985).

Fig. 38 - Tracce desunte dallanalisi di


immagini telerilevate nei pressi di Jesolo.
Le linee rosse tratteggiate corrispondono
al limite delle aree investigate sul terreQRULSRUWDWHLQJ/HWUDFFHFRQWUDGdistinte dai toni marroni si riferiscono
DLFRPSOHVVLGXQDOLFRVWLHULLSDOHRDOYHL
XYLDOLVRQRHYLGHQ]LDWLLQURVVRFKLDUR
in viola quelli lagunari-palustri. Le linee
EOXFRUULVSRQGRQRDLXPLDWWXDOLOHOLnee rosse a strutture antropiche sepolte.
Sl. 38 - Sledi naravnega izvora, odkrite z analizo daljinsko zaznavanih slik v
RNROLFL-HVROD5GHHUWNDQHUWHXVWUHzajo mejam EAP, prikazanim na sl. 37. Z
UMDYR EDUYR VR R]QDHQH VOHGL REDOQLK
VLSLQVNLK VLVWHPRY ] UGHR LQ RUDQQR
so poudarjene nekdanje struge rek, z
YLMROLQR SD VOHGL ODJXQPRYLULM 0RGUH UWH SUHGVWDYOMDMR VHGDQMH NDQDOH LQ
UHNHPHGWHPNRREPRMD]PRGURPUHRXVWUH]DMRUHQLPJUHEHQRP
38

Fig. 39 - Particolare di una foto aerea


del 1945 (RAF - Royal Air Force) relativa
allarea di Jesolo 2 (tratteggio rosso). La
traccia rossa a est dellarea sembra corrispondere allantico alveo della Fossa
Vecchia. Nellimmagine compaiono con
EXRQD HYLGHQ]D OH WUDFFH LGHQWLFDWH
come antiche suddivisioni agrarie.
6O   3RGUREQRVW ]UDQHJD SRVQHWka iz leta 1945 (RAF - Royal Air Force)
REPRMD-HVROR UGHHUWNDQR 5GHD VOHG Y]KRGQR RG REPRMD XVWUH]D
nekdanji trasi jarka Fossa Vecchia. Na
VOLNL VR ]HOR UD]ORQR YLGQH VOHGL NL VR
opredeljene kot stare razmejitve kmetijVNLK]HPOML
Fig. 40 - Ubicazione dei sondaggi realizzati nel sito Le Mura - area Jesolo 1 (A) e
nel sito di osservazione JES1 poco a est
dellarea Jesolo 2 (B), corrispondente al
carotaggio manuale e alla sezione descritta lungo la parete della scolina (cfr.
JJ 

39

Sl. 40 - Lokacija opazovalnega mesta


-(6NLXVWUH]DURQHPXMHPDQMXY]RUFHY LQ RSLVDQHPX SUHUH]X Y]GRO VWHQH
odvodnega jarka (prim. sl. 41, 42, 43).

40

61

41

la Fossa Vecchia viene ubicato il monastero medievale di San Giorgio in


Pineto, e non sembra azzardato ipotizzare che tali tracce possano essere collegate al suo sistema di sfruttamento economico del territorio.
Rilevamento geologico
Jesolo1

62

Nel corso del rilevamento geologico si cercato di caratterizzare


il sottosuolo nei pressi del sito archeologico noto (localit Le Mura),
di individuare presso il monastero
di S. Mauro la posizione del canale
maggiore e di analizzarne il materiale sedimentario e antropico di riempimento (ubicazione dei sondaggi in
F  -DHOQDRRHCDKRHSNCDKKDA@RHliche stato eseguito un carotaggio
(JES2) profondo 4,8 m. I livelli archeologici sono localizzati entro 1,4 m
di profondit. Fino ad 1 m di profondit i reperti sono particolarmente
concentrati e sono immersi in una

L@SQHBD KHLNR@ EQ@ BHQB@  L D  


L RH SQNU@ TM KHUDKKN CH R@AAH@ MD
con reperti archeologici (frammenti
di vetro, carboni) rari e abbondanti
frammenti di conchiglie (riconosciuto un Cerastoderma).
Fra 1,4 e 2,45 m vi sono sabbie
MHRSDQHKHCHOQNA@AHKDNQHFHMDTUH@le. Le sabbie hanno un limite inferiore netto e poggiano su una succesRHNMDCHKHLHK@FTM@QHOQDRDMSDMN@
fondo foro, interrotta da un livello di
R@AAH@LNKSNMDEQ@ D LD
da uno strato di torba fra 4,60 e 4,75
m. Nei limi lagunari sono presenti
frequenti livelli con resti vegetali,
spesso canne palustri in posizione
di vita, e molluschi (Loripes lacteus,
Lentidium, Cerastoderma, Venus), alcuni con valve chiuse.
Nei dintorni del monastero di
San Mauro sono state eseguite alcune trivellate esplorative nella posizione in cui scavi precedenti avevano localizzato i canali che circondaU@MNKDCHBHN #TDRNMC@FFHG@MMN

raggiunto quasi 3 m di profondit, un


terzo si arrestato a 95 cm in corrispondenza di un livello ricchissimo
di laterizi, probabilmente un piano
strutturale (tale livello ha restituito
anche un frammento di ceramica di
probabile et tardoantica).
A sud est delle rovine, in corrispondenza della traccia di un canale secondario (sondaggio JES3), lo
spessore dei materiali di riporto di
 L 0TDRSHTKSHLHRNMNBNRSHSTHSH
da limi sabbiosi e sabbie sciolte steQHKHMN@ LDC@KHLN@QFHKKNRN
con frammenti di carbone e grumi
di calce da 1,05 a 1,95 metri. Sotto
iniziano i limi lagunari, come rilevato
in JES2. Il supposto canale sembra
essere stato interrato dalluomo con
lapporto di macerie e di sedimenti
riportati dai dintorni.
A sud ovest delle rovine stato
intercettato il canale maggiore, che
B@Q@SSDQHYY@SNC@TM@RSQ@SHFQ@@OH
complessa cos schematizzabile:
 LCHOQNENMCHSQHDLOHLDMSNQDsiduale limoso organico contenente
@AANMC@MSHK@SDQHYHDFQTLHCHB@KBD
     L KHLN @QFHKKNRN CH BNKNQD
scuro, screziato, contenente abbonC@MSH K@SDQHYH  BNM KHUDKKH MDLDMSD
laminati alla base e limite inferiore
LNKSNMDSSN
     L KHLN @QFHKKNRN FQHFHN 
screziato, privo di reperti e con frammenti di conchiglie (un frammento
di Unio
     L ENMCN RNMC@FFHN R@AAH@MHRRHL@BNM@AANMC@MSHBHNSSNKH
centimetrici, frammenti di laterizi e
gasteropodi.
Lalternanza di livelli sterili, alcuni con strutture sedimentarie e
BNMBGHFKHDTUH@KHUnio), e di livelli
ricchi di reperti, lascia dedurre che
il canale, dopo aver esaurito la sua
funzione, sia stato utilizzato inizialmente come discarica di materiale,
MN@KBNLOKDSN@AA@MCNMN BGDMD
ha comportato limpaludamento.
Jesolo 2
In questarea si cercato di caratterizzare il paleoalveo gi individuato con telerilevamento, determiM@MCNMD KD CHLDMRHNMH DDSSHUD D
descrivendone i rapporti geometrici con i depositi costieri. Si avuta
lopportunit di osservare nel dettaglio una scolina da poco rifatta e
orientata secondo una sezione obliPT@RTKO@KDN@KUDNFF   

La sezione collocata in prossimit del punto di massima curvatura di un meandro con lansa rivolta a
sud. Nella sezione esaminata molto
evidente la sponda erosiva del punto di botta situata nella parte esterna (meridionale) del meandro, nella
posizione dove massima lazione
DQNRHU@CDKTLD +@RTODQBHDDQNsiva si sviluppa a spese delle sabbie
costiere e su di essa si appoggiano
i depositi limoso-argillosi che hanno
riempito la depressione dellalveo
dopo il suo abbandono. Sulla sponda opposta (settentrionale) altrettanto evidente la struttura della barra di meandro, caratterizzata da straSHB@YHNMH TMHENQLDLDMSD HMBKHM@SD
verso il centro del canale con angoli
apparenti misurati sulla sponda della scolina di 15-20. I sedimenti sono
@ FQ@M@ HMRNKHS@LDMSD MD  BNRSHSTHti da limi argillosi con intercalazioni
sabbiose. In alcune immagini satelKHS@QHRTKK@RTODQBHDCDHB@LOH@CH@centi sono riconoscibili le scroll bars
concentriche alla curvatura del meandro. In corrispondenza della barra
di meandro massima lattivit sediLDMS@QH@CDKTLD ODQS@MSNK@RONMda di questo lato (settentrionale, nel
caso in esame) poco evidente, non
DRRDMCN TM@ MDSS@ RTODQBHD DQNRHU@ L@TM@RTODQBHDCDONRHYHNM@KD
in corrispondenza della quale si osserva un limitato contrasto litologico
fra i corpi sedimentari. Ipotizzando
di posizionare la sponda dove non
RNMN OH DUHCDMSH KD RSQ@SHB@YHNni inclinate della barra di meandro,
lampiezza del canale misurata lungo
la scolina risulterebbe di circa 18 m.
Un sondaggio (JES1) eseguito al
centro del paleoalveo ha permesso
CHB@Q@SSDQHYY@QDK@RDQHDRSQ@SHFQ@B@
BNQQHRONMCDMSD@KKDE@RHM@KHCDKK@Stivit del canale e al suo abbandoMN RBDMCDMCNMN@ LC@KK@RTODQBHDSNONFQ@B@ +@RSQ@SHFQ@@RH
pu cos sintetizzare:
@KK@A@RD EQ@ D LRHQHRBNMSQ@
TMKHUDKKNKHLNRNLNKSNLNKKD
EQ@ D LRHNRRDQU@MNR@AAHD
MHDLDCHNMHCDANKLDMSDKHLNRD 
contenenti alcuni clasti limosi alla
base e alcuni livelli ricchi di bivalvi
lagunari (fra i generi riconosciuti vi
sono Loripes, Donax, Lentidium
EQ@ LDK@RTODQBHDSNONFQ@B@ RH NRRDQU@MN H RDCHLDMSH MH CDK
riempimento residuale successivi
allabbandono dellalveo. Fra 2,2 e

Daljinsko zaznavanje
Na sliki 37 sta obe obravnavani
NALNIHONKNDMHDYYDLKIDUHC$MNS
@MSHMDONJQ@IHMD .O@YHLNK@GJN C@
OQUN NALNID )DRNKN  RNUO@CD R
OQDCDKNL NYM@DMHLJNS,DKHNQHQ@MNLNUHQRJN NA@KMNONCQNID"@ 
$ / "@NQKD  CQTFN NALNID )DRNKN
2) pa je skoraj v celoti znotraj obalnega pasu (Co 9a).
Analiza sledi naravnega izvora
na fotografskih posnetkih (sl. 38) je
pokazala obstoj sistema lagunskih LNUHQM@SHG J@M@KNU NJNKH NALNI@)DRNKNSDQNRS@MJ@RS@QDQDMD
RSQTFD  M@KHY@Q@YKHMHGONRMDSJNUR
SDF@ONCQNI@IDONJ@Y@K@OQHRNSMNRS
Q@YONYM@UMHG@MSQNOHMHGRKDCHR@LN
na lokaciji Le Mura.
-@ CQTFDL NALNIT OQDUK@CTjejo sledovi starih kordonov dun, ki
RNC@MDRUBDKNSHYQ@UM@MHYNJNKHBN
poleg njih je dobro vidna sled prvotne struge nekdanje Fosse Vecchie v
UYGNCMDL CDKT NALNI@  RK   
-@BDKNSMDLNALNIT)DRNKNHMU
njegovi neposredni okolici so se zaYM@KDSDUHKMDQ@UMDQSD@MSQNOHMD
narave, ki se razlagajo kot morebiSMD @MSHMD Q@YLDIHSUD JLDSHIRJHG
povrin (sl. 39). Ob stari strugi Fosse
Vecchie se nahaja srednjeveki samostan San Giorgio in Pineto, in ni
HYJKITDMN  C@ RN RKDCNUH Q@YLDIHSDU
CDK OQHO@C@INDF@ RHRSDL@ FNRONC@QRJDF@HYJNQH@MI@NYDLKI@

ig. 41 - Operazioni di pulitura della


sponda di una scolina in corrisponden]DGHOVRQGDJJLR-(6 XELFD]LRQHLQJ
% YLVLELOHLOULHPSLPHQWRRUJDQLFR
del paleoalveo della Fossa Vecchia.
6OLHQMHRGYRGQHJDMDUND ORNDcija na sl. 40), v katerem je vidno polnjenje stare struge jarka Fossa vecchia s
organskim materialom.
)LJ   'HWWDJOLR GHOOD VWUDWLFD]LRQH
inclinata della barra di meandro visibile
QHOOLPPDJLQHVDWHOOLWDUHGLJSUHVso JES1.
6O   3RGUREQRVW SRHYQH VWUDWLNDcije meandrske sipine, vidna na satelitskem posnetku na sl. 43.
Fig. 43 - Meandro relitto del Piave attualmente seguito dalla Fossa Vecchia
in unimmagine satellitare del 2004 di
*RRJOH(DUWKLQGLFDWDOXELFD]LRQHGHO
VRQGDJJLR-(6 FIUJ% 

42

Sl. 43 - Meander jarka Fossa Vecchia


na satelitskem posnetku GoogleEarth s
kontrastnimi odtenki, z lokacijo prereza.

43

Geoloke izmere
Jesolo1
V teku geolokih izmer smo poskuali opredeliti sestavo podzemnih slojev v okolici poznanega
@QGDNKNJDF@ NALNI@ KNJ@BHI@ +D
,TQ@  CNKNHSH ONKN@I M@IUDIDF@
kanala ob samostanu S. Mauro in
@M@KHYHQ@SH RDCHLDMSMH HM @MSQNOHMH
material, s katerim je bil kanal v preteklosti zapolnjen (sl. 40 za lokacijo
RNMCHQ@MI  5 AKHHMH M@ICH@ A@YHKHJ
smo opravili vrtino (JES2) globine
4,8 m. Arheoloke nivoje smo nali v
slojih do 1,4 m globoko. Do 1 m globine je arheolokih ostankov precej
HMRDM@G@I@INULTKITUFKNAHMHNC
OQHAKHMNLCN LRDM@G@I@RKNI
MDF@ODRJ@YQDCJHLH@QGDNKNJHLH
EQ@FLDMSHJNJHRSDJK@ NFKIDHMUDKHJNJNKHHMNYCQNAKIDMHGJNKIJOQDpoznan primerek Cerastoderme).
2KNILDC HM LIDHYMDF@
RSDQHKMDF@ ODRJ@  UDQIDSMN QDMDF@


izvora. Meja med peskom in njegovo


podlago je ostra. Pod njim se nahaja
vrsta plasti lagunskega mulja vse do
CM@UQSHMDUFKNAHMHLDC HM 
LF@OQDJHMI@RKNIYDKNMDF@ODRJ@ 
v globini med 4,60 in 4,75 m pa je
najti plast. V lagunskem mulju je najti tevilne sloje rastlinskih ostankov,
ONFNRSNLNUHQMDF@SQR@URSNIDDL
ONKN@IT  SDQ NRS@MJD JNKIJ Loripes
lacteus, Lentidium, Cerastoderma, Venus), nekaterih z zaprto lupino.
V okolici samostana San Mauro
smo opravili nekaj poskusnih vrtin
na mestu, kjer so se med predhodnimi izkopi nali ostanki kanalov, ki
RNNAJQN@KHONRKNOID #UDUQSHMHRS@
dosegli skoraj 3 m globine, tretja pa
se je ustavila 95 cm pod povrjem,
kjer smo naleteli na zelo izdaten sloj
opeke, po vsej verjetnosti strukture
tal (v tej plasti smo nali tudi fragment keramike domnevno pozno-

@MSHMDF@HYUNQ@ 
Jugovzhodno od ruevin znaa ob
ostanku manjega kanala (vrtina JES3)
debelina nanosa 1,95 m. Sam nanos
RDRSNIHHYODDMDF@LTKI@HMRSDQHKMDga peska do globine 1,05 m, pod tem
pa iz ilovnatega mulja z vsebovaniLH JNJH NFKI@ HM L@IGMHLH FQTC@LH
apnenca v globini od 1,05 do 1,95
LDSQ@ DFKNAKIDRDY@MDINOK@RSHK@gunskega mulja, kot je pokazala vrtina
JES2. Domnevni kanal so po vsej verjetnosti zasuli ljudje z odpadnim materialom in okolikimi sedimenti.
Jugozahodno od ruevin smo
Y@RKDCHKH UDIH J@M@K  J@SDQDF@ RSQ@SHFQ@ERJHOQNKIDANKIQ@YKDMIDM
 LFKNAHMDONKMHKNHYNRS@MJNU
organskega mulja s tevilnimi drobci
NODJDHMFQTC@LH@OMDMB@
   LHKNUM@SHLTKISDLMDA@Qve, prepreden s progami, vsebuje veKHJNJNKHHMNCQNABDUNODJD RONCMIH

del sloja tenko razslojen in z ostro


Q@YLDIHSUHIN
     L RHUH HKNUM@SH LTKI  OQDpreden s progami, brez arheolokih
NRS@MJNU  URDATIN CQNABD JNKIJ
(najden fragment Unio
   LCMNUQSHMDMHODRDJY
UDKHJNJNKHHMNBDMSHLDSQRJHGOQNCMHJNU CQNABHNODJDHMONKDU
9@Q@CHHYLDMITINHGRDRKNIDURSDQHKMDF@ODRJ@ONMDJNCURDATINDF@
RDCHLDMSD HM CQNABD QDMHG Unio)
ter slojev, bogatih z arheolokimi
ostanki, se ponuja domneva, da so
kanal po tem, ko je presahnil, prvoSMN TONQ@AKI@KH JNS NCK@F@KHD NCpadnega materiala, dokler ga niso v
celoti opustili, kar je privedlo do njeFNUDF@Y@LNUHQIDMI@
Jesolo 2
-@ SDL NALNIT RLN ONRJT@KH
OQDTHSHRS@QNRSQTFN J@SDQDONSDJID

63

Fig. 44 - Sintesi del potenziale archeologico antiche mura di Jesolo.


Sl. 44 - Povzetek arheolokega potenciala - stari zidovi Jesola.
44

Fig. 45 - Le aree indagate nei dintorni


di Adria.
6O3RGUREQDVOLNDREPRLMY$GULL
45

64

0,9 m vi sono limi argillosi grigi con


K@LHM@YHNMHMHDRNSSHKHHMSDQB@K@YHNni sabbiose, che testimoniano una
persistenza dellattivit sedimentaria anche dopo labbandono, dovuta
allinvasione della depressione residuale da parte di acque di rotta di un
corso dacqua attivo nelle vicinanze.
Al tetto della sequenza, fra 0,9 m e
il piano campagna, presente una
lente di limo organico nerastro (probabilmente torba mineralizzata e in
parte pedogenizzata) che corrisponde alla striscia di terreno scuro visibile in foto aerea al centro del paleoalveo. Esso rappresenta limpaludaLDMSN CDK B@M@KD CNON HK CDMHSHUN
abbandono, con linterruzione della
sedimentazione terrigena e la formazione di torbe.

La presenza di conchiglie lagunari


nelle sabbie spiegabile con lintrusione nel canale di acque salmastre
in una fase in cui lattivit alluvionale era gi sensibilmente diminuita.
Appena a nord di Jesolo, infatti, persistevano specchi dacqua lagunari
MN@K7(7RDBNKNN@KKHMHYHNCDK77 
OQHL@CDKKDDRSDMRHUDANMHBGDBGD
hanno interessato ampie aree costiere fra il Tagliamento e la Laguna
Veneta.
/DGHQL]LRQHGHLPRGHOOLGL
potenziale archeologico
Larea di Jesolo ricade nellambito della pianura del Piave. Sembra opportuno suddividere la zona
in due settori distinti. Il primo, pi a

monte (impostato sul centro di San


Don di Piave), interessato dalla
presenza di rinvenimenti rarefatti
principalmente rapportabili allet
romana, probabilmente interessati
da un certo alluvionamento (si veda
il sito 772 in BONDESAN, MENEGHEL
2004, p. 450, quota di rinvenimenSN  LDSQHC@KO C B  il secondo
settore, pi a valle, si restringe sensibilmente a coincidere con gli apporti
alluvionali di un dosso ben delineato
e nettamente coincidente con la cosiddetta Piave Vecchia. fondamentale un dato gi messo in evidenza
dagli studi geologici, riguardante la
datazione di questo ramo pi meridionale: in prossimit di Caposile la
torba alla base del corpo sabbioso
di accrescimento del dosso in paro-

la viene datata al 530-680 d.C., termine da stabilirsi come post quem


per la sua attivazione. Ad est e ad
ovest del dosso della Piave Vecchia
si aprono rispettivamente spazi interdossivi e la laguna di Venezia.
Durante le ricerche nelle aree
campione di Jesolo emersa la necessit di isolare dal resto del comparto il centro storico di localit Le
Mura, come formazione a parte (UPA
di Jesolo). Le ricerche geoarcheologiche descritte sopra (si veda particolarmente il sondaggio JES 2) hanno mostrato come sotto gli strati
antropici del sito Le Mura si collocassero livelli torbosi e come siano
avvenute le crescite di carattere naSTQ@KD D @QSHBH@KD BGD ROHDF@MN K@
sopraelevazione dellinsediamento
rispetto al territorio circostante. Una
prima successione di crescite sabbiose si sovrappone ai livelli lagunari, cui segue una sequenza antropica
CHMNSDUNKDRODRRNQD MN@ LDC
oltre. Se il sondaggio in parola non
ha intercettato un qualche alveo,
pure attestato in zona da fonti scritte, potremmo essere in presenza di
una chiara indicazione dimensionale
concernente il potenziale archeologico della zona, forse anche sottostimato, in quanto il punto di osservazione si colloca a N del complesso della cattedrale e probabilmente
non proprio al centro del mound iesolano.
Un punto da stabilire, di non secondaria importanza, se questisola
di insediamento fosse preesistente
alla formazione altomedievale del
dosso della Piave Vecchia, oppure
successiva. Vista la presenza di materiali di et romana e tardoantica,
attestati da varie fonti, sembra pi
probabile trovarsi di fronte ad una
formazione pi antica, la cui caratteristica di alto geomorfologico rispetto al territorio circostante potrebbe
essere ulteriormente accentuata dalla successiva crescita antropica. Tale
formazione di conseguenza dovrebbe essere lambita dagli apporti successivi della Piave Vecchia, che tendono a rimanere delimitati verso sud.
Sar comunque compito delle
successive ricerche geoarcheologiche appurare questo processo.
Per il momento le considerazioni
ora esposte valgano a distinguere
la zona dellinsediamento storico di
Jesolo (oggetto peraltro di una UPA

DONJ@Y@KNC@KIHMRJNY@YM@U@MID HM
IHCNKNHSHCDI@MRJDCHLDMYHIDHMQ@Ymerja glede na obalne nanose. Imeli
RLNOQHKNMNRSNO@YNU@SHONCQNAMNsti pred nedavnim obnovljenega segmenta jarka s poevnim prerezom
stare struge (sl. 41, 42, 43).
Analizirani prerez se nahaja na
vrhnjem delu krivulje meandra z zavojem, obrnjenim proti jugu. Dobro
UHCM@IDDQNCHQ@M@AQDHM@M@YTM@MIHITMHTC@QMHSNJHLD@MCQ@ S@L
torej, kjer je erozijsko delovanje reke
M@ILNMDID  $QNCHQ@M@ ONUQHM@ ID
izpodrinila obalni pesek, na njej pa
slonijo depoziti iz mulja-ilovice, ki
RNM@ONKMHKHNOTDMNRSQTFN -@M@sprotnem (severnem) bregu je prav
tako vidna struktura meandra, za kaSDQNRNYM@HKMHRKNIHYDM@JNLDQMHL
nagibom proti sredini kanala z navideznimi koti 15-20, izmerjenimi na
bregu jarka. Granulacija sedimentov
je nenavadno majhna, sestavljena
iz ilovnatega mulja z vmesnimi sloji
peska. Na nekaterih satelitskih posnetkih okolikih njiv so prepoznavni t.i. scroll bars (odvodni nanosi), kaSDQHGNAKHJ@IDJNMBDMSQHM@FKDCDM@
zavoj meandra. Aktivnost nanaanja
QDMHGM@OK@UHMIDM@IUDI@M@SDLDMT LD@MCQ@  Y@SN ID AQDHM@ M@ SDI
U CNSHMDL OQHLDQT RDUDQMH SNJH
slabo vidna, saj ne gre za povrino,
JH ID HYONRS@UKIDM@ HYJKITMN DQNYHIH 
O@O@Y@ONUQHMN J@LNQRDM@K@F@jo naplavine in kjer litoloka razlika
LDCFLNS@LHM@MNR@MHHYQ@YHS@ D
AQDHMN RSQTFD GHONSDSHMN ONRS@UHLNUONKN@I JIDQMHRNUDUHCMHRKNIH
YM@FHANL SHOHMHY@SDLDMRJNSNko meandra, je ocenjena irina korita
OQHAKHMNL 
Vrtina (JES1), opravljena v srediMHRS@QDRSQTFD IDNLNFNHK@@M@KHYN
RSQ@SHFQ@ERJDF@ OQNK@ U JNMMHG E@zah delovanja kanala in po njegovi
opustitvi. Globina vrtine je bila 4,7
m pod topografskim povrjem. StraSHFQ@INUQSHMDIDLNFNDONUYDSHJNS
sledi:
M@NRMNUH UFKNAHMHNC CN 
LRDM@G@I@RKNIYDKNLDGJDF@LTKI@
 LDC   HM   L ID NO@YHSH M HM
RQDCMID M ODRDJ Y NLDIDMN OQHRNtnostjo mulja, ki vsebuje nekaj muKI@RSHGJK@RSHMHGRDCHLDMSNUSDQMDkaj slojev z veliko vsebnostjo lagunskih koljk (med prepoznanimi vrstami so Loripes, Donax, Lentidium
LDC LHMSNONFQ@ERJHLONUQjem je opaziti drobnozrnate sedi

mente polnila iz obdobja po opustiSUH QDMD RSQTFD  5 FKNAHMH LDC  


in 0,9 m se nahaja sivi ilovnati mulj,
na tanko prepreden s sloji peska, kar
J@DM@MDOQDJHMIDMNCDI@UMNRSM@M@@MI@STCHONSDL JNQDM@RSQTF@
MHAHK@UDCDKTIN@ @IDU@MINY@Q@CH
OQDANI@ UCQK@ UNC@ HY AKHMIDF@ @Jtivnega vodotoka. V zgornjem sloju,
v globini med 0,9 m in povrjem se
M@G@I@ JQNUM@ OK@RS QMHJ@RSDF@ NQganskega mulja (verjetno mineralizirana in delno pedogenizirana ota),
JH TRSQDY@ ONUQHMRJDLT O@RT QMD
A@QUD UHCMDLM@YQ@MDLONRMDSJT
sredine stare struge. Ta predstavlja
Y@LNUHQIDMID J@M@K@ ON CNJNMMH
NOTRSHSUH JNMHAHKNUDM@OK@UHMRJHG
RDCHLDMSNU HM ID Y@DK@ M@RS@I@SH
ota.
Prisotnost lagunskih koljk v peRJT ID LNFND Q@YKNHSH Y UCNQNL
slankaste vode v kanal takrat, ko je
AHKNONOK@UKI@MIDNYDLKI@DAHRSUDno manj intenzivno. Samo nekoliko
bolj severno od Jesola je bilo naLQDURDCN RSNK @KHBDKNCNY@DSJ@   RSNK  JN RN RD Y@DK@ LDKHNQ@BHIRJ@CDK@M@NARDMHGNA@KMHG
NALNIHG LDC 3HKLDMSNL HM ADMDko laguno, gosto prepredeno z vodnimi zrcali lagunske vode.
'RORDQMHPRGHORYDUKHRORNHJD
potenciala
$MNS@ )DRNK@ ID CDK MHHMRJDF@
RUDS@QDJD/H@UD +NFHMNINIDSNQDI
Q@YCDKHSHM@CU@KNDM@CDK@ /QUHRD
M@G@I@UOQUDLNCRDJTQDMDF@SNJ@
RRQDCHDLULDRST2@M#NMCH/H@UDHMRDNRQDCNSN@M@QDCJDM@ICAD OQDSDMNHYQHLRJDF@NACNAI@ JH
jih je verjetno prizadela poplava (glej
M@ICHDM@!.-#$2 - ,$-$GHEL 2004, str. 450, kvota najdbe
- 5,00 metrov pod pohodno povriMNCQTFHCDK JHONJQHU@RONCMIHNCRDJQDMDF@SNJ@ IDOQDBDINIHHMRD
omeji na naplavinske nanose dobro
HYQ@DMD HYFNMRJD RSQTFD  JH NHSMN
sovpada s tako imenovano staro Piavo. Bistvenega pomena je podatek,
JHRNF@DHYONRS@UHKDFDNKNJDQ@YHRJ@UDHMRDM@M@@M@S@ M@IITMDIH 
QNJ@U QDJD C@SHQ@MID NSD U UYMNIT
ODDMD FLNSD NLDMIDMDF@ HYFNM@
UAKHHMH"@ONRHK@KD SNTUQ@UNAdobje med leti 530 - 680, kar je vsekakor kasneje od obdobja, v katerem
se je vodotok aktiviral. Vzhodno in
zahodno od izgona stare Piave se
Q@YSDY@IN MHYJ@ LDCQDM@ ONCQNI@

in beneka laguna.
,DC OQDTDU@MIDL UYNQMHG ONCQNHI )DRNK@ RD ID ONI@UHK@ ONSQDA@
ON KNHSUH RS@QDF@ LDRSMDF@ IDCQ@
JQ@I@ +D ,TQD NC NRS@KDF@ NALNI@
(EAP Jesolo). Prej opisane geoarheoloke raziskave (glej zlasti raziskavo
Jes 02) so pokazale, da se pod antroOHMHLHRKNIHKNJ@BHIDM@G@I@INOK@RSH
ote, pa tudi, da je prilo do naravnega in umetnega nanaanja novih
OK@RSH  JH K@GJN Q@YKNHIN OQHCUHFMIDM
ONKN@IM@RDKAHMDUOQHLDQI@UHYNJNlikim ozemljem. Prve plasti peska
se nalagajo na podlago lagunskega
SHO@ RKDCHINO@IHLOK@RSH@MSQNOHMDga izvora precejnje debeline (do 1,4
L HM UD  DOQ@U OQH UQS@MIT MHRLN
naleteli na starodavne struge, kljub
temu, da so te omenjene v zgodovinskih zapisih, pa se lahko zaradi tovrRSMDQ@RSHNALNI@URDDMNOQDCUHdeva, da gre za bogat arheoloki potencial, ki smo ga morda celo podceMHKH R@IRDSNJ@NO@YNU@MI@M@G@I@U
severnem delu kompleksa katedrale
HMSNQDIMDONURDLM@RQDCHMHFNLHle Jesola.
Porojeva se vpraanje, ali je ta
M@RDKAHMRJ@ OKN@C NARS@I@K@ D
pred nastankom zgodnjesrednjevekega izgona Stare Piave ali je do nje
prilo kasneje. Glede na dejstvo, da
so se tu nali materiali iz rimskega in
ONYMN@MSHMDF@NACNAI@ J@QONSQITjejo tevilni viri, je bolj verjetno, da
RLN OQH@ RS@QDIH ENQL@BHIH  G J@SDQDYM@HKMHNAKHJHCUHFMIDMDOKN@CH
v primerjavi z okolikim terenom bi
lahko dodatno prispevali tudi ljudje.
*@RMDIDM@IAHAHK@FNLHK@NAC@M@
z dodatnimi naplavinami reke Piave,
JHIHGIDM@ISHUDHMNL@ITMNNCMID 
Proces bo vsekakor potrebno
preveriti z dodatnimi geoarheolokimi raziskavami. Za zdaj naj pravkar prikazane domneve pomagajo
KNHSH OQDCDK RS@QNC@UMD M@RDKAHMD
Jesola (ki je predmet posebne EAP)
NCNRS@KDF@NALNI@ #DI@MRJNIDOQH
izvajanju arheolokega dela raziskave prilo do izjemno zanimivih rezulS@SNU DLTQANSQTIDSTCHCDIRSUN C@
ID Q@YHRJ@U@ ONCQNAMHG ONCQNHI )DR
1 in 2 v okviru projekta Parsjad potekala v povezavi s e enim raziskovalnim projektom, ki ga je neposredno koordiniralo osebje Univerze Ca
Foscari (Oddelek za srednjeveko arheologijo, prof. Sauro Gelichi, 2011).
Intenzivna tudija je bila namenjena
izrecno segmentu v kraju Le Mura. V

njenem okviru so imenovano obmoIDOQDBDIM@S@MMNNLDIHKH UR@IJ@Q


zadeva vidna in dostopna mesta z
vidika raziskav povrja, torej v glavMDLRDUDQMHHMUYGNCMHCDKNALNI@ 
*@D  C@ RN RS@QNRDKBH Y@DKH OQDCDK
poseljevati ele v 4. stol., kar je potrdila tudi predhodna analiza materialov, zbranih med raziskavami povrja leta 2011. Ta podatek ne odstopa
dosti od rezultatov nekoliko starejHG @QGDNKNJHG Q@YHRJ@U  DOQ@U RD
MD HYJKITTID LNMNRS NARSNI@ RS@QDIHGOQHDU@MI JHRNINLDCCQTFHL
DUDJQ@SNLDMHKHQ@YKHMHUHQH
V nadaljevanju je kratek povzeSDJHYGNCHMHGDKDLDMSNUYDLKIDUHda arheolokega potenciala (sl. 44).
Podatki s terena (predmet drugih
NAHQMHGHMNARDMHGQ@YHRJ@UUNJUHru raziskovalnega projekta Univerze
Ca Foscari) se v glavnem nanaajo
na razprene in le omejeno nakopiDMDM@ICADL@SDQH@K@HYLNCDQMDHM
sodobne dobe: keramika iz obdobja
med 15. in 20. stol. ter drobci opeke,
ki verjetno pripadajo majhnim ruralMHLY@RDKJNL@KHNA@RMHLNAHRJNL
NALNI@ 9@MHLHU@IDONONKM@NCRNSMNRS M@ICA M@ ONCQNIT  JIDQ M@I AH
stali srednjeveki samostani S. Giorgio in Pineto (Marina Alta, lokacija Fornasotto) ter SS. Vito e Modesto
(La Gaiola, Le Motte), torej tam, kjer
so arhivski podatki in raziskave iz 19.
stol. navajali obstoj objektov.
-@ OQDCDKT NJNKH M@ICH@ +D
Mura - S. Maria Assunta, - nanj se je
NRQDCNSNHK@ Q@YHRJ@U@ HY KDS@ 
Y M@LDMNL CNKNHSH SNONFQ@ERJD HM
kronoloke meje starodavne naselAHMD$PTHKNRONLNINBHKI@MDF@YAHranja materialov, ki so pogledali na
plano med oranjem poljedelskih poUQHM HM HDMI@ HYONRS@UKIDMHG OQDCDKNU IDAHKNLNFNDNBDMHSHNARDF
HM ONSDMBH@K NARSNIDDF@ @QGDNKNkega depozita. Material, ki se je poL@JMHK M@ ONUQID  J@D M@ M@RDKAHno iz obdobja med 4.-5. In 15. stol..
-@IUDF@IDM@ITMDLHMRDUDQMDL
NAQNAIT@QGDNKNJDF@M@ICH@J@SDCQ@KD M@LDRST JHRDKNHNCNJNKHBD
ONCQTF@MHRDRS@UHS@KL@MIODRJ@
HM ON UHIDL ONKN@IT U OQHLDQI@UH
z njo. Na osnovi zbranih podatkov
RLN AQDY SD@U CNKNHKH RDUDQMD QNANUD NSNJ@  LDCSDL JN RD Y@ ITMH
del domneva, da se je povrina staQDM@RDKAHMDQ@YSDY@K@URDCNAQDHM
Stare Piave (dananje reke Sile). Med
HDMIDL HYONRS@UKIDMHG OQDCDKNU

65

Fig. 46 - Sedimenti sabbiosi del dosso


del Po di Adria digradanti verso i terreni torbosi di colore pi scuro, oggetto di
ERQLFKHQHOVHFRORVFRUVR
6O3HHQHXVHGOLQHYJUHEHQXUHNH
3RGL$GULDNLVHVSXDMRSURWLRWQLP
tlom bolj temne barve. V preteklem stoOHWMXVRELOHL]YHGHQHVDQDFLMHREPRMD

46

66

particolare) dal resto del comparto.


(MDDSSHKDB@LO@FMD@QBGDNKNFHBGD
di survey si sono qui svolte con risultati di grande interesse, anche per il
fatto che la campagna attuata nelle
aree di dettaglio Jes 1 e 2, in seno al
progetto Parsjad, stata condotta a
sua volta in collegamento ad un altro
progetto di ricerca, coordinato direttamente dallUniversit Ca Foscari
(Insegnamento di Archeologia Medievale, Prof. Sauro Gelichi, 2011).
Una survey intensiva stata dedicata
RODBHB@S@LDMSD @K BNLO@QSN CH KNcalit Le Mura, portando ad una perimetrazione piuttosto precisa di tutta
larea insediativa, almeno nelle zone
visibili e accessibili dal punto di viRS@CDKKDQHBDQBGDCHRTODQBHD BHN
principalmente sui versanti nord ed
est. Pare che linizio del grosso della
frequentazione non dati prima del IV
secolo, come mostrato da una preliminare analisi dei materiali raccolti
CTQ@MSDKDQHBDQBGDCHRTODQBHDCDK
  0TDRSN C@SN RNRS@MYH@KLDMSD
non contrasta con le ricerche archeologiche compiute in passato, anche
se uneventuale presenza pi antica
non pare certo improbabile e viene
peraltro citata pi volte dalle fonti.
(MF BNLO@HNMNHMRHMSDRHFKH
elementi su cui ragionare per la costruzione di una carta del potenziale
archeologico.
I dati acquisiti sul territorio (oggetto di altre ampie esplorazioni
estensive in seno al progetto di ricerca di Ca Foscari) riguardano, per
lo pi, dispersioni e piccole concentrazioni di materiali di et moderna
e contemporanea: ceramica databile
SQ@HK75(DHK77RDBNKNDEQ@LLDMSH
di laterizi relativi, con molta probabilit, a piccoli insediamenti rurali o
a semplici frequentazioni sporadiche. Spicca la totale assenza di rin-

venimenti nelle aree in cui si ritiene


potessero essere ubicati i monasteri medievali di S. Giorgio in Pineto
(Marina Alta, localit Fornasotto) e
dei SS. Vito e Modesto (La Gaiola, Le
Motte), luoghi in cui carte storiche,
fonti darchivio e rinvenimenti avUDMTSH MDK 7(7 RDBNKN HMCHB@U@MN K@
OQDRDMY@CHDCHBH 
Per quel che riguarda larea circostante il sito de Le Mura S. Maria Assunta, su cui si concentrata
lindagine del 2011, con lobiettivo
CHHMCHUHCT@QDRH@HKHLHSHSNONFQ@BH
sia cronologici dellantico abitato di
Equilo, attraverso una raccolta miraS@CDHL@SDQH@KH@NQ@MSHRTKK@RTODQBHDCDHB@LOH@Q@SHPT@CQDSS@STQ@
dellarea) e la pulizia delle sezioni
esposte, stato possibile valutare la
consistenza e la potenzialit del deposito archeologico presente. I maSDQH@KH @NQ@MSH HM RTODQBHD HMPT@drano labitato in un periodo comOQDRNSQ@HK(5 5RDBNKNDHK75RDBNKN 
La concentrazione sembra presente
nei terreni a sud e a nord del sito archeologico della Cattedrale, in una
zona che si distingue da quelle marginali per una consistenza del terreno meno sabbiosa e per una maggiore altimetria. In base ai dati acquisiti
stato possibile individuare i margini dellisola nella parte settentrionale, mentre a sud si ipotizza che la
RTODQBHD@MSHB@LDMSDHMRDCH@S@ONSDRRD DRSDMCDQRH MN @KKD QHUD CDKK@
/H@UD 5DBBGH@ NCHDQMN TLD 2HKD 
La pulizia delle sezioni esposte, effettuata nei pressi della Cattedrale
e nellarea pi marginale dellisola,
verso nord, ha messo in luce un deposito che mostra, subito al di sotto
CDKKNRSQ@SNCH@Q@SHUN RSQ@SHB@YHNMH
altomedievali. In alcuni punti staSN HMCHUHCT@SN TM A@BHMN RSQ@SHFQ@co di almeno un metro di spessore.

I materiali rinvenuti sono in linea


BNM PT@MSN NRRDQU@SN HM RTODQBHD 
La cultura materiale raccolta attesta
lesistenza, nel corso della Tarda Antichit e del Medioevo, di produzioni
locali (ceramica acroma grezza e alcune rivestite) e di importazioni sia
dallentroterra della penisola sia dal
Mediterraneo, e delinea un centro
ben inserito allinterno dei circuiti
commerciali tardo antichi e altomedievali.
6.2 Il territorio di Adria
(an, cn, ta, ec, af, pm)
Nel territorio circostante la citt
di Adria sono state prese in considerazione tre distinte aree di indagine
 CQH@    D   F    BNM KHMSDMzione di chiarire alcuni degli aspetti
della complessa evoluzione del paesaggio nellimmediato hinterland
della citt, laddove le tracce da telerilevamento avevano rivelato con
buon dettaglio sia elementi naturali,
come paleoalvei, canali e ventagli di
rotta, sia tracce antropiche, principalmente attribuibili a parcellizzazioni agrarie e allassociato sistema
di fossi e viabilit minore.
In particolare, le aree Adria 1 e 2
RNMNRS@SDCDMHSDHMETMYHNMDCDKK@
presenza di tracce antropiche osservate da telerilevamento e di evidenze archeologiche note in letteratura.
Larea Adria 3 posta in prossimit
dellarea urbana, dove sono concentrati buona parte degli scavi archeologici noti, ed attraversata da un
O@KDN@KUDN ADM BNMRDQU@SN  RS@S@
quindi ritenuta essere uninteressanSD MDRSQ@ CH SDQQHSNQHN ODQ HMC@FHMH
geoarcheologiche e di analisi del
potenziale archeologico.

La carta del noto


(KBDMRHLDMSNCDKMNSNDDSST@to solo per quel che concerne la biAKHNFQ@@ CHRONMHAHKD  G@ QDRSHSTHSN
numerose testimonianze relative
in maggioranza al centro urbano (si
veda infra), ma pertinenti pure al suburbio e agli immediati dintorni della citt, censiti con particolare riferimento alle attivit di campionatura
che si sarebbero poi svolte in seno
al Parsjad.
Non questa la sede per una disamina della complessa questione
archeologica posta dallimportanSD HMRDCH@LDMSN O@C@MN  RNQSN M
dallet del Ferro (ma con precedenti
anche nellet del Bronzo) su di un
dosso poco pronunciato, basti ricordare che si tratta di un insediamento
BNM B@Q@SSDQHRSHBGD TUH@KH D HLONQtante nodo per le comunicazioni sia
verso lentroterra padano, sia come
punto di sosta per il transito terrestre NS (via Popilia e via Annia).
Con particolare riferimento allarea territoriale immediatamente riEDQHAHKD@C CQH@ HMAHAKHNFQ@@RNMN
disponibili due ordini di dati. Vecchi
e nuovi scavi riferiscono soprattutto della presenza di numerose ed
estese necropoli di et ellenistica
e romana poste soprattutto lungo
la fascia suburbana meridionale e
NQHDMS@KD  RB@U@SD M C@H OQHLH @MMH
del Novecento. Molti di questi nuclei
sono da porsi in collegamento con la
UH@AHKHS  RODBHB@LDMSD PTDKK@ LDridionale che collegava Adria da una
parte allentroterra padano e a Bologna, dallaltra con la costa verso Spina, Ravenna e Ariminum. Il secondo
ordine di dati riguarda invece tratti del paesaggio sepolto. almeno
dagli anni Sessanta del secolo scorso che nel comprensorio polesano

Fig. 47 - Tracce di paesaggi centuriali a


sud-est di Adria, zona campione 2.
Sl. 47 - Sledi centuriacije pokrajine juJRY]KRGQRRG$GULHY]RUQDFRQD.

47

same katedrale in obrobnih pasov na


severu otoka se je pokazal arheoloki depozit, v katerem so takoj pod
slojem obdelovalne zemlje razvidni
sloji iz obdobja zgodnjega srednjega
veka. Na nekaterih mestih smo opazili stratigrafska zajetja debeline vsaj
enega metra. Najdeni material ustreza opazovanjem na povrju. Narava
YAQ@MDF@L@SDQH@K@HYRS@QN@MSHMDF@
in srednjevekega obdobja potrjuje
obstoj lokalnega rokodelstva (nebarvana surova glina in nekateri prevleDMH EQ@FLDMSH HM UMNR@ HYCDKJNU Y
italskega polotoka ali iz Sredozemlja
HM OQH@ N RQDCHT  JH ID AHKN CNAQN
Y@RSNO@MN U RS@QN@MSHMDL HM RQDdnjevekem gospodarskem okolju.
6.2. Ozemlje Adrie
(an, cn, ta, ec, af, pm)
V okolici mesta Adria smo vzeli
ONCKTONSQHKNDM@NALNI@ OQDCLDSQ@YHRJ@UD CQH@ HM RK 
namen raziskave je bil, pojasniti nekatere vidike kompleksnega razvoja
ONJQ@IHMD U AKHMIDL Y@KDCIT LDRS@ 
torej tam, kjer so se med postopkom
daljinskega zaznavanja precej poCQNAMNNCHS@KDM@Q@UMDYM@HKMNRSH 
JNS RN RS@QD QDMD RSQTFD  J@M@KH HM
O@GKI@@RSH Y@UNIH  O@ STCH @MSQNOHne sledi, ki jih gre v glavnem pripi

R@SH O@QBDK@BHIH @FQ@QMHG YDLKIH HM


OQHO@C@INHL RHRSDLNL M@L@J@KMHG
jarkov in manjih cest. Konkretno
RLNNALNIH CQH@HMOQDTHKHM@
ONCK@FH @MSQNOHMHG RKDCH  JH RN IHG
NCHS@KH YQ@MH ONRMDSJH  SDQ D YM@MHG@QGDNKNJHGOQHDU@MIUKHSDQ@STQH 
.ALNID CQH@RDM@G@I@UAKHHMH
mesta.
Tu so v preteklosti opravili znanih
@QGDNKNJHG HYJNONU  OQDJ@ O@ F@
CNAQN NGQ@MIDM@ RS@QNC@UM@ RSQTF@
iz teh razlogov se je izbrala kot zanimiv vpogled v teritorij in dobro izhoCHDY@FDN@QGDNKNJDQ@YHRJ@UDHM
analizo arheolokega potenciala.
Zemljevid poznanega
Popis poznanega (opravili smo ga
R@LNYTONQ@ANQ@YONKNKIHUDKHSDQ@STQDIDONSQCHKNARSNISDUHKMHGOQHDU@MI UDHMNL@HYLDRSMDF@RQDCH@
(glej infra), a tudi iz predmestij in bliMID NJNKHBD LDRS@ OQH ONOHRT RLN
posebno pozornost namenili dejavMNRSHLUYNQDMI@ JHM@IAHRDJ@RMDID
opravile v okviru projekta Parsjad.
Na tem mestu ne bomo govorili o
HYIDLMNQ@YKDMIDMH@QGDNKNJHRHST@ciji ega pomembnega padskega meRSMDF@ RQDCH@  J@SDQDF@ M@RS@MDJ
RDF@UDKDYMNCNAN OQUHY@LDSJHO@
BDKNUNACNAIDAQNM@RSDCNAD RON-

mnimo naj le, da gre za naselbino


NAQDMDF@ YM@@I@ HM Y@ ONLDLAMNRSHHDONUDY@UOQNSHO@CRJDLT
Y@KDCIT HM ONHU@KHD M@ JNODMRJHG
poteh v smeri sever - jug (via Popilia
e via Annia).
. NALNIT U MDONRQDCMH AKHHni Adrie sta v literaturi na voljo dve
vrsti podatkov. Stareji in noveji
izkopi omenjajo predvsem obstoj
SDUHKMHGHMNARDMHGMDJQNONKHYGDKDMHRSHMDF@ HM QHLRJDF@ NACNAI@ 
JH RN RD M@G@I@KD YK@RSH U ITMDL HM
vzhodnem obrobnem pasu in so jih
Y@DKHHYJNO@U@SHDUOQUHGKDSHG 
stoletja. tevilne med njimi so nastale ob cestnih povezavah, konkretno
NAITMHUO@CMHBH JHID CQHNM@DMH
strani povezovala s padskim zaledjem in Bologno, na drugi pa z obalo
v smeri Spine, Ravenne in Ariminuma
(dananji Rimini). Druga vrsta podatkov pa se nanaa na podobo skrite
ONJQ@IHMD HY SHRSDF@ NACNAI@  D NC
estdesetih let prejnjega stoletja
dalje se je v arheolokem prostoru
Polesine razvila raziskovalna smer,
ki je upotevala tudi podatke daljinRJDF@ Y@YM@U@MI@ OQHCQTHKH RN RD IH
tudi lokalni arheologi in skupine prostovoljcev. Osnovna tema tovrstnih
Q@YHRJ@U ID AHK@ NUQDCMNSHSH @MSHMD
centurijske sisteme in ostanke ce-

stnih povezav v povezavi s kompleksnimi vpraanji, ki se zastavljajo v


zvezi z zgodovinsko in topografsko
rekonstrukcijo starodavnih poti. Prav
ta pristop je spodbudil nao pozornost z namenom, preveriti metode
raziskovanja pokopanih pokrajin kot
UHQ@@QGDNKNJHGOQHDU@MI 
Tematiki so namenili pozornost
tudi tevilni strokovnjaki, zato je toUQRSM@KHSDQ@STQ@OQDBDIHYQOM@YK@RSH
M@I NLDMHLN CDK@ 1@@DK@ /DQDSS@ 
po izobrazbi geologa, ki je znal isto@RMN TONSDU@SH ONC@SJD HYJNONU 
YQ@MD ONRMDSJD HM FDNLNQENKNJN
podobo (na primer PERETTO 1993).
-@JQ@SJNM@NALNIT CQHDIDOQHRNSDMS@JNRHRSDLBDRSMHGONUDY@UM@
CNKFDQ@YC@KIDvia per Gavello, via
Annia, via PopilliaJNSSTCHUDKNJ@KMHG BDMSTQHIRJHG BDRSMHG NLQDHI  NC
katerih najbolj homogena in raziskana pertika se nahaja v tako imenoU@MH BDMSTQH@BHIH 5HKK@CNRD PERET
TO  MIMMO  FRASSINE
Y@ONCNAN@MSHMDF@BDRSMDF@
NLQDI@RONTC@QJNLM@LDSNCHC@ljinskega zaznavanja). Iz zadnjih let
M@U@I@LN RHRSDL@SHM@ Q@YHRJNU@KM@
dela podatkov daljinskega zaznavanja, uporabnih za razumevanje paleo
okoljskih in geoarheolokih vidikov.
STCHINIDHYUDCDK.CCDKDJFDNFQ@-

67

Fig. 48 - Sezione ricavata sulla parete di una scolina in cui visibile, al di


sotto dello strato arativo, il livello torboso contenente frammenti di laterizi
romani. Sotto il livello torboso vi sono
OLPLVDEELRVLFKHSDVVDQRDVDEELHQL
al fondo della scolina.
Sl. 48 - Prerez, izdelan na steni na odvodnega jarka, kjer je pod oranim sloMHPYLGHQRWQLQLYRNLYVHEXMHRSHQH
in rimske odlomke. Pod otnim nivojem
VRSHHQLPXOMLNLSUHLGHMRYPLYNRQD
dnu odvodnega jarka.
Fig. 49 - Sulle sponde di questa scolina
appena ripulita nel settore Adria 2 sono
ben visibili due canali (uno in primo
piano, uno allaltezza delle persone), intercettati in sezione obliqua, corrispondenti alle tracce rilevate in foto aerea.
Sl. 49 - Novo obnovljen odvodni jarek v
sektorju Adria 2, v katerem sta dobro vidna dva kanala (eden zgoraj in eden na
viini oseb), ki ustrezata sledem, odkriWLPQD]UDQHPSRVQHWNX
48

68

si sviluppato un orientamento di
ricerca attento alle tracce da telerilevamento, portato avanti anche da
studiosi locali e da gruppi di volontariato. Tema di ricerca principale
quello riguardante gli antichi sistemi
centuriali e le tracce di viabilit, in
relazione alle complesse problematiche poste dalla ricostruzione storiB@DSNONFQ@B@CDHSQ@BBH@SH@MSHBGH 
soprattutto su questa stimolante
cornice che si appuntata la nostra
@SSDMYHNMD SDR@@UDQHB@QDKDLDSNdologie di indagine sui paesaggi sepolti come risorsa archeologica.
Vari studiosi si sono interessati della materia, dando luogo a una
HMFDMSDAHAKHNFQ@@ 2HCDUNMNBHS@QD
HMLNCNO@QSHBNK@QDHK@UNQHCH1@@ele Peretto, geologo di formazione
che ha saputo considerare contemporaneamente i dati di scavo, le foto
aeree e il quadro geomorfologico
(ad esempio PERETTO 1993). In sintesi la zona di Adria restituisce sia il
quadro viario di una rete stradale di
KTMF@ODQBNQQDMY@UH@ODQ&@UDKKN 
via Annia, via Popillia), sia pi siste-

49

mi centuriali che vedono nella coRHCCDSS@ BDMSTQH@YHNMD CH 5HKK@CNRD


K@ODQSHB@OHNLNFDMD@DOHRSTdiata (/$1$33.,(,,.
FRASSINE 2010 per il quadro della viabilit antica con attenzione al
telerilevamento). Negli ultimi anni
deve essere citato il sistematico lavoro di ricerca sulle tracce da telerilevamento, per la comprensione
paleoambientale e geoarcheologica,
attuato dal Dipartimento di Geogra@CDKK4MHUDQRHSCH/@CNU@ HMQDK@YHNMD @K /QNFDSSN MMH@  BGD G@ QHguardato anche il territorio di Adria
(PIOVANMOZZI, NINFO 2009
NINFO 2009MOZZI, NINFO, PIOVAN
2010).
La ricerca sul campo
Adria 1
Larea Adria 1, ad est di Adria,
stata interessata dal passaggio di
TM Q@LN CDK TLD /N  HMCHB@SN HM
letteratura come Po di Adria e attivo durante let del Bronzo e linizio
CDKKDSCDK%DQQN MN@K(7 5(((RDB 

a.C. (/(.5 -5$&&( -( 1972).


(KCNRRNF G@NQHDMS@YHNMDBHQca est-ovest e nellarea in esame
presenta un rilievo di circa 1 m sulla
piana circostante. Immediatamente
ad est di Adria il dosso perde rilevanza morfologica ma sono ben riconoscibili nelle immagini satellitari
D@DQDDSQ@BBDCHO@KDNHCQNFQ@@BGD
RHDRSDMCNMNUDQRN-$MN@KRHRSDma di paleodune. Losservazione di
scoline agrarie indica che nellarea
Adria 1 sono dominanti le sabbie
MH@CDKDU@S@DDQUDRBDMY@@KK@BHdo cloridrico e con alto contenuto di
mica. Nelle aree comprese tra i maggiori paleoalvei sono presenti sabbie limose e, localmente, limi argilKNRHMN@ BLC@KOH@MNB@Lpagna, mentre a profondit maggiori
tornano a prevalere le sabbie.
Le foto aeree mostrano che vi
sono evidenti tracce di paesaggi
agrari sepolti, con alcune lineazioni
che sembrano appoggiarsi ad una
via obliqua che si diparte dal centro
di Adria verso est (MIMMO 2006, in
O@QSHBNK@QDF  RHRSDL@B 

Nonostante le particolari evidenze da telerilevamento, non si sono


riscontrati risultati apprezzabili dal
punto di vista archeologico, se non
alcune dispersioni di materiali di
et moderna e medievale (grezze da
fuoco).
Adria 2
Ben pi indicativi i risultati ottenuti nellarea Adria 2, a sud-est di
Adria, in posizione meridionale rispetto al Canal Bianco e al Collettore
Padano Polesano (precedentemente noto come Scolo di Gavello). Le
chiare ed estese tracce da telerilevamento qui si presentano pi numerose ed organiche, a formare un vero
e proprio sistema a maglie ortogonali, compatibile con le caratteristiche
di un sistema centuriale.
Come dati pregressi si aveva a disposizione la pubblicazione di uno
studio parziale riguardante uno scaUN DDSST@SN SQ@ HK  D HK 
che aveva dato alcuni spunti per una
QHDRRHNMD CH SHON RSQ@SHFQ@BN D @K
SDLON RSDRRN SNONFQ@BN BONOMI,

je na Univerzi v Padovi v povezavi s


/QNIDJSNL MMH@ UNJUHQTJ@SDQDF@
se je obravnavalo tudi ozemlje Adrie
(PIOVANMOZZI, NINFO
NINFOMOZZI, NINFO, PIOVAN
2010).
Raziskovanje na terenu
Adria 1
Ozemlje Adrie 1, vzhodno od
LDRS@ CQH@ IDMDJC@IOQDJ@KQNJ@U
reke Pad, v literaturi znan po imenu
Pad Adrie (Po di Adria), aktiven v broM@RSHHMM@Y@DSJTDKDYMDCNAD URD
do 9.-8. stol. pr. n. t. (PIOVAN
VEGGIANI 1972). Greben izgonRJDRSQTFDRK ONSDJ@UOQHAKHMH
smeri vzhod - zahod in je na raziskoU@KMDLNALNITUHRNJOQHAKHMNL
nad okoliko ravnico. Le malo bolj
vzhodno od Adrie se greben spusti v
ravnino, vendar so njegove paleohidrografske sledi, ki se v severovzhodni smeri raztezajo vse do nekdanjih
dun, e vedno vidne na satelitskih
HMYQ@MHGONRMDSJHG /QDFKDC@MHM@L@J@KMHI@QJHJ@DIN C@M@ONCQNIT
CQH@OQDUK@CTIDINMHODDMHM@nosi z visoko stopnjo penjenja zaradi
vsebovane solne kisline in z veliko
URDAMNRSINRKITCD -@NALNIHGLDC
UDIHLH @MSHMHLH RSQTF@LH ID OQHRNten muljast pesek, lokalno pa tudi
ilovnati mulj do globine 70-80 cm
od pohodne povrine, medtem ko v
globljih plasteh spet prevlada pesek.
9Q@MH ONRMDSJH J@DIN M@ CNAQN
razvidne sledi zakopanih kmetijskih
povrin, z nekaterimi razmejitvami,
za katere se zdi, da se povezujejo s
poevno cesto, ki iz mestnega jedra
Adrie pelje pod kotom proti vzhodu
(MIMMO 2006, zlasti sl. 6, sistem c).
*KITACNAQNHYQ@DMHLONCQNAMNRSHL
daljinskega zaznavanja nismo odkrili arheoloko pomembnih elemenSNU HYIDL@ RN ONR@LHMH Q@YOQDMH
drobci iz moderne dobe in srednjega
veka (surova glina za pripravo hrane).
Adria 2
Precej pomembneji so rezultaSH  YAQ@MH M@ NALNIT CQHD   ITFNUYGNCMNNCLDRS@ CQH@HMITMNNC
kanala Bianco in od zbiralnika Collettore Padano Polesano (prej znanega
JNSNCUNCMHJ@M@K&@UDKK@ 1@YKNMD
HM NAHQMD RKDCH  NCHS@MD Y C@KIHMRJHL Y@YM@U@MIDL  RN ST SDUHKMDIe in organskega izvora, pravzaprav
tvorijo pravcat sistem s pravokotni

Fig. 50 - Adria 2. Materiali laterizi di et


romana presenti sotto depositi torbosi,
rinvenuti al fondo di una scolina.
6O   $GULD  2SHQDWL PDWHULDOL L]
rimskega obdobja pod otnimi usedlinami.
50

Fig. 51 - Collocazione dei sondaggi nelle tre aree campione di Adria. Con la
stella verde sono evidenziati i sondaggi da cui provengono i campioni datati
con il radiocarbonio.
Sl. 51 - Lokacija sondiranja in vzorca, ki
MH ELO SRGYUHQ UDGLRRJOMLNRYHPX GDWLranju.
51

mi zankami, ki ustreza centurijskemu


tipu razmejitve ozemlja.
Na voljo so nam bili podatki tudije, ki se je nanaala na izkop, opraUKIDMUKDSHGNCCNQDYTKS@SH SD STCHID RN RKTHKH JNS ONCK@F@
Y@RSQ@SHFQ@ERJH HRSN@RMNO@STCHSNpografski pristop (BONOMI, PERETTO,
TAMASSIA RSQ  PERETTO
1993, str. 178-179 in str. 181). Poleg
MDJQNONKDHYGDKDMHRSHMDF@NACNAI@
so med izkopom v ulici via Spolverin
odkrili tudi sledi pohodne ravnine iz
rimskega obdobja, povezane s sistemom pravokotnih kanalov z usmeQHSUHIN OQHAKHMN n Y@GNCMN NC 2 
RNUO@C@INHG R ROKDSNL RKDCH M@
YQ@MHGONRMDSJHG JHRNUHCMHM@NARDMDLNALNITMDJNKHJNANKIUYGNdno. Z vidika stratigrafskega stolpca
ti elementi ustrezajo ravnini iz rim-

RJDF@NACNAI@ JHKDHONCRJQNLMHL
slojem naplavinskih nanosov iz obCNAI@ONJNMBTQHLRJDF@@R@HMC@nanje obdelovalne zemlje. Zanimiv
je tudi stratigrafski podatek, ki velja tudi za druge kontekste v okolici
Adrie: pod pravkar opisanim slojem
KDHOK@RSNSD@KHYDKNSDLMDF@LTKI@
z veliko vsebnostjo organskih snovi.
KNM@IAHY@QDYTKS@SE@YDY@LNUHQjenja po koncu rimskega obdobja,
J@SDQDF@NRS@MJHRNY@OD@SHKHOQDBDI
OKHSUN KDDH @MSHMH @QGDNKNJH RKNI
(80-100 cm) (PERETTO 1993). Pred
rimskim obdobjem naj bi tu potekale manje neenakomerno speljane
QDMDRSQTFDCDKMNM@Q@UMDF@HMCDKMN@MSQNOHMDF@HYUNQ@ JHM@IAHONCQNIDMHHMRJDF@RUDS@OQDOQDC@KDU
smeri s severa proti jugovzhodu.
Predel je torej bogat s sledmi

JQ@IHMHYOQDC@R@LDKHNQ@BHIRJHGCDK
moderne dobe, ki bi jih lahko na
podlagi stratigrafskih in topografskih podatkov morda opredelili kot
@MSHMD 2KDCHIDJ@RMDIDTONQ@AHKHM
z daljinskim zaznavanjem dodatno
preveril Oddelek geolokih znanosti Univerze v Padovi. Med postopkom so dodatno odkrita odstopanja
izmerili in geoloko opredelili (sl.
47). Dobra preglednost posnetkov
je rezultat odziva vegetacije (pojav
cropmarks), posnete v primernem
trenutku z multispektralnim senzorIDL HM SDUHKMHG ENSNFQ@I  ONRMDSHG
iz ustreznega kota. Terensko preverjanje je bilo potrebno opraviti, da
RLN ONSQCHKH ONC@SJD C@KIHMRJDga zaznavanja, pa tudi zato, da smo
K@GJNCNKNHKHYHMDHMRSQ@SHFQ@ERJD
YM@HKMNRSH  M@ J@SDQD AH RHBDQ K@GJN

69

70

PERETTO, TAMASSIA 1993, pp. 94PERETTO 1993, pp. 178-179 e p.


181). Oltre ad una necropoli di et
ellenistica, lo scavo di via Spolverin
aveva restituito tracce di un piano
di calpestio di et romana collegato
ad un sistema di canalizzazioni ortogonali con un orientamento di circa
N27 O, compatibili con un plesso di
tracce da foto aerea visibili in un vasto comprensorio posto pi a E. Dal
OTMSN CH UHRS@ RSQ@SHFQ@BN PTDRSH
elementi erano in fase con un suolo
di et romana, posto sotto un debole
apporto alluvionale post-romano e
larativo moderno. Interessante anBGD NRRDQU@QD TM C@SN RSQ@SHFQ@BN
che riconosciuto in altri contesti
attorno ad Adria, cio la presenza,
alla base dello strato precedentemente descritto, di un livello di torbe o di limi molto scuri per apporto
organico. Si tratterebbe di una fase
di impaludamento postromana che
tende a sigillare la sequenza archeologica antica, che si trova alla esigua
profondit di 80-100 cm PERETTO
1993). Precedentemente allappoderamento romano vi sarebbe stata
una situazione di piccoli alvei, parte
naturali, parte antropici, ma ad andamento irregolare, che solcavano la
zona della pianura adriese con andamento principale da nord a sud-est.
Il settore recava in conclusione
estese tracce di paesaggi precedenSH KD ANMHBGD CH DS LNCDQM@  BGD
@KBTMH C@SH CH B@Q@SSDQD RSQ@SHFQ@BN D SNONFQ@BN HMCHB@U@MN DRRDQD
potenzialmente antiche. Tali tracce
sono state poi riprese e ulteriorLDMSD UDQHB@SD MDK SDKDQHKDU@LDMto operato dal Dipartimento di Geoscienze dellUniversit di Padova,
che ha potuto rintracciare ulteriori
anomalie precisandone estensioMDDFDNQDEDQDMYH@YHNMDF  +@
buona visibilit data dalla risposta
della vegetazione (cropmarks) registrata in un momento opportuno
da un sensore multispettrale e dalle
numeose foto oblique acquisite appositamente. La prospezione a terra
stata necessaria non solo per una
FDMDQHB@ U@KHC@YHNMD CDK C@SN C@
telerilevamento, ma per precisare
KD B@Q@SSDQHRSHBGD RHBGD D RSQ@SHFQ@BGD CDK RNSSNRTNKN QHUDQADQ@SD C@H
coltivi e per circoscriverne i termini
cronologici.
Il quadro geologico desunto da
cinque sondaggi e dallosservazione

di numerose sezioni esposte in scoli


agrari pu essere cos sintetizzato:
KHLHR@AAHNRHHMRTODQBHD BGDMDK
settore settentrionale (corrispondente grossomodo alle campagne
a nord della nuova tangenziale di
CQH@@QQHU@MNMN@ BLC@K
piano campagna, nel settore meriCHNM@KDMN@BL
- un livello di torba avente uno spessore di circa 20 cm, in diminuzione
OQNBDCDMCNC@MNQCUDQRNRTC
- una successione di piana di esondazione, con limi argillosi localmente (specie nel settore settentrionale)
sabbiosi con intercalazioni torbose
MN@ L DR@AAHDMHMN@ 
m (profondit massima raggiunta in
carotaggio).
La deposizione delle alluvioni
sottostanti lo strato torboso certaLDMSD KDF@S@ @KK@SSHUHS TUH@KD CDK
Po di Adria, risalente allet del Bronzo - inizio et del Ferro. Il top deposizionale di tali alluvioni costituito
C@TM@RTODQBHDNMCTK@S@ BNMTM@
bassura al piede del dosso del Po e
un alto morfologico pi a sud. I blandi dislivelli sono parzialmente livellati dal livello di torba e dalle alluvioni pi recenti post-romane.
2TKK@O@KDN RTODQBHDRNFFH@BDMte lo strato torboso sono impresse
numerose tracce di frequentazione
@MSQNOHB@ FF      -DK RDSSNQD
nord dellarea si osservano alcuni
B@M@KH @QSHBH@KH CNS@SH CH AK@MCD @Qginature, parzialmente riempiti da
materiale organico, che corrispondono perfettamente alle tracce riconoRBHTSDC@ENSN@DQDDF  +@SDQ@Kmente rispetto ai canali si riconosce
in alcuni punti un livello omogeneo,
di colore leggermente pi scuro dei
terreni sottostanti e privo di strutture pedogenetiche evidenti, con tracce di rimaneggiamento antropico e
CDKHLHS@SN@KK@A@RDC@TM@RTODQcie piuttosto netta e irregolare, che
stato interpretato come uno strato arativo sepolto. Nel settore meridionale, allinterfaccia fra alluvioni e
torbe sono stati rinvenuti in alcuni
punti abbondanti frammenti di laterizi, ceramica e frustuli di concotto
@SSQHATHAHKH@KKDONB@QNL@M@F 
In contemporanea alla realizzazione delle osservazioni stratigraBGD D CDH RNMC@FFH CH BTH RNOQ@ 
la survey si svolta in modo estensivo su una buona parte dellarea
campione prescelta, su una serie

di campi arati, o in corso di aratura,


collocati ad E della via Spolverin. La
ODQKTRSQ@YHNMDCDKKDRTODQBHUHRHAHKH
non dava la possibilit di recuperare materiale diagnostico, se non un
FDMDQHBNQTLNQDCHENMCNBNRSHSTHSN
da frustulame di et moderna. Invece losservazione delle sezioni esposte portava al riconoscimento delle
formazioni che davano ragione delle
estese tracce da foto aerea. Le radici
CDKKD OH@MSD ODQBDOHRBNMN TM CHDrente apporto di acqua e nutrienti
BGDFDMDQ@K@L@STQ@YHNMDCHDQDMziale in risposta agli intagli e riempimenti del suolo agrario sepolto di
et romana.
La geometria di tali formazioni,
interpretabili appunto come canali
@QSHBH@KH MNMDQ@E@BHKDC@QDFHRSQ@re, in quanto le scoline moderne le
tagliano diagonalmente. Il rilievo di
una sezione, con la quale si sono potute percepire almeno le parti superiori delle sponde e dei riempimenti,
ha mostrato una larghezza di circa m
4, per una profondit stimata attraverso i sondaggi di circa 1-2 m.
I materiali archeologici associati,
visibili sia nei riempimenti dei canali, sia lateralmente ad essi (inseQHSH MDKK@ RSQ@SHFQ@@ HM E@RD DQ@MN
costituiti da frammenti di laterizi e
di ceramiche chiaramente ascrivibili allet romana. Tali frammenti
si posizionavano invariabilmente al
di sotto dello strato di argille a forte componente organica, cio sulla
testa del terzo strato individuabile
dallalto (si veda supra).
I dati acquisiti permettono dunque di stabilire che il tetto delle alluvioni del II-I millennio a.C. costituisce il piano di frequentazione di
DONB@QNL@M@ (KPT@CQNSNONFQ@BN
D RSQ@SHFQ@BN C@ MNH Q@BBNKSN ONQS@
a validare la presenza di un esteso
appoderamento di et classica posto
nellarea a sud est di Adria, costituito principalmente da fossati di scolo disposti ortogonalmente, e molto
probabilmente intercalato da strade
poderali in semplice terra battuta,
forse leggermente rilevate, a riporto,
QHRODSSN@KOH@MNBHQBNRS@MSD 0TDRSN
appare in piena sintonia con quanto gi acquisito negli scavi dei primi
anni Novanta del secolo scorso di via
Spolverin, anche se va sottolineato
che appare una novit lampiezza
del sistema centuriale da noi esplorato, che potrebbe non aver nulla da

invidiare rispetto a quelli, pure ritenuti di et romana, individuati a nord


del centro urbano e ad ovest del medesimo, nel comparto di Villadose.
Da un punto di vista prettamenSDSNONFQ@BNU@RNSSNKHMD@SNHKE@Sto che orientamenti simili compaiono in persistenza anche a nord del
Canal Bianco, sempre a est di Adria,
e che vi una certa assonanza di
NQHDMS@LDMSN BNM K@ BNRHCCDSS@ UH@
ODQ &@UDKKN HMRHDLD CH QDSSHKH QHMtracciati soprattutto da foto aerea
che alcuni ritengono possa coincidere con una via di primaria importanza), tratto suburbano a sud ovest di
Adria, e con una serie di limites ad
essa correlati nella stessa zona. Sono
appoderamenti che costituiscono un
vero e proprio sistema, nel quale la
direzione dei limiti agresti risponde
in pieno alla pendenza del terreno
D @KK@ BNMFTQ@YHNMD CDK O@DR@FFHN
fossile, caratterizzato dalla presenza di corsi dacqua in aree instabili e
tendenzialmente vallive (PERETTO
1993, p. 184).
Dopo il periodo romano larea
fu abbandonata e and impaludandosi, divenendo lambiente idoneo
alla sedimentazione organica e alla
formazione dellorizzonte torboso
che sigilla i resti archeologici di et
romana. Un sottile strato di alluvioni
dovuti a esondazioni del Po in epoca moderna ricopre il livello torboso.
Recentemente (ultimi secoli) larea
RS@S@ANMHB@S@DQDBTODQ@S@ODQTRN
agricolo.
Il problema dellabbandono del
sistema antico di appoderamento
si collega, ad Adria come altrove, al
tema della trasformazione del paesaggio altomedievale. Un dato imONQS@MSD RTK PT@KD QHDSSDQD OQNUHDne dalla datazione 14C cui stato
sottoposto un campione prelevato
dalle torbe che coprivano i livelli di
et romana nel settore meridionale
dellarea di indagine (sondaggio A
2-3, limo organico torboso, profonCHS BLC@KO B F 
Il campione ha fornito la seguente
et calibrata: 240-440 d.C. Ne consegue il riferimento cronologico piuttosto preciso ad un periodo che si trova
al centro del dibattito attuale sullabbandono delle campagne tardoantiche. Molti recenti interventi tendono
a focalizzare lattenzione sul periodo
tardoantico a cavallo tra V e VI secolo,
ma non va sottovalutato il fatto che si

vplivala vegetacija, in jih kronoloko


Q@YONQDCHKHM@@RNUMHBN
Sledi kratek povzetek geoloke
podobe na podlagi petih sondiranj in
NO@YNU@MI@SDUHKMHGONR@LHMHGNCkritih odsekov v odmakalnih jarkih:
- /DDM@ HKNUHB@ M@ ONUQIT  JH U
severnem delu (kar ustreza poljem
severno od nove obvoznice Adrie)
RDF@ CN FKNAHMD   BL  U ITnem pa do globine 50 cm od pohoCMDONUQHMD
2KNINSDCDADKHMDOQHAKHMNBL 
NCRDUDQ@OQNSHITFTRDS@MI@
- Poplavna ravnica, lokalno z ilovnatim muljem (predvsem v severnem
predelu), sloj peska, prepreden s
NSN CNFKNAHMD L HMMHODRDJ
do globine 3,9 m (maksimalna globina vrtine).
Naplavinski nanosi pod slojem
NSDRNMDCUNLMNONUDY@MHYQDMN
dejavnostjo rokava Po di Adria iz broM@RSDHMY@DSJ@DKDYMDCNAD *QNUni nanos sestavlja valovita povrina
Y UFQDYMIDMHL QDKHDENL NA UYMNIT
izgonskega grebena Pada in morfoKNJNFNLHKNMDJNKHJNITMDID !K@FD
UHHMRJDQ@YKHJDRNRDUDHMNL@TQ@Unale z nanosom ote in posledicami
mlajih poplavljanj po koncu rimskega obdobja.
-@ O@KDN ONUQIT  JH KDH ONC
slojem ote, so vidne tevilne sleCH @MSQNOHMD M@Q@UD RK      5
RDUDQMDL OQDCDKT NALNI@ ID NO@znih nekaj umetnih kanalov z blago
nakazanimi nasipi, delno napolnjenih z organskim materialom, ki povsem sovpadajo s sledmi, vidnimi na
YQ@MHGONRMDSJHGRK  !NMNNC
kanalov je na nekaterih mestih razONYM@UM@ GNLNFDM@ ONUQHM@ MHID
KDDHG OQDCDKNU MDJNKHJN SDLMDID
barve, brez vidnih pedogenetskih
RSQTJSTQ  R RKDCLH @MSQNOHMHG ONRDFNU  M@ J@SDQHG UYMNID LDIH OQDBDI
HRS@ ONUQHM@ MDOQ@UHKMD NAKHJD
menimo, da gre za pokopani sloj obCDKNU@KMDYDLKID 5ITMDLCDKTNALNI@RLNURKNITLDCM@OK@UHMRJHmi nanosi in oto na nekaterih mestih nali tevilne fragmente opeke,
keramike in delce toplotno obdelane
opeke (concotto) iz rimskega obdobja (sl. 50).
(RSN@RMN R OQ@UJ@Q NOHR@MHLH
stratigrafskimi posnetki in sondiraMIDL RLN NOQ@UHKH NARDM@ NO@YNU@MI@UDIDF@CDK@HYAQ@MDF@UYNQMDF@ NALNI@  JNMJQDSMN OQDNQ@MHG
njiv ali tistih, na katerih je oranje


pravkar potekalo, lociranih vzhodno od ulice via Spolverin. Pregled


NCJQHSHG ONUQHM MH MTCHK LNMNRSH
zbiranja materiala za analizo, z izjeLNMDJ@JMDF@ROKNMDF@GQTO@HY
ozadja, ki so ga sestavljali drobci iz
moderne dobe. Kljub temu pa smo
med opazovanjem odkritih predelov
prepoznali formacije, ki so potrdile
NARDMD RKDCH  Q@YUHCMD M@ YQ@MHG
posnetkih. Korenine rastlin zaradi
Q@YKHJUYDLKIHCNAHU@INUD@KHL@MI
vode in hranilnih snovi, kar privede
CNQ@YKHMDQ@RSHM@LDRSHGRS@QHGQDnih strug in zakopanih kmetijskih povrin iz rimskega obdobja.
Geometrije umetnih kanalov ni
bilo enostavno popisati, saj jih dananji odvodni kanali diagonalno
prepredajo. Iz analize preseka, s kaSDQHLIDAHKNLNFNDNO@YNU@SHUR@I
YFNQMIDCDKDAQDHMHMONKMHK@ IDQ@YUHCMN C@IDAHKJ@M@KHQNJOQHAKHMN
4 metre, ocena njegove globine na
podlagi sondiranja pa je bila pribliMN LDSQ@
Arheoloke ostaline, vidne v polMIDMIT HM ANMN NC MIHG UOHR@MH U
stratigrafski stolpec) so bile sestavljene iz drobcev opeke in keramike
ONURDL NHSMN QHLRJDF@ HYUNQ@ 2K 
9.15-16). Vsi drobci so brez izjeme
KD@KH ONC RKNIDL HKNUHBD Y LNMN
vsebnostjo organskih snovi, torej na
temenu tretjega sloja od zgoraj (glej
supra).
Na osnovi dobljenih podatkov
lahko torej ocenimo, da krovna plast
M@OK@UHMRJHG M@MNRNU HY    SHRNKDSI@ HRSN@RMN OQDCRS@UKI@ STCH SK@ 
po katerih so hodili ljudje v rimskem
obdobju. Topografski in stratigrafski
vzorci, ki smo jih zbrali, potrjujejo
CNLMDUN N NARDMH Q@YCDKHSUH YDLKIDHYJK@RHMDCNADM@ITFNUYGNCT
Adrie v tirikotna posestva, omejena
z odvodnimi jarki, po vsej verjetnosti pa so med njimi vodile tudi lokalne vozne poti iz zbite zemlje, morda
nekoliko dvignjene nad polja. Ta podoba se v celoti sklada z najdbami
HYJNONU HY Y@DSJ@ CDUDSCDRDSHG KDS
prejnjega stoletja v ulici Spolverin,
DOQ@UIDSQDA@ONTC@QHSH C@RLNRD
LDC M@HL CDKNL RNNHKH Y MNUHL
dejstvom o obsegu raziskanega centurijskega sistema, saj morebiti ta ni
MHL@MIHNCONCNAMHGRS@QNQHLRJHG
centurij, lociranih severno in zahodno od mestnega jedra v predelu
Villadose.
9 HYJKITMDF@ UHCHJ@ SNONFQ@ID

je treba poudariti, da se v podobni


RLDQHKDDDBDMSTQHIDONFNRSNONI@vljajo tudi severno od kanala Bianco
(tudi ta na vzhodnem obrobju Adrie)
in da je podobno razporeditev moFNDNO@YHSHSTCHNAS@JNHLDMNU@MH
via per Gavello (splet ravnih sledi,
UHCMHG OQDCURDL Y YQ@MHG ONRMDSkov, za katere nekateri menijo, da bi
lahko sovpadali z zelo pomembno
cestno povezavo), v jugozahodnem
predmestju Adrie ter v nizu z njo povezanih limitesUHRSDLNALNIT &QD
za posestva, ki sestavljajo kompleksen sistem, v katerem smer meja
poljedelnih povrin v celoti sovpada
Y M@FHANL SDQDM@ HM R JNMFTQ@BHIN
fosilne pokrajine, za katero so znaHKMH UNCMH SNJNUH M@ MDRS@AHKMHG HM
NAH@IMN CNKHMRJHG NALNIHG PE
RETTO 1993, p. 184).
Po koncu rimskega obdobja so se
obdelovalne povrine opustile in se
ONRSNONL@Y@LNUHQHKD J@QIDOQDCstavljalo ugodno okolje za organske
nanose in za nastanek otne ravnice, ki je pod seboj zaprla arheoloJDNRS@KHMDHYQHLRJDF@@R@ NSMN
plast prekriva tanek sloj naplavin,
ki so posledica poplavljanja Pada v
moderni dobi. V zadnjih stoletjih so
se v pokrajini opravila melioracijska
dela, izsueno zemljo pa zdaj uporabljajo v kmetijske namene.
/QNAKDL@SHJ@ NOTRSHSUD @MSHMDga sistema parcelacije je v Adrii, pa
tudi drugod, povezana s tematiko
spreminjanja srednjeveke podobe.
Pomemben podatek, ki je vsekakor
vreden razmisleka, prihaja iz datiranja 14C vzorca, odvzetega iz plasti ote, ki prekriva sloje iz rimskega
@R@UITMDLCDKTOQNIDJSMDF@NALNI@ RNMCHQ@MID     NQF@MRJ@
otna ilovica, globina 0-75 cm pod
ONGNCMN ONUQHMN  RK   RSQ@SHgrafski vzorec je pokazal naslednjo
kalibrirano starost: 240-440 n. t..
-@ONCK@FHSDF@ONC@SJ@ID@RNUM@
umestitev v obdobje, ki je predmet
SQDMTSMD Q@YOQ@UD N NOT@MIT ONYMN@MSHMHG JLDSHIRJHG ONUQHG  OQDBDIOQDBHYM@ 5Y@CMIDL@RTRNSDUHKMHRSQNJNUMI@JHOQDOQH@MH C@IDCN
tega pomembnega premika prilo v
ONYMN@MSHMDLNACNAITM@OQDGNCT
med 5. in 6. stoletjem, vendar ne gre
zanemariti dejstva, da je lo za precej dolgotrajen proces, na katerega
RN LNMN UOKHU@KH STCH KNJ@KMH CDjavniki. Zdi se, da je v Adrii prilo do
NOT@MI@JLDSHIRJHGYDLKIHOQDBDI

hitreje kot drugje, kar so med druFHL SQCHKH MDJ@SDQH RSQNJNUMI@JH D U


@RT HYJNO@ U TKHBH 2ONKUDQHM  R@I RN
bile najstareje tamkajnje najdbe iz
3. stoletja. Materiala za primerjavo
ID CNUNKI STCH HYUDM LDI@ CDDKMDga ozemlja, najdbe pa potrjujejo, da
RNRDNARDM@NALNI@BDMSTQHIRJHG
razdelitev, predvsem tista, ki so bila
bolj izpostavljena paleo okoljskim
UOKHUNL  NOT@K@ D U NACNAIT S H 
JQHYDSQDSIDF@RSNKDSI@ 
/QNTDU@MIDOQDCLDRSI@HMONCDDKI@ CQHDIDRJTO@IROQNTDU@MIDL
mestnega jedra (glej infra) s seboj
prineslo dokaze o celi vrsti agrarnih
sistemov, katerim smo poskusili pripisati starost in vrsto, pa tudi stopnjo
NGQ@MIDMNRSH HM YM@HKMNRSH @QGDNKNJHGNRS@KHM &QDY@S H HAJDRHRSDme, saj jih je oblikovala samo zemlja,
iz katere so sestavljeni, in bi jih lahko
ocenili samo kot skupek zemeljskih
OK@RSH  D NA SDL MD AH TONSDU@KH 
C@RNRDCDI@MRJNOQDOKDS@KHULQDN
M@RDKAHMRJHGBDKHB /QDHUDKHRNR@LN
kot sledi, nakazane z dananjo veFDS@BHIN @KH NCSDMJNL  JNS SDJN HM
samo posredno otipljiva stvarnost.
-IHGNU@LNIDUYCQTAH J@SDQDCDK
so, v zgodovinski stvarnosti, ki ni bila
R@LNONKID SDLUDCDKJNLOKDJRMDga sistema vodnih in kopnih poti, ki
so iz Adrie vodile na vse strani. OdKNHKMDF@ ONLDM@ U SDL RLHRKT ID
povezava z predelom Ariana, kamor
je vodil odsek Popillie, preden se je
slednja obrnila proti jugu (glej infra)
Adria 3
-@NALNIT CQHD Y@GNCMNNC
CQHD  RK   RD M@G@I@ RS@QN QDMN
korito in vrsta najdb predzgodovinskih in rimskih pokopov, dokumenSHQ@MHG Y MDONONKMHLH ONC@SJH  DY
NALNID  J@SDQDF@ SNONLHM ID Qtessura, naj bi poleg tega vodila tudi
DM@NCBDRS JHRNY@OT@KD@MSHMN
LDRSMNIDCQN HMRDJ@RMDIDOQHCQTHK@BDRSHUH@ODQ&@UDKKN -DM@Y@CMID
velja poudariti, da na celotnem obLNITY@GNCMNNC CQHDHMNAURDL
OQHLDRSMDLO@RTKDHINSDUHKM@FQNAH@ YM@M@ ID S H  MDJQNONK@ J@M@la Bianco iz predzgodovinskega in
rimskega obdobja), poleg njih pa e
tevilni infrastrukturni objekti, med
J@SDQHLH DKHLN HYONRS@UHSH TQDCHSDU
QDMDRSQTFDTLDSMHJ@M@K JHRNF@
ONSQCHKH MDC@UMH HYJNOH M@ NALNIT
bolninice (BONOMI et alii 1995).
*NSDQDDMN J@DFDNKNJ@ON-

71

Fig. 52 - Localit Artessura, oggetto del


survey nellarea Adria 3.
Sl. 52 - Adria 3. Raziskava na lokaciji Artessura.
52

Fig. 53 - Adria 3. Pulizia di sezioni stratiJUDFKHGHLGHSRVLWLDOOXYLRQDOLHVSRVWL


GDOULIDFLPHQWRGHLIRVVDWLGLERQLFD
6O$GULDLHQMHL]SRVWDYOMHQLK
prerezov v kanalih.
53

tratt di un fenomeno assai articolato


nel tempo e con forti aspetti di regionalizzazione. Il caso di Adria sembra
indicare una certa precocit rispetto
al panorama complessivo, peraltro in
accordo con quanto alcuni studiosi
avevano gi sostenuto proprio a proposito dello scavo di via Spolverin,
laddove non comparvero elementi
recenziori rispetto al III secolo d.C. I
confronti sono molteplici, anche a livello extraregionale, e testimoniano
di come larghe fasce di territorio centuriato, quelle pi esposte alle sollecitazioni paleoambientali, fossero in
CHRRDRSNFHCTQ@MSDK@BNRHCDSS@BQHsi del III secolo.
La ricerca portata sul plesso suburbano e territoriale di Adria, da
vedersi in stretta correlazione con
quella condotta sul centro urbano (si
veda infra) ha messo in evidenza una
serie di sistemi agrari di cui si cercato di appurare non solo laspetto
cronologico e tipologico, ma anche
il grado di conservazione e le caratteristiche del deposito archeologico.
2HSQ@SS@CHRHRSDLHCDANKHHMPT@MSN
RHB@LDMSD ENQL@SH C@KK@ RNK@ SDQQ@
che li costituiva e che possono essere visti in fondo come insieme di
strati, se non si volesse considerare
linsediamento di cui costituivano la
rete connettiva. Sopravvivono come
tracce evidenziate dalla vegetazione
NC@BNKNQDCHTM@QD@KSCHBHKLDMte tangibile, almeno non in modo
immediato. La loro forza linsieme
di cui fanno parte, una realt storica
che non fu solo agraria, ma porzione
di un complesso sistema di collegaLDMSHTUH@KHDSDQQDRSQHBGDBNMUDQgevano su Adria da varie direzioni.
Una parte determinante in questo
senso riveste il collegamento con la
zona di Ariano, alla quale conduceva
il tratto della Popillia diretto verso
sud (si veda infra).
Adria 3

Fig. 54 - Adria 3. Mattone di modulo meGLHYDOHGDOVXRORVRSUDODVWUDWLFD]LRne a forte componente organica.

72

Sl. 54 - Adria 3. Zidak srednjevekega


NDOXSD L] WDO QDG VWUDWLNDFLMR ] YHOLNR
vsebnostjo organskih snovi.
54

Nellarea Adria 3, a ovest di Adria,


F   RH RDFM@K@U@ K@ OQDRDMY@ CH
un paleoalveo e di una serie di rinvenimenti di sepolture protostoriche
e romane documentate da notizie
frammentarie. In questa zona, toponimo Artessura, si collocherebbe
inoltre una delle vie in uscita dalla
citt antica, che a sua volta si conMDSSDQDAAD@KK@UH@ODQ&@UDKKN 
5@HMMDRNSSNKHMD@SNHKE@SSNBGD
tutto il settore occidentale di Adria,

CNA@ YDKN HYQ@YHSN RKDC LD@MCQHMD


RS@QD QDMD RSQTFD  HQNJD   L 
napolnjene z organskim materialom
SDLMDA@QUDHMNAC@MDRODDMHLH
AQDHM@LH  2KDCMID SUNQHIN MDJNKHJN
dvignjen izgonski greben, ki pa ne
dosega enega metra viine glede na
ravnico okoli njega
Stratigrafski stolpec (sl. 53) je poCNADMSHRSDLTHYNALNI@ CQHD
,TKIHMODDMHLTKI CDADKHM@RKNI@OQHAKHMNLUONOK@UMHQ@UMHMHHM
 LNA@KTUH@KMDLFQDADMT
- Sloj, bogat z organskimi ostanki,
ki ga sestavljajo otni mulj, lokalno
ota, debeline 20-40 cm, ploskovna
Q@YHQHSDU
- Zaporedje poplavne ravnice, ki jo
RDRS@UKI@IN LTKI HM LNUHQM@ HKNUHB@
CN FKNAHMD OQHAKHMN   L NC ONGNCMDQ@UMHMD DFKNAKIDMHODRDJ
M@IUDI@FKNAHM@UQSHMDID LDSQNU
*NS ID LNFND NO@YHSH HY RSQ@SHgrafskega stolpca, se pohodna ravnina iz rimskega obdobja nahaja na
globini 1,2-1,8 m (podatek se spreminja glede na debelino aluvialnih
naplavin nad njim) in predstavlja
krovno plast aluvionalnih sedimentov Pada Adrie. Ti so pokopani pod
organsko-otno plastjo, ki naj bi, kot
smo videli v primeru vzorca, odvzeSDF@M@NALNIT CQH@ RDF@KUR@I
v poznorimsko obdobje. Organski
sloj prekrivajo kasneji nanosi, ki jih
je s seboj prinesel Pad med svojim
MDC@UMHLJNSCNJ@YTIDINYQ@MHONsnetki) poplavljanjem.
Med obirno raziskavo nekaterih preoranih njiv, kjer je bil dobro
viden sloj obdelovalne zemlje, smo
med materialom, ki je pogledal na
C@M M@KHHYJKITMNNRS@KHMDHYNACNbja po koncu srednjega veka, kar potrjuje, da so sloji obdelovalne zemlje
nastali relativno pozno. Pri kronoloJHTLDRSHSUHU@RONJNMBTQHLRJDga obdobja in srednjega veka smo
si pomagali z opazovanjem arheolokega materiala na mestu samem
HM Y Q@CHNLDSQHMN C@S@BHIN DMDF@
od vzorcev, odvzetega med sondiranjem.
$M@ NC NO@YNU@MHG SNJ ID OQDcej globok jarek, v katerem smo v
FKNAHMH OQHAKHMN   BL ONC
pohodno ravnino nali sloj svetlorI@UDF@LTKI@ JHIDONJQHU@KDYM@MN
plast organskega materiala v zgoraj
opisanem zaporedju. V vzorcu, odvzetem iz notranjosti tega sloja, smo
M@KH MDJ@I EQ@FLDMSNU NODMHG YH

dakov (sl. 54) ki bi jih lahko po naHMTNACDK@UDHMONJ@KTOTTLDRSHKH


v poznosrednjeveko obdobje (najJ@RMDID U    RSNK   D S@ ONC@tek nas lahko privede do domneve
o zgodovinskem obdobju, v katerem
so se uporabljala tla aluvialnega izUNQ@ JHRNM@RS@K@M@CNSNRKDCMI@
AH JNSSNCQHY@NALNID CQHDFK 
supra), vsaj delno lahko pripisali poznorimskemu obdobju.
Vzorec, namenjen ugotavljanju
starosti z metodo radiometrijskega
datiranja, prihaja iz segmenta A3,
RNMCHQ@MI@   M@S@MMDIDHYRKNI@
NSDUUYMNITRKNI@ODDMNLTKI@stih povrinskih slojev. Kalibrirana
C@S@BHI@F@TLD@UNACNAID
-1220 n. t. (95.4%) in ponuja nov
HM ONLDLADM DKDLDMS Y@ CNKN@MID @RNUMDF@ NACNAI@  U J@SDQDL
ID OQHKN CN ONI@U@ NOT@MI@ BDMturij, vsaj kar zadeva jugozahodni
del, pa tudi velik del ostalega podroI@ CQHD /NI@UY@LNUHQIDMI@UNALNIT CQHD  ID MDCUNLMN OQDBDI
LK@IHNCHRSDF@OQNBDR@M@ONCQNIT
CQHD   R@I F@ ID LNFND TLDRSHSH
ele v sam vrh srednjega veka. Podatek se vsekakor lepo ujema z arheolokimi najdbami artefaktov s tega
NALNI@  R@I RD RKDCMIH M@G@I@IN U
mlajih aluvionalnih slojih ote, kjer
RN M@KH EQ@FLDMSD NODJD  JH J@DIN
obdobje vsaj po 12. stoletju.
Nastanek srednjeveke pokrajine:
dolgotrajni pojav
/NC@SJHQ@YHRJ@UDUITMDLHMY@GNCMDLCDKTNALNI@ CQHDUJKITMN Y Q@YONKNKIHUHLH UHQH HY @QGDNKNJD KHSDQ@STQD M@L NLNFN@IN NANgatiti razpravo v teku, ki se ubada s
ROQDLHMI@MIDLONCNAD@MSHMHGONkrajin. Pomembne se zdijo predvsem
SQHHYSNMHBD
Centurijska pokrajina kot kratkoQNMH EDMNLDM M@ SDL ONCQNIT ID
trajal relativno malo (dve stoletji?) in
F@ ID AHKN SDJN UYCQDU@SH  JNS RD
IDONSQCHKNU CQHHY@LNUHQIDM@
ONJQ@IHM@ JNS CNKFNQNMH EDMNLDM 
MD R@LN U ONYMNQHLRJDL  O@ O@
tudi v srednjevekem obdobju. Preveriti bi bilo treba delovno domnevo
o splonem dolgotrajnem pojavu, ki
IDOQHY@CDKBDKNSMNITMNHMY@GNCMN
NALNID CQHD YY@DSJNLDU  
RSNKDSITHMR@RNLSQ@I@MI@ JNSJ@D 
skozi ves zgodnji srednji vek.
Kasneji aluvialni nanosi se lahko upotevajo kot podlaga za nasta-

nek bolj stabilne pokrajine poznega


srednjega veka kljub nedavnim poOK@U@L JHIHGONSQITIDINRS@QDQDMD
RSQTFDM@SDLONCQNIT 
Pri oblikovanju podobe srednjeveke pokrajine torej prevladujejo
CNKFNQNMH ONI@UH  JH FNUNQHIN N NARDMHG HM CNKFNSQ@IMHG NOTDMHG
OQDCDKHG NYDLKI@  J@SDQHG Y@DSJH
sovpadajo z slabim nadzorom rimskega / centurijskega sistema kmetijskih povrin.
$GULDRFHQDPHVWQHJD
arheolokega potenciala
V okviru ciljev tudije arheolokega potenciala mesta in predmestja Adrie (raziskava pripravnikov v
NJUHQT OQNIDJS@ /@QRI@C U SDJT Q@YHskovalni doktorat s poglabljanjem v
te tematike, pripravila Elisa Corr) se
je pokazala potreba po zbiranju literarnih virov predhodne arheoloke
dokumentacije. Zbrani podatki so se
vnaali v kataloki sistem (database
ONQNHK@ Y M@LDMNL SNONFQ@ERJD
TLDRSHSUD OQNIDJSMHG NALNHI  5RH
podatki so se nato arhivirali in geoQDEDQDMBHQ@KH U NJNKIT &(2 U SNJNUnem prikazu), kasneje pa dopolnili z
ostalimi geolokimi, morfolokimi in
YFNCNUHMRJHLH O@Q@LDSQH SDQ Y YQ@nimi posnetki.
/QH@M@KHYHYQ@MHGONRMDSJNURLN
RDNOQKHM@*@QSNFQ@ERJH@QGHUCDDKD
!DMDHID  HM ROKDSMN DQNENSNSDBN
Kartografskega laboratorija in GIS-a (CIRCE). Upotevali smo nekatere
fotograme iz obdobja od tridesetih
let prejnjega stoletja pa do nedavnih poletov, konkretno poletov: IGM
1931-1933, RAF 1944, GAI 1954-55,
1D5DM       .CKNHKH RLN RD  C@ ANLN TONQ@AHKH YQ@MD
ONRMDSJDHYQDK@SHUMNCNKFDF@@RNUMDF@NACNAI@ R@IRLNDKDKH@M@KHYHQ@SH ROQDLDLAD SDQHSNQHI@ U Q@YKHMHG
E@Y@G TQA@MHRSHMDF@ Q@YUNI@  1@Ylaga posnetkov je prikazala podobo
pokrajine, ki se precej razlikuje od
C@M@MID  -@IUDID ROQDLDLAD RN
vidne v mestnem tkivu. Med najbolj
HYRSNO@INHLH DKDLDMSH Q@YHRJ@UD  RN
RS@QDQDMDRSQTFD NCRDJHBDMSTQHY@BHID RKDCHKNUDJHGONRDFNU JHIHGID
ONSQDAMNDCNC@SMNOQDTHSH SDQNARDM@NALNI@ JHRDIHGCDK@LNCDQne distribucije kanalov in gradbena
dela, ki so drugje tako korenito spremenila ozemlje, e niso dotaknila.
Poleg tega smo na platformi GIS
za potrebe georeferenciranja vne-

sli podatke zemljevidov IGM iz let


1892, 1916, 1934 in 1965. Z njihovo
ONLNINRLNY@ADKDHKHROQDLDLAD
objektov in orisali proces rasti mesta.
S postopkom vektorizacije in preJQHU@MI@ SQDMTSMDF@ TQA@MHRSHMDF@
M@QS@ R SDLH YDLKIDUHCH RLN K@GJN
primerjali razvoj mesta, e posebej
RS@QDF@ LDRSMDF@ IDCQ@  U Q@YKHMHG
zgodovinskih trenutkih. To prvo seriIN ONC@SJNU M@ NRMNUH M@QSNU RLN
kasneje dopolnili s podatki analize
YFNCNUHMRJHG YDLKIDUHCNU HY #Q@Unega arhiva v Benetkah, na katerih
RN OQHJ@Y@MD YM@HKMNRSH RS@QNC@UMD
pokrajine.
Analiza geomorfoloke situacije
OQNIDJSMDF@ NALNI@ ID ONJ@Y@K@ 
da se je mesto Adria razvilo na dviFMIDMH OKN@CH U OQHLDQI@UH Y NJNlikimi depresijami (PIOVAN 2008).
Ta morfoloka posebnost analiziraMDF@ NALNI@ RD NCQ@@ STCH U ONQ@YCDKHSUH @QGDNKNJHG OQHDU@MI  5
ITMDL CDKT LDRS@ RD M@LQD YFNstijo najdbe iz obdobja antike, medtem ko analizirani podatki ne omoFN@IN HYCDK@UD CNJNMMD ONCNAD
LDRS@ U ONYMN@MSHMDL NACNAIT HM
U Y@DSJT RQDCMIDF@ UDJ@ MIMMO
2006, str. 199-216). Kognitivni okvir
za poznavanje zgodnjega srednjega
veka tako e vedno ostaja precej fraFLDMS@QDM  /NC@SJH N OQHDU@MIHG HY
tega obdobja niso dovolj zanesljivi,
da bi lahko na njihovi podlagi z goSNUNRSIN ONSQCHKH RHRSDL@SHMH NARSNI
LDRS@  *@DIN OQDCURDL M@ OKDMIDnje objektov iz preteklosti, na primer
tistega v ulici Bettola (ROBINO 2008,
str. 7-19), odstranjevanje materiala z
@MSHMHG J@M@KHY@BHIRJHG RHRSDLNU HM
uporabo elementov za gradnjo poti,
kot je to vidno v ulici S. Francesca
(ROBINO 2008, str. 7-19). Najdeni so
STCH CNJ@YH N NAMNUH BDRS HM TMHDnju objektov, ki so tam neprekinjeno
RS@KHDNCGDKDMHRSHMDCNAD @RNIHG
M@CNLDRSHKH R ETMJBHNM@KMN CQTF@nimi. Tak primer je Via Ex Riformati,
JIDQIDM@LDRSNDNARSNIDDRS@MNU@MIRJDDSQSHYQ@RK@MDJQNONK@ JHIN
lahko umestimo v 7.-8. stoletje (RO
BINO 2008, str. 7-19).
3D M@ICAD HM CQTF@ OQHDU@MI@ U
severnem delu dananjega mestneF@ RQDCH@  M@ OQHLDQ ONCYDLM@
dvorana pod katedralo Sv. Petra (CA
SAZZA   RSQ   MOTTA, BRO
GGI 1989, str. 251-255), datirana v
9.-10. stol., ki naj bi bila absida ali
kripta druge katedrale v Adrii, dajejo

73

74

come area perimetrale alla citt antica, si segnala non solo e non tanto
per la presenza di sepolture (famosa la necropoli cosiddetta del Canal
Bianco, protostorica e romana), ma
anche per la presenza di una serie
di sistemazioni infrastrutturali, con
particolare riferimento alla sistemaYHNMD CH TM @KUDN TUH@KD  B@M@KD
@QSHBH@KD BGD QHSQNU@LDMSH QDK@SHU@mente recenti, collocati nella zona
dellospedale, hanno potuto accertare (BONOMI et alii 1995).
Il quadro geologico, come detto
sopra, mostra la traccia molto evidente di un paleoalveo meandriforme ampio 10-15 m, caratterizzato da
un riempimento organico di colore
RBTQN D @MBGDFFH@SN C@ E@RBD R@Abiose corrispondenti agli argini naSTQ@KH 0TDRSHTKSHLHC@MMNNQHFHMD@C
un blando dosso alluvionale, avente
unelevazione di poco meno di 1 m
rispetto alla piana circostante.
+@ RSQ@SHFQ@@ NRRDQU@AHKD RTKKD
O@QDSHCDHENRR@SHF RHLHKD@
quella dellarea Adria 2:
- limi e limi sabbiosi per uno spessore di circa 1 m nella piana di esondazione e di 1,4 m in corrispondenza
CDKCNRRN@KKTUHNM@KD
- un livello ricco di sostanza organica
costituito da limi torbosi, localmente
torbe, avente uno spessore di 20-40
BLD@MC@LDMSNS@ATK@QD
- una successione di piana di esondazione costituita da limi e argille
O@KTRSQHMN@BHQB@ LC@KOH@MN
B@LO@FM@DC@R@AAHDMH@OQNENMCHSL@FFHNQHK@L@RRHL@OQNENMCHS
raggiunta in carotaggio 3,4 metri.
Da quanto stato possibile osRDQU@QD HM A@RD @KK@ RSQ@SHFQ@@  K@
RTODQBHD CH EQDPTDMS@YHNMD QNL@na si troverebbe a 1,2-1,8 m di profondit (valore variabile in ragione
dello spessore delle alluvioni sovrastanti) e corrisponderebbe al top
deposizionale dei sedimenti alluvioM@KHODQSHMDMSH@K/NCH CQH@ 0TDRSH
sono sepolti da un livello organicotorboso che, come abbiamo visto
nel caso del campione prelevato in
Adria 2, avrebbe unet almeno tardoromana. Il livello organico a sua
volta ricoperto da depositi pi reBDMSH CNUTSH @KKD QNSSD TUH@KH  CDKKD
quali il paleoalveo riconosciuto in
foto aerea documenta lepisodio pi
recente.
(K PT@CQN NDQSN C@KK@ survey archeologica, condotta estensivamen-

te su alcuni campi arati in perfetta


UHRHAHKHS  QDRSHSTHU@ @KK@ RTODQBHD
esclusivamente materiali post-medievali, a dimostrazione della formazione relativamente recente dei
livelli arativi attualmente coltivati.
Ulteriori elementi per una miglior
precisazione del quadro cronologico
post romano e medievale provenivano sia dalle osservazioni sul materiale archeologico in situ, sia dalla
radiodatazione di uno dei campioni
prelevati dai sondaggi.
Presso uno dei punti di osservazione, una scolina molto profonda,
vi era (a circa cm 80-100 dal p.d.c,)
uno strato di limo marrone chiaro
che copriva il consueto livello a forte componente organica, secondo la
RDPTDMY@ RSQ@SHFQ@B@ FH CDRBQHSS@
sopra. Il terreno di risulta proveniente dallinterno di tale strato, relativo
alle operazioni di pulizia cui era stata sottoposta la scolina, recava alcuMHEQ@LLDMSHCHL@SSNMHF BGD
per lavorazione e per modulo potevano ritenersi di et tardomedievale
MNM OQHL@ CDK 7((( 7(5  &H PTDRS@
osservazione poteva costituire unipotesi di lavoro nella datazione del
momento duso del livello di suolo
di origine alluvionale che si form
sopra le torbe, le quali, come si ricava ad Adria 2 (v. supra), sarebbero ascrivibili almeno a partire da un
orizzonte tardoromano.
Il campione sottoposto a radiodatazione prelevato in Adria 3 proviene dal sondaggio A3-3, precisamente dalle torbe alla base dei deONRHSH KHLNRN R@AAHNRH RTODQBH@KH 
La datazione calibrata si riferisce al
periodo 1030-1220 d.C. (95.4%),
e fornisce un nuovo quanto imporS@MSD DKDLDMSN ODQ K@ CDMHYHNMD
dellorizzonte cronologico durante
il quale si attuano i fenomeni di disRDRSNBGDMHRBNMNBNMKHMSDQDRR@QD
gran parte del territorio adriese, almeno nel comparto sud-occidentale.
Il fenomeno di impaludamento sembra in Adria 3 decisamente pi recente rispetto a quanto appurato in
Adria 2, essendo inquadrabile ormai
tra i secoli pienamente tardomedievali. Ci sembra del resto ben collimare con losservazione archeologica dei manufatti presenti nei livelli
alluvionali pi recenti delle torbe,
recanti appunto laterizi che indicano
una datazione post-quem almeno
ONRSDQHNQD@K7((RDBNKN

La formazione di un paesaggio
medievale: un fenomeno di lunga
durata
I dati raccolti durante la ricerca
sul settore meridionale e occidentale del territorio di Adria, unitamente a
quanto ricavabile dalla letteratura archeologica disponibile, permettono
di arricchire il dibattito in corso sulla
trasformazione dei paesaggi antichi.
Tre spunti sembrano importanti:
- il paesaggio romano centuriale
come fenomeno, in queste zone, di
durata relativamente breve (2 seBNKH D CH CHBHKD L@MTSDMYHNMD 
BNLDCHLNRSQ@SNHM CQH@
HKO@DR@FFHNHLO@KTC@SNBNLD
fenomeno di lunga durata, non solo
tardoromano, ma anche pienomeCHDU@KD ONRRHAHKDUDQHB@QDKHONSDsi di lavoro di un fenomeno generalizzato di lunga durata che interessa
tutto il settore meridionale e occidentale adriese, che inizi gi nel III
-IV secolo e che sembra proseguire
per tutto laltomedioevo.
Gli apporti alluvionali pi recenti possono essere considerati come
base per la formazione di un paesaggio pi stabile nel tardomedioevo,
nonostante fenomeni esondativi recenti indicati da tracce di paleoalvei
presenti in zona.
Nella formazione del paesaggio
medievale giocano insomma fenomeni di lunga durata che parlano
CHTM@AA@MCNMNCHK@QFGDE@RBDCH
territorio prolungato nel tempo, databile dallinizio del rallentamento
del controllo di impostazione romana / centuriale sui sistemi agrari.
$GULDYDOXWD]LRQHGHO
SRWHQ]LDOHDUFKHRORJLFRXUEDQR
H MH CDKKN RSTCHN CDKKD ONSDMzialit archeologiche della citt e
del suburbio di Adria (ricerca come
RS@FDHMRDMN@KOQNFDSSN/@QRI@CHM
corso un Dottorato di ricerca di approfondimento su queste tematiche, a cura di Elisa Corr) si reso
necessario acquisire la documentazione archeologica edita pregressa,
inserendo le informazioni in un sistema di schedatura (database reK@YHNM@KD  M@KHYY@SN @K ONRHYHNM@LDMSNSNONFQ@BNCDHRHSH 3TSSHHC@SH
sono stati quindi archiviati e georeferenziati in ambiente GIS (secondo
una rappresentazione puntiforme)
e successivamente integrati da altri
parametri di tipo geologico, morfo-

KNFHBN RSNQHBND@DQNENSNFQ@BN
Per lo studio delle foto aeree
sono stati consultati lArchivio CartoFQ@BN CDKK@ 1DFHNMD CDK 5DMDSN1 e
lAerofototeca on line del LaboratoQHNCH"@QSNFQ@@D&(2"(1"$ 2NMN
stati presi in considerazione alcuni
fotogrammi che vanno dagli anni 30
MN@HUNKHOHQDBDMSHHMO@QSHBNK@QDH
voli: IGM 1931-1933, RAF 1944, GAI
1954-55, ReVen 1983, 1987, 2008.
Si scelto di analizzare delle foto aeree comprese in un arco cronologico
piuttosto ampio per analizzare i cambiamenti del territorio durante le diverse fasi di sviluppo urbanistico. La
fotointerpretazione ha evidenziato
un paesaggio assai diverso dalla realS@SST@KD BNMCDKKDCHDQDMYDLNKSN
evidenti soprattutto nel centro urbano. Tra gli elementi pi caratterizzanti
emersi da questa indagine compaiono paleoalvei, tratti di centuriazione,
tracce antropiche da approfondire e
zone ancora non intaccate dalle opere di canalizzazione moderna e dallo
sviluppo edilizio attuale che ha profondamente cambiato il territorio.
Sono state inoltre georeferenziate allinterno della piattaforma GIS le
tavolette IGM del 1892, 1916, 1934
e 1965, per rilevare le trasformazioMH CDFKH DCHBH D CDKHMD@QD KDRO@Msione del complesso urbano. La vettorializzazione e la sovrapposizione
di queste carte al PRG attuale ha
reso possibile la comparazione nelle diverse epoche dello sviluppo del
centro urbano e, in particolare, del
BDMSQN RSNQHBN  0TDRS@ OQHL@ RDQHD
di dati di ordine planimetrico sono
stati integrati con lanalisi di carte
storiche presenti presso lArchivio di
Stato di Venezia, che hanno evidenziato particolari caratteristiche del
paesaggio antico.
Dallanalisi della situazione geomorfologica dellarea oggetto di ricerca inoltre emerso che la citt
di Adria si sviluppata in una zona
rilevata rispetto alle aree depresse circostanti (PIOVAN 2008). La
distribuzione delle attestazioni archeologiche trova riscontro con la
morfologia dellarea rilevata. Nella
zona meridionale della citt si concentrano infatti i dati relativi allet
antica mentre per la Tardantichit e
per linizio del Medioevo i dati analizzati non permettono di tracciare
TMPT@CQNCDMHSHUNQDK@SHUN@KK@sionomia urbana (MIMMO 2006, pp.


LHRKHSH C@IDAHKNSNONCQNIDM@MDJ
M@HM@JSHUMNSTCHUSDGRSNKDSIHGCA
SAZZA 2001).

Fig. 55 - Carta Archeologica del noto. Indicazione schematica e puntiforme delle


attestazioni (elaborazione C. NEGRELLI).

6Y%D]LOLMY$ULDQX3ROHVLQH
(cn, ta, an, pm)

Sl. 55 - Arheoloki zemljevid najdb. ShePDWVND QDYHGED LQ QDYHGED Y WRNDK


vseh potrditev (izdelal C. NEGRELLI).

Uvod
Sv. Bazilij se nahaja na obalnem
ONCQNIT Y@J@SDQDF@IDYM@HKDMRHRSDLRS@QHGCTMHMAKHMIDRS@QNTRSID
enega od rokavov Pada (sl. 2, 55). Izbiri te lokacije za projekt Parsjad so
botrovali dokazi o dolgotrajni priRNSMNRSH KNUDJ@ NC DKDYMD CNAD
pa vse do pozne antike/zgodnjega
RQDCMIDF@UDJ@ (YDSQT@MRJDF@NACNAI@RNMDJ@SDQDM@ICADYYDLKIH
okoli posestva Forzello in zahodno
od njegovih poslopij. V rimskem obdobju je bilo na tem mestu, ob cesti med Ravenno in Oglejem, eno od
BDRSMHG ONHU@KH  mansio Hadriani,
okoli njega pa je zrasla precej obseM@M@RDKAHM@LDC@QGDNKNJHLHHYkopi na posestvu Forzello v letih od
1977 do 1980 je na dan pogledalo
veliko rimsko poslopje). Iz poznoanSHMDF@ HM YFNCMIDRQDCMIDUDJDF@
obdobja so temelji kultnega objekta
ROQHO@C@INNJQRSHKMHBN JHRNIHGNCkrili med nedavnimi izkopi na posestvu Forzello in so zdaj razstavljene
v tamkajnjem muzeju na prostem,
NARSNID@L@IGM@BDQJDU@2U !@YHK@
pa je iz sredine srednjega veka.
-@RDKAHM@ ID HLDK@ D NC RUNIHG
Y@DSJNUHYQ@YHSNETMJBHINNABDRSMDF@ONHU@KH@ J@QIDQ@YUHCMNHYMIDMDKDFDNARSHHT@MSHMDF@QNJ@U@
Pada in z njim povezanih kanalov ter
na prehodnem mestu ob obalni rimski cesti proti Adrii in obalnem podaljku ceste proti Ogleju (Popillia),
sicer zamaknjene nekoliko bolj proti robu obale in lagune. Izjemnega
ONLDM@ ID STCH SQCNHUNRS SD M@RDKAHMD JHIDOQDHUDK@DC@KDUYFNdnji srednji vek in v obdobja za njim,
Y@Q@CH DR@Q AH RH URDJ@JNQ Y@RKTHK@
posebno obravnavo. V zadnjih letih
ID M@LQD OQHKN CN URD UDIDF@ Y@nimanja za nastanek novih obalnih
RQDCH RDUDQMDF@ )@CQ@M@ NC "Nmacchia do Benetk) na prehodu med
pozno antiko in zgodnjim srednjim
vekom in v tem kontekstu bi Sv. Bazilij lahko predstavljal neodkrit raziskovalni inkubator rezultatov srednjega veka v rimskem obcestnem
ONHU@KHT

55

Arheoloka uvrstitev
V Sv. Baziliju so se v preteklosti
NOQ@UHKH SDUHKMH RHRSDL@SHMH HYJNOH
ONKDF SDG RN M@ NALNIT NJNKH MIDF@ NCJQHKH STCH SDUHKM@ OQHDU@MI@ 
J@QONSQITID C@MDFQDR@LNY@UDRKNIMN  O@ O@ STCH Y@ YDKN NARDMN
M@ICHD 
Iz predrimskega obdobja so
NRS@MJH M@RDKAHMD HY DKDYMD CNAD 
6.-5. stol. pr. n. t. (VITALI, SALZANI
2002), ko se je na celotnem obalnem
ONCQNITNC2OHMDCN CQHDDQ@YUHI@K@SQFNUHM@RDYLNQRJHLHCDDK@LH 
V rimskem obdobju se je poseljenost preselila nekaj sto metrov jugovzhodno, kjer je zrasel velik objekt
LDRSMN ONCDDKRJ@ UHK@  NCJQHS U
sedemdesetih letih preteklega stoletja na posestvu Forzello (BUSANA
2002, str. 251-256 z literaturo). Ta

veliki stavbni kompleks s stanovanjskimi in proizvodnimi krili (slednje


ID KNBHQ@MN U CNKHMH UD JNS  L
po osi S-J z dolgim jarkom irine 5-6
L J@DO@STCHDKDLDMSDRQDCMIDF@
in poznega rimskega cesarstva, vsaj
iz obdobja do 5.-6- stoletja. NedaKD RSQ@M OQNSH UYGNCT RN MDC@UMH
izkopi (leta 2005 in kasneje) na posestvu Forzello tik ob cesti (SP 44),
JH SDD NA J@M@KT !QDMS@  NCJQHKH SDLDKID LNFNMDF@ ONRKNOI@  LNQC@
GNQQDTL JHM@IAHRKTHKRJK@CHDMIT
HS@QHB 1@YLHRKHSHIDUQDCMNNLNMH
ONUDY@UHRONHU@KHDLL@MRHN'@driani na zgodovinskem zemljevidu
Tabula Peutingeriana, kar pa seveda
ne zmanja zgodovinsko - arheolokega pomena lokacije. Izkopi naLQDNCJQHU@INONJNO@KHDHYONYMD
antike in zgodnjega srednjega veka,

ki je povezano z ostanki krstilnice in


O@KDNJQ@MRJD BDQJUD  -@RDKAHM@
O@STCHRHBDQMHAHK@NOTDM@UYFNdnjem srednjem veku, saj obstajajo
iz tega obdobja tevilni dokazi o njeMHONRDKHSUHHMMTLHYL@SHMDM@ICAD 
5   RSNK  RLN OQH@ M@RS@MJT
MNUDF@ UDQRJDF@ RQDCH@ D MDJNliko bolj vzhodno od pravkar opisanih krajev. Srednjeveka cerkev Sv.
Bazilija e danes dominira nad aglomeratom z nekoliko dvignjene plo@CH ENRHKMD RHOHMD  JH ID OQDHUDK@
YQ@UM@U@MIDYYDLKIN J@SDQDQSDURN
sicer bile dune v pasu stare obale.
Tudi v tem primeru so nedavni izkopi
(1994-1998, TUZZATO 2001) v njeMH MNSQ@MINRSH OQHJ@Y@KH Q@YKDMIDMN
Y@ONQDCIDQ@YUNI@BDQJUDONCC@M@MIN RSQTJSTQN KDH L@MI@ BDQJUDM@
zasnova z dvema absidama in tlemi

75

199-216). Il quadro conoscitivo per


let altomedievale risulta piuttosto
frammentato. Non sono presenti tra
le attestazioni dati rilevanti che perLDSS@MN CH @DQL@QD TMN RS@MYH@mento sistematico. Le attestazioni
riguardano spoliazioni di precedenSHDCHBH BNLDPTDKKNCHUH@!DSSNK@
(ROBINO 2008, pp. 7-19), spoliazioni di antichi impianti fognari e utilizzo di elementi di reimpiego nella realizzazione di camminamenti,
come attestato in via S. Francesco
(ROBINO 2008, pp. 7-19). Sono state individuate anche ristrutturazioni di strade e spoliazioni di strutture che mantenevano una continuit
MC@KKDSDKKDMHRSHB@RNRSHSTHSDBNM
nuove destinazioni duso. il caso di
Via Ex Riformati, dove su una precedente zona di abitato viene impiantata una necropoli riconducibile al
VII-VIII secolo d.C. (ROBINO 2008,
pp. 7-19).
Grazie a questi rinvenimenti e ad
altre attestazioni nella parte settentrionale del centro urbano attuale,
come laula sotterranea rinvenuta
nella cattedrale di S. Pietro (CASAZ
ZA   O   MOTTA, BROGGI
  OO     C@S@S@ @K (7 7
secolo ed interpretata come abside o cripta della seconda cattedrale
di Adria, inducono a ipotizzare che
questarea sia stata in qualche modo
attiva anche in questi secoli (CASAZ
ZA 2001).

Fig. 56 - Ubicazione delle osservazioni nel


sito di San Basilio (elaborazione T. ABB).
6O   0HVWD RSDDQM QD ORNDFLML 6DQ
Basilio (izdelal T. ABB).

56

Fig. 57 - Le tracce rilevate nelle foto aeree con lubicazione delle trivellate. Il
SUROR VWUDWLJUDFR GL )LJ   EDVDWR
sulle osservazioni SB13-20 (elaborazione T. ABB e A. NINFO).
6O   6OHGL YLGQH QD ]UDQLK SRVQHWNLK ] ORNDFLMR YUWLQ 6WUDWLJUDIVNL SURO
QDVOWHPHOMLQDRSDDQMLK6%
(izdelala T. ABB in A. NINFO).

6.4. San Basilio di Ariano Polesine


(cn, ta, an, pm)
57

Introduzione

76

Il sito di San Basilio inserito in


un ambiente costiero caratterizzato
da un sistema di paleo-dune e dalla vicinanza dellantica foce di uno
CDHQ@LHCDK/NFF   +@RBDKS@
di questarea per il progetto Parsjad
motivata dalla documentata frequentazione antropica per un lungo intervallo temporale, dallet del
Ferro alla tarda antichit/alto medioevo. Allepoca etrusca risalgono
alcuni reperti rinvenuti nelle campagne della tenuta Forzello ad ovest
CDFKH DCHBH CDKK@YHDMC@  (M DONB@
romana questa localit era la sede
di una stazione di posta, la mansio
Hadriani, lungo la via tra Ravenna
e Aquileia ed era attorniata da un
nucleo insediativo piuttosto esteso
TM FQ@MCD DCHBHN QNL@MN  RS@S@

messo in luce da scavi archeologici


DDSST@SHMDKK@SDMTS@%NQYDKKNSQ@FKH
anni 1977 e 1980). Al periodo tardoantico ed altomedievale risalgono le
ENMC@YHNMHCHTMDCHBHNCHBTKSNBNM
annesso battistero, venute a giorno
in occasione di scavi recenti sempre
nella tenuta Forzello ed ora adibite a
museo allaperto, mentre la chiesetta medievale di San Basilio risale ai
secoli centrali del Medioevo.
Linsediamento sembra racchiuCDQD M C@H RTNH DRNQCH TM@ BGH@ra funzione itineraria, da ravvisarsi
nella presenza di un incrocio tra un
antico ramo del Po, con canali collegati, e il punto di passaggio della via
romana costiera verso Adria e verso il prolungamento litoraneo della
strada diretta ad Aquileia (Popillia),

pi spostato sul margine litoraneo e


lagunare. Di eccezionale importanza
il prolungamento della vita del sito
nellaltomedioevo e nelle epoche
successive, temi che da soli potrebADQN BNRSHSTHQD HK KN BNMCTSSNQD CH
un progetto di studio mirato. Infatti
negli ultimi anni si assistito ad un
crescere dellinteresse verso la nascita nei nuovi centri costieri altoadriatici (da Comacchio a Venezia) tra
tarda antichit ed altomedioevo, ed
in questo contesto San Basilio potrebbe rappresentare un luogo inedito di ricerca, nel quale si produssero gli esiti medievali di un agglomerato romano di carattere itinerario.

Inquadramento archeologico
Le ricerche archeologiche svolte
nel comparto di San Basilio si sono
attuate in passato anche attraverso
una buona serie di scavi sistematici,
oltre ad una quantit di segnalazioni che gi potevano dare lidea di un
sito non solo a carattere pluristratiB@SN L@O@QSHBNK@QLDMSDDRSDRNHM
termini areali. Per let preromana va
segnalato un insediamento pertinente allet del Ferro, VI-V secolo a.C.
(VITALI, SALZANI 2002), quando tutta
larea costiera da Spina ad Adria sembra gi attiva anche in riferimento al
commercio oltremarino.
In et romana la frequentazione
si sposta qualche centinaio di metri
a SE, nel luogo presso il quale sor

HY CQNAKIDMD NODJD R OQHO@C@INHL


prostorom za pokope, ki se kasneje
raziril do svojih poznosrednjevekih in modernih dimenzij.
Geomorfoloka uvrstitev
Izvorna morfologija lokacije se
je korenito spremenila zaradi izravnavanja dun v preteklem stoletju.
Sipinski sistemi so tvorili grebene z
usmeritvijo S-J in so se dvigali nad
okoliko poplavno ravnico kar do
5-7 metrov visoko. Danes so ohranjeni samo nekateri segmenti, deloma zaradi stavb, ki so jih na njih zgradili, deloma pa tudi zaradi priznanja,
JH F@ THU@IN JNS Y@HSDM@ M@Q@UM@
NALNI@ *KITAROQDLDLA@LUOQDteklosti pa so sistemi dun e vedno
dobro razvidni na satelitskih posnetJHGY@Q@CHQ@YKHJDLDCODDMHLHCDpoziti (ki so svetleji in bolj odbijajo
svetlobo) in ilovnato-muljastim terenom med njimi.
Sipinski kordoni v Sv. Bazilu so
CDK JNLOKDJRMDF@ RHRSDL@ @MSHMHG
RSQTJSTQQDMHGCDKSLDCADMDJNK@FTMNHM"NL@BBGHDL JHOQH@INNM@predovanju (progradaciji) delte Pada
v zadnjih 4500 letih. Za strukture
CDKSD ID YM@HKM@ CUNJQHKM@ NAKHJ@ 
sestavljena iz zajede proti morju na
ustju reke in dveh stranskih kril, ki se
UYCNK NA@KD ONRSNONL@ RS@MI@S@
in ob katerih so nastali nizi sipin. To
LNQENKNJNONCNANIDLNFNDUBDKNSHOQDONYM@SHM@YQ@MDLONRMDSJT
HMNLNFN@QDJNMRSQTJBHIN@RNUMDga zaporedja nekaterih faz sedimenS@BHIDHMDQNYHIDFKDCDM@KDFNQDMDF@TRSI@HMNA@KMDQSD 
#DKS@  NA J@SDQH KDH Y@RDKDJ 2U 
Bazila, predstavlja enega najbolj nazadovanih sistemov, nastalega pred
3500-2700 leti (BONDESAN et alii
 STEFANI, VINCENZI 2005). V
@RT $SQT@MNU NA@KM@ QS@ M@IAQ
MHONSDJ@K@C@KDNCJQ@I@ J@QOQH@
NSDL C@UDKDYMHCNAHO@CRJ@CDKS@
RJNQ@IC@MHM@OQDCNU@K@ $SQT@MRJ@
naselbina se je torej nahajala za nizi
RHOHMHMUAKHHMHQDMDF@TRSI@ *@M@K
CDKSDM@OQNIDJSMDLNALNITIDANKI
ali manj sovpadal z dananjim Padom Goro. V rimskem obdobju smo
OQH@MDJNKHJNANKIHMSDMYHUMDLTM@K@F@MIT M@OK@UHM  .A@KM@ QS@ RD ID
takrat pomaknila za nekaj kilometrov
proti morju, ob njej pa so nastali novi
nizi sipin, ki jih danes lahko vidimo
vzhodno od Sv. Bazila med kraji Riv
in Magazzini. Na projektnem obmo

ITRDLDC@MSHMHLHCTM@L
2700 BP) in novejimi strukturami
CDKSD M@G@I@ OQHAKHMN  L HQNJ
O@R Y@J@SDQDF@RNYM@HKMHLTKI@RSN
ilovnati sedimenti temne barve.
Med zravnavanjem sipin so se izbrisale tudi arheoloke ostaline, ki
RNKD@KDM@OQUNSMDLONUQITDCHMN
izjemo predstavljata cervkeni objekt
Sv. Bazila in njegova neposredna
okolica, saj je bil zgrajen ravno na eni
od teh sipin in jo je tako obvaroval
pred spremembami moderne dobe.
-DJ@IUD@QSDE@JSNUIDLNFNDM@ISH
KDDNAUYMNITJNQCNMNUUYGNCMN
in zahodno od dananjega urbanega
RQDCH@  -@ICAD HY RS@QDIDF@  DSQT@MRJDF@ NACNAI@ RD M@G@I@IN M@
poljih vzhodno od posestva Forzello.
3TCHOQHDU@MI@HYQHLRJDF@NACNAI@
IDLNFNDM@ISHST O@STCHY@GNCMN
od zaselka.
Nekatere podatke o geolokem
OQNKT ONCQNI@ ID M@UDCDK BALISTA
 JHIDHLDKLNMNRSOQDFKDC@ti stene arheolokih izkopov s konca
sedemdesetih let preteklega stoletja. Avtor opisuje naslednje zaporedje: najstareji arheoloki sloj na
SDLONCQNITIDS H DSQT@MRJHKDH
na aluvialnih nanosih, ki jih prekinjajo sipinski kordoni. Prekrivajo ga
sloji naplavin mulja in peska, ki so
ONRKDCHB@ MHY@ ONOK@UKI@MI QDJD U
tem sloju so prisotne tevilne ostaKHMDKNUDJDOQHRNSMNRSHHYOQDCQHLskega obdobja (predvsem urejanje
UNC@  .OTRSHSDU NALNI@ RNUO@C@
YM@RS@MJNLLNJQHM@MIDL ROQU@
sladkovodnih z nanosi ote, kasneje
pa slankastovodnih, z nanosi lagunskega mulja. Na nekaterih mestih so
NO@YMH ODDMH RDCHLDMSH M@C RKNjem lagunskega mulja (kar bi lahko
J@Y@KN M@ J@RMDIN UMNUHMN @JSHUMNRS QDMHG SNJNU  K@GJN O@ STCH M@
stareje obalne gmote, ki so ostale
izven gladine vode v laguni). Sloj naMNRNUK@FTMRJHGLTKIDUHMODDMHG
naplavin vsebuje tevilne ostaline
iz rimskega obdobja, kot potrjujejo
NARDMD M@ICAD @QGDNKNJDF@ L@teriala. Najdbe iz patricijske vile so
NCJQHKHSTCHNAUYMNITRHOHMRJHGJNQCNMNU  JH RN AHKH U @RT  JN ID @USNQ
HYCDK@KONQNHKN DUDCMNUHsoki 5 - 6 metrov. Sloje tik pod povrIDL  JH Y@OD@SHIN Y@ONQDCID HM OQDkrivajo rimske ostaline, sestavljajo
sedimenti, ki so posledica kasnejih
poplavljanj in nanosa materiala med
sodobnimi melioracijskimi deli. Opis

RDRDUDC@M@M@@HYJKITMNM@HYJNO 
torej na polja vzhodno od posestva
%NQYDKKN @KL@MIJ@INONC@SJHNM@S@MMH KNJ@BHIH HM JUNS@G RSQ@SHFQ@Eskega stolpca.
Geoloke izmere in arheoloka
tudija
Geoloke izmere v okviru projekta Parsjad so se opravile na obRDMDL NALNIT OQHAKHMN  L
vzhodno in zahodno od mestnega jeCQ@ M@ITFTO@CNAQDHMDQNJ@U@/N
CH &NQN RK    .OQ@UHKH RLN QNMD
UQSHMDCNM@IUDIDFKNAHMDLDSQNU
od povrja. Ob prerezih korit in poljskih jarkov smo opravili stratigrafsko
analizo povrja. Namen opazovanj
je bil, preveriti na terenu obstoj nekaterih ostalin, vidnih na daljinskih
posnetkih. Pri opisu vrtin smo upotevali pedogenetske lastnosti tal,
litologijo sedimentov, stratigrafske
meje ter morebitni obstoj organskih
materialov in arheolokih ostalin.
Meritve na terenu in priprave nanje
RNUDR@RONSDJ@KDURNCDKNU@MITY
ekipo arheologov Univerze Ca Foscari, ki so nam bili v pomo, da smo
lahko geoloke raziskave usmerili v
razumevanje arheolokega konteksta analiziranih obmoij.
V okviru projekta Parsjad smo se
NCKNHKH  C@ ANLN OQDCDKT 2U  !@YHKHI@ CNCDKHKH RS@STS UYNQMDF@ NALNI@  M@ J@SDQDL AH K@GJN OQDHYJTRHKH
tudi tehnike arheoloke tudije, ki se
NRQDCNSN@INM@QDJNMRSQTJBHINNJNlja in na opredelitev arheolokega
potenciala. Uporabljena metoda je
AHK@HYJKITMNSDRSMDM@Q@UD Y@SNRD
je bolj kot na koncept intenzivnosti
SNQDIJ@JNUNRSHNRQDCNSNHK@M@DJRSDMYHUMNRSNALNI@SNQDIJNKHHMD 
kar pomeni, da smo se izognili sisteL@SHMDLT Q@YONQDI@MIT @KH FDNQDferenciaciji posameznih najdb. Raziskavo smo opravili po posameznih
OQDFKDCMHG SNONFQ@ERJHG DMNS@G
in drugi za drugo pripisali rezultate
povrinskih pregledov. Omejili smo
se torej na opazovanje in kratek zaOHR LNQDAHSMHG JNOHDMI  Q@YOQHtev / odsotnosti najdb na terenu. Z
vidika strategije del smo v skladu s
splonimi smernicami projekta ParsI@C C@KH OQDCMNRS UYNQDMIT  (YAQ@KH
smo samo tiste povrinske predele,
JHRNAHKHU@RTSTCHIDNJSNADQ CDcember 2011 in julij 2012) dejansko
dostopni, predvsem pa vidni, torej
povrine, ki so bile preorane in jih

niso pokrivale poljedelske kulture.


Zaradi potrebe po dobri vidljivosti
smo povrinske preglede omejili na
irok pas ozemlja, ki okvirno preseka
posestvo Forzello v smeri od vzhoC@OQNSHY@GNCT RHLDQRLNCNAHKH
RUNIDUQRSDM OQDRDJ  DSTCH MDOQ@UHKMDNAKHJD KDDURLDQHNCJNOMDF@
OQNSH@MSHMHNA@KMHQSH 
Zaradi navedenih dejavnikov, ki
RN UOKHU@KH M@ HYAHQN NALNI@  ID SNONFQ@ERJHYM@@IR@LNCDKDM UR@IJ@Q
Y@CDU@ JQHSDQHI HYQOMNRSH UYNQB@ Y@
@M@KHYN  *KITA SDLT ID AHKN LNFND
YAQ@SH ONC@SJD N NARDMNRSH NALNI@@QGDNKNJHGCDONYHSNU2U !@YHKHI@ OQHDLDQRLNRDUDC@LDCRDANI
primerjali podatke iz nae tudije s
tistimi, ki izvirajo iz drugih razpoloKIHUHGUHQNU
Med tirimi terenskimi obiski lokacije novembra in decembra 2011
smo opravili vrsto preverjanj, katerih
cilj je bil:
 CNKNHSH M@IUDIH NARDF M@RDKAHMD
U Q@YKHMHG YFNCNUHMRJHG NACNAIHG R
ONLNINDJRSDMRHUMDSTCHID
- ugotoviti, na kateri globini se nahajajo arheoloki depoziti tudi na
mestih, ki se jih nedavni izkopi niso
CNS@JMHKH ONRKDCHMNO@STCHMIHGNUN
stanje in stopnjo ohranjenosti
CNKNHSHRSQ@SHFQ@ERJDK@RSMNRSHRTARSQ@S@FKDCDM@NALNIDOQHNA@KMDF@
in lagunskega tipa
CNKNHSHLQDNONUDY@U UJ@SDQNRD
M@RDKAHM@ UQ@@ NC JK@RHMD CNAD
dalje, s posebnim poudarkom na vodnih poteh, ki jih nakazujejo daljinska zaznavanja in potrjujejo stare
najdbe.
Pred predstavitvijo rezultatov,
YAQ@MHG HRSN@RMN Y CQTFHLH TONQ@bljenimi raziskovalnimi metodami,
pa nekaj razmiljanj. Seznam poznanega, o katerem je bilo predhodno
govora, resda govori o naselbini, katere poselitveni vzorec je precej fraFLDMS@QDM HM SNJNUMDF@ SHO@  SNC@
naa tudija je na podlagi povrinRJHG OQDFKDCNU ONC@K@ CQTF@MN UQsto poselitvenega modela.
Kljub temu, da zaradi vrste ovir
TQA@MHY@BHI@ NALNI@ HM Y@Q@Dnost z rastlinjem in kulturami) razUHCMNRSNALNI@MHAHK@ONONKM@ O@
podoba, ki se je zarisala, govori o veliki naselbini s solidno topografsko
Q@RSIN DOQ@UIDSQDA@TONSDU@SH C@
RNQDYTKS@SHHYJKITMD@M@KHYDS H clusters JNOHDMI@ HM QDCDMI@ @QGDNKNJHGOQHDU@MIQ@IDJNSMDY@AQHR@MH

77

FDQHKFQ@MCDDCHBHNUHKK@TQA@MN
rustica?) scavato negli anni Settanta
del secolo scorso in tenuta Forzello
(BUSANA 2002, pp. 251-256 con biAKHNFQ@@  %NMC@SN HM DS @TFTRSD@ 
PTDRSNFQ@MCDDCHBHNCNS@SNCH@Oparati residenziali e produttivi (intercettato lungo lasse NS per pi di
100 m mediante una lunga trincea
larga 5-6 m), mostrava fasi medio e
S@QCNHLODQH@KH  @KLDMN MN @K 5 5(
secolo d.C. Non lontano, un poco pi
ad E, scavi pi recenti condotti dal
2005, ancora in tenuta Forzello, nello spazio antistante alla via (SP 44)
che costeggia lo scolo Brenta, hanno
intercettato le fondazioni di un granCDDHLONMDMSDDCHBHNHMSDQOQDS@SN
come horreum creato forse per il magazzinaggio di granaglie. Si impone
allattenzione il plausibile collegamento con la mansio Hadriani della
Tabula Peutingeriana, relazione che
tuttavia non esaurisce la portata storico-archeologica del sito. Infatti gli
stessi scavi stanno mettendo in luce
un nucleo funerario tardoantico ed
altomedievale a sua volta collegato
alle strutture di un battistero e di una
chiesa paleocristiana. La frequentazione, daltra parte, non sembra cessaQD @@SSN MDKK@KSNLDCHNDUN  QDB@MCN
questultima epoca tracce abitative e
reperti numismatici.
-DK 7 RDBNKN RH @RRHRSD @KK@ BQD@zione di un nuovo polo religioso, ancora pi ad E dei luoghi ora descritti.
La chiesa medievale di San Basilio
ancora oggi domina lagglomerato
dallalto di un rilievo formato da una
duna fossile sopravvissuta allopera di spianamento cui gran parte di
questa fascia paleocostiera stata
oggetto. Anche in questo caso scavi
recenti (1994-1998, TUZZATO 2001)
praticati al suo interno hanno mostrato una complessa sequenza, che
parte da una chiesa pi piccola posta sotto quella attuale, caratterizzata da un impianto a due absidi e da
una pavimentazione in cocciopesto,
MN @ Q@FFHTMFDQD KD E@RH A@RRNLDdievali e moderne con relative sepolture.
Inquadramento geomorfologico

78

La morfologia originaria del sito


stata completamente alterata a
causa dello sbancamento delle dune
avvenuto in gran parte nel secolo
scorso. Gli apparati dunali costituivano cordoni orientati mediamente

NS e raggiungevano unaltezza di
5-7 m rispetto alla piana alluvionale
circostante. Attualmente solo alcuni
segmenti sono conservati, in parte
FQ@YHD@KK@OQDRDMY@CHDCHBHBNRSQTiti su di essi, in parte grazie al loro
riconoscimento come aree di pregio
ambientale e alla loro protezione
istituzionale. Nonostante questo, i
sistemi di dune conservano una notevole evidenza nel telerilevamento
R@SDKKHS@QD  CNUTSN @KK@ MDSS@ CHDQDMY@CHQHDSSDMY@CDHCDONRHSHR@AAHNRHOHQHDSSDMSH BGH@QHDCDHSDQreni limoso-argillosi scuri nelle lame
interdunali
I cordoni dunali di San Basilio
fanno parte di un complesso sistema
di antichi apparati deltizi, estesi fra
la Laguna Veneta e Comacchio, che
documentano la progradazione del
delta padano negli ultimi 4500 anni.
Gli apparati deltizi sono caratterizzati da una geometria bialare, formata da una cuspide protesa verso
mare in corrispondenza della bocca
di foce e da due ali laterali che si assottigliano lungo la costa, sulle quali
RHRUHKTOO@MNHBNQCNMHCHCTMD 0TDsta morfologia ben riconoscibile in
foto aerea e consente di ricostruire
la cronologia relativa di alcune fasi
sedimentarie ed erosive in base alla
posizione delle bocche di foce e delle linee di costa.
Lapparato deltizio su cui situato il sito di San Basilio costituisce
uno dei sistemi pi arretrati (UPA Co
2), che viene attribuito a 3500-2700
anni fa (BONDESAN et aliiSTE
FANI VINCENZI 2005). La linea di costa di et etrusca (UPA Co 3a) non
era probabilmente lontana dal sito,
testimoniando una progradazione
del delta padano molto scarsa per
tutta lEt del Ferro. Linsediamento
etrusco si trovava dunque alle spalle di questi cordoni e nelle vicinanze
della bocca di foce. Il canale deltizio,
nellarea in esame, coincideva grossomodo con lattuale Po di Goro. In
epoca romana si assiste ad una attivit sedimentaria pi intensa con la
progradazione della linea di costa di
alcuni chilometri verso mare e alla
formazione di cordoni dunali pi
avanzati (UPA Po 3). Nellarea di interesse, fra le dune di 3500-2700 anni
BP e gli apparati deltizi pi recenti si
trova unampia zona caratterizzata
da sedimenti limoso argillosi di colore scuro (UPA Po 3).

Lo sbancamento delle dune ha


causato la cancellazione delle testimonianza archeologiche presenti
RTKK@ RTODQBHD SNONFQ@B@ NQHFHM@KD KTMHB@ DBBDYHNMD  BNRSHSTHS@
C@KKDCHBHNDBBKDRH@RSHBNCH2@M!@silio e dai suoi immediati dintorni,
che sorse appunto su una di queste
formazioni preservandola in questo
modo dalle trasformazioni di et moderna. Le concentrazioni di reperti si
trovano solo al piede dei cordoni,
ad est e ad ovest dellattuale nucleo
abitato. I ritrovamenti pi antichi, di
epoca etrusca, sono localizzati nelle
campagne ad est della tenuta Forzello. Le testimonianze di epoca romana si rinvengono sia in questa zona
sia ad ovest dellabitato.
Alcune informazioni sullassetto
geologico dellarea sono riportate
da BALISTA (1986), che aveva avuto
la possibilit di esaminare le pareti
CDFKH RB@UH @QBGDNKNFHBH CH MD @MMH
Settanta. LAutore descrive una successione cos schematizzabile. Il piano di frequentazione etrusco, che
costituisce il livello archeologico pi
antico documentato in zona, si colloca su depositi alluvionali interdigitati con i cordoni dunali. Il piano
etrusco sepolto da vari episodi di
QNSS@TUH@KDBGDCDONRHS@QNMNR@AAHDKHLNRDHMPTDRSHKHUDKKHRHNRRDQvano ancora abbondanti tracce di
frequentazione antropica pre-romana (prevalentemente sistemazioni
idrauliche). Labbandono dellarea
coincide con linstaurarsi di un ambiente palustre inizialmente di acqua dolce, con formazione di torbe, e
successivamente di acqua salmastra,
con deposizione di limi lagunari. In
alcune zone si osservano sedimenti
sabbiosi in posizione di alto rispetto
ai limi lagunari (che potrebbero indicare una ripresa successiva dellatSHUHSTUH@KD L@ONSQDAADQN@MBGD
costituire rilievi arginali pi antichi
QHL@RSH @NQ@MSH C@FKH RODBBGH C@Bqua lagunari). Il top deposizionale
dei limi lagunari e delle alluvioni
sabbiose costituisce il piano di frequentazione romano, come testimoniato da copiosi ritrovamenti di materiale archeologico. Reperti attribuibili a ville patrizie si trovavano anche sulle pendici dei cordoni dunali,
che allepoca in cui lAutore scriveva
(1986) conservavano unaltezza di
 LDSQH (KHUDKKHOHRTODQBH@KHBGD
chiudono la serie seppellendo i resti

romani sono costituiti da sedimenti dovuti a esondazioni successive


D QHONQSH CNUTSH @ ANMHBGD QDBDMSH 
La descrizione riportata riferibile
strettamente al settore in cui furoMN DDSST@SH FKH RB@UH  KNB@KHYY@AHKD
nelle campagne ad est della tenuta
Forzello. Mancano per lubicazione
precisa e i riferimenti alle quote dei
KHLHSHRSQ@SHFQ@BH
Rilevamento geologico e VXUYH\
archeologico
Il rilevamento geologico eseguito nel progetto Parsjad ha riguardato unarea estesa per circa 400 m ad
est e ad ovest del nucleo abitato e a
RTCMN@KK@QFHMDCDK/NCH&NQNF 
 2NMNRS@SDDDSST@SDSQHUDKK@SDL@MT@KHROHMSDMN@KK@OQNENMCHS
massima di 5 m dal piano campagna.
+@RSQ@SHFQ@@RTODQBH@KDRS@S@NRservata lungo i tagli delle scoline e
dei fossati agricoli. Tali osservazioni
RNMNRS@SDLHQ@SD@KK@UDQHB@@KRTNlo di alcune delle tracce osservate
mediante il telerilevamento. Nella
descrizione delle trivellate si prestato attenzione ai caratteri pedogenetici del suolo, alla litologia dei
RDCHLDMSH  @H KHLHSH RSQ@SHFQ@BH  @KK@
presenza nel sedimento di materiale organico e di reperti archeologici.
Il rilevamento in campagna e la sua
OH@MHB@YHNMD RH RNMN RUNKSH RDLOQD
in collaborazione con lquipe di archeologi dellUniversit Ca Foscari,
in modo da indirizzare le indagini geologiche alla comprensione del contesto archeologico dei siti in esame.
Nellambito del progetto Parsjad
si deciso di assegnare al comparto di San Basilio il valore di unarea
campione nella quale sperimentare
anche tecniche di survey archeologico attente sia alla ricostruzione
ambientale, sia alla determinazione
del potenziale archeologico. Il metodo utilizzato, avendo esclusivamente un valore di test, si focalizzato
sul concetto di estensivit, piuttosto che di intensit, evitando quindi
quadrettature o georeferenziazioMH ODQ QDODQSN K@ QHBDQB@ RH  RUNKS@
ODQ 4MHS 3NONFQ@BGD 1HBNFMHSHUD 
con censimento del record di suODQBHD B@LON ODQ B@LON  "H RH 
limitati cio allosservazione ed alla
registrazione sommaria di eventuali concentrazioni / dispersioni / assenze sul terreno. Dal punto di vista
della strategia di intervento si fat

in bi jih morali ovrednotiti tudi z vidika kronoloke razporeditve. e en


pomemben podatek: zbrani podatki
J@DIN C@M@RDKAHM@MHSHMHS@JNYDKN
raztegnjena ob osi S-J, kar bi kazaKN M@ MIDMN M@Q@UM@MNRS M@ @MSHMD
BDRSMDONUDY@UD O@O@J@D C@RD
razvija tudi v smeri Z-V in povezuje
NALNIDNA@KMHGCTMHMNMRSQ@MMIHG
OQNSHNA@KH JHUQHLRJDL@RTUDQIDSMNMHAHK@S@JNYDKNC@KDYNA@KMHL
Y@KDCIDL STCHI@J@D C@@QGDNKNJH
RKNIHNAH@IMNKDHINUFKNAHMHNC
do 100 cm pod dananjim povrjem,
saj lahko samo z enostavnim opazovanjem preorane zemlje najdemo
OQDBDIMIN JNKHHMN NRS@KHM JDQ@LHke in gradbeni material). V nekaterih
OQHLDQHG ID AHKN LNFND NO@YHSH NAstoj arheolokih struktur in situ (na
samem mestu), zlasti pri opazovanju
jarkov za namakanje poleg arheolokih slojev zlahka naletimo tudi na
@MSHMDSDLDKID infra).
9@Q@CH ONKN@I@ @MSHMHG HM RQDdnjevekih horizontov naj e enkrat
poudarimo, da se je na primeru Sv.
!@YHKHI@ HM OQHO@C@INDF@ NYDLKI@
projektna tudija izkazala za izjeLMNTHMJNUHSNNQNCIDOQHQDDU@MIT
prvega problema, ki bi si ga morala
zastaviti vsaka raziskava na tem poCQNIT  M@LQD M@S@MMDF@ CNKN@MI@NARDF@@MSHMHGM@RDKAHM

Fig. 58 - Quadro generale della survey


compiuta nellautunno 2011. A colori
sono evidenziate le varie Unit TopoJUDFKH 5LFRJQLWLYH FRQ JUDGXD]LRQH
nella concentrazione di reperti archeologici (elaborazione C. NEGRELLI).
Sl. 58 - Sploni pregled raziskave,
opravljene jeseni 2011. Barvno so oznaHQH UD]OLQH (QRWH WRSRJUDIVNLK SUHJledov, z ozirom na stopnjo koncentracije
arheolokih najdb (izdelal C. NEGRELLI).

Rezultati
(J=<=DG::J=AFA(9<9
3N NALNID ID AHKN D ONRDADI
zanimivo zaradi vidnih anomalij na
MDJ@SDQHG YQ@MHG ONRMDSJHG  &QD Y@
Q@UMDRKDCHUNAKHJH@MSQNOHMDF@J@nalizacijskega sistema na pravokotni
LQDH Y KDFN -n$ RK    -IHGNU@
lega je popolnoma neodvisna od daM@MIDF@ ONUQHMRJDF@ CQDM@MDF@
NLQDI@HMUOQDFKDC@MHYFNCNUHMRJH
J@QSNFQ@IHMHUQHR@M@ 
Sledi smo najprej ocenili v primerjavi s karto poznanega, predvsem pa v primerjavi z rezultati tuCHIDRK  DM@SDQDMTIDAHKNLNFND TFNSNUHSH  C@ ID RKDC FK@UMDF@
I@QJ@ ONSDJ@K@ U AKHHMH 2U  !@YHKHI@ 
YDKN AKHYT OQDBDI NARDMHG NRS@Mkov zidovja, vidnih v preseku severMD AQDHMD UNCNSNJ@ 2BNKN !QDMS@ 
Dolga vrsta debelih zidov se nahaja
U KHMHIH CNKHMD UD JNS  LDSQNU 
9HCNUHRNAHKHNHSMNNCQDY@MHLDC
izkopom umetnega kanala. StruktuQD J@DIN LNFNMD SDLDKID HY KDRDMHGO@KHR@C M@J@SDQHGKDHINJKDSJDY


58

malto zalitega drobirja opeke in kaLMNU LDCMIHLO@RNUQRSDNODM@tih ali kamnitih zidakov ali pa velikih
kvadratnih blokov iz trahita.
1@YHRJ@U@  NOQ@UKIDM@ ITMN NC
namakalnega kanala Brente na preCDKT M@J@SDQDF@RNNONYNQHKHDNOHR@MHYQ@MHONRMDSJH J@DJNMBDMSQ@BHINQHLRJHGHMONYMN@MSHMHGNRS@KHM 
razporejenih po pasu dimenzij priAKHMN  W  L  Y NRIN 2 ) HM
usmeritvijo proti severu, torej predstavlja idealni podaljek arheoloJDF@NALNI@%NQYDKKNJQRSHKMHB@HM
RSQTJSTQD OQHO@C@INDGNQQDTLT 3Npografsko se ta cluster nahaja vzhoCMNNCI@QJNU OQDONYM@UMHGM@YQ@MHGONRMDSJHG DOQ@UIDSQDA@ONTC@riti, da zaradi sedanje ceste in kanaK@  JH F@ OQDJQHU@S@  MH LNFND HLDSH
jasne slike o topografskem razmerju
LDC MIHLH  $M@JN SD@UMN ID UYONstaviti morebitno povezavo z arheNKNJHL NALNIDL HM R RSQTJSTQ@LH

tako imenovane ville, odkrite konec


sedemdesetih let preteklega stoletja.
Zaradi rezultatov daljinskega zaznavanja in tudije se je med stratigrafskim pregledom na terenu opraUHKNQNMHGUQSHM NCJ@SDQHGIHGID
AHKN  HYAQ@MHG OQDMN M@ FK@UMN
RKDC TLDSMDF@ J@M@K@ BHKI CDI@UMNsti je bil, opredeliti sedimente in doKNHSHUDKHJNRSSDQONRJT@SHTFNSNUHSH
izvor in zgodovinsko obdobje uporabe (sl. 59).
Ob zunanjih robovih sledi so vidni ilovnati mulj do 70-90 cm globine pod pohodne ravnine, otni mulj
in ota v globini od 70-90 cm do
130-190 cm, temni organski mulj z
veliko vsebnostjo rastlinskih ostanJNU  OQDOQDCDM R S@MJHLH HK@LH ODRJ@ CN FKNAHMD  L M@IUDI@ CNRDDM@FKNAHM@  QGDNKNJ@OQHDU@MI@
RN RJNQ@CI@ U UDHMH NALNI@ NCRNtna, izjema je ibka koncentracija v
pravkar opisanem pasu Z-V.

5 OQDMDL RSQ@SHFQ@ERJDL OQDQDzu sledi (sl. 59) je vidno naslednje


zaporedje od zgoraj navzdol:
- do globine 70-80 cm od topografskega povrja se nahaja sterilni ilovM@SH LTKI  DM@JN JNS RLN NCHS@KH U
OQNKTHYUDMRKDCH
- med 70-80 cm in 100-110 cm, loJ@KMNCNBL IDOQHRNSDMRKNINSD
ONCRKNIDLNSDKDHHKNUM@SHHMODDMH LTKI  U@RHG Y MNQL@KMHL RSNpnjevanjem, bogat z rastlinskimi
NRS@MJH JHM@QNATRKDCHCNRDD 
m, v osrednjem delu pa 5 metrov
globine. V teh plasteh so razprene
arheoloke najdbe, predvsem drobci
opeke in concotta (toplotno obdelane opeke), ki se najdejo do globine
1,9-2,1 m po vsej irini preseka, venC@QUDKHJNANKIM@JNOHDMNUNAQNAMDLONKN@ITM@RDUDQMHRSQ@MH -@IFKNAKIN M@ICAN OQDCRS@UKI@ JDQ@LHM@QDOHMI@ UDQIDSMNHYDSQT@MRJDF@ NACNAI@  5 AKHHMH RDUDQMD RSQ@-

79

80

to leva sul concetto di campionatura,


coerentemente con lassetto generale della ricerca Parsjad, scegliendo
solo quelle fasce di terreno che al
momento della survey (ottobre dicembre 2011 e luglio 2012) erano di
fatto accessibili e soprattutto visibili, cio arate e non coperte da manti
colturali. Tenuto conto dellesigenza
di visibilit, le ricerche si sono poi
concentrate su di una larga fascia,
grosso modo intersecante la tenuta
Forzello e proiettata verso E e verso W, in modo da ottenere una sorta
di transetto sia pure irregolarmente
orientato dallentroterra alla linea di
costa antica.
Ne consegue il carattere di parziaKHSSNONFQ@B@CDKK@QHBDQB@DDSST@ta, almeno in ordine ad un criterio di
ricognizione esaustiva del sito. Nondimeno stato possibile raccogliere
dati inerenti lestensione areale dei
depositi archeologici di San Basilio,
incrociando ovviamente il dato da
survey a quello proveniente dalle altre indagini e fonti a disposizione.
Durante 4 sopralluoghi compiuti
tra novembre e dicembre 2011 sono
RS@SDDRDFTHSDTM@RDQHDCHUDQHBGD
volte a:
- individuare lareale di massima
espansione dellinsediamento nelle
sue varie epoche mediante una survey estensiva
- stabilire la profondit dei depositi
archeologici anche nelle zone non
toccate dai recenti scavi, e di conseguenza lo stato ed il grado di conservazione degli stessi
- determinare le caratteristiche straSHFQ@BGDCDKRTARSQ@SNHMQHEDQHLDMto allarea costiera e lagunare
- individuare la rete itineraria nella
quale linsediamento appare organicamente inserito dallet classica,
con particolare riferimento a quelle
vie dacqua che sembrano indiziate
sia dal telerilevamento, sia da vecchi
rinvenimenti.
Prima di esporre i risultati conseguiti concorsualmente alle altre metodiche di ricerca applicate, opportuno esporre qualche considerazione. Se infatti la carta del noto di cui si
parlato sopra avrebbe potuto dare
limpressione di un insediamento caratterizzato da un pattern abbastanza frammentario e puntiforme, le riBNFMHYHNMH CH RTODQBHD G@MMN ODQLDRRN CH HMCHUHCT@QD TM CHDQDMSD
tipo di modello insediativo.

Bench la visibilit non fosse


completa per la presenza di una
serie di ostacoli dovuti da una parte allurbanizzazione, dallaltra alle
coperture vegetazionali, limmagine
che sembra emergere parla a favore di un grande insediamento in soRS@MYH@KDBNMSHMTHSSNONFQ@B@ @Mche se va tenuto in conto che la sola
analisi dei clusters e delle dispersioni tende ad appiattire un dato che
invece dovrebbe essere sottoposto
al vaglio della scansione cronologiB@  +HMRDCH@LDMSN BNR CDMHSN  @Ktro dato di interesse rilevante, non
appare pi che tanto allungato lunFN TM @RRD -2 QHDSSDMSD HK RHRSDL@
itinerario dei percorsi antichi, ma
sembra svilupparsi pure in direzione
W-E, mettendo in collegamento larea delle dune (ed oltre, verso il litorale che in et romana non doveva
essere molto lontano) con linterno
retrocostiero. La survey mostra che
generalmente i livelli archeologici si
trovano tra i 50 e i 100 cm di profondit dal piano di campagna, essendo
facilmente individuabili con la sola
osservazione discrete quantit di reperti (ceramiche e materiali costruttivi) dai campi arati. In alcuni casi
RS@SNONRRHAHKDUDQHB@QDK@OQDRDMY@
di strutture archeologiche ancora in
situ, soprattutto attraverso losservazione delle scoline e dei fossati, che
spesso intercettano antiche fondaYHNMH NKSQD @KKD RSQ@SHB@YHNMH @QBGDologiche (infra).
Vista dunque la posizione dei
piani antichi e medievali va ribadito che nel caso di San Basilio e del
suo territorio la survey si dimostra
BNLD LDYYN DRSQDL@LDMSD DB@ce in ordine ad un primo problema
che la ricerca dovrebbe porsi, quello dellesatta determinazione areale
dellinsediamento.
Risultati
Settore adiacente allargine del Po
0TDRSN RDSSNQD G@ CDRS@SN O@Qticolare interesse a causa di vistose
anomalie riscontrate in alcune foto
aeree. Si tratta di tracce rettilinee
aventi laspetto di un sistema di canalizzazioni antropiche disposte tra
loro ortogonalmente con un orientaYHNMD -n$ F    +@ KNQN NQHDMtazione totalmente indipendente
C@KK@ QDSD CH CQDM@FFHN RTODQBH@KD
odierna e non trova riscontro nella
B@QSNFQ@@RSNQHB@DR@LHM@S@ 

La traccia stata valutata, in primis, in rapporto alla carta del noto


e soprattutto ai risultati della surveyF  &HRTKB@LONRHONSDU@
constatare che la traccia principale
dellinvaso si avvicina al nucleo abitato di San Basilio proprio in corrispondenza di notevoli strutture murarie visibili in sezione sulla sponda
settentrionale dello Scolo Brenta.
Una lunga serie di muri di grosso
spessore si colloca su di un fronte
di pi di 100 m di lunghezza. Chiaramente tagliate dalle operazioni di
escavazione del canale, tali strutture mostrano imponenti fondazioni
@ O@KHB@SD KHFMDD RT BTH ONFFH@MN
vespai a pezzame laterizio e lapideo
annegato in malta, oltre a porzioni di
alzato in mattoni oppure ottenute da
grossi blocchi squadrati in trachite.
La survey condotta a sud dello
scolo Brenta, su parte dellappezzamento occupato dalle tracce aeree
gi descritte, mostra una concentrazione di materiale romano e tardoantico distribuito su di una fascia W-E
di circa 60/70 x 200 m, proiettata
verso N, cio esattamente in continuit ideale con larea archeologica
del Forzello (battistero e strutture relative allhorreum 3NONFQ@B@LDMSD
questo cluster viene a porsi ad E delle
canalizzazioni riscontrabili nella foto
aerea, anche se va ribadito che non
possibile rendersi conto dei rapporti
SNONFQ@BH SQ@ KD CTD DMSHS @ B@TR@
della copertura attuata dalla strada e
dal canale attuali. Lo stesso problema
si pone riguardo alleventuale rapporto con larea archeologica e con le
strutture della cosiddetta villa scavaS@@KK@MDCDFKH@MMH2DSS@MS@CDKRDcolo scorso.
Alla luce dei risultati del telerilevamento e della survey, la campagna
CHQHKHDUNRSQ@SHFQ@BNRH@UU@KR@CH
13 carotaggi manuali, dei quali 11
disposti trasversalmente alla princiO@KDSQ@BBH@CHB@M@KD@QSHBH@KD BNM
lobiettivo di caratterizzarne i sedimenti e le dimensioni e nel tentativo
di determinarne lorigine e lepoca di
TSHKHYYNF  
Allesterno della traccia si osserU@MN KHLH @QFHKKNRH MN @   BL
dal piano campagna, limi torbosi e
torbe da 70-90 cm a 130-190 cm,
limi organici scuri ricchi di resti vegetali con sottili intercalazioni sabAHNRDMN@LL@RRHL@OQNENMCHS
raggiunta). Le testimonianze arche-

)LJ3URORVWUDWLJUDFRDWWUDYHUVR
il canale relitto osservato in foto aerea
in prossimit del sito di San Basilio (vedi
JSHUXELFD]LRQH  HODERUD]LRQH7
ABB e P. MOZZI).
6O   6WUDWLJUDIVNL SURO VNR]L JODYQL
umetni kanal iz rimskega obdobja (gl.
sliko 57 za lokacijo) (izdelala T. ABB in
P. MOZZI).

ologiche sono assenti in quasi tutto


il settore e presentano una debole
concentrazione nella fascia W-E descritta poco sopra.
-DKOQNKNRSQ@SHFQ@BNSQ@RUDQR@KD@KK@SQ@BBH@F  RHQHRBNMSQ@K@
seguente successione, dallalto verso il basso:
MN@ BLC@KK@RTODQBHDSNONFQ@B@UHRNMNKHLH@QFHKKNRHRSDQHKH 
BNLDQHKDU@SN@KKDRSDQMNCDKK@SQ@BBH@
- fra 70-80 cm e 100-110 cm, localmente 150 cm, presente un livello
CHSNQA@
- sotto il livello torboso, ci sono limi
argillosi e sabbiosi, talvolta con gradazione normale, ricchi di resti vegetali, che raggiungono la profondit di 2,5 m presso il limite della
traccia e 5 m nella parte centrale. In
questi livelli sono presenti in modo
sparso reperti archeologici costituiti
per lo pi da frammenti di laterizi e
BNMBNSSH  QHMUDMTSH MN @KK@ OQNENMdit di 1,9-2,1 m in tutta la larghezza della sezione ma nettamente pi

59

MHBD ID STCH OQDBDIM@ JNKHHM@ Q@Yprenih slano- ali slankastovodnih


koljk, med prepoznanimi vrstami
so Ostrea, Bittium in Cerastoderma,
JHRNRHBDQYM@HKMHY@K@FTMRJHG@AHS@SOK@RSHLTKI@KDHINYNRSQNKNDMN
spodnjo mejo na drobnem pesku z
visoko vsebnostjo sljude.
2SQ@SHFQ@I@ @MNL@KHID SNQDI NCstopa od okolikih rezultatov po vsebovanih arheolokih ostalinah in laFTMRJHGJNKIJ@G ,NMDF@KHSNKNJDga odstopanja od okolikih sedimentov ni opaziti. Fragment lesa, odvzet
v globini 2,05 m pod pohodno ravnino je pokazal radiokarbonsko starost
o @MMH " !/  J@Q TRSQDY@
J@KHAQHQ@MHRS@QNRSHOQHAKHMNOQ M 
t. - 70 n. t..
Zbrani elementi podpirajo domnevo, da gre pri glavni sledi za
umetni kanal iz rimskega obdobja.
Sondiranje njegovega brega pribliMN  LDSQNU UYGNCMN NC NOHsanega preseka je v globini 130
cm prestreglo 30 cm dolg fragment


KDR@ U M@UOHMDL ONKN@IT Y Q@UMN


NRMNUN  JH AH K@GJN TRSQDY@K JNKHJT
podporne konstrukcije stene jarka.
9DKN JNQHRSMN AH AHKN YAQ@SH D UD
podatkov s povrinskim pregledom
BDKNSMDF@ NALNI@  M@ J@SDQDL RN
se opazile anomalije (v obeh opazovalnih obdobjih, novembra 2011 in
ITMHI@ IDAHKNM@LQDNALNID
CDKNL@ONQ@DMNYLK@CHLHONRDUJH U Q@RSH @KH O@ R OQ@UJ@Q ONDSHLH
kulturami) in z izvedbo dodatnih vrSHM JHAHONI@RMHKDRSQ@SHFQ@ERJHOQNK
Predel zahodno od Sv. Bazilija
tudija, ki smo jo tudi v tem segmentu opravili ekstenzivno in s poudarkom na splonih mejah naselbine, je pokazala nekatera mesta koOHDMI@ @QGDNKNJHG NRS@KHM  -@IANKI
Y@MHLHU ONC@SDJ OQHG@I@ HY OQDMDga prereza, opravljenega v smeri iz
UYGNC@ NCCDK@ JHRDM@G@I@M@IAKHje poslopjem posestva Forzello, proti zahodu. Skrajna meja naselbine se
Q@YUHI@UYONQDCMNRBDRSN JHSDDNA

J@M@KTLDC431HMRLNCNKNHKH
OQHAKHMNLDINLDCQ@YOQDMNRSINHM
odsotnostjo materialov. Opazovalno
mesto smo zaradi hitreje raziskaUD ONKITAMN CNKNHKH M@ RJQ@IMH LDIH
SDQDM@ ANKI M@S@MM@ AH K@GJN AHK@
samo poglobljena topografska meQHSDU  *@JNQJNKH  YCH RD  C@ OQHAKHMN
s tem pasom sovpada tudi ena od
okvirnih meja naselbine.
Geoloka opazovanja, ki smo jih
izvedli predvsem znotraj zgoraj opiR@MHG NALNHI JNOHDMI@  Q@YOQHSUD J@DIN C@RDM@ONUQITNCJQHU@
ilovnati organski mulj temne barve,
ki sega do globine 50-80 cm in vseATID OQDBDIMIN JNKHHMN QHLRJDF@
arheolokega gradiva. Med 50-80
cm in 3 metri globine pod pohodno
Q@UMHMN M@IUDI@ CNRDDM@ FKNAHM@
vrtine) najdemo mehek ilovnat mulj
brez arheolokih ostalin, ki vsebuID LNUHQMHJN UDFDS@BHIN HM E@UMN 
Edinole pri sondiranju (SB4 in sl. 56)
LD@MCQHMDRKDCHONUDYNU@KMDF@J@M@K@  UHCMDF@ M@ MDJ@SDQHG YQ@MHG

posnetih, smo pod organskim muljem z rimskimi artefakti naleteli na


OQHAKHMNLCDADKNOK@RSYLTKIDL
pomeanega srednjezrnatega peska,
JHF@IDLNFNDOQHOHR@SHQDMHLRSQTgam. Ta plast je vsebovala fragmente
opeke in zdrobljenega kamna dvoLKIHUDF@ONQDJK@UFKNAHMH LRD
Y@MDOK@RSLNUHQMHJDF@LTKI@ -@
FKNAHMH BLK@GJNSNQDICNKNHmo rimskodobno pohodno ravnino.
Zaradi pogostega oranja zemlje se
arheoloki material neredko pojavi
tudi na povrju.
Na poljih zahodno, v neposreCMH AKHHMH NAQ@UM@U@MDF@ NALNI@ 
YQ@MHONRMDSJHJ@DINRKDCH JHIHGID
LNQC@LNFNDOQHOHR@SHBDRSMHHMEQ@RSQTJSTQH HM @FQ@QMH Q@YCDKHSUH RKDCH
potekajo v smeri N8O in pravokotno
na njih (sl. 60). Opazovanj na terenu
v tem sektorju nismo mogli opraviti.
Predel vzhodno od San Bazilija
Z geomorfolokega vidika je bolj
raznoliko stanje v predelu vzhodno

81

Fig. 60 - Tracce di ripartizioni agrarie


antiche nel settore posto a ovest del sito
di San Basilio.
Sl. 60 - Sledi v sektorju zahodno od loNDFLMH6DQ%DVLOLR=UGHRVRR]QDHQH
meje poligona, ki je predlagan za arheRORNR SRPHPEQR REPRMH 3RGDULWL MH
treba, da meja na severni strani zajema
WXGLXVWUH]QR]DLWQRREPRMHSURWR]godovinske lokacije in je potisnjena na
rob obalnih sipin najdlje v notranjosti.
60

82

concentrati in posizione marginale, a


ridosso del lato nord. Il reperto pi
profondo costituito da un coccio
di ceramica probabilmente di epoca etrusca. Sempre nelle vicinanze
CDK K@SN MNQC  RNMN OQDRDMSH CHTsamente conchiglie di acqua salata
NR@KL@RSQ@EQ@HFDMDQHQHBNMNRBHTSH
vi sono Ostrea, Bittium e Cerastoderma, che solitamente caratterizzano
TM@LAHDMSDK@FTM@QDHKHUDKKHKHLNRH
poggiano con un limite basale netto
RTR@AAHDMHRBHNKSDQHBBGDCHLHB@
+@ RSQ@SHFQ@@ HM BNQQHRONMCDMY@
dellanomalia maggiore si discosta
dunque dallintorno per la presenza
di reperti archeologici e di conchiglie lagunari. Non si osserva un forte
contrasto litologico con i sedimenti
circostanti. Un frammento di legno
campionato a 2,05 m di profondit
dal piano campagna ha fornito uneS Q@CHNB@QANMHN CH o @MMH
14
"!/ BGDBNQQHRONMCD@CTMDSB@librata 60 a.C.-70 d.C.
&KH DKDLDMSH Q@BBNKSH Q@NQY@MN
lipotesi che la traccia maggiore sia
TM B@M@KD @QSHBH@KD CH DS QNL@M@ 
Un sondaggio eseguito lungo il suo
margine circa 100 m ad est della se-

zione descritta, ha intercettato a 130


cm di profondit un frammento di legno di 30 cm in posizione verticale
con base piatta che potrebbe corrispondere ad un palo appartenente
ad unopera di sostegno spondale. Si
riterrebbe molto utile incrementare
i dati acquisiti mediante losservaYHNMD RTODQBH@KD CDKKHMSDQ@ YNM@
interessata dalle anomalie (che nei
due periodi di rilevamento, novembre 2011 e giugno 2012, erano in
parte coperte da colture in crescita o
appena trebbiate) e lesecuzione di
altri carotaggi per chiarire il quadro
RSQ@SHFQ@BN 
Settore a ovest di San Basilio
La survey, condotta anche in
questo comparto in modo estensivo
e con una particolare attenzione al
problema dei limiti generali dellinsediamento, mostra alcune aree di
concentrazione. Il dato pi interessante proviene da un transetto condotto da E, dal comparto pi vicino
@FKHDCHBHCDKK@SDMTS@%NQYDKKN UDQso O. Il limite dellinsediamento si
sviluppa parallelamente alla strada
che costeggia lo Scolo Brenta: tra

lUTR 4 e 7 stato possibile stabilire


allincirca il limite tra dispersione e
assenza dei materiali. Losservazione per le caratteristiche della ricerca
speditiva stata arbitrariamente appoggiata al limite del campo, e solo
una pi approfondita campagna toONFQ@B@ONSQDAADQHRTKS@QDOHOQDcisa. Ad ogni modo su questa fascia
indicativamente sembra cadere uno
dei limiti dellinsediamento globalmente considerato.
Le osservazioni geologiche, condotte essenzialmente entro le aree
di concentrazione / dispersione di
BTH RNOQ@  LNRSQ@MN BGD HM RTODQBHD @NQ@MN KHLH @QFHKKNRH NQF@MHBH
CH BNKNQD RBTQN MN @   BL CH
profondit, contenenti abbondante
materiale archeologico romano. Fra
50-80 cm e 3 m dal piano campagna (massima profondit indagata
in carotaggio) si trovano limi argillosi molli, privi di reperti e contenenti
vegetazione e faune palustri. SolaLDMSD HM TM RNMC@FFHN 2! HM F 
56) ubicato in corrispondenza della
traccia meandriforme di un canale di
rotta, evidente in alcune foto aeree,
sotto i limi organici con reperti roma-

ni si osserva un intervallo di circa 1


LCHRODRRNQDCHR@AAHDLDCHNMHKHLNRD@SSQHATHAHKH@QNSSDTUH@KH BNMtenenti frammenti di laterizi e pietra
BNMBH@CHCTAAH@@SSQHATYHNMD@ 
m iniziano i limi palustri. Alla profondit di 50-80 cm si pu dunque
individuare la base dei livelli romani. A causa del rimaneggiamento subito nel corso delle arature, i reperti
@NQ@MN BNM @AANMC@MY@ @MBGD HM
RTODQBHD 
Negli appezzamenti posti subito
a O dellarea indagata su terreno, le
foto aeree mostrano la presenza di
tracce che paiono attribuibili ad infrastrutture viarie e partizioni agrarie
pre-moderne, con orientazioni N8O
DODQODMCHBNK@QHF  (MS@KDRDSSNQDMNMRS@SNONRRHAHKDDDSST@QD
osservazioni di campagna.
Settore a est di San Basilio
Nel settore posto ad E di San BaRHKHNK@RHST@YHNMDOHCHUDQRHB@S@
dal punto di vista geomorfologico.
Nei pressi dellabitato moderno si osservano le tracce dello spianamento
delle porzioni terminali dei cordoni
di dune, ancora preservate in corrispondenza del museo e della chiesetta medievale. Sulle pareti di alcune scoline vicine a queste strutture
RS@S@NRRDQU@S@K@RTODQBHDHMBKHM@S@
delle dune sulla quale si appoggiano
limi argillosi di ambiente palustre di
acqua dolce, di colore grigio scuro
per la presenza di sostanza organica.
Un sondaggio eseguito ad un centinaio di metri dal sito ha evidenziato
che i limi organici raggiungono come
minimo 5 m di profondit e contenFNMNRSQ@SHR@AAHNRHCHQNSSDTUH@KH 
In questo settore il livello interessato da reperti archeologici romani
e tardoantichi ha uno spessore di
50-80 cm, paragonabile a quello rilevato ad ovest di San Basilio. Procedendo da San Basilio verso SE lungo
i campi adiacenti alla provinciale, il
materiale archeologico si dirada e a
circa 250-300 m dal nucleo abitato
del tutto assente.
A questa distanza iniziano inveBD @C @NQ@QD @K ENMCN CDKKD RBNKHne, a circa 1 m di profondit, limi con
abbondanti conchiglie lagunari. Le
condizioni di visibilit al momento
del rilevamento non hanno consentito di individuare i limiti superiore e
inferiore dei sedimenti lagunari, ma
stato possibile delimitarne lesten

Fig. 61 - I risultati della survey nel settore a est del sito con indicata la possibile
estensione dellarea di interesse archeologico (elaborazione C. NEGRELLI).
Sl. 61 - Rezultati raziskave v vzhodnem
VHNWRUMXORNDFLMHLQPRQDUD]LULWHYDUKHRORNR SRPHPEQHJD REPRMD SURWL
severovzhodu (izdelal C. NEGRELLI).
61

NC 2@M !@YHKHI@  5 AKHHMH LNCDQMDga zaselka so vidne sledi zravnanja


JNMMHG NCRDJNU JNQCNMNU CTM Y
YDLKIN ONR@LDYMH RDFLDMSH RN D
UDCMN NGQ@MIDMH U AKHHMH LTYDI@ HM
srednjeveke cerkvice. Na stenah
MDJ@SDQHG NCUNCMHG J@M@KNU U AKHHMHODDMHGCTMIDNO@YHSHM@FMIDMN
povrino dun, ob kateri sloni ilovnaSHLTKIHYRK@MJ@RSDF@LNUHQMHJDF@
okolja, temno sive barve zaradi prisotnosti organskih snovi. Sondiranje,
JHRLNF@NOQ@UHKHOQHAKHMNRSNLDtrov od te lokacije, je pokazalo, da
sega organski mulj najmanj 5 metrov
UFKNAHMNHMC@URDATIDODDMDRKNIDQDMHGM@OK@UHM 
V tem sektorju je sloj, ki vsebuje
QHLRJD HM ONYMN@MSHMD @QGDNKNJD
ostaline, debel 50-80 cm, kar je primerljivo s tistim, ki smo ga izmerili
zahodno od Sv Bazilija. Ko se oddaljujemo od Sv. Bazilija v JV smeri po
ONKIHG  JH KDHIN NA ONJQ@IHMRJH BDRSH 
postaja arheoloki maetrial vse bolj
QDCDJ  OQHAKHMN   L NC M@selja pa ga v celoti zmanjka. Na tej
razdalji se na dnu odvodnih jarkov
U FKNAHMH OQHAKHMN  L Y@MD ONI@UKI@SHLTKIYUDKHJNJNKHHMNK@FTMRJHG


koljk. Omejena vidljivost v trenutku


HYLDQ MH CNUNKHK@ CNKN@MI@ YFNQMID
in spodnje meje lagunskih sedimentov, zato pa smo jih lahko izmerili s
pregledom satelitskih posnetkov. Na
vzhodu in na zahodu mejijo na dva
sistema dun. Na jugu jih omejuje
dananji rokav Pada Goro, katerega
RSQTF@ONOQHAKHMHNBDMHUDQIDSMNRNUO@C@RONKN@IDLCDKTINDF@J@M@la na ustju iz rimskega obdobja. Na
severu se lagunski mulj nadaljuje
vse do mesta najdbe zidovja (SB9,
FKDIUM@C@KIDU@MIT -@SDLM@ICHT
se lagunsko rastlinje in arheoloke
ostaline nahajajo v istem sloju, nali
pa smo tudi kamen, ki se ga oprijeL@INKNO@QIH JHHUHINUNJNKITHYQ@YHSN
AQ@JHMHGUNC@
Raziskava, ki smo jo tudi v tem
segmentu izvedli na ekstenziven
M@HMRK  J@DNAHQMNNALNID
Q@YOQDMHG HM M@JNOHDMHG @QGDNKNJHG NRS@KHM  JH RD Q@YSDY@ OQHAKHMN
250/300 m vzhodno od cerkve Sv.
Bazilija. Mejo naselbine je v tej smeQHQDK@SHUMNK@GJNCNKNHSHM@ONCK@FH
podatka o povrini (meja med UTR
  HMBEQ RK  5DCUNLNU ID OQH CNKN@MIT RDUDQMD LDID

glede na analizirani presek. SegmenS@RDUDQNUYGNCMNNCBDQJUDM@LQD


RHRSDL@SHMH OQDFKDC DMNRS@UMN MH
Y@IDK DOQ@URS@OQDFKDCMHSNONFQ@Eski enoti t. 15 in 16 (razpritev preSDMN QHLRJDF@ HM ONYMN@MSHMDF@
materiala) kazali, da bi morali nadaKIDU@SH DY OQDFKDCMN LDIN U RLDQH
OQNSH RDUDQT RK    #QTF@D ONUDdano, ekipi sta nali samo navidezno
severno mejo, saj se onstran na karti
vrisane severne razmejitvene linije
pregled na terenu sploh ni opravil.
Predpostavimo lahko torej, da se
@MSHM@M@RDKAHM@M@RDUDQTQ@YSDY@
DDYLDIN JHRLNINNCHS@KH BDKN
HYUDM LDI@ NALNI@  JH ID SQDMTSMN
NYM@DMN JNS Y@HSDMN @QGDNKNJN
NALNID  -@ SN RS@MID MDONRQDCMN
J@DS@ STCH NO@YNU@KMH SNJH 2! HM
SB9bis (sl. 56 za lokacije). Tu je bilo
M@LQDLNFNDNO@YHSHNARSNIYHCNUja na mestu samem ele z opazovaMIDL ONKIRJHG I@QJNU YK@RSH M@ SNJH
SB9 se je nahajal morebitni ostanek
LNY@HMHGS@KROQHO@C@INNRSQTJSTro zidu, po rimskem vzorcu narejeno
iz zdrobljene opeke.

29CDBMCA
*KITASDLT C@RLNOQH@MDY@CNstnim podatkom, pa daljinski posnetki in informacije, zbrane na terenu,
vendarle potrjujejo paleogeografski
kontekst priobalnih pogojev, ki so se
M@ NALNIT 2@M !@YHKHI@ RK    
NGQ@MHKHLDCOQUHLSHRNKDSIDLOQ M 
t. in prvimi stoletji naega tetja.
2SQTJSTQD  Y@ADKDDMD M@ YQ@MDL ONRMDSJT ONCQNI@ U ITMDL
delu mesta, odpirajo domnevo o posredni povezavi z morjem po sistemu kanalov, ki so po vsej verjetnosti
UNCHKHCNOQHRS@MH@ $CHMNNOQ@UKIDno radiokarbonsko datiranje vodi do
domneve, da bi lahko bil ta sistem
kanalov aktiven v obdobju rimskega
HLODQHI@ 5SDL@RT JNIDAHK@NA@la precej bolj oddaljena, je bilo poCQNIDCDKNL@ONCFK@CHMNRK@MJ@RSD
vode, ki je morda v segmentih vzhoCMN  U MDONRQDCMH AKHHMH C@M@MIDga naselja, ustvarila nekaken zaliv
U Y@UDSQIT ODDMHG RHOHMRJHG JNQCNMNU  3TCH M@ICA@ J@LM@  NAKNDMDF@RRK@MNUNCMHLHJNKIJ@LH J@D
na neposredno povezavo z morjem.
.ARSNI QDMDF@ OQHRS@MH@ NA TRSIT
bi med drugim sovpadal tudi z vlogo

83

84

sione areale esaminando le immagini satellitari. Ad est e ad ovest sono


BNMM@SH C@ CTD RHRSDLH CH CTMD  
sud sono delimitati dal ramo attuale del Po di Goro, che con una certa approssimazione verosimilmente
occupa la posizione del canale di
foce attivo in et romana. A nord i
KHLH K@FTM@QH RH DRSDMCNMN MN @KK@
zona del ritrovamento delle strutture
murarie (SB9, vedi oltre). Nei pressi
di tale ritrovamento, faune lagunari
e reperti archeologici si rinvengono
negli stessi livelli ed stato trovato
anche un masso incrostato di balani, crostacei di acqua marcatamente
salmastra.
La survey, condotta anche in
questo comparto in modo estensivo
F    LNRSQ@ TM@ FQ@MCD @QD@ CH
dispersioni e concentrazioni che si
estende ad E della chiesa di san Basilio per circa 250/300 m. Se il limite dellinsediamento su questo versante appare abbastanza delineabiKD RTKK@ A@RD CDK C@SN CH RTODQBHD
KHLHSD SQ@ KD 431    D K@ 
BEQ F  TM@L@FFHNQDHMBDQSDYY@
sussiste verso N rispetto al transetto
di ricognizione. Infatti il comparto a
NE della chiesa semplicemente non
stato coperto dalle esplorazioni
RHRSDL@SHBGD DOOTQD KD 4MHS 3NONFQ@BGD 1HBNFMHSHUD MM   D 
(dispersioni di materiali prevalentemente romani e tardoantichi) mostravano di continuare oltre il limite
CH QHBNFMHYHNMD UDQRN - F    (M
altri termini esse trovavano un conMD RDSSDMSQHNM@KD RNKN @OO@QDMSD 
in quanto, oltre la loro linea di demarcazione nord riportata in carta,
la ricognizione semplicemente non
stata attuata.
dunque presumibile che linsediamento antico si estenda anchenellappezzamento pi a N rispetto
a quello da noi rilevato, peraltro in
una zona al di fuori dellarea soggetta allattuale vincolo archeologico.
0TDRSNRS@SNCHBNRDCHQDSS@LDMSD
mostrato dai punti di osservazione
2!D2!AHRF ODQTAHB@YHNMH 
0THHME@SSHRHONSTS@MNS@QDK@OQDsenza di strutture murarie in situ attraverso la sola osservazione dei fossati agricoli: in particolare nel punto
SB9 vi era un probabile resto di pavimentazione musiva associata ad una
struttura muraria costituita da pezzame di laterizi di modulo romano.

Conclusioni

Note

Pur in presenza di dati non esaustivi, le osservazioni da telerilevamento e le informazioni raccolte sul
campo indicano unampia estensione delle aree di interesse archeoKNFHBN @ 2@M !@RHKHN FF      (K
PT@CQN O@KDNFDNFQ@BN UDCD HK RHSN
di San Basilio permanere in condizioni costiere tra il primo millennio
a.C. e i primi secoli dopo Cristo. Le
strutture individuate in foto aerea
nellarea a sud del sito lasciano ipotizzare un collegamento indiretto
al mare tramite un sistema di canalizzazioni che conducevano probabilmente a una struttura portuale.
Lunica datazione al radiocarbonio
suggerisce che tali canalizzazioni
potessero essere attive in et romana imperiale. In questo periodo, con
la costa alquanto pi lontana, larea
era parzialmente occupata da specchi dacqua salmastri, che verosimilmente nel settore immediatamente
ad est dellattuale nucleo abitato
creavano una sorta di baia riparata
fra i cordoni di dune. Il ritrovamento
nei livelli archeologici di un masso
incrostato da crostacei di acqua salata suggerisce nuovamente un collegamento indiretto con il mare. LeRHRSDMY@ CH TM ONQSN TUH@KD OQDRRN
la foce sarebbe peraltro in accordo
con il ruolo di snodo commerciale e
di stazione di posta che il sito di San
Basilio ha rivestito a pi riprese nei
periodi storici in questione.
La presenza di materiali di et romana nel settore a ovest del sito di
supporto nel suggerire una probabile origine antica delle tracce da telerilevamento poste nei campi adiacenti. Per supportare ulteriormente
PTDRS@ HONSDRH  @MCQDAAD UDQHB@S@
RH@ KDDSSHU@ OQDRDMY@ CH L@SDQH@KD
@QBGDNKNFHBNHMRTODQBHD RH@K@BNerenza tra le orientazioni delle tracce e quelle delle strutture venute
alla luce nello scavo del sito di et
romana.
Nel settore orientale le maggiori
informazioni derivano dallosservaYHNMDCDKKDRTODQBHCDHB@LOH@Q@SH
e delle scoline. Limportanza dellarea testimoniata dalle concentrazioni e dispersioni di materiali prevalentemente romani e tardo antichi
e dalla presenza di strutture murarie
in situ associate ad una probabile
pavimentazione musiva.

1
Lattivit di telerilevamento e carSNFQ@@ FDNLNQENKNFHB@  RS@S@ RUNKS@
OQHMBHO@KLDMSDC@ -HMEND2 /QHLNMHK
QHKDU@LDMSNFDNKNFHBNRS@SNDDSST@SN
da T. Abb con il contributo di A. Ninfo,
%NMS@M@D/ ,NYYHKD@SSHUHSFDNLNQfologiche sono state dirette da P. Mozzi
con il contributo di A. Fontana. Alle ricerche archeologiche ed alla redazione
della carta archeologica del noto, dirette
da S. Gelichi e coordinate da C. Negrelli, hanno partecipato S. Cadamuro, che
si occupara del quadrante territoriale
pi settentrionale, C. Moine, per quello
mediano, e L. Sabbionesi, per quello meridionale. E. Corr ha svolto unattivit di
ricerca entro uno stage per la Regione
Veneto, occupandosi degli aspetti archeologici di Adria. Mario Bresolin e FranceRBN#H,@QHNG@MMNDDSST@SNTMNRS@FD
per la Regione Veneto analizzando varie
immagini telerilevate e contribuendo
@KK@ L@OO@STQ@ CDKK@MSHB@ HCQNFQ@@ SQ@
HTLH+HUDMY@D/H@UD
2
Si ringrazia il Servizio geologico
della Provincia di Venezia nella persona
della dr.ssa V. Bassan per aver consentito
laccesso ai dati geomorfologici e geologici del data base provinciale.

SQFNURJDF@HMONONSMHJDF@UNYKH@ 
JHINIDLDRSN2U !@YHKHI@UDJQ@SNCigralo v omenjenih zgodovinskih obdobjih.
Prisotne rimske ostaline v segmentu zahodno od mesta so nam
UONLNOQHNAKHJNU@MITCNLMDUDN
@MSHMDLONQDJKTRKDCHM@RNRDCMIHG
ONKIHG  JH RN Q@YUHCMD HY YQ@MHG ONsnetkov. Za dodatno podporo tej domnevi bi bilo potrebno preveriti dejanski obstoj arheolokega materiala
na povrju, pa tudi, ali v resnici obstaja povezava med smerjo teh novoodkritih sledi in ostalih struktur, ki
RNTFKDC@KDKTOQHHYJNOTM@RDKAHMD
iz rimskega obdobja.
Najpomembneje informacije v
vzhodnem segmentu so tiste, ki izhajajo iz opazovanja preoranih njiv
HMNCUNCMHGI@QJNU /NLDMNALNI@
O@ONSQITIDINM@JNOHDMDHMQ@YOQDne ostaline, predvsem iz rimskega in
ONYMN@MSHMDF@NACNAI@ SDQNRS@MJH
zidovja na kraju samem, povezani s
SDL J@QAHK@GJNAHK@LNY@HM@SK@

Opombe
1
Dela daljinskih izmer in geomorfolokega kartiranja sta v glavnem opravila
-HMENHM2 /QHLNMFDNKNJDHYLDQDID
opravil T. Abb s sodelovanjem A. Ninfo,
%NMS@M@HM/ ,NYYHY@FDNLNQENKNJD
CDI@UMNRSH O@ ID AHK Y@CNKDM /  ,NYYH R
sodelovanjem A. Fontana. Arheoloke
raziskave in pripravo arheolokega zemljevida poznanih najdi je opravil S.
Gelichi, koordiniral je C. Negrelli, pri izvajanju nalog pa so sodelovali S. CadamuQN JHIDAHKY@CNKDMY@RDUDQMHJU@CQ@MS 
C. Moine za srednji kvadrant ter L. SabbiNMDRH Y@CNKDMY@ITMHJU@CQ@MSSDQHSNrija. Elisa Corr je opravila raziskovalno
dejavnost arheolokih vidikov Adrie v
NJUHQT OQHOQ@UMHSU@ Y@ CDDKN 5DMDSN 
Mario Bresolin in Francesco Di Mario sta
UNJUHQTOQHOQ@UMHSU@Y@CDDKN5DMDSN
analizirala razline posnetke daljinskih
izmer in sodelovala pri izdelavi starodavnega poreja rek Livenza in Piave.
2
 9@GU@KITIDLN RD &DNKNJH RKTbi pokrajine Benetke v osebi g.e dr. V.
!@RR@M  JH M@L ID NLNFNHK@ CNRSNO CN
pokrajinske banke geomorfolokih podatkov.

62

63
Fig . 62 - In rosso larea ad alta intensit
di evidenze archeologiche a est del sito
di San Basilio, sulla base dei risultati
preliminari della survey.
6O   = UGHR MH R]QDHQR REPRMH
z veliko gostoto arheolokih dokazov,
vzhodno od lokacije San Basilio, kakor
so pokazali prvi rezultati raziskave.

Fig. 63 - Le aree di interesse archeologico a San Basilio.


6O$UKHRORNRSRPHPEQRREPRMH
v San Basiliu.

85


3UREOHPDWLFKHHGRSSRUWXQLWPDQDJHULDOL 3RVORYQHSUREOHPDWLNHLQSULORQRVWLSUL
per la valorizzazione del patrimonio archeologico YUHGQRWHQMXDUKHRORNHGHGLLQH
Fabrizio Panozzo

,


Obiettivo della ricerca di inquadrare lo sviluppo delle risorse archeologiche del territorio veneto del Parco Archeologico dellAlto Adriatico in
chiave di valorizzazione sostenibile
GDO SXQWR GL YLVWD HFRQRPLFR H PDnageriale. In particolare, lobiettivo
del progetto di duplice natura: da
un lato, si mira a fornire strumenti utili
per il management del patrimonio arBGDNKNFHBNC@KK@KSQN RHUNFKHNMNHMCHviduare alcune opportunit di sviluppo strategico di prodotti culturali mirati alla valorizzazione del patrimonio
archeologico dellarea. In particolare,
lanalisi si articolata in due fasi:
- la prima fase ha visto la realizzazione
di una ricerca desk sui nuovi modelli
di business che la letteratura propone
nellanalisi dei musei archeologici, approfondendo alcuni aspetti in termini
di prodotto, processo e relazioni che
listituzione museale pu instaurare
BNMHRNFFDSSHCDKBNMSDRSN
- nella seconda fase si realizzata
un9F9DAKA =D< sul sistema archeologico museale dellarea PArSJAd, focalizzando lanalisi in particolare su
alcuni dei temi emersi dalla revisione
della letteratura, tra cui la forma di geRSHNMD  KD @SSHUHS D H RDQUHYH NDQSH @K
pubblico e le collaborazioni con i soggetti del territorio.
Il capitolo si conclude con un tentativo di delineare le principali opportunit del sistema museale archeologico dellarea oggetto di studio alla
luce delle considerazioni fatte grazie
ai dati raccolti.
[

,

Il mondo dei musei deve oggi
confrontarsi con un numero sempre
maggiore di competitor provenienti
sia dal settore culturale sia dallambito dellintrattenimento. Il confronto con le nuove forme di intratteniLDMSN NDQSD @K BNMRTL@SNQD ODQ
occupare il proprio tempo libero ha
QDRN TM@ UDQ@ D OQNOQH@ RC@ ODQ H
musei di oggi cercare di raggiungere
nuovi segmenti di pubblico, come ad
esempio quello dei giovani e quella
vasta e disomogenea categoria dei
non visitatori, mantenendo al contempo il ruolo di garante del patriLNMHNKNQN@C@SN
Per quanto concerne la realt
museale archeologica veneta, escludendo lArena di Verona, le antiche
testimonianze non sembrano essere
riuscite a diventare fattori di rilevante attrattiva turistica. In particolare,
K@RHFMHB@SHU@ROHMS@@LTRD@KHYY@QD
i reperti ritrovati durante le numerose campagne di scavo attuatisi in
tutto il territorio regionale per conto
della soprintendenze e delle universit dagli anni 80 ad oggi, ha portando allapertura di musei di piccole dimensioni collocati in aree rurali
periferiche delle provincie di Rovigo,
Padova e Verona. Come sottolinea
FONTANA [1996], in una sua analisi
dedicata ai musei archeologici del
Veneto, lapertura di tali strutture
non sembra essere stata adeguatamente supportata da interventi a favore di assunzione di personale quaKHB@SN  ENQMHSTQ@ CH RO@YH @CDFT@SH 
di attrezzature e sovvenzione eco-

Fabrizio Panozzo

8


CiljOQHTINDF@Q@YHRJNU@KMDF@CDK@
je opredeliti razvoj arheolokih virov benekega dela ozemlja v pristojnosti Arheolokega parka Severnega Jadrana v smislu trajnostnega
vrednotenja z ekonomskega in poslovnega vidika. Projekt si zastavlja
dva cilja: na eni strani, ponuditi uporabna orodja za upravljanje arheoloJDCDCHHMDM@CQTFHO@ ONHRJ@SH
OQHKNMNRSHY@RSQ@SDJHQ@YUNIJTKSTQnih izdelkov, namenjenih valorizaciji
@QGDNKNJD CDCHHMD OQNIDJSMDF@
NALNI@  M@KHYNRS@MI@RLNQ@YCDlili v dve fazi:
- v prvi fazi se je opravila t.i. namizna
raziskava novih poslovnih modelov,
ki jih literatura predlaga za analizo
@QGDNKNJHGLTYDIDU UJKITMNRONglobljeno obravnavo nekaterih vidikov produkta, procesa in odnosov, ki
jih muzejska institucija lahko razvije
RRTAIDJSHUSDLJNMSDJRST
- v drugi fazi se je izvedla analiza
QD WHUHQX arheolokega muzejskeF@ RHRSDL@ M@ OQNIDJSMDL NALNIT
/ Q2) C OQHDLDQRLNRDOQDCURDL
NRQDCNSNHKHM@MDJ@SDQDSDL@SHJD JH
so se pokazale pri pregledu literature: oblike upravljanja, dejavnosti in
storitve za javnost ter sodelovanje z
subjekti na ozemlju.
/NFK@UIDRDY@JKITHRONRJTRNL
NQHR@ ONFK@UHSMHG OQHKNMNRSH Y@ @Qheoloki muzejski sistem na analiziQ@MDLNALNITM@ONCK@FHNO@@MI 
ki so se nam porodila iz zbranih podatkov.

 $   

Svet muzejskih dejavnosti se
C@MC@M@MIH RNN@ Y UDCMN UDIHL
tevilom konkurentov tako iz kulturMDF@ ONCQNI@ JNS STCH HY RUDS@ Y@bavnitva. Vedno nove oblike zabave, ki se potronikom ponujajo kot
OQHKNMNRS Y@ HYJNQH@MID OQNRSDF@
@R@  ONRS@UKI@IN C@M@MID LTYDID
pred zahteven izziv: poiskati je treba nove ciljne skupine obiskovalcev, kot so otroci in mladina pa tudi
iroka in nehomogena kategorija
yMD NAHRJNU@KBDUi HRSN@RMNO@D
naprej ohraniti vlogo garanta dediHMD JHIHLIDAHK@Y@TO@M@
Arheoloka muzejska stvarnost
M@NYDLKITCDDKD!DMDHIDJ@D C@
RS@QNC@UMHL OQHDU@MIDL Y HYIDLN
Arene v Veroni) ni uspelo, da bi poRS@K@@JSHUMHCDI@UMHJHUDIDSTQHRSHne atrakcije. V zadnjih letih smo pri@ONRODDMHyLTYD@KHY@BHIHiM@ICA 
odkritih med tevilnimi izkopi, opravljenimi od osemdesetih let preteklega stoletja do danes na vsem deDKMDLNYDLKITONCUNCRSUNLDJHO
Y@UNCNUY@U@QRSUNJTKSTQMDCDCHHMDHMTMHUDQYS@SQDMCIDOQHUDCDKCN
odprtja tevilnih manjih muzejev
M@ ODQHEDQMHG ONCDDKRJHG OQDCDKHG
pokrajin Roviga, Padove in Verone.
Kot opozarja FONTANA [1996] v eni
svojih analiz arheolokih muzejev v
CDDKH!DMDHIH O@RDNANCOQSITSDG
struktur ni namenilo dovolj sredstev
in pozornosti zaposlovanju strokovno usposobljenega osebja, zagotavljanju ustreznih prostorov in gospodarskim subvencijam [FONTANA
1996, 46].

87

88

nomiche [FONTANA 1996, 46].


I musei archeologici veneti, oltre
alla pi generale problematica legaS@@KK@RHFMHB@SHUHSCDHTRRHCHUHsitatori, presentano unelevata complessit gestionale, probabilmente
QHBNMCTBHAHKD @C TM@ RHFMHB@SHU@
burocratizzazione dellapparato museale, a sempre pi limitate risorse
DBNMNLHBN M@MYH@QHD D@CTM@FDneralizzata scarsa collaborazione
con i soggetti del contesto, che a sua
volta pu incidere fortemente sullo
sviluppo stesso dei musei.
2H RS@ @DQL@MCN RDLOQD OH K@
consapevolezza, riconosciuta dalla letteratura [MORETTI 1999] e dai
soggetti istituzionali di riferimento,
che i musei archeologici debbano
intraprendere un processo di rinnovamento, in cui la risorsa archeologica (da intendersi sito e/o museo) sia
considerata ad un duplice livello: a
livello micro, come singola organizzazione, e a livello macro, come parte integrante di un sistema territoriale ed economico pi ampio. Sembra
emergere, quindi, la necessit di una
riconcettualizzazione che incida sul
prodotto culturale, sui processi di
produzione e sugli assetti organizzativi, sia interni che esterni, e che
sia capace di decretare il passaggio
da museo oggetto a museo soggetto,
adottando un modello gestionale che
non sia solo product-oriented, principalmente impegnato nella conservazione, nello studio, nella ricerca, nella
catalogazione e nella tutela dei reperti, ma anche customer-oriented,
cio maggiormente attento ai bisogni del pubblico.
Il museo archeologico, da considerarsi un vero e proprio polo culturale, in grado di interagire con lintera comunit, e non solo con unlite
privilegiata formata principalmente
da studiosi e appassionati, imparanCN @ QHRONMCDQD HM L@MHDQ@ DB@BD
DC DBHDMSD @KKD M@KHS ENQL@SHUD
educative e sociali che si propone.
Come sottolinea BAGDAGLI [1995,
< TMLTRDNBGDUNFKH@@DQL@QD
la propria funzione socio-culturale
e assumere maggiore centralit nel
OQNOQHNSDQQHSNQHN CDUD@QNMS@QDTM@
CTOKHBD RC@ LHFKHNQ@QD HK OQNOQHN
servizio e la qualit del rapporto con
il pubblico, cercando al contempo di
QDBTODQ@QDL@QFHMHCHDBHDMY@
( O@Q@FQ@ RTBBDRRHUH OQNONMFNno un approfondimento dei concet-

ti di prodotto, processo e network,


paradigma interpretativo per la riconcettualizzazione del museo archeologico e delle risorse archeologiche stesse, prendendo in considerazione modelli manageriali presenti
nella letteratura economica dedicata
@K L@M@FDLDMS  D MDKKN RODBHBN @K
management museale, cercando di
adattarli alle peculiarit proprie del
museo archeologico.
,OSURGRWWRPXVHDOH
Iniziare lanalisi dal concetto di
prodotto museale risulta essenziale per descrivere i nuovi modelli di
business delle organizzazioni museali archeologiche, in quanto sono
OQNOQHN KD NDQSD @C DROQHLDQD K@
ragione dessere dellimpresa, in
questo caso impresa culturale, caratterizzandone lidentit [CURTOLO,
TAMMA 2009, 74], e di conseguenza
a rivestire unimportanza strategica.
Un qualsiasi cambiamento loro apONQS@SN OT LNCHB@QD K@ QDK@YHNne produttore/cliente decretando il
successo o linsuccesso del prodotto.
+NDQS@OQNONRS@C@KLTRDNCNUQDAbe essere pensata nella prospettiva
della creazione del valore del cliente, e non un output preconfezionato,
pronto alluso. Tale approccio porta il
museo a spostare lattenzione dalla
produzione allutilizzo, dal prodotto
al processo, dalla transazione alla relazione.
Le implicazioni manageriali che
derivano da questa visione del
cliente sono molteplici. Innanzitutto, necessaria una segmentazione del pubblico per una coerente
OQNFDSS@YHNMD CH NDQSD RODBHBGD 
BGD RNSSHMSDMCD TM@ CHUDQRHB@YHNne nelle modalit di accesso e fruHYHNMD CDH BNMSDMTSH HM RDBNMCN
luogo emerge la necessit di porre
attenzione anche allallestimento
dellambiente in cui viene erogato il servizio, cercando di creare un
percorso facile e ben segnalato, con
didascalie e pannelli esplicativi che
E@BHKHSHMNK@KDSSTQ@CDHQDODQSHHMMD 
la progettazione dellinterazione
SQ@ODQRNM@KDCHEQNMSNBDDHKUHRHtatore, ma anche tra questultimo e
gli altri utenti presenti al momento
della visita. A tale scopo, come sar
approfondito al paragrafo successivo, risulta di particolare rilevanza la
BTQ@CDKKNDQS@CHRDQUHYHCTQ@MSDKD
fasi che precedono la visita, imple-

mentando canali di comunicazione


BGDETMF@MNC@UDHBNKNODQK@CHTsione delle informazioni indirizzate
al cliente, aiutandolo nel processo di
scelta e co-produzione della visita.
3Q@ K@ F@LL@ CDH RDQUHYH NDQti, sar poi il visitatore a scegliere
di quali servizi usufruire, con quale
modalit e grado di approfondimento visitare la collezione, partecipando cos in modo attivo al processo
di produzione di unesperienza museale ampiamente customizzata. In
conclusione, il visitatore deve sperimentare la sensazione di assistere
ad uno spettacolo ben orchestrato,
pur rimanendo egli stesso il regista
della rappresentazione [BAGDADLI
1995, 112].
I processi di produzione
museale
Il secondo pilastro dello schema
HMSDQOQDS@SHUN M@KHYY@SN @KK@ QHBNMcettualizzazione del prodotto museale, il concetto di processo di produzione, dove con questo si intende
un insieme complesso di attivit,
hard e soft fondato su risorse materiali e immateriali, al quale partecipano pi organizzazioni e anche il
consumatore [TAMMA 1996, 7].
Lo stretto legame tra prodotti e
processi stato pi volte evidenziato nella letteratura sullinnovazione,
dove emerge come linnovazione di
processo pu portare ad uninnovazione del prodotto, e linnovazione
di prodotto porta sempre uninnovazione di processo. Nellottica di innoU@YHNMDDQHMMNU@LDMSNCDKKNDQS@
museale, ci che abbiamo chiamato
riconcettualizzazione corrisponde
essenziale al conoscere i processi
che le istituzioni museali attivano
per la realizzazione della propria offerta culturale.
Dato il complesso sistema di
attivit interdipendenti che caratterizza la produzione museale, e
la molteplicit delle relazioni che
intrattiene sia con le diverse categorie di visitatori, sia con i diversi
stakeholders, possibile individuare tre dimensioni che caratterizzaQRLSURFHVVLJHVWLRQDOLGLXQPXVHR
[BRADFORD 1994, ZAN 1999]:
@FDRSHNMDCDKLTRDNRHB@DCHQDSta, in termini di attivit, collezioni, e
NQF@MHYY@YHNMDCDKKDQHRNQRDTL@MD
b) gestione dello sviluppo del pub-

blico HMBTHBNMTHRBDSTSS@K@M@KHRH
delle prestazioni verso i diversi pubblici del museo, includendo anche
le diverse modalit tramite le quali
il museo entra in contatto, comunica
e pubblicizza le proprie attivit alla
CNL@MC@
c) gestione delle relazioni con i patron, al cui interno si inserisce lanaKHRH CDKK@ U@QH@AHKD DBNMNLHBN  nanziaria.
Nei processi di gestione del museo (a), ricadono tutte quelle attivit
core tipiche di una struttura museale: studio, conservazione, tutela,
valorizzazione, esposizione, didattica, ecc. Si tratta di attivit di natura
molto diversa e ci implica processi
CHUDQRHB@SHDBNLOKDRRH
Perch tali processi abbiano luogo necessario utilizzare una certa
quantit di risorse materiali e immateriali che partecipino con apONQSH CHDQDMSH @KK@ BQD@YHNMD CH TM
OQNCNSSN MHSN  @C DRDLOHN K@ UHRHta ha luogo se si ricorre non solo ad
unampia gamma di risorse umane
(custodi, addetti alla biglietteria, guide, ecc.) e al loro know-how, ma anche allutilizzo di strutture, impianti,
attrezzature di vario genere.
A seconda della predominanza
delle componenti materiali o immateriali possibile individuare due
dimensioni rilevanti per la creazione del prodotto museale [MORETTI
1999]: da un lato vi la standardizzazione del processo, mentre allaltro polo si pu collocare la personalizzazione dei processi, in termini di
variazione degli stessi sulla base del
grado di customizzazione del prodotto.
Il processo standardizzato viene realizzato attraverso limpiego di
tecnologie hard, soft e miste che ne
permettono la standardizzazione e
la riproducibilit di alcune componenti del servizio. bene precisare
che ci non comporta un annullamento della partecipazione della
domanda alla visita, ma al contrario,
nonostante i gradi di libert siano
ristretti in regole rigide, ai visitatori vengono delegati numerosi compiti. Analizzando sotto questottica
la produzione museale, possibile
rendersi conto che la produzione del
RDQUHYHNNDQSN@HUHRHS@SNQHOT@UDre luogo con combinazioni di capitale e lavoro che, in certi casi, richiede


Upravljanje arheolokih muzejev


CDDKD !DMDHID ID ONKDF YM@MD HM
ROKNMD SD@UD Y@Q@CH NLDIDMDF@
dotoka obiskovalcev) zelo zahtevna
M@KNF@Q@YKNFFQDONURDIUDQIDSMNRSH
poiskati v okoreli muzejski birokraciji, vedno bolj omejenih ekonomRJN M@MMHG UHQHG HM URDROKNMDL
pomanjkanju sodelovanja s subjekti
U SDL JNMSDJRST  J@Q K@GJN LNMN
vpliva na sam razvoj muzejev.
Vse bolj postaja jasno (med drugim enako trdijo tudi literarni viri
[MORETTI 1999] in pristojne institucije), da morajo arheoloki muzeji stopiti na pot prenove. V tem
procesu bo potrebno arheoloki vir
M@ICHD HM@KH LTYDI NAQ@UM@U@ti dvoplastno: na mikro-nivoju kot
ONR@LHMN NQF@MHY@BHIN  M@ L@JQN-nivoju pa kot sestavni del irega
teritorialnega in gospodarskega siRSDL@  *@D SNQDI  C@ AN ONSQDAMN
preoblikovati koncept tako, da bo
lahko vplival na kulturni produkt,
na proizvodne procese in na zunanje
in notranje organizacijske strukture,
in da bo sposoben izpeljati prehod
iz muzeja objekta v muzej subjekt z uporabo modela upravljanja,
ki ni samo product-oriented, torej
usmerjen predvsem v ohranjanje,
OQDTDU@MID  Q@YHRJNU@MID  J@S@KNFHYHQ@MIDHMU@QNU@MIDDJRONM@SNU O@
pa tudi customer-oriented, torej bolj
pozoren na potrebe javnosti.
Arheoloki muzej mora postati
OQ@UB@SNJTKSTQMNRQDCHD TRONRNbljeno za interakcijo s celotno skuOMNRSINHMMDUDR@LNROQHUHKDFHQ@no elito, ki jo sestavljajo predvsem
RSQNJNUMI@JH HM Y@MDRDMI@JH M@THSH
RD AN SQDA@  J@JN RD THMJNUHSN HM
TRODMNNCYU@SHM@HYNAQ@AQ@DU@KMD UYFNIMDHMCQTADMDBHKID JHRLN
si jih zastavili.
Kot poudarja BAGDAGLI [1995,
< RDLNQ@LTYDI JHDKHTUDKI@UHSHRUNINCQTADMN JTKSTQMNUKNFNHM
Y@UYDSHANKIUHCDMONKN@IM@RUNIDL
NYDLKIT  RNNHSH Y CUNIMHL HYYHUNL
izboljati svoje storitve in kakovost
NCMNR@YI@UMNRSIN HRSN@RMNO@HYJNQHRSHSHQDYDQUDRUNIDTHMJNUHSNRSH
V naslednjih odstavkih ponujamo poglobljeni pregled pojmov
SURGXNW, proces in RPUHMH. Gre za
razlagalno paradigmo, potrebno za
izdelavo prenovljenega modela koncepta arheolokega muzeja in arheolokih virov, pri kateri smo upotevali poslovne modele v ekonomski


KHSDQ@STQH  JH RD ONRUD@ ONRKNU@MIT 


konkretno pa muzejskemu meneCLDMST HMIHGONRJTRHKHOQHK@FNCHSH
posebnostim arheolokega muzeja.
0X]HMVNLSURGXNW
9@DSH @M@KHYN R JNMBDOSNL LTzejskega produkta je bistvenega
pomena za opis novih poslovnih
modelov muzejskih arheolokih
organizacij, saj so prav ponujeni
izdelki in storitve razlog za obstoj
vsakega podjetja (v tem primeru
ONCIDSI@  JH ySQHi JTKSTQN :CURTO
LO, TAMMA   < JDQ LT SNQDI
CNKN@IN HCDMSHSDSN  RN yOQNCTJSHi
stratekega pomena za vsako podjetje. Kakrnakoli sprememba lahko
ONRKDCHMN ROQDLDMH NCMNR LDC
proizvajalcem in uporabnikom ter
NCKN@NTRODGT@KHMDTRODGTOQNdukta. Pri muzejski ponudbi bi se
AHKN ONSQDAMN NRQDCNSNHSH M@ NAKHkovanje vrednosti uporabnika in ne
le na golo ponudbo predpakiranega,
za uporabo pripravljenega izdelka.
Tak pristop vodi muzej v preusmerjanje pozornosti od proizvodnje do
uporabe, od izdelka do procesa, od
transakcije do odnosa.
Tovrstno dojemanje kupca pa
prinaa s seboj mnogovrstne poRKDCHBD M@ ONCQNIT LDMDCLDMS@ 
/QDCURDLIDY@TRJK@IDMNM@QSNU@nje ciljane ponudbe potrebno razdeliti obiskovalce na segmente, kar
ONLDMHQ@YKHJDUM@HMTOQHRSNO@HM
uporabi vsebin. Poleg tega je treba
biti pazljiv tudi na opremo prostoQNU UJ@SDQHGRDMTCHRSNQHSDURKDCMIH
morajo biti urejeni tako, da je prehod
skozi njih enostaven in dobro oznaDM R ONCM@OHRH HM S@AK@LH Y@ K@IH
dostop do informacij o eksponatih.
Nenazadnje pa je treba zagotoviti
interakcijo med osebjem za pultom
in obiskovalci, pa tudi med njimi
in drugimi uporabniki, prisotnimi v
LTYDIT U @RT NAHRJ@  9@ CNRDF@MIDSDGBHKIDUID JNSANQ@YKNDMNU
naslednjem odstavku, bistvenega
pomena skrb za ponudbo storitev
v fazah pred samim obiskom, torej
izdelava komunikacijskih kanalov,
preko katerih bo potekal prenos informacij za obiskovalce in jim pomaF@KOQHHYAHQHHMM@QSNU@MITNAHRJ@ 
Obiskovalec bo sam izbiral, katero v paleti ponujenih storitev bo
HYAQ@KHMJNQHRSHK M@J@JM@HMHMJ@JN
poglobljeno bo obiskal muzejsko
YAHQJNKDS@JNANK@GJN@JSHUMNRN-

deloval v procesu proizvodnje po


meri oblikovane muzejske izkunje.
Skratka, obiskovalec mora dobiti
NATSDJ  C@ OQHRNRSUTID CNAQN NQJDRSHQ@MHOQDCRS@UH DOQ@UNRS@I@NM
R@LMIDMQDHRDQy:BAGDADLI 1995,
112].
Procesi muzejske proizvodnje
Drugi oporni steber razlagalne
sheme rekonceptualizacije muzejskega produkta je pojem proizvoCMDF@ OQNBDR@ Y MIHL ID LHKIDM
yY@OKDSDMHMQ@YKDMIDMRJKNOCDI@Unosti, opreme in storitev, ki temelji
na opredmetenih in neopredmeteMHGUHQHGHMOQHJ@SDQDLRNCDKTIDUD
organizacij, pa tudi potronik [TAM
MA 1996, 7].
Na tesno povezavo med produkSNLHMOQNBDRNLIDDUDJQ@SNONzorila literatura, ki obravnava inovacije: iz nje je razvidno, da inovacija
procesa lahko privede do inovacije
izdelka, da pa inovacija izdelka za
seboj vedno potegne inovacijo procesa. Iz vidika inovacije in prenove
muzejske ponudbe to, kar smo imenoveali rekonceptualizacija v bistvu ustreza poznavanju procesov, ki
jih muzejske ustanove uporabljajo
za pripravo svoje kulturne ponudbe.
Na osnovi kompleksnega sistema
RNNCUHRMHG CDI@UMNRSH  JH NYM@TID
muzejsko proizvodnjo, in mnogoteQNRSHNCMNRNU JHIHGLTYDIUYCQTIDY
Q@YKHMHLHJ@SDFNQHI@LHNAHRJNU@KBDU
HMQ@YKHMHLHMNRHKBHHMSDQDRNU IDLNFND CNKNHSH WUL GLPHQ]LMH ]QDLOQH ]D SURFHVH XSUDYOMDQMD PX]HMD
[BRADFORD 1994, ZAN 1999]:
@YHMNHMMDONRQDCMNTOQ@UKI@MID
LTYDI@ JHUJKITTIDCDI@UMNRSH YAHQJDHMNQF@MHYHQ@MIDKNUDJHGUHQNU
b) upravljanje razvoja obiskovalcev,
J@LNQRDTUQ@BDKNSDMRJKNO@M@liz storitev za obiskovalce muzeja,
UJKITMNYQ@YKHMHLHM@HMHM@UDYNvanja stikov, komuniciranja in obve@MI@I@UMNRSHNRUNIHGCDI@UMNRSHG
c) upravljanje odnosov s pokrovitelji, kamor spada analiza ekonomsko M@MMHGROQDLDMKIHUJ 
V procese upravljanja muzeja (a)
RNCHIN URD SHRSD yJKITMDi CDI@UMNRSH  JH RN YM@HKMD Y@ LTYDIRJN
ustanovo: tudija, restavratorstvo,
Y@HS@  UQDCMNSDMID  Q@YRS@UKI@MID 
CHC@JSHMD CDI@UMNRSH HSC  &QD Y@
mnogovrstne dejavnosti, ki zahtevaINQ@YKHMDHMJNLOKDJRMDOQNBDRD

Da bi lahko te procese udejaMHKH  ID ONSQDAM@ CNKNDM@ JNKHHM@


opredmetenih in neopredmetenih
UHQNU  JH M@ Q@YKHMD M@HMD OQHRODU@IN J NAKHJNU@MIT JNMMDF@ HYCDKka, na primer: za izvedbo obiska ni
ONSQDAM@ R@LN BDK@ UQRS@ KNUDJHG
UHQNURJQAMHJH NRDAID Y@CNKDMNY@
OQNC@IN URSNOMHB  UNCHH HSC  HM MIHGNUN RSQNJNUMN YM@MID  O@ O@ STCH
strukture, intalacijska oprema, razKHMDUQRSDNQNCI@HMCQTFDNOQDLD 
Glede na to, ali v storitvi prevladujejo opredmetene ali neopredmeSDMD JNLONMDMSD  K@GJN CNKNHLN
dve bistveni dimenziji priprave muzejskega produkta [MORETTI 1999]:
na eni strani standardizacija procesa, na drugo stran pa lahko umestimo personalizacijo (prilagajanje)
procesov v smislu spreminjanja le-teh glede na stopnjo oblikovanja
izdelka po meri.
Pri realizaciji standardiziranega
procesa se uporabljajo t.i. tehnologije hard, soft in tehnologije meaMDF@ SHO@  JH NLNFN@IN RS@MC@QCHY@BHIN HM LNMNRS RDQHIRJD TONQ@AD
nekaterih komponent storitve. Dobro je poudariti, da tak pristop ne
razveljavi sodelovanja uporabnikov
OQH NAHRJT Q@UMN M@ROQNSMN  JKITA
temu, da so ravni svobode omejene s strogimi pravili, se obiskovalcem e vedno zaupajo tevilne zaCNKHSUD  D LTYDIRJN OQNHYUNCMIN
analiziramo iz tega vidika, lahko
ugotovimo, da se lahko storitev
obiskovalcem ponudi kot kobinaciI@ J@OHS@K@ HM CDK@  J@Q U CNKNDMHG
OQHLDQHG Y@GSDU@ UDKHJD M@KNAD U
NOQDLN RSQTJSTQD SDQ UHRNJD JRMD
RSQNJD  @ MHID ROQDLDMKIHUD RSQNke [MORETTI< 3DLTID JNSD
Q@YKNDMN SQDA@CNC@SHDROQDLDMljivo stopnjo obnovljivosti izdelkov
in procesov, ki jo lahko zagotovimo
Y Q@YKHMHMN yNACDK@UNi NOQHIDLKIHvih komponent storitve, na primer z
vpeljavo avtomatiziranih procesov
@KH Y CNKN@MIDL OQ@UHK  RS@MC@QCNU
in parametrov interakcije med osebjem in uporabniki.
Nasprotno pa je za proces, namenjen realizaciji po meri izdelaQHJDSURGXNWD YM@HKM@ UHRNJ@ RSNpnja interakcije med proizvajalcem
in obiskovalcem. Proizvodni proces
IDDJRHAHKDM S@JNC@K@GJNOQHRKTGMDHMRDNCYNUDQ@YKHMHLY@GSDU@L
odjemnikov. Sorazmerno z vijo stoOMINHMSDQ@JBHIDRDONUD@TCDKDA@

89

90

un ingente investimento ed elevati


BNRSH RRH HM HLOH@MSH D @SSQDYY@STQD 
ma minori costi variabili da sostenere [MORETTI 1999]. A ci si aggiunge, come gi spiegato, un grado di
riproducibilit variabile presente sia
nei prodotti sia nei processi, che pu
essere ricercato agendo in misura
diversa sulle componenti tangibili
del servizio, introducendo procesRH @TSNL@SHYY@SH  CDMDMCN QDFNKD 
norme, parametri di interazione tra
personale e fruitori.
Al contrario, il processo volto alla
realizzazione di prodotti personalizzati si caratterizza per unalta interazione tra produttore e visitatore.
(KOQNBDRRNOQNCTSSHUNDRRHAHKDHM
modo tale da poter accogliere e rispondere alle varie richieste della domanda. Pi aumenta il grado
di interazione, maggiore diventa la
partecipazione del cliente al processo produttivo. Il personale gioca un
ruolo fondamentale, ed importante che esso sia adattabile alle varie
richieste. In tali situazioni, la produzione pu seguire solo in parte processi strutturati, per il resto deve far
leva sulle competenze e sulle capacit di problem solving del personaKD "H@UUHDMDPT@MCN@KKNRS@CDK
museo viene richiesta lorganizzazione di unattivit studiata ad hoc,
capace di soddisfare particolari esigenze del cliente, come per esempio
delle visite guidate e dei laboratori
didattici tesi a sviluppare particolari
tematiche, oppure mirati al coinvolgimento di persone con determinate
problematiche, come per esempio
sordo-muti e non vedenti.
Nella gestione dello sviluppo
del pubblico e della reputazione
(b), invece, importante analizzare
le tre fasi di del processo di fruizione: pre-visita, visita e post-visita.
La fase antecedente alla visita,
ovvero il tempo che intercorre tra
la valutazione delle informazioni e
delle alternative (altri prodotti o servizi che concorrono nel settore del
tempo libero) e lattuazione della visita, costituisce unopportunit per
implementare una serie di processi
che portino alla decisione da parte
CDKBKHDMSDCHDDSST@QDK@UHRHS@ ENQnendo tutti gli strumenti utili per la
preparazione al processo di fruizione, in modo tale da poterne trarre il
L@FFHNQADMDBHN
Linformazione nella gestione del

contatto fondamentale non solo


per ridurre il livello di complessit
dellesperienza vissuta da chi si approccia alla visita di un museo per la
prima volta, il cosiddetto UVW WLPH
visitor, ma anche perch unadeguata, chiara e completa informazione
permette di ridurre i tempi di orientamento del cliente, migliorando la
qualit di interazione che si instaura
tra esso e il personale di IURQWRce, e di conseguenza aumentando i
livelli di soddisfazione del cliente.
Anche la possibilit di prenotazione
anticipata pu risultare un servizio
utile alla facilitazione dei processi
di gestione e di regolamentazione
CDH TRRH  $RR@  HME@SSH  Q@OOQDRDMS@
uno strumento utile sia per lorganizzazione museale, consentendo
il monitoraggio dei gruppi di visitatori nei vari momenti della giornata
o della settimana, sia per il visitatore, evitando lunghe attese in coda e
garantendo la possibilit di accesso
alla struttura.
Nella fase di visita, invece, risulta di primaria importanza per lorganizzazione museale la gestione dei
TRRH CH UHRHS@SNQH  RNOQ@SSTSSN MDKKD
strutture di maggiori dimensioni che
attraggono centinaia di visitatori al
giorno. La presenza di pi visitatori nello stesso momento allinterno
dello stabile pu portare alla creazione di punti critici, i cosiddetti colli
di bottiglia, che si possono presentare lungo lintero processo di produzione ed erogazione del servizio,
C@KKDMSQ@S@ MN @KKTRBHS@ CDK LTRDN  4M RNUQ@NKK@LDMSN @KKHMSDQMN
del museo pu portare ad una vera
e propria concorrenza per laccesso
@KKDQHRNQRD RH@RHBGDBGDTL@MD 
Se ad esempio in un museo vi
un numero limitato di guide autorizY@SD @C DDSST@QD UHRHSD  RNKN ONBGH
individui o gruppi possono usufruire
immediatamente del servizio, mentre il resto dei visitatori interessati
deve aspettare. In caso di congestione sono due i principali disagi che il
consumatore pu sopportare: un effetto ritardo, di tipo oggettivo, dovuto al dilatarsi dei tempi di attesa e
CH UHRHS@  DC TM DDSSN RBNMENQSN  CH
natura soggettiva, che provoca una
minore soddisfazione culturale [FU
NARI e VISCOLANI 1998, 171].
Per la valutazione e analisi in
chiave migliorativa del processo di
fruizione alle collezioni museale

possibile fare riferimento a tre principali fattori, individuati da MORETTI


[1999], che caratterizzano la variet e la variabilit della domanda: il
diverso comportamento dei diversi
segmenti di domanda contemporaneamente presenti allinterno di un
LTRDN HK CHUDQRN BNLONQS@LDMSN
QDK@SHUN @H RHMFNKH UHRHS@SNQH K@ OQDRDMY@CHQRSSHLD UHRHSNQ +@M@KHRHCH
questi tre fattori pu utilmente essere sviluppata dallorganizzazione
museale per migliorare i processi di
fruizione del prodotto.
(MMD MDKK@fase post-visita, prima che i visitatori escano dal museo, oppure una volta tornati a casa,
lorganizzazione museale ha la possibilit di attivare dei processi di
feedback, volti non solo ad accrescere il valore erogato e la relativa soddisfazione, ma anche ad incentivare
il ritorno dellutente, raccogliere i
giudizi sulle attivit e cogliere spunti che possono servire per cercare di
migliorare costantemente la qualit
del servizio erogato.
Diversi possono essere gli strumenti per raggiungere il risultato,
come per esempio: una bacheca
espositiva, un libro per la raccolS@CDKKDQLD NCDHPTDRSHNM@QHODQ
monitorare il grado di customer satisfaction, sia in formato cartaceo alla
conclusione del percorso museale sia per via telematica, attraverso
linvio di e-mail o la predisposizione
nel sito del museo di una sezione
dedicata alla valutazione del grado
di soddisfazione dei propri visitatori.
Il processo di feedback rilevante soprattutto in termini di analisi da
parte del personale interno dei vari
giudizi e dati raccolti tramite questi
strumenti, in quanto consente un riscontro diretto sulla qualit e sulla
soddisfazione del servizio erogato e,
HMNKSQD NQDK@ONRRHAHKHSCHB@OHQDH
principali punti di debolezza dellofferta.
(MMD  ODQ PT@MSN BNMBDQMD la
gestione delle relazioni con i patron (c), stante la progressiva riduzione dei contributi pubblici a sostegno delle istituzioni museali, risulta
sempre pi rilevante lesigenza di
LDSSDQDHM@SSNOQNBDRRHCHCHUDQRHB@YHNMDCDKKDENQLDCHM@MYH@LDMSN  @@MB@MCN @KKD DQNF@YHNMH C@
parte degli enti pubblici, dei contributi provenienti dal settore privato.
Attualmente lequilibrio economico-

M@MYH@QHN  MNMBG K@ B@O@BHS CH


investire nello sviluppo, rappresentano una grossa problematica del
settore culturale, che dalla crisi economica del 2008 ha subito numerosi
tagli da parte dei contributi statali.
Anche i musei archeologici veneti
sono soggetti a tale problematica:
gestiti prevalentemente in economia dallEnte Locale proprietario
[SCATTOLIN O < CHBHKLDMte essi godono di entrate cospicue,
essendo posti in diretta concorrenza
per laccesso alle risorse economicoM@MYH@QHDBNMFKH@KSQHRDQUHYHFDRSHSH
DNDQSHC@KKDMSDOTAAKHBN 
I musei statunitensi, in questi
caso, potrebbero rappresentare un
modello desempio per i musei italiani. Essi, infatti, tendono da sempre
a valorizzare al massimo lattivit di
fund-raising, cercando in particolare
CH CHUDQRHB@QD KD ENMSH CH M@MYH@mento, in modo tale da diminuire la
dipendenza da singoli enti o soggetti, e conseguentemente aumentare
lautonomia economica.
I Network
Il terzo ed ultimo pilastro del framework concettuale per la riconcettualizzazione e valorizzazione del
patrimonio archeologico riguarda
lanalisi dei network, cio delle diverse collaborazioni che un museo
pu stringere con i soggetti presenti
MDKBNMSDRSN@CHUDQRHMHDFQ@CHCH
interazione. Risulta sempre pi evidente, soprattutto negli anni pi recenti, la tendenza dei musei a stringere una serie di connessioni e relazioni con altri soggetti del contesto,
coincidenti in rapporti di scambio, di
cooperazione e di competizione, necessari per la messa in atto del processo di produzione-riproduzionedistribuzione del prodotto.
Tale tendenza rintracciabile
anche in altri settori e industrie, quali ad esempio le grandi imprese della
meccanica o del settore automotive,
che sono gi da tempo impegnate in
forti interventi di deverticalizzazioMD  NTSRNTQBHMF D DRRHAHKHYY@YHNMD 
che permettono loro di focalizzarsi
su precise competenze distinte e intergrate in una rete di relazioni stabili [PAROLINI 1996, 7].
In questo senso, anche i musei,
stanno cominciando ad esternalizzare diverse attivit, quali la realizzazione di mostre temporanee, il ser

uporabnika v proizvodnem procesu.


.RDAID HL@ OQH SDL JKITMN UKNFN 
Y@Q@CHDR@QIDONLDLAMN C@RDID
RONRNAMN OQHK@FNCHSH Q@YKHMHL Y@Gtevam. V taknih primerih lahko proizvodnja samo deloma sledi strukturiranim procesom, v ostalem pa se
mora opirati na znanje in sposobnost reevanja problemov zaposleMHG 3HOHDMSNUQRSDMOQHLDQID J@C@Q
se osebje muzeja zaprosi, naj orgaMHYHQ@ CDI@UMNRS ON LDQH CNKNDMHG
posebnih potreb obiskovalca, kot na
OQHLDQUNCDMHNAHRJH@KHHYNAQ@DU@Kne delavnice, namenjene obravnavi
posebnih tematik ali takne, ki v kaSDQDRDUJKITHINNRDADRONRDAMHLH
potrebami, kot na primer gluhonemi
ali slabovidni in slepi obiskovalci.
Pri upravljanju irjenja obsega
obiskovalcev in krepitve ugleda
muzeja (b) je pomembno analizirati
tri faze uporabe muzejske strukture:
faza pred obiskom, med njim in faza
po obisku.
Faza SUHG RELVNRP PX]HMD, oziQNL@@R JHOQDSDDLDCNBDMNHMENQL@BHI HM @KSDQM@SHUMHG LNMNRSH
CQTFH JNMJTQDMMH HYCDKJH @KH RSNQHtve iz ponudbe industrije za prosti
@R HM LDC R@LHL NAHRJNL  OQDCRS@UKI@OQHKNMNRSY@BDKNUQRSNOQNcesov, ki bodo uporabnika prepri@KHUNAHRJHMLTONMTCHKHJNQHRSMN
orodje za pripravo nanj, tako da bo
K@GJNCDI@MRJHNAHRJHLANKITHMJNvito izkoristil.
.AUD@MIDOQHM@UDYNU@MITRSHJ@IDJKITMDF@ONLDM@ MDR@LNY@
YL@MI@MID NATSJ@ CDNQHDMS@BHID
SHRSHG JHANCNLTYDINAHRJ@KHOQUH 
S@JNHLDMNU@MDF@QRSSHLDUHRHSNQ
OQUH U LTYDIT RHMCQNL@  SDLUD
tudi, ker ustrezna, jasna in celostna
HMENQL@BHI@ NLNFN@ RJQ@I@MID
@R@  JH F@ NAHRJNU@KDB ONSQDATID
za orientacijo, s tem zagotavlja bolj
kakovostno interakcijo med njim in
osebjem za sprejemnim okencem
HM MDM@Y@CMID UNCH CN UDIDF@ Y@dovoljstva odjemnikov izdelka. Tudi
LNMNRS OQDCGNCMD QDYDQU@BHID
lahko poenostavi procese upravljanja in uravnavanja dotoka obiskoU@KBDU 2KDCMI@M@LQDMHTONQ@AM@
samo za organizacijo muzeja, saj
NLNFN@ M@CYNQ RJTOHM NAHRJNU@KBDUUCNKNDMHGSQDMTSJHGCMDU@@KH
SDCM@  SDLUD STCH Y@ R@LDF@ NAHskovalca, saj se tako izogne dolgim
@J@KMHL UQRS@L HM RH Y@FNSNUH CNstop do muzeja.


V fazi obiskaO@IDJKITMDF@ONmena za organizacijo muzeja upravljanje in nadzor dotoka obiskovalcev. To je e posebej pomembno v
velikih muzejskih kompleksih, ki
privabijo stotine obiskovalcev na
dan. Veliko tevilo obiskovalcev isSN@RMN U MNSQ@MINRSH LTYDI@ K@GJN
M@LQDONUYQNHM@RS@I@MIDJQHSHMHG
SNJ  S@JN HLDMNU@MHG NYJHG FQK  JH
RN K@GJN OQHRNSM@ UYCNK BDKNSMDF@
procesa proizvodnje in opravljanja
storitev od vhoda pa vse do izhoda iz muzeja. Zaradi prenatrpanosti
znotraj muzeja lahko pride do pravcate borbe za dostop do virov, tako
YHMHGJNSSTCHKNUDJHG 
D M@ OQHLDQ LTYDI Q@YONK@F@
R@LNYNLDIDMHLSDUHKNLUNCHDU 
bo njihovo znanje lahko takoj izkoristilo samo nekaj prvih posameznikov ali skupin, ostali obiskovalci
O@ ANCN LNQ@KH M@MID ON@J@SH  5
primeru zastojev lahko obiskovalca
CNKDSHS@CUDUQRSHMDUDMNRSHY@ONYMDKTHMDJNAIDJSHUMDM@Q@UDY@Q@CH
ONC@KI@MDF@@R@@J@MI@HMNAHRJ@
SDQNATSDJQ@YN@Q@MI@RTAIDJSHUMD
M@Q@UD J@QUMIDLONUYQNHL@MID
kulturno zadovoljstvo [FUNARI, VIS
COLANI 1998, 171].
Pri oceni in analizi v smislu izboljanja procesa izkoristka muzejskih zbirk se lahko, tako MORETTI
[1999], sklicujemo na tri poglavitne
dejavnike, ki opredeljujejo raznolikost in spremenljivost povpraeU@MI@ Q@YKHJD U UDCDMIT Q@YKHMHG 
SNC@ HRSN@RMN OQHRNSMHG RDFLDMSNU ONUOQ@DU@MI@ YMNSQ@I LTYDI@
razlike v vedenju posameznih obiRJNU@KBDU NAHRJNU@KBH UQRSD OQUH U
muzeju (UVW WLPHYLVLWRU). Muzejska
organizacija lahko opravi to analizo
za izboljanje procesov izkoristka
produkta.
V ID]L SR RELVNX, e preden
obiskovalci zapustijo muzej ali ko
se vrnejo domov, lahko muzejska
NQF@MHY@BHI@ LNMNRS @JSHUHQ@ J@nale za povratne informacije (feedback). Njihov cilj ni samo pove@SHUQDCMNRSNOQ@UKIDMDRSNQHSUDHM
preveriti zadovoljstvo odjemnika,
SDLUD STCH RONCATCHSH NAHRJNvalce k ponovnemu obisku, zbirati
NBDMD RUNIHG CDI@UMNRSH HM ADKDHti indice, ki jih lahko uporabijo pri
nenehnem izboljevanju kakovosti
svojih storitev.
Dobre rezultate lahko muzej doRDDM@Q@YKHMDM@HMDRS@AK@LHY@

izobeanje obvestil,s knjigo podpiRNUONGU@KHMOQHSNA YUOQ@@KMHJH


o stopnji zadovoljstva uporabnikov,
lahko na papirju na koncu obiska
muzeja ali na spletu, s poiljanjem
DKDJSQNMRJHGRONQNHK RONRDAMHSNki v okviru muzeja, namenjeni oceni
stopnje zadovoljstva njegovih obiskovalcev itd.
/NRSNODJ UQ@@MI@ HMENQL@BHI ID
pomemben predvsem za analizo
Q@YKHMHG NBDM HM ONC@SJNU  YAQ@MHG M@ OQ@UJ@Q NOHR@MD M@HMD  R@I
NLNFN@MDONRQDCMDHMENQL@BHIDN
kakovosti in zadovoljstvu nad opravljeno storitvijo, poleg tega pa nudi
LNMNRS Y@ Q@YTLDU@MID FK@UMHG
pomanjkljivosti ponudbe.
In e upravljanje odnosov s pokrovitelji (c): ker je javnih sredstve
Y@ ONCONQN HM UYCQDU@MID LTYDjev vedno manj, postaja vse bolj
pomembno, da muzejske ustanove
aktivirajo procese za pridobivanje
M@MMD ONCONQD HY Q@YKHMHG UHQNU
ONKDFRQDCRSDUHYI@UMDF@OQNQ@TM@
je potrebno poiskati tudi prispevke iz zasebnega sektorja. Trenutno
DJNMNLRJN M@MMNQ@UMNUDRIDSDQ
sposobnost vlaganja v prihodnost
predstavljajo velik problem na poCQNIT JTKSTQD  JH ID NC Y@DSJ@ FNspodarske krize leta 2008 utrpela
SDUHKMDQDYDM@MBHQ@MI@HYCQ@UMHG
skladov. Tej usodi se niso izgonili niti
@QGDNKNJH LTYDIH CDDKD !DMDHID 
Ker z njimi upravlja predvsem lokalna lastnika ustanova [SCATTOLIN
 O < QDCJNCNAHINUDIDURNSDRQDCRSDU R@IRDY@M@MM@RQDCRSU@MDONRQDCMNONSDFTIDINHRSN@sno z drugimi ponudniki storitev, s
katerimi upravlja javna ustanova.
Tukaj bi se lahko italijanski muzeji zgledovali po severnoameriJHG 5MIHGRDM@LQDYDKNONTC@Qja pomen fund-raising-a (zbiranje
sredstev), zlasti pa se trudijo, da bi
OQHCNAHKH HLUD Q@YKHMHG UHQNU M@MBHQ@MI@ M@S@ M@HM RD HYNFHA@IN
odvisnosti od enega samega podjetja, ustanove ali posameznika in poRKDCHMN JQDOHIN RUNIN DJNMNLRJN
neodvisnost.
'EJ=B9
Tretji in zadnji podporni steber
okvirja za rekonceptualizacijo in
UQDCMNSDMID @QGDNKNJD CDCHHMD
Y@CDU@ @M@KHYN NLQDHI  SNQDI RNCDKNU@MI@ Y Q@YKHMHLH BHKIH HM M@ URDG
ravneh, ki jih lahko muzej splete s

subjekti, prisotnimi v njegovem kontekstu. V zadnjih letih postaja med


LTYDIRJHLHTRS@MNU@LHURDANKINHten trend vzpostavljanja povezav in
navezovanja odnosov z drugimi zainteresiranimi subjekti v kontekstu,
HYQ@DMHG JNS HYLDMI@U@  RNCDKNU@nje in konkurenca, in nujno potrebnih za izvajanje procesa produkcije-reprodukcije-distribucije izdelka.
3@ SQDMC ID LNFND M@ISH STCH U
drugih panogah in industriji, kot na
primer v velikih podjetjih mehanike ali v avtomobilski industriji, kjer
RLN D CKID @R@ OQH@ yNAFK@UKI@nju centralizirane piramide, sodelovanji s podizvajalci (outsourcing)
HMDJRHAHKMNRSH J@QL@SHMDLTONCIDSIT NLNFN@  C@ RD NRQDCNSNH M@
RODBHM@ LDCRDANIKNDM@YM@MI@ 
ONUDY@M@ULQDNRS@AHKMHGNCMNRNU
[PAROLINI 1996, 7].
5 SDL RLHRKT STCH LTYDIH Y@Dnjajo oddajati zunanjim izvajalcem
Q@YKHMD CDI@UMNRSH  JNS RN OQHOQ@U@
NA@RMHG Q@YRS@U  M@CYNQ HM ONLN
NAHRJNU@KBDL  HYNAQ@DU@KMD HM CNdatne storitve, v lastni pristojnosti
O@ NAH@IMN NACQHIN R@LN ETMJBHID
vodstva in restavratorstva.
Povsem jasno je, da mora muzej, enako kot katerakoli druga organizacijska oblika, za svoje delo in
krepitev ponudbe navezati odnose
z drugimi (istovrstnimi ali aktivno
RNCDKTINHLH U CQTFHG RDJSNQIHG HMstitucijami, katerih pravne oblike se
lahko med seboj zelo razlikujejo.
,TYDI M@LQD MD CDKTID R@LNRSNIMN  U RS@SHMDL NJNKIT HM AQDY YTM@MIHG UOKHUNU  SDLUD ID U BDMSQT
FNRSD LQDD NCMNRNU  JH IN SJDIN
tevilne kategorije notranjih (endogenih) ali zunanjih (eksogenih) nosilcev interesov, ter drugi muzeji in
kulturne ustanove, ki so z njim povezane skozi neposredno in posredno
konkurenco pa tudi sodelovanje.
Muzejska ustanova formalno ali
neformalno sodeluje z lokalnimi
NAK@RSLH NAHMD  ONJQ@IHMD  CDDKne oblasti), z zavodi za varstvo kulSTQMD CDCHHMD  NK@LH URDG UQRS
in stopenj, univerzami in drugimi
raziskovalnimi ustanovami, proizvajalci in ponudniki blaga in storitev,
LDC J@SDQD RD TUQ@IN STQHRSHMH
delavci in podjetja, s skladi, zlasti z
A@MMHLH RJK@CH  R JTKSTQMHLH HM M@Q@UNRKNUMHLH YCQTDMIH SDQ Y CQTFHmi muzeji. Tovrstna sodelovanja so
JKITMDF@ONLDM@Y@Q@YUNI UMDJ@-

91

92

vizio di sorveglianza e assistenza al


pubblico, i servizi educativi e i servizi aggiuntivi, a ditte e associazioni
esterne, mantenendo generalmente
allinterno solo le funzioni direzionali e conservative.
Risulta ormai chiaro che il museo, come qualsiasi altra forma di
organizzazione, per poter operare,
nonch ampliare la propria capaciS CH NDQS@  MDBDRRHS@ CH RSQHMFDQD
rapporti con altre istituzioni, sia dello stesso tipo sia con attori attivi in
RDSSNQHCHDQDMSH BGDONRRNMN@RRTmere anche forme giuridiche molto
diverse tra loro. Il museo non lavora autonomamente, in un ambiente statico e privo di stimoli esterni,
ADMR RH SQNU@ @K BDMSQN CH TM@ SS@
rete relazionale costituita da numerose categorie di stakeholder, endogeni ed esogeni, e da altri musei e
istituzioni culturali legati da rapporti di concorrenza diretta e indiretta,
nonch di collaborazione.
Listituzione museale stringe delle collaborazione, formali o informali, con gli Enti pubblici locali, quali
Comuni, Province, Regioni, Soprintendenze, scuole di ogni grado ed
ordine, Universit ed altri tipologie
di enti di ricerca, produttori di beni
e servizi, nei quali rientrano gli operatori turistici e le imprese, le fondazioni, in particolare le fondazioni
bancarie, le associazioni culturali e
naturalistiche, e altre istituzioni museali. Tali collaborazioni, risultano
essenziali per lo sviluppo, e in alcuni
casi per la stessa sopravvivenza, del
museo, creando degli indotti positivi che si riversano sul territorio di
@OO@QSDMDMY@  K MD CH CDRBQHUDQD
le modalit in cui avvengono i processi produttivi, risulta essere utile
il concetto di costellazione di valore, (NORMANN, RAMIREZ, 1994) in
BTH UHDMD Q@OOQDRDMS@S@ K@ SS@ SQ@ma di relazioni che le organizzazioni
HMSQ@SSDMFNMN BNM @KSQH @SSNQH @K MD
di controllare e/o mobilitare quelle
risorse e funzioni che garantiscono
la creazione di maggior valore. Al
centro del sistema di costellazione
del valore non risiede, quindi, lorganizzazione museale, ma il valore stesso, formato da diversi attori
BGD HMSDQ@FHRBNMN SQ@ CH KNQN @K MD
di co-produrlo: prima tra tutti, lorganizzazione museale, seguita da
fornitori, partner pubblici e privati,
soprintendenze, associazioni cultu-

Q@KH @KSQHLTRDH D HMMD HKUHRHS@SNQD 


Maggiore il numero di soggetti che
partecipano alla creazione del prodotto, maggiore diventa la densit
del valore costruito, in cui per densit si intende una combinazione
ottimale di risorse che vengono moAHKHS@SDODQTM@RHST@YHNMDRODBHB@
@KMDCHBQD@QDHKL@RRHLNQHRTKS@SN
in termini di valore/costo. La densit
esprime, quindi, il grado di mobilitazione delle risorse realizzabile per
una particolare unit/spazio/attore.
[NORMANN 2002, 30]
Un ulteriore passo in avanti rispetto alle teorie presentate da
NORMANN, RAMIREZ [1995] viene
compiuto da PAROLINI [1996], la
quale sostiene che, prima di esseQD HCDMSHB@SH BNLD TM HMRHDLD CH
attori, i sistemi di creazione di valore possano essere descritti come
insiemi di risorse (materiali, immateriali e umane) preposte alle attivit
che compartecipano alla creazione
del valore [PAROLINI 1996, 141], il
tutto analizzato sotto la prospettiva
CDKK@BPTHQDMSD M@KD  (M O@QSHBNK@re, nella schematizzazione proposta,
linsieme delle risorse viene rappresentato da una serie di nodi, legati
tra loro da degli archi che ne rappreRDMS@MNTRRHCHMENQL@YHNMD L@SDQH@KH QHRNQRDM@MYH@QHDDQDK@YHNMHCH
HMTDMY@ 
Tale tendenza alla DRRHAHKHYY@zione dei processi di produzione,
con una conseguente apertura alla
collaborazione con altri soggetti operanti nel contesto, nel settore
museale italiano stata supportata a partire dagli anni 90 anche da
profondi mutamenti del quadro istituzionale e organizzativo-gestionale
delle organizzazioni museali.
Ad aumentare il coinvolgimento
dei privati, sia nei musei statali sia
di propriet di enti locali, intervenuta soprattutto lentrata in vigore di
una RODBHB@MNQL@SHU@, che ne ha
legittimato e sostenuto lapporto di
QHRNQRD M@MYH@QHD D CH BNLODSDMYD
tecniche manageriali.
Tali rapporti di collaborazione
ONRRNMN@RRTLDQDCHUDQRDBNMFTrazioni. In particolare, RUSSO [2009],
nel suo contributo dedicato alle partnership pubblico - private nella produzione museale, ne individua tre:
- collaborazioni informali, caratterizzate da un basso livello di strutturazione, in cui il soggetto pubblico

mantiene il ruolo principale. I meccanismi di governance di manifestano mediante relazioni e interazioni


RNBH@KHUNKSD@Q@NQY@QDHKBNNQCHM@LDMSNSQ@LHSDU@KNQHBNMCHUHRH CTcia, complementariet e risoluzione
CDHBNMHSSH 3@KHSHONKNFHDCHBNKK@ANrazioni, come analizzato nel capitolo 2 dedicato allanalisi benchmark,
sono tipiche delle reti e sistemi muRD@KH HMBTHUHDMDHRSHSTHSNTM4BHN
Associato, che coordina e valorizza
le attivit promosse dai musei aderenti, ai quali viene comunque lasciata autonomia di gestione e proFQ@LL@YHNMD
- collaborazioni contrattuali, nelle
quali i soggetti sono legati tra loro
tramite relazioni di tipo contrattuale. Ci consente al soggetto pubAKHBN CH SQ@QMD TM@ RDQHD CH ADMDBH
in termini strategico operativi ed
economici, come per esempio la diminuzione dei costi da sostenere e
maggiori possibilit di concentrarsi
nella attivit distintive. Il passaggio
della gestione dei servizi e funzioni
artistiche e culturali avviene tramite
delega della gestione a un soggetto
esterno rispetto al sistema pubblico,
OQHU@SNOQNSDMNMOQNS
- collaborazioni formali, nelle quali
viene creata una nuova entit giuQHCHB@  BGD OT @RRTLDQD CHDQDMSH
forme e caratteristiche, in cui si fondono gli interessi del soggetto pubblico e privato. In tale tipologia di
collaborazioni, regole, assegnazione
di responsabilit e ripartizioni dei
QHRBGHRNMNCDMHSH@OQHNQH HMLNCN
tale da dotare i soggetti pubblici di
quegli strumenti per ottenere il masRHLNCDHADMDBH 
Ecco, quindi, che sul piano legislativo italiano possibile scindere,
da un lato, gli interventi che vanno
ad incidere sulla gestione dei servizi aggiuntivi (tipici delle collaborazioni contrattuali) che hanno visto
una loro prima applicazione grazie
alla legge Ronchey (D.L. 14 novembre 1992, n. 433, convertito in legge
14 gennaio 1993, n. 4) che ha introdotto la possibilit di esternalizzazione dei servizi aggiuntivi nei muRDH M@YHNM@KH HS@KH@MH C@KK@KSQN K@SN 
possibile individuare una serie di
HMSDQUDMSH LHQ@SH RTKK@ QHBNMFTQ@zione delle forme di gestione, grazie
allemanazione di alcune norme che
hanno posto le premesse giuridiche
per il rinnovamento degli assetti isti-

tuzionali e gestionali sia a livello di


Enti Locali sia Statali.
Per quanto concerne gli Enti Locali, si ricordano la L. n. 142/90 che
disciplina le forme di gestione dei
servizi pubblici locali, a cui si deve
aggiungere la L. 448/01 art. 35, che
LNCHB@ K@QS  AHR CDK 3TDK  MDK
quale si individuano nuovi modelli
di gestione dei servizi pubblici locali
privi di rilevanza industriale, tra cui
musei, senza fornire precise indicazioni, lasciando cos allEnte Locale
piena libert di scelta nella forma
giuridica da applicare.
Analizzando gli articoli del Tuel,
possibile individuare due macrocategorie di forme di gestione, che a
loro volta possono suddividersi in
diversi modelli:
- forme giuridiche individuali: IstituzioMD  YHDMC@2ODBH@KD "NMUDMYHNMD
- forme giuridiche collettive: Consorzio, Associazione, Fondazione di Partecipazione e Societ di capitali.
A livello statale, invece, la previsione
pi ampia in materia di collaborazioni pubblico-privato operata dallarticolo 10, d. lgs n.368 del 1998 (riordino del Ministero per i Beni e le
Attivit Culturali), in base al quale,
@HMHCDKOHDB@BDDRDQBHYHNCDKle sue funzioni e, in particolare, per
la valorizzazione dei beni culturali e
ambientali, il Ministero pu stipulare accordi con amministrazioni pubbliche e con soggetti privati e costruire o partecipare ad associazioni,
fondazioni o societ (comma 1).
Con tale disposizione si apre la
possibilit anche ad enti statali di
delegare la gestione, oppure di costruire o partecipare ad organismi la
cui responsabilit sia condivisa da
pi enti. Il Ministero sembra maggiormente propenso alla seconda
opzione, che permette di continuare ad occuparsi direttamente della
gestione. In particolare, lo strumento della fondazione, si addice a tale
compito meglio dellassociazione
e della societ, forme questultime
forse pi idonee allo svolgimento di
@SSHUHSBNMM@KHSCHKTBQN
La Fondazione di partecipazione una forma di gestione che si sta
K@QF@LDMSDCHNMCDMCNHM(S@KH@RH@
nei musei Statali sia nei musei la cui
propriet ricade sugli enti locali, a
BTH QHRONMCNMN CHDQDMSH M@KHS HM
base alle strutture e alle attivit che
BNMTHRBNMN HM DRR@  (M O@QSHBNK@QD

SDQHGOQHLDQHGO@BDKNY@OQDHUDSID
muzeja, saj se skozi njih ustvarjajo
pozitivni tokovi, ki se irijo po vsem
pripadnem prostoru muzeja. Za opis
pogojev, v katerih potekajo proizvodni procesi, je uporaben pojem
ozvezdje vrednosti, (NORMANN,
RAMIREZ, 1994) v katerem je predstavljena gosta tekstura razmerij, ki
jih organizacije spletajo z drugimi
akterji z namenom nadzora in/ali
mobilitacije tistih virov in funkcij,
ki zagotavljajo ustvarjanje dodatne
UQDCMNRSH 5RQDCHTNYUDYCI@SNQDI
MHRN LTYDIRJD NQF@MHY@BHID  O@ O@
vrednost sama, nastala z medsebojMN JNLTMHJ@BHIN Q@YKHMHG @JSDQIDU 
ki sodelujejo pri njeni ko-produkciji: predvsem je tu muzejska organizacija, sledijo dobavitelji, javni in
zasebni partnerji, nadzorni zavodi,
JTKSTQM@YCQTDMI@ NRS@KHLTYDIHHM 
MDM@Y@CMID  NAHRJNU@KDB  5DID JNS
je tevilo subjektov, ki sodelujejo
OQHTRSU@QI@MITHYCDKJ@ UDI@ONRS@ne gostota izdelane vrednosti, pri
DLDQ ID FNRSNS@ NOQDCDKIDM@ JNS
optimalna kombinacija virov, ki se
@JSHUHQ@IN Y@ CNKNDMN RHST@BHIN Y
namenom ustvariti kar najbolji rezultat glede na razmerje vrednost/
RSQNJH &NRSNS@SNQDIHYQ@@RSNOMIN
@MF@HQ@MI@UHQNU HYUDCKIHUNY@CNKNDMN DMNSNOQNRSNQ@JSDQI@i  :NOR
MANN 2002, 30]
e korak naprej od teorij, ki sta
jih predstavila NORMANN in RAMI
REZ [1995], je naredila PAROLINI
[1996], ki meni, da lahko, e preden
RDCNKNHRJTODJ@JSDQIDU yRHRSDLD
ustvarjanja vrednosti opiemo kot
skupek virov (opredmetenih, neoOQDCLDSDMHGHMKNUDJHG NCFNUNQnih za dejavnosti, ki bodo sodelovale v procesu ustvarjanja vrednosti
[PAROLINI 1996, 141], vse analiziQ@MN Y UHCHJ@ JNMMDF@ NCIDLMHJ@ 
V predlaganem modelu je skupek
virov opredeljen kot vrsta vozlov,
JH IHG LDC RDANI ONUDYTIDIN KNJH SH
predstavljajo dotok informacij, maSDQH@KNU  M@MMHG UHQNU HM UOKHUMHG
odnosov.
3QDMC DJRHAHKHY@BHID OQNBDR@
OQNHYUNCMID R ONRKDCHMHL NCOHQ@njem sodelovanju z drugimi, v istem
JNMSDJRST CDKTINHLH RTAIDJSH  RD
je v devetdesetih letih preteklega
stoletja med italijanskimi muzeji zaDKTUDKI@UKI@SHSTCHY@Q@CHJNQDMHSHG
sprememb institucionalnih in organizacijsko-upravnih okvirjev, s kate

QHLH RN RD LNQ@KD RNNHSH LTYDIRJD


organizacije italijanskih muzejev.
*QDOHSDU TCDKDAD Y@RDAMDF@
RDJSNQI@ U CQ@UMHG LTYDIHG SDQ U
muzejih v lasti lokalnih ustanov je
OQDCURDL ONRKDCHB@ RODBHMD Y@konodaje, ki je uzakonila in podprla
Y@FNS@UKI@MIDM@MMHGUHQNUHMSDGMHMHGSDQLDMDCDQRJHGYM@MI
Tovrstno sodelovanje lahko poteJ@M@Q@YKHMDM@HMD RUSSO [2009]
v svojem prispevku v zvezi s partnerstvu javnega in zasebnega sektorja z
muzejsko proizvodnjo opred-eljuje tri:
- neformalno sodelovanje, zanj je
YM@HKM@ RK@AN Q@YUHS@ RSQTJSTQ@  U
kateri javni subjekt ohrani glavno
vlogo. Mehanizmi upravljanja se izQ@@IN RJNYH CQTADM@ Q@YLDQI@ HM
medsebojno komunikacijo, namenjeno okrepljenemu usklajevanju s
ONLNINRJTOMHGUQDCMNS Y@TO@MI@ 
CNONKMIDU@MI@ HM QDDU@MI@ JNMHJtov. Kot smo pokazali v drugem poglavju (analiza merila uspenosti), so
SDUQRSDRNCDKNU@MI@YM@HKMDY@LTYDIRJDLQDDHMRHRSDLD UJ@SDQHGRD
TRS@MNUHRJTOM@RKTA@ JHTRJK@ITID
in razvija dejavnosti na pobudo priCQTDMHGLTYDIDU 2KDCMIHUUR@JDL
primeru ohranijo samostojnost pri
TOQ@UKI@MITHMM@QSNU@MIT
- pogodbeno sodelovanje, subjekti
so med seboj povezani s pogodbenim razmerjem. Javni subjekt lahko
izkoristi vrsto strateko operativnih in ekonomskih prednosti, kot so
YL@MI@MID RSQNJNU HM UD LNMNRSH  C@ RD NRQDCNSNH M@ RDAH K@RSMD
naloge. Za upravljanje storitev in
kulturnoumetnikih funkcij se pooblasti subjekt, ki deluje izven javMDF@RHRSDL@ OQNSMH@KHMDOQNSMH
Y@RDAMHRTAIDJS
- formalno sodelovanje, ustanovi se
nova pravna oseba, ki ima lahko razKHMDENQLDHMETMJBHIDURDAHYCQTTID HMSDQDRD I@UMDF@ HM Y@RDAMDF@
sektorja. V tovrstnem sodelovanju
se pravila, dodelitev odgovornosti
in razdelitev tveganja vnaprej opredelijo tako, da se javnim subjektom
zagotovijo taka orodja, ki jim bodo
OQHMDRK@J@QM@IUDJNQHRSH 
Tako je torej na italijanski zakoMNC@IMH Q@UMH LNFND KNHSH M@ DMH
strani posege, ki vplivajo na upraUKI@MID ONLNMHG RSNQHSDU SHOHMN
ONFNCADMHGRNCDKNU@MIOQUHRDID
nova zakonodaja uporabila z zakonom Ronchey (zak.odl. 14 novembra
1992, t. 433, spremenjen v zakon

z dne 14 januarja 1993, t. 4), ki je


TUDCDK FTQN YTM@MIDF@ HYU@I@KB@
ONLNMHGRSNQHSDUUHS@KHI@MRJHGM@QNCMHG LTYDIHG M@ CQTFH RSQ@MH O@
IDLNFNDNOQDCDKHSHUQRSNONRDFNU 
katerih cilj je preureditev oblik upraUKI@MI@RONLNINMDJ@SDQHGOQDCOHsov, ki so postavili pravne temelje za
prenovo institucionalne in upravne
RSQTJSTQDM@KNJ@KMHHMCQ@UMHQ@UMH 
V zvezi z lokalnimi ustanovami
naj spomnimo na zakon t. 142/90, ki
ureja oblike upravljanja lokalnih javMHG RKTA SDLT ID SQDA@ CNC@SH STCH
 K Y@JNM@S  JHROQDLHMI@ AHRKMNQL@SHU@3TDKY@JNM
opredeljuje nove modele upravljanja
lokalnih nosilcev javnih storitev brez
industrijskega pomena, med katerimi
RNSTCHLTYDIH @AQDYM@S@MMHGM@vodil, kar pomeni, da javna ustanova
ohrani vso pravico do izbire svoje
pravne oblike.
(Y@M@KHYDKDMNUY@JNM@3TDKRS@Q@Yvidni dve glavni (makro) kategoriji
oblik upravljanja, ki se lahko delita
M@Q@YKHMDONCJ@SDFNQHID
- individualne pravne oblike: ustanova, podjetje s posebnim statuRNL JNMUDMBHI@
- kolektivne pravne oblike: konzorBHI  YCQTDMID  O@QSMDQRJ@ ETMC@BHI@ 
J@OHS@KRJ@CQTA@
-@ CQ@UMDL MHUNIT RD ID M@IUDIH
OQDLHJM@ONCQNITRNCDKNU@MI@I@Unega in zasebnega sektorja zgodil s
K    Y@J  NCKNJ@ S   HY 
(reorganizacija ministrstva za kulSTQMN CDCHHMN HM CDI@UMNRSH  M@
podlagi katerega lahko ministrstvo
Y@ ANKI THMJNUHSN HYU@I@MID RUNIHG
funkcij, zlasti pa za promocijo kulSTQMD CDCHHMD HM NJNKI@ yRJKDMD
sporazume z javno upravo in z zasebnimi subjekti ter ustanovi ali
RD OQHCQTH NARSNIDHL YCQTDMIDL 
TRS@MNU@L@KHCQTA@LiSNJ@ 
Zaradi te novosti imajo tudi dr@UMD TRS@MNUD LNMNRS ONUDQHSH
upravljanje tretjim ali ustanoviti
oziroma sodelovati v organizmih, za
J@SDQDHRSN@RMNOQDUYDL@NCFNUNQMNRSUDTRS@MNU ,HMHRSQRSUNRDYCH
ANKI M@JKNMIDMN CQTFH LNMNRSH  R@I
S@ NLNFN@ M@C@KIDU@MID MDONRQDdnega upravljanja. Ta oblika ustreza
ETMC@BHIH L@MIYCQTDMIT@KHCQTAH 
Slednji bi bili morda bolj primerni za
NOQ@UKI@MIDOQNSMDCDI@UMNRSH 
3DUWQHUVND IXQGDFLMD je oblika
upravljanja, ki se precej uveljavlja v
(S@KHIHTONQ@AKI@ININCQ@UMHLTYDIH 

pa tudi muzeji v lasti lokalnih ustanov, katerih cilji se razlikujejo glede


na njihove strukture in dejavnosti.
Izstopata predvsem dve obliki: prva,
v kateri se fundacija ustanovi z naLDMNL YCQTDU@MI@ UD TRS@MNU
eden takih primerov je Fundacija
Mestnih muzejev v Benetkah, ki od
leta 2008 upravlja in spodbuja boF@SHMODRSDQRHRSDLLTYDIDUNAHMD
Benetke, ali pa Fundacija Senesi,
ustanovljena leta 2003, ki upravlja
33 muzejev, med katerimi je 11 arheolokih, pa e Fundacija Brescia
Musei, nastala je leta 2003 kot delMHJ@CQTA@HMRDJ@RMDIDOQDSUNQHK@
UO@QSMDQRJNETMC@BHINCQTF@NAKHJ@ 
kjer se fundacija ustanovi na podlaFH DMNRS@UMD ROQDLDLAD M@HM@
upravljanja predhodne muzejske
TRS@MNUD  JNS M@ OQHLDQ $FHO@MRJH
muzej v Torinu.
/NOTK@QMNRS  JH IN CNHUKI@ SNUQstno upravljanje, gre pripisati dvojni koristi za javno ustanovo: po eni
strani predstavlja orodje za partnerstvo z zasebnim subjektom, ki
RD LT RHBDQ NLNFNH RNCDKNU@MID 
@ TRS@MNU@ JNS TRS@MNUHSUDMH K@M
e vedno ohrani vlogo nadzora in
TOQ@UKI@MI@ M@ CQTFH RSQ@MH O@ IH
MTCH LNMNRS  C@ ONUDQH MNUH TRS@novi upravljanje in izvajanje cele
vrste dejavnosti in storitev, nameMIDMHG U@KNQHY@BHIH OQDLNDMI@ U
SDLOQHLDQT@QGHSDJSTQMDCDCHHMD
[RUSSO 2009, 339-340]. Ta pravna
NAKHJ@ M@LQD NLNFN@ TQ@UMNSDDMNTCDKDANI@UMDF@HMY@RDAMDF@ RDJSNQI@ U HRSH RSQTJSTQH  R HLDQ
se zasebnemu podjetnitvu ponudi
TRSQDYDMONRKNUMHOQNRSNQ HRSN@RMN
pa so izpolnjene potrebe skupnosti.
Druga pravna oblika, ki ne izhaI@ HY Q@YLDQI@ O@QSMDQRSU@  SDLUD
LTYDIT CNOT@ UD @USNMNLHID
pri upravljanju, je Ustanova, ki jo
gre razumeti kot instrumentalni
organ lokalne ustanove, namenjen
opravljanju socialnih storitev
AQDY ONCIDSMHJDF@ ONLDM@i  Dprav ustanova nima svoje pravne
osebnosti, je samostojna z vidika
TOQ@UKI@MI@  M@MB HM JMIHFNUNCRSU@  HYCDK@ RUNI OQNQ@TM HM HL@
LNMNRS R@LNNCKN@MI@ N K@RSMH
organizacijski strukturi.
3@NAKHJ@TOQ@UKI@MI@MDOQDQDD
popkovine z institucijo, ki ji pripada,
SDLUD RH OQHY@CDU@ OQDRDH NCMNR
HYJKITMD NCUHRMNRSH NC MID  4OQ@vljanje ustanove je torej rezultat

93

94

emergono due diverse soluzioni: la


prima, in cui la fondazione viene costituita allo scopo di raggruppare pi
istituti, come nel caso, solo per citare alcuni esempi, della Fondazione
Musei Civici Veneziani, che dal 2008
gestisce e promuove il ricco e articolato sistema museale del Comune
di Venezia, della Fondazione Musei
Senesi, istituita nel 2003, che gestisce 33 musei, tra cui 11 archeologici,
della Fondazione Brescia Musei, nata
come societ per azioni nel 2003, e
trasformata poi in fondazione di parSDBHO@YHNMDK@RDBNMC@ HMBTHK@ENMdazione viene istituita in funzione di
semplice trasformazione della modalit di gestione di un precedente
istituto museale, come per esempio
il Museo egizio torinese.
+@ CHTRHNMD BGD RS@ QHRBNMSQ@Mdo questa forma di gestione da
attribuire ad un duplice vantaggio
riscontrabile per lente pubblico: da
un lato, rappresenta uno strumento
di partnership con il privato, al quale
viene aperta la partecipazione, che
gli consente di mantenere un ruolo
direttivo in quanto membro fondanSDC@KK@KSQN FKHBNMRDMSDCH@C@QD
ad un nuovo ente la gestione di una
serie di attivit e servizi per la valorizzazione di un patrimonio [Russo
  < 0TDRS@ENQL@FHTQHdica, infatti, permette una congiunzione equilibrata tra lambito pubblico e lambito privato allinterno della
stessa struttura, dando cos giusto
spazio allimprenditorialit privata
e, al contempo, al soddisfacimento
delle esigenze della collettivit.
Altra forma giuridica, che non
nasce da un rapporto di partnership
ma che lascia maggiore autonomia
gestionale al museo, lIstituzione,
da intendersi come un organismo
strumentale dellEnte Locale per lesercizio di servizi sociali senza rilevanza imprenditoriale. Nonostante
listituzione non abbia una propria
personalit giuridica, essa dotata
CH @TSNMNLH@ FDRSHNM@KD  M@MYH@QH@
e contabile, elabora un vero e proprio bilancio, ed ha la possibilit di
autodeterminare la propria struttura
organizzativa.
Tale forma di gestione non taglia
il legame con lente di appartenenza, ma cerca di superare il rapporto
di stretta dipendenza. La gestione
dellistituzione , quindi, il risultato di decisioni prese su due livel-

KH CHDQDMSH CDBHRHNMH CH B@Q@SSDQD


RSQ@SDFHBN  CDMHSD C@KK$MSD +NB@KD 
che determinano il raggio dazione
dellorganismo, da un lato, decisioni
di carattere esecutivo, necessarie al
Q@FFHTMFHLDMSN CDFKH NAHDSSHUH CDniti dallente proprietario, dallaltro.
In questo modo possibile mantenere una sicura garanzia anche del
rispetto della gestione del Patrimonio artistico-culturale, della sua conservazione e integrit, che costituiscono la prima ragione dessere del
museo.
Ma, come sottolinea Andreani [1998], listituzione ha suscitato
scarso interesse, nonch esigue realizzazioni pratiche, a causa delle
HMRTBHDMSH HMCHB@YHNMH @ B@Q@SSDQD
normativo e della mancanza di riferimenti da poter trarre dallesperienza passata. Infatti, mentre le
S.p.a. e lazienda speciale sono una
prosecuzione dellazienda municipalizzata, lIstituzione rappresenta
un tentativo di superare i problemi
rilevati nella gestione dei servizi in
economia o tramite la concessione a
terzi.
(MMDTM@KSQNDRDLOHNCHENQL@
utilizzata per la gestione museale
la Societ per Azioni a prevalente capitale pubblico locale, prevista
qualora si renda opportuna, in relazione alla natura del servizio da erogare, la partecipazione di altri soggetti pubblici e privati.
Caso di eccellenza la Societ
Parchi della Val di Cornia S.p.a, istituita nel 1993 per iniziativa dei Comuni di Piombino, Campiglia Marittima,
San Vincenzo, Suvereto e Sassetta
e di soci privati, ai sensi dellart. 22
della legge 142/1990 del Tuel. Dal
  ODQ TM@ LNCHB@ @KK@ MNQL@tiva vigente (D. Lgsl 42/2004, art.
115), si reso necessario trasformare lassetto societario raggiungendo
una compagine azionaria interamente pubblica. La societ negli anni ha
ricevuto numerosi premi per linnovazione nella gestione dei beni culturali e ambientali. La sua missione
consiste nel progettare e realizzare
gli interventi per la valorizzazione
delle risorse culturali ed ambientali,
e gestire, in forma integrata, i servizi
per la fruizione pubblica.

$

,

Attraverso gli strumenti concettuali presentati al paragrafo precedente, articolati sui temi di prodotto, processo e reti di relazioni, si
sviluppato il framework analitico per
lindagine volta a descrivere lo scenario attuale dei musei archeologici
dellarea PArSJAd, ed in particolare
mirata a descrivere e comprendere il
modo in cui essi operano.
Le aree tematiche su cui lanalisi stata articolata, emerse dallanalisi dedicata ai nuovi modelli di
business, sono dunque: la forma di
gestione, le attivit che i musei offrono al proprio pubblico, gli spazi
che hanno a disposizione, i servizi accessori, e le collaborazioni che
NFMHLTRDNHMRS@TQ@BNMKDCHDQDMSH
tipologie di stakeholder.
2NSSNHKOQNKNLDSNCNKNFHBNRH
reso necessario costruire un database capace di raccogliere un insieme
di dati empirici ed informazioni relaSHUD@KKDCHDQDMSHRSQTSSTQDHMC@F@SD 
La popolazione di riferimento
stata individuata tramite il portale
internet ArcheoVeneto dedicato alla
valorizzazione e alla fruizione dei
beni archeologici veneti, promosso
dallAssessorato alla Cultura della
Regione del Veneto e curato dal Dipartimento di Archeologia dellUniversit degli Studi di Padova, in collaborazione con la Soprintendenza
Archeologica. Il portale ospita un database nel quale sono censiti in maniera sistematica tutti i dati relativi
a monumenti, aree archeologiche e
musei presenti nel nostro territorio e
aperti al pubblico.
Tramite linterrogazione del database stato possibile individuare
le 13 realt museali archeologiche
presenti nel territorio regionale di riferimento. Lanalisi HOG stata successivamente sviluppata tramite la
distribuzione di un questionario con
domande a risposta chiusa e aperta,
volto a raccogliere le informazioni
necessarie allinvestigazione delle
diverse aree tematiche.
Il questionario stato somministrato, nei mesi di dicembre 2011,
gennaio, febbraio e marzo 2012, a responsabili e direttori delle strutture
tramite breve intervista telefonica o
inviato, su richiesta degli stessi intervistati, per posta elettronica per procedere alla compilazione.

Lindagine si focalizzata sulle 13 realt museali site nelle aree


coinvolte dal progetto1. Di queste,
9 sono musei prettamente archeologici e 4 sono musei compositi
che accostano ai reperti archeologici collezioni darte o naturalistiche2.
Complessivamente, si tratta di musei
di medie-piccole dimensioni siti in
centri medio-piccoli (Rovigo, Chioggia, Portogruaro) o in zone rurali periferiche, alcune delle quali collegate direttamente alle aree archeologiche di scavo3.
Rispetto alla distribuzione nel
territorio, un dato che emerge che
i 4 musei compositi sono collocati
nella sola provincia di Venezia, mentre nel Basso Polesine le realt censite espongono collezioni formate
esclusivamente da collezioni archeologiche.
Per quanto riguarda il periodo
di fondazione delle istituzioni, la
maggior parte di esse pu essere
CDMHS@ CH MTNU@ FDMDQ@YHNMD  @C
eccezione del Museo Archeologico
Nazionale di Portogruaro, del Museo
Provinciale di Torcello e del Museo
del Vetro di Murano, di carattere storico-territoriale e nati dopo lUnit
dItalia, le cui collezioni sono frutto
sia di ritrovamenti avvenuti nel territorio sia di donazioni da parte di
illustri collezionisti locali. Le restanti organizzazioni museali sono state
aperte al pubblico soprattutto negli
anni 80-90, periodo in cui si assiste
ad una maggiore spinta a musealizY@QDHQDODQSHOQNUDMHDMSHC@KKDCHDrenti campagne di scavo. Tali musei
espongono, infatti, collezioni legate
al proprio contesto, utili quindi allo
studio e alla valorizzazione del terriSNQHNKNB@KDDBNMSQ@CCHRSHMSHC@HMH
prevalentemente didattici.

/

La prima area di indagine volS@@UDQHB@QDHC@SHOQHMBHO@KHQDK@SHUH
allo status giuridico e alla forma di
gestione delle 13 realt analizzate,
cercando di comprenderne la propriet, lesistenza di statuti o di regolamenti, laccreditamento regionale
sulla scorta della Legge Regionale n.
CDKDK@RRDSSNM@MYH@QHN

NCKNHSDU  ROQDIDSHG M@ CUDG Q@YKHnih ravneh: na eni strani so strateke


NCKNHSUD JHIHGNOQDCDKHKNJ@KMHNQF@MHMCNKN@INNODQ@SHUMNNALNID
ustanove, na drugi pa izvrne odloHSUD  ONSQDAMD Y@ CNRDF@MID BHKIDU 
JH IHG CNKN@ TRS@MNU@ K@RSMHB@  -@
S@JM@HMRDY@FNSNUHSTCHY@I@LDno spotovanje pri upravljanju umeSMHJD HM JTKSTQMD CDCHHMD HM OQH
njenem ohranjanju in celovitosti, ki
so navsezadnje glavni razlog za obstoj muzeja.
Toda - kot poudarja Andreani
[1998], je za ustanovo malo zanimanja in izjemno redki so primeri
njene vpeljave v prakso. Razlog za
to gre poiskati v neustreznih informacijah zakonodajne narave in v
pomanjkanju referenc iz preteklih
izkuenj. Dejstvo je, da so delnike
CQTAD2 O @ HMONRDAM@ONCIDSI@U
QDRMHBHONC@KIDJNAHMRJDF@ONCIDtja, medtem ko ustanova predstavlja
ONRJTR OQDL@FNU@MI@ SD@U  JH M@stajajo pri neposrednem upravljanju
storitev ali pri poverjanju storitev
zunanjim izvajalcem.
Ob koncu e ena oblika upravljanja muzejske dejavnosti: DelniND GUXED Y UDHMRJHL J@OHS@KNL
v lokalni javni lasti (javna delnika
CQTA@ OQDCUHCDM@ ID yD ID Y@Q@di narave storitve, ki se bo izvajala,
ONSQDAM@TCDKDA@CQTFHGI@UMHGHM
zasebnih subjektov.
(YIDLDM OQHLDQ ID CQTA@ /@QBGH
della Val di Cornia S.p.a, ki se je ustaMNUHK@ KDS@  M@ ONATCN NAHM
Piombino, Campiglia Marittima, San
Vincenzo, Suvereto in Sassetta ter
Y@RDAMHG CDKMH@QIDU  U RJK@CT R K 
22 zakona 142/1990 Tuel. Leta 2007
je bilo zaradi spremembe veljavMHGOQDCOHRNUY@J NCK  K 
115) potrebno preoblikovati lastniJNRSQTJSTQNCQTADHMINOQDSUNQHSHU
I@UMNCDKMHJNCQTAN #QTA@IDNC
svojega obstoja dalje prejela tevilne
nagrade za inovacije pri upravljanju
JTKSTQMDHMNJNKIRJDCDCHHMD -IDMN ONRK@MRSUN ID M@QSNU@MID HM HYvajanje posegov za izboljanje kulturnih in okoljskih virov in celostno
upravljanje storitev za javno korist.

0

5

2ONLNINUOQDIMIDLONFK@UIT
predstavljenih konceptualnih orodij,
oblikovanih po meri izdelka, procesa
HMLQDDNCMNRNU RLNQ@YUHKH@M@KHSHMHNJUHQY@ONLNOQHQ@YHRJ@UH JH
naj bi opisala dananji scenarij arheolokih muzejev na projektnem
NALNIT/ Q2) CYM@LDMNL OQDCstaviti in razumeti, kako slednji delujejo.
Analizirali smo naslednja tematRJ@ONCQNI@ JHIHGIDNOQDCDKHK@OQDChodna analiza novih poslovnih modelov: oblika upravljanja, dejavnosti, ki
jih muzeji ponujajo svojim obiskovalBDL  Q@YONKNKIHUH OQNRSNQH  CNC@SMD
RSNQHSUD HM Q@YKHMD NAKHJD RNCDKNU@MI@ JHIHGUR@JLTYDIHYU@I@YQ@YKHMHmi vrstami nosilcev interesov.
9@HYCDK@UNLDSNCNKNJDF@OQNla je bilo potrebno izdelati zbirko podatkov, v kateri bi lahko shranili vse
DLOHQHMD ONC@SJD HM HMENQL@BHID N
Q@YKHMHG@M@KHYHQ@MHGRSQTJSTQ@G
1DEDQDMMNONOTK@BHINRLNNOQDdelili na spletnem portalu ArcheoVeneto. Ta je namenjen vrednotenju
in boljemu izkoristku arhitekturne
CDCHHMD CDDKD !DMDHID  HYCDK@K
pa se je na pobudo odbora za kulSTQN CDDKD !DMDHID HM ONC ONJQNviteljstvom oddelka za arheologijo
na Univerzi v Padovi v sodelovanju z
Zavodom za varstvo arheoloke deCHHMD /NQS@KFNRSHYAHQJNONC@SJNU 
UJ@SDQHRDRHRSDL@SHMNADKDHINURH
podatki o spomenikih, arheolokih
M@ICHHGHMI@UMNRSHNCOQSHGLTYDIHG
M@CDDKMDLNYDLKIT
Pregled zbirke podatkov je ponudil podatke o trinajstih arheolokih
muzejskih stvarnostih, prisotnih na
QDEDQDMMDL CDDKMDL NYDLKIT  9@
potrebe kasneje analize na terenu
smo anketirancem razdelili vpraalnike z vpraanji zaprtega in odprtega tipa. Iz odgovorov na vpraanja
smo zbrali dovolj podatkov za raziRJ@UNQ@YKHMHGSDL@SRJHGONCQNHI 
Vpraalnik smo v mesecih decembra 2011 ter januarja, februarja
in marca 2012 izpolnili tako, da smo
pri odgovornih in direktorjih opraviKHJQ@SDJSDKDENMRJHHMSDQUIT ONDKIH
anketirancev pa smo ga tudi poslali
po elektronski poti, da so ga nato
samostojno izpolnili.

1@YHRJ@U@ RD ID NRQDCNSNHK@ M@


trinajst muzejskih struktur, prisoSMHGM@OQNIDJSMDLNALNIT1. Devet
LDC MIHLH ID HYJKITMN @QGDNKNJHG 
tirje pa so meanega tipa, kar pomeni, da poleg arheolokih eksponatov razstavljajo tudi umetnike
ali naravoslovne zbirke2. V glavnem
gre za majhne in srednje velike muYDID  JH RSNIHIN U L@MIHG RQDCHHG
(Rovigo, Chioggia, Portogruaro) ali
M@ONCDDKIT MDJ@SDQHM@KHBTLDRS@
@KHMDONRQDCMNONUDY@MHRONCQNIH 
kjer so ali e potekajo arheoloka izkopavanja3.
Z vidika porazdelitve po ozemlju
je zanimivo dejstvo, da se vsi tirje muzeji meanega tipa nahajajo
v pokrajini Benetke, medtem ko v
pokrajini Basso Polesine popisani
LTYDIH Q@YRS@UKI@IN HYJKITMN @QGDNloke zbirke.
5DHMNUQ@YHRJ@UNUJKITDMHGLTzejev lahko uvrstimo med muzeje
nove generacije, z izjemo Narodnega arheolokega muzeja v Portogruaru, Pokrajinskega muzeja v Torcellu in Muzeja muranskega stekla, ki
so zgodovinsko ozemeljskega obeKDI@HMRNM@RS@KHONYCQTHSUH(S@KHID 
-IHGNUDYAHQJDRNQDYTKS@SM@ICHM@
SDQDMT SDQ CNM@BHI HY CNL@HG YAHQJ
uglednih lokalnih zbirateljev. Preostale muzejske organizacije so odprle svoja vrata javnosti predvsem
v osemdesetih in devetdesetih letih
prejnjega stoletja, ko se je intenzivno spodbujalo arhiviranje najdb
tevilnih organiziranih izkopavanj. V
njih so razstavljene zbirke, ki so tesno povezane s svojim kontekstom
HM Y@Q@CH SDF@ TONQ@AMD Y@ OQDTDvanje in valorizacijo lokalnega teriSNQHI@SDQUCHC@JSHMDM@LDMD 

3

5OQUDLCDKT@M@KHYDRLNDKDKH
preveriti osnovne podatke o pravnem statusu in obliki upravljanja
trinajstih analiziranih struktur in
ugotoviti obstoj lastnitva, statutov
@KH OQ@UHKMHJNU  CDDKMHG @JQDCHS@BHI
M@ONCK@FHCDDKMDF@Y@JNM@S 
HYKDS@SDQMIHGNUM@MMHNJUHQ
Iz analize zbranih podatkov se je
pokazalo, da je lastnik analiziranih
LTYDIDU M@IUDJQ@S U  NC  LT-

YDIDUNAHM@J@QRHBDQUDKI@STCHY@
druge muzejske ustanove z arheoKNJHLH YAHQJ@LH U CDDKH !DMDHIH
trije od preostalih petih struktur so
narodni muzeji (Narodni arheoloki
muzej v Adrii, Narodni arheoloki
muzej v Altinu in Narodni arheoloki muzej v Portogruaru), dva pa sta
pokrajinska (Pokrajinski muzej v TorBDKKTHM3TQHRSHMN JTKSTQMNRQDCHD
Sv. Bazilij, Ariano nel Polesine).
Gre za strukture, za katere je
YM@HKDMQDLQXSUDYOMDQMD v lastni
oskrbi, tak torej, ki ga izvaja neposredno ustanova-lastnica. Analiza
J@D  C@ ID R@LN U SQDG TRS@MNU@G
upravljanje poverjeno zunanjemu
HYU@I@KBT 3TQHRSHMN JTKSTQMN RQDCHD 2U  !@YHKHI  QH@MN MDK /NKDRHMD 
ki ga upravlja Zavod parka delte Pad,
Muzej muranskega stekla, z njim
upravlja Fundacija mestnih muzejev
v Benetkah, ter Stalna razstava rimske centuriacije v Villadosu, s katerim upravlja Kooperativa za turizem
in kulturo.
-@ ONCQNIT VWDWXWRY LQ SUDYLOnikov je celotni secenarij tak, kot ga
NOHRTIDOQ@UHKMHJ JHCNKN@SDGMHMD
in strokovne zahteve ter standarde za delovanje in razvoj muzejev
(Atto di indirizzo sui criteri tecnico RBHDMSHBH D RTFKH RS@MC@QC CH ETMzionamento e sviluppo dei musei
# +FR  S   K   SNJ@ 
priprava statutov, pravilnikov ali
drugih enakovrednih pisnih listin
LTYDIDL NLNFN@ OQHYM@MID OQ@Unega statusa in vsakemu od njih
zagotavlja organski in kompleksni
sistem standardov in predpisov,
ONUDY@MYMIDFNUHLRODBHMHLONslanstvom. Prav zaradi tega teje
izdelava statuta in/ali pravilnika za
minimalni zahtevek, pa tudi refeQDMMH NJUHQ Y@ NQF@MHY@BHIN HM CDlovanje slehernega muzeja ter uporabno orodje za bolj kakovostno in
ciljano dejavnost.
Analiza zbranih podatkov je pokazala, da gre pri raziskanih arheolokih
muzejih za slabo urejene strukture z
vidika predpisov in standardov. Od
trinajstih anketiranih muzejev imajo samo trije lastni statut, sedem pa
notranji pravilnik. Gre torej za zelo
enostavno strukturirane muzejske
TRS@MNUD  JH CDKTIDIN ON JK@RHMDL
vzorcu muzej-pisarna in so iz administrativnega in upravnega vidika
odvisne od zavoda-lastnika.
Od vseh, ki so zanjo zaprosili, je

95

96

Dallanalisi dei dati raccolti emerge come la propriet dei musei indagati, in linea con le altre realt museali con collezioni archeologiche
della Regione Veneto, vede la netta
maggioranza della propriet comuM@KDRTRSQTSSTQDKDQHL@MDMSH
5 istituzioni sono divise in tre musei
a carattere nazionale (Museo Archeologico Nazionale di Adria, Museo
Archeologico Nazionale di Altino e
il Museo Archeologico Nazionale di
Portogruaro) e due a carattere provinciale (il Museo Provinciale di Torcello e il Centro Turistico di San Basilio di Ariano nel Polesine).
Si tratta di strutture caratterizzate prevalentemente da una modalit di gestione in economia, cio
amministrate direttamente dallEnte
proprietario. Dallanalisi emerge, infatti, che sono solamente tre le strutSTQDK@BTHFDRSHNMD@C@S@@CTM
ente esterno: il Centro Turistico Culturale San Basilio di Ariano nel Polesine, diretto dallEnte Parco Delta
del Po, il Museo del Vetro di Murano,
gestito dalla Fondazione Musei Civici Veneziani, e la Mostra della Centuriazione Romana di Villadose, diretto
dalla Cooperativa Turismo Cultura.
Lo scenario complessivo, in tema
di presenza di statuti e regolamenti,
BNLD UHDMD RODBHB@SN MDKK SSN CH
HMCHQHYYNRTHBQHSDQHSDBMHBN RBHDMSHci e sugli standard di funzionamento e sviluppo dei musei (D.Lgs. n.
112/98 art. 150 comma 6), la dotazione da parte dei musei di statuti, regolamenti o di altri documenti
scritti di pari valore, consente di riconoscere loro uno status giuridico proprio e di assicurare a ciascun
museo un complesso organico di
MNQLD BNQQDK@SN @KK@ RT@ RODBHB@
missione. Proprio per questo motivo la dotazione di uno statuto e/o
di un regolamento va considerato un
requisito minimo, nonch punto di
riferimento per lorganizzazione e il
funzionamento di ogni museo e strumento utile per orientare lattivit.
Dallanalisi dei dati raccolti risulta come i musei archeologici oggetto
di indagine, siano degli istituti scarR@LDMSD QDFNK@SH C@ MNQLD RODBHche. Dei tredici musei censiti solo
3 godono di uno statuto proprio,
mentre 7 sono dotati di un regolamento interno. Si tratta, quindi, di
istituzioni museali caratterizzate da
una struttura semplice, coincidente

BNM HK BK@RRHBN LTRDN TBHN  BGD


dipendono dal punto di vista amministrativo e gestionale dallente proprietario.
Rispetto, invece, al numero di
realt museali che hanno richiesto
e ottenuto il riconoscimento regionale ai sensi della L. 50/84, solo 5
musei godono di tale accreditamento. Lottenimento del riconoscimento
regionale, sia per i musei di propriet pubblica che privata, indispenR@AHKD ODQ ONSDQ @BBDCDQD @H M@Mziamenti regionali.
Per quanto concerne le modalit
<A F9FRA9E=FLG i risultati emersi
dalla raccolta dei questionari evidenziano alcune criticit che caratterizzano lo scenario complessivo.
Lanalisi delle risposte relative alle
LNC@KHS CH M@MYH@LDMSN D KD HMterviste condotte con i responsabili,
fanno emergere come solamente in
alcuni casi gli enti proprietari riescaMN @C @RRHBTQ@QD @H LTRDH TM TRRN
QDFNK@QDDRTBHDMSD@RNRSDMDQDK@
gestione ordinaria della struttura.
I musei analizzati basano principalmente il loro sostentamento
su fondi di natura prevalentemenSD OTAAKHB@  RH@ ODQ H M@MYH@LDMSH
ordinari che straordinari, o su fondi
DQNF@SHC@M@MYH@SNQHHRSHSTYHNM@KH
privati, quali le Fondazioni Bancarie
o gli istituti di credito.
Il ricorso al coinvolgimento di
soggetti privati di diversa natura,
nelle forme pi comuni delle erogazioni liberali o delle sponsorizzazioni, per lo pi limitato ad occasioni
ADM CDMHSD  PT@KH DUDMSH D LNRSQD
temporanee. Come si pu intuire,
lattivit di fund raising viene ancora interpretata come una richiesta
DRSDLONQ@MD@ D ODQBH MNM OH@MHcata e continua nel tempo.
Poche sono anche le realt che
FNCNMN CH ENQLD CH @TSNM@MYH@mento derivanti principalmente dalla bigliettazione, dalle attivit didattiche, che nella maggior parte dei
casi vengono esternalizzate, diventando perci un costo a causa del
pagamento di un canone annuo per
il servizio prestato, e dalle vendite
DDSST@SDC@KANNJRGNO

$

La seconda area di indagine
volta ad inquadrare le principali atSHUHSDRDQUHYHCDKKNDQS@BGDB@Q@Sterizza il sistema museale archeologico dellarea Parsjad.
Una prima e generale considerazione che emerge dai risultati
la limitata accessibilit alle diverse
strutture museali, soprattutto quelle
collocate nelle aree rurali periferiche.
I musei nazionali sono aperti
tutti i giorni con orario continuato,
mentre per i musei gestiti dalle amministrazioni comunali lorario varia
nei diversi casi. Pi precisamente, si
nota che, mentre per la provincia di
Venezia i musei sono aperti con orari
variabili quasi tutti i giorni della settimana, dei cinque musei della provincia di Rovigo, solo il Museo Nazionale di Adria e il Museo dei Grandi
Fiumi di Rovigo garantiscono lapertura con una certa stabilit.
Sommando le ore di apertura
al pubblico, evidente come alcuni musei non riescano a garantire il
numero minimo di ore di apertura,
coincidente con 24 ore settimanali,
stabilito nel documento riguardante
gli standard museali, recepito dalla
Regione del Veneto con delibera della Giunta Regionale n. 2863/2003. Il
raggiungimento di tale monte ore
essenziale per far s che un museo
ONRR@ CDMHQRH S@KD  .UUH@LDMSD 
non bisogna dimenticare, che lapertura di tali musei direttamente inTDMY@S@C@KK@KNQNBNKKNB@YHNMDMDK
SDQQHSNQHNRHSQ@SS@ HME@SSH CHOHBBNKD
realt museali situate in aree rurali
periferiche caratterizzate da una limitata accessibilit esterna.
Per quanto riguarda, invece, le
attivit svolte dai musei archeologici considerati, esse possono essere raggruppate in due categorie
principali: da un lato, abbiamo le
attivit dedicate alla valorizzazione
e alla divulgazione delle collezioni, dallaltro, le attivit prettamente
connesse alla JA;=J;9K;A=FLA;9.
Dallanalisi dei dati emerge come
i musei archeologici si stiano magFHNQLDMSD HLODFM@MCN MDKKNDQta di servizi e attivit che ricadono
nelle prima categoria sopra citata (si
UDC@ HK FQ@BN   3TSSD KD RSQTSSTQD 
HME@SSH NQNMNTMRDQUHYHNDCTB@SHUN 
rivolto soprattutto alle scolaresche,

BGD BNHMBHCD BNM KNDQS@ CH UHRHSD


guidate, proposte in tutti i 13 musei,
e di attivit didattiche, presenti in
tutte le istituzioni, ad esclusione del
Museo Archeologico di Santa Maria
di Lugo.
Oltre a questi servizi, che possono essere oggi considerati di base,
si aggiungono anche attivit dirette
alla promozione e alla divulgazione della collezione e delle ricerche
BNMCNSSDC@KKNRS@RBHDMSHBN PT@KH
eventi culturali di vario genere, che
spaziano dai concerti, alle giornate a
tema, alla Notte dei Musei, proposti
in ben 10 realt, seguiti da mostre e
conferenze organizzate rispettivamente in 9 e 8 musei. Tutte queste
attivit svolgono unazione di rilievo, in quanto capaci di proiettare il
museo verso la societ e la comunit
RBHDMSHB@CHQHEDQHLDMSN L@HLOHDgando al contempo notevoli risorse
CH SDLON D CH ODQRNM@KD PT@KHB@to, non sempre presente in tutte le
strutture. Vedi Graf. 1 - Attivit Musei
progetto Parsjad.

Altro settore, come gi spiegato,


verso cui il museo archeologico riversa la propria specializzazione
K@QHBDQB@RBHDMSHB@ -DKKHMC@FHMDRH
constatato che i musei che svolgono principalmente tale attivit sono
i musei nazionali e i musei comunali
(anche compositi), collocati in centri maggiori: tra questi abbiamo il
Museo dei Grandi Fiumi di Rovigo,
HK,TRDNCDKK@!NMHB@CH2@M#NM
di Piave, il Museo del Vetro di Murano. Oltre allattivit di ricerca, consistente principalmente nello studio
dei reperti, nella loro catalogazione,
nella partecipazione a campagne di
scavo o a progetti di diversa natura,
in collaborazione con le soprintendenze archeologiche e le universit,
cinque musei sono attivi anche nel
campo del restauro.
necessario comunque sottolineare che il numero di musei in grado di portare avanti unattiva attivit
CH QHBDQB@ RBHDMSHB@  DRHFTN  OQHMcipalmente a causa sia alle singole
RBDKSDDDSST@SDC@KKDHRSHSTYHNMH RH@
dalla mancanza di fondi e di personale specializzato.
Relativamente contenuta anche
lorganizzazione di corsi di formazione (7) indirizzati al personale interno
oppure proposti al pubblico esterno
interessato al settore, quali archeologici, insegnanti, studenti, ecc.
Rispetto alla disponibilit di spa

GHHOQRDNUHGLWDFLMRYVPLVOX]DNRQD/ dobilo samo pet muzeIDU  /QHCNAHSDU CDDKMDF@ OQHYM@MI@


je za muzeje v javni in zasebni lasti
AHRSUDMDF@ONLDM@Y@LNMNRSOQHCNAHU@MI@CDDKMHGM@MMHGRONCbud.
Zbrani rezultati iz vpraalnikov,
ki zadevajo QDLQ QDQFLUDQMD, so
ONJ@Y@KHM@MDJ@SDQDJQHSHMDSNJD 
YM@HKMD Y@ BDKNSMH RBDM@QHI  M@KHY@
NCFNUNQNU Y NCFNUNQMHLH J@D  C@
je samo nekaterim lastnikim institucijam uspelo zagotoviti reden in
Y@CNRSDM CNSNJ M@MMHG RQDCRSDU
za nemoteno upravljanje strukture.
y/QDHUDSIDi @M@KHYHQ@MHG LTYDIDU SDLDKIH OQDCURDL M@ M@Mciranju iz rednih ali izrednih javnih
sredstev ali na podpori s strani zasebnih institucionalnih donatorjev,
JNSRNA@MMDETMC@BHID@KHJQDCHSMH
instituti.
Sodelovanje z zasebnimi subjekSHQ@YKHMHGUQRSNAH@IMNFQDY@OQNstovoljne prispevke ali sponzorstva)
ID M@IUDJQ@S NLDIDMN M@ ONRDAMD
OQHKNMNRSH  JNS RN OQHQDCHSUD HM NA@RMD Q@YRS@UD  #DI@UMNRS YAHQ@MI@
sredstev (fund raising) torej e veCMN SDID JNS Y@@RM@ HM HLOQNUHYHQ@M@ M@KNF@  JH RD MD M@QSTID HM MH
trajne narave.
Redke so muzejske realnosti, ki
HYJNQH@IN J@SDQN NC NAKHJ R@LNM@MBHQ@MI@UFK@UMDLFQDY@CNAHDJ
NCOQNC@IDURSNOMHBHMNCHYNAQ@DU@KMHG CDI@UMNRSH  JH O@ RD M@IUDkrat odstopijo zunanjim izvajalcem
HM Y@Q@CH OK@HK@ KDSMD OQHRSNIAHMD
za opravljeno storitev) postanejo
stroek, ter od prodaje v muzejskih
prodajalnah.

'

Drugi del raziskave je namenjen
analizi osnovnih dejavnosti in storitev v ponudbi, ki karakterizira arheoloke muzeje v okviru projekta
Parsjad.
Prva in splona ocena, ki je razvidna iz rezultatov, je omejen dostopCNQ@YKHMHGLTYDIRJHGRSQTJSTQ 
predvsem tistih, ki se nahajajo na
ONCDDKIT 
Narodni muzeji so odprti vse dni
Y MDOQDJHMIDMHL CDKNUMHL @RNL 
LTYDIHUNAHMRJHTOQ@UHO@RNNCOQSHYQ@YKHMHLCDKNUMHL@RNL *NM

kretno smo opazili, da so v pokrajini


Benetke muzeji odprti skoraj vse dni
USDCMTYQ@YKHMHLCDKNUMHL@RNL 
medtem ko je od petih muzejev v
ONJQ@IHMH1NUHFNQDCMHNCOHQ@KMH@R
zagotovljen samo v Narodnem muzeju v Adrii in Muzeju velikih rek v
Rovigu.
DRDSDIDLNURDTQDNCOQSI@I@Unosti, ugotovimo, da nekateri muzeji
ne morejo zagotoviti minimalnega
SDUHK@TQSDCDMRJN JHIHGCNKN@
dokument o muzejskih standardih,
ROQDIDSUCDDKH!DMDHIHYNCKNJNL
#DDKMDF@ RUDS@ S   
Doseganje taknega tevila ur pa
je osnovni pogoj, da se lahko muzej
opredeli kot tak. Seveda ne smemo
ONY@AHSH  C@ ID @R NCOHQ@MI@ LTYDjev neposredno pogojen z njihovo
TLDRSHSUHIN M@ NYDLKIT FQD M@LQD
Y@L@IGMDLTYDIDUNCQNMHGONCDDKRJHG JQ@IHG Y NLDIDMHL CNSNJNL
obiskovalcev.
Dejavnosti, ki jih izvajajo obravnavani arheoloki muzeji, lahko
razdelimo v dve osnovni kategoriji:
na eni strani gre za dejavnosti, namenjene YDORUL]DFLML LQ UD]LUMDQMX
informacij o muzejskih zbirkah, na
CQTFHO@Y@CDI@UMNRSH JHRNUDHMNma vezane na znanstveno raziskovanje.
Iz analize podatkov je razvidno,
da arheoloki muzeji razvijajo predvsem ponudbo storitev in dejavnosti, ki sodijo v prvo kategorijo (glej
*UDNRQ   5RD RSQTJSTQD M@LQD
ONMTI@IN HYNAQ@DU@KMD RSNQHSUD 
namenjene predvsem olskim skupinam, ki vsopadajo s ponudbo vodenih obiskov (ponuja jih vseh 13
LTYDIDUHMCHC@JSHMHGCDK@UMHB M@
voljo v vseh obravnavanih muzejih z
izjemo Arheolokega muzeja v Santa
Marii di Lugo.
Poleg teh storitev, ki jih dandanes pritevamo med osnovne, so
tu e dejavnosti, povezane neposreCMN R OQNLNBHIN HM NAUD@MIDL N
muzejskih zbirkah ter raziskovalne
dejavnosti, ki jih izvaja strokovno
osebje, kot so raznovrstne kulturne
prireditve, koncerti, tematski dneUH  -NH U LTYDIT ONMTI@ IHG J@Q
10 ustanov), razstave (9 muzejev)
in predavanja (organizira jih 8 muzejev). Vse natete dejavnosti so
ONLDLAMD Y@ OQDHUDSID LTYDI@ 
R@I F@ SDRMDID ONUDYTIDIN Y CQTAN
in s ciljanimi skupinami strokovnih
krogov, vendar pa zahtevajo veliko

@R@HMRSQNJNUMDF@NRDAI@ JHO@MH
vedno na voljo v vseh strukturah.
*UDNRQ'HMDYQRVWLPX]HMHYSURMHNta Parsjad

#QTFN ONCQNID CDKNU@MI@ @QGDolokega muzeja je znanstveno raziskovanje. Analiza je potrdila, da mu


M@IUD ONYNQMNRSH M@LDMI@IN M@QNCMHHMNAHMRJHLTYDIHSTCHLD@MDF@SHO@HYUDIHGRQDCH ,DCMIHLH
so Muzej velikih rek v Rovigu, Muzej
!NMHJD U 2@M #NM@IT CH /H@UD HM
Muzej muranskega stekla. Poleg razHRJNU@KMHG CDI@UMNRSH RD ONRUD@IN
predvsem tudijam eksponatov, njihovem katalogiranju, skupaj z zavodi
Y@U@QRSUN@QGDNKNJDCDCHHMDHMY
univerzami sodelujejo pri projektih
izkopov ali drugovrstnih projektih,
pet muzejev pa je dejavnih tudi na
ONCQNITQDRS@UQ@SNQRSU@ 
@KO@IDSQDA@ONTC@QHSH C@RDY
dejavnostmi znanstvenega raziskovanja aktivno ukvarja le skromno
tevilo muzejev. Razloge za to lahko
ONHDLNOQDCURDLUHMCHUHCT@KMHG
NCKNHSU@G UR@JDF@ NC MIHG  O@ STCH
zaradi pomanjkanja sredstev in strokovnega osebja.
Precej omejeno je tudi organiziQ@MID SD@IDU Y@ TRONR@AKI@MID  
namenjenih zaposlenim ali pa v ponudbi zunanjim interesentom, kot
RN@QGDNKNFH THSDKIH STCDMSIDHSC
V zvezi z UD]SROROMLYRVWMR WXdijskih prostorov RNM@FQ@JNMT
razvidni rezultati vpraanj, ki so se
nanaala na obstoj prostorov, namenjenih raziskovalnim dejavnostim
ter prostora za redno izvajanje dejavnosti v ponudbi obiskovalcem.
-@IUD @MJDSHQ@MHG LTYDIDU HL@
JNMEDQDMMN CUNQ@MN   RKDCH IH
RSQNJNUM@JMIHMHB@ @QGHUCNJTmentov (6) in fotografski arhiv (6).
*UDNRQ   WXGLMVNL SURVWRUL PX]HML
projekta Parsjad

/QHAKHMN ONKNUHB@ LTYDIDU HL@


THKMHBDYMIHLHIDNOQDLKIDMHG@MJDSHQ@MHG RSQTJSTQ  3@ ONC@SDJ J@D 
da preostala polovica muzejev v
stavbi, kjer so razstavljene muzejske
zbirke, ne razpolaga s prostorom, ki
AH AHK M@LDMIDM HYJKITMN HYU@I@MIT
tovrstnih dejavnosti, kar pomeni, da
morajo delavnice potekati med razstavnimi vitrinami.
2S@MID ID LNQC@ NOQ@UHDMN Y@radi dejstva, da tevilne anketirane
muzeje gostijo strukture, ki prvotno
niso bile namenjene muzejski dejavnosti, kot na primer Arheoloki
Muzej Santa Maria di Lugo, ki se

nahaja v bivi cerkvi, ali Pokrajinski


muzej Torcello, ki je lociran na biUDLRDCDT.AHMRJDF@RUDS@HMU
QGHURJHO@K@H HMRNIHGDKDJ@RMDID
prilagodili novi namembnosti. Slabo
zastopane so tudi tudijske dvorane
(4) in laboratoriji (4).
Za iri in bolj kompleten vpogled v arheoloko muzejsko poMTCAN RLN RD NCKNHKH  C@ ANLN
upotevali tudi SRQXGER GRGDWQLK
storitev, namenjenih celostni ponudbi obiska, ki tako postane e bolj
OQHIDSDM NQF@MHYHQ@MHMHYQODM 
*@D  C@ ID Y@JNM  9@JNM
Ronchey), ki je vpeljal lik zasebneF@ ONMTCMHJ@ ONLNMHG RSNQHSDU 
kot so booshop, kavarna, garderoba,
vodeni obiski, v praksi izvedlo samo
nekaj anketiranih arheoloko-muzejskih organizacij. Kot bomo videli
UM@RKDCMIDLNCRS@UJT RDCHC@JSHne dejavnosti in vodeni obiski resda
pogosto poverijo zunanjim izvajalcem, v glavnem zaradi pomanjkanja
strokovnega osebja in sredstev, vendar jim e vedno zelo malo muzejskih ustanov zaupa tudi opravljanje
dodatnih storitev, kot so garderoba, muzejska prodajalna, varnostna
RKTA@ HM ONCNAMN  3D RSNQHSUD  D
jih je muzej organiziral, opravljajo
njegovi zaposleni4. Razlog se skriva
v majhnosti in lokaciji nekaterih muYDIDU NTSRNTQBHMF ONLNMHG RSNQHtev v teh strukturah trenutno ne bi
bil ugoden za zasebnika, ki bi rad inUDRSHQ@KUCNAHJNMNRMNCDI@UMNRS 
Poleg analize muzejskih prostorov anketiranih struktur smo se odKNHKH C@ANLNQ@YHRJ@KHSTCHMIHGNUN
notranjo dostopnost osebam z omejenimi gibalnimi sposobnostmi. Med
trinajstimi muzeji je kar deset takih,
JH NLNFN@IN DMNRS@UDM CNRSNO CN
vseh javnih prostorov, medtem ko
K@GJN NRDAD R SD@U@LH OQH FHA@MIT
NAHDIN R@LN OQHSKHID -@QNCMDF@
arheolokega muzeja v Portogruaru.
DKDKHRLNTFNSNUHSHSTCH @KHLTYDIH
Q@YONK@F@INYLNMNRSINNAHRJ@RKDpih in slabovidnih. Trenutno so table
Y!Q@HKKNUNOHR@UNM@LDDMDR@LN
v treh muzejih: Narodna arheoloka
muzeja v Altinu in Portogruaro ter
Pokrajinski muzej v Torcellu.

97

Si inoltre voluto indagare anche


sulla presenza di percorsi non vedenti allinterno delle sedi espositive. Attualmente sono solamente tre
i musei che dispongono di pannelli
con linguaggio braille: il Museo Archeologico Nazionale di Altino e di
Portogruaro, e il Museo Provinciale
di Torcello.

&


*UDFR$WWLYLW0XVHLSURJHWWR3DUVMDG
*UDNRQ'HMDYQRVWLPX]HMHYSURMHNWD3DUVMDG

zi di consultazione HKFQ@BNQHONQta i risultati delle domande relative


alla presenza di strutture utili per lo
svolgimento dellattivit di ricerca, e
di ambienti adibiti alle normali funzioni delle attivit proposte al pubblico. Nei musei indagati, le strutture
L@FFHNQLDMSD CHTRD RNMN K@ R@K@
conferenze (7), seguite da biblioteca
specializzata (6), archivio documenS@KDD@QBGHUHNENSNFQ@BN 
Vedi Graf. 2 - Spazi di consultazione, Musei progetto Parsjad

98

Circa il 50% delle strutture risulta essere il numero dotato di aule didattiche, presenti in 7 strutture. Tale
dato suggerisce come nella restante
LDS CDH B@RH FKH DCHBH NROHS@MSH KD
collezioni non dispongano di spazi
espressamente dedicati allorganizzazione di tale attivit, che sar dunque svolta tra le vetrine della sezione espositiva.
Tale situazione probabilmente
FHTRSHB@S@C@KE@SSNBGDLNKSHLTRDH
analizzati sono ospitati in strutture che originariamente non svolgevano unattivit museale, come per
esempio il Museo Archeologico di
Santa Maria di Lugo, ospitato in una
ex chiesa, e il Museo Provinciale di
Torcello, ospitato nellex sede del
Consiglio e nel Palazzo dellArchivio,
e che quindi sono state riadattate a
MTNU@ETMYHNMD /NBNCHTRDRNMNKD
sale studio (4) e i laboratori (4).
(MMD ODQ@UDQDTM@UHRHNMDOH
@LOH@DBNLOKDS@CDKKNDQS@LTRDale archeologica, si deciso di prendere in considerazione anche lG=Jta di servizi accessori, che si aggiun-

gono a completamento della visita


per renderla maggiormente piacevole, organizzata e completa.
Lentrata in vigore della L. 4/93
(Legge Ronchey), che ha introdotto
K@ FDRSHNMD OQHU@S@ MDKKNDQS@ CDH
servizi aggiuntivi, quali bookshop,
B@DSSDQH@ FT@QC@QNA@ UHRHSDFTHC@te, sembra essere stata recepita solo
in parte dalle organizzazioni archeologiche analizzate. Se, infatti, come
vedremo nel prossimo paragrafo, le
attivit didattiche e di visite guidaSD UDMFNMN RODRRN @C@SH @C DMSH
esterni, principalmente per mancanza di personale specializzato e
carenza di fondi, sono ancora pochi
i tentativi di esternalizzare servizi accessori, quali guardaroba, bookshop, servizio di guardiania, ecc.
0TDRSTKSHLH  PT@MCN OQDRDMSH  UDMgono gestiti dal personale interno4.
Ci dovuto alla piccola dimensione
D@KK@KNB@KHYY@YHNMDCH@KBTMHLTRDH
loutsourcing dei servizi accessori in
tali realt, non avrebbe attualmente
convenienza per il privato che vuole
investire in unattivit remunerativa.
Oltre ad aver analizzato gli spazi museali presenti nelle strutture
indagate, si deciso di prendere in
considerazione anche la loro accessibilit interna da parte di parte di
persone con limitate capacit motorie. Su un totale di 13 musei, ben
10 risultano facilmente accessibili in
tutti gli spazi accessibili al pubblico,
mentre lesposizione del Museo Archeologico Nazionale di Portogruaro
fruibile a persone con problemi di
deambulazione sono al piano terra.

Come emerso nei capitoli precedenti, laspetto delle forme di collaborazione con altre organizzazioni
e istituzioni presenti nel territorio
di riferimento posso assumere una
valenza strategica. Per tale ragione,
si dedicata la terza parte dellindagine allanalisi delle principali forme
di collaborazione che i musei archeologici dellarea Parsjad hanno sviKTOO@SN ODQ ONSDQ NODQ@QD D NQHQD
i servizi e le attivit dichiarate nei
questionari.
Nel paragrafo dedicato ai nuovi
modelli di business si sostenuto
come sia essenziale stringere una
serie di collaborazioni e relazioni
con gli altri soggetti del territorio per
mettere in atto un processo di produzione-riproduzione-distribuzione
del prodotto. Dallelaborazione dei
dati emerge abbastanza chiaramente come i musei archeologici collaborino principalmente con il mondo
della scuola, suo principale fruitore,
e con associazioni ed organizzazioMH BTKSTQ@KH BGD NQNMN HK RDQUHYHN
di visita guidata e laboratori didatSHBH  3TSSH H LTRDH @C@MN  @KLDMN
in parte, il servizio di visite guidate
ad associazioni esterne o a gruppi
di volontari. Lo stesso avviene anche per i laboratori didattici dati in
outsourcing in ben 11 realt museali.
Molto forte risulta anche il legame con vari enti che si occupano di
JA;=J;9K;A=FLA;9, segnalato da ben
9 istituzioni museali. Spesso, infatti,
i musei archeologici collaborano a
progetti di valorizzazione del patrimonio archeologico e a campagne
di scavo, condotte in collaborazione
con le universit e la Soprintendenza per i Beni Archeologici, durante le
quali la loro struttura funge da vera e
propria sede logistica per la pulizia e
per la prima catalogazione dei reperti. Le collaborazioni con le universit,

inoltre, si esplicano anche attraverso


la creazione di attivit congiunte:
conferenze, dibattiti, pubblicazioni,
B@O@BH CH Q@NQY@QD KHLL@FHMD RH@
del museo sia dellente di ricerca,
non solo nei confronti della domanda locale, ma anche di quella esterna. In alcuni casi il museo archeologico pu diventare un vero e proprio
centro di formazione. Il Museo dei
Grandi Fiumi, per esempio, dispone
di un laboratorio di restauro molto
attivo, in cui si svolgono attivit di
tirocinio formativo, alle quali prendo
parte studenti italiani e stranieri.
Vedi Graf. 3 - Collaborazioni attivate dai
Musei Archeologici dellarea Parsjad.

,NKSN CHTRD RNMN @MBGD KD


collaborazioni per la realizzazione
di eventi culturali di vario genere, come per esempio le domeniche dedicate alle famiglie, musei in
musica, manifestazioni a tema, ecc.
Dallanalisi delle risposte pervenute, per quanto riguarda lorganizzazione di eventi, i musei dellarea
PArSJAd sembrano collaborare principalmente con associazioni culturali e musicali, come per esempio
il Museo Archeologico Nazionale di
Altino e il Museo Archeologico Nazionale di Adria che collaborano rispettivamente con lAssociazione
Diapason&Naima, il primo, e il Conservatorio Buzzollo, il secondo. Alcuni musei, inoltre, si stanno aprendo
alla collaborazione con gruppi specializzati in rievocazioni storiche,
come la Mostra della Centuriazione
Romana di Villadose, che collabora
con lAssociazione Danze Antiche e
lassociazione Legio I Italica per la
creazione di eventi e manifestazioni
culturali.
Sempre in tema di collaborazioni per la realizzazione di eventi, di
successo anche levento Con le
mani nella storia organizzato dallo
RS@ CDK ,TRDN CDH &Q@MCH %HTLH CH
1NUHFN  @@MB@SN C@KK@RRNBH@YHNMD
Paleoworking (con sede nello stesso
stabile del museo) e da molti esperti
in archeologia sperimentale. La manifestazione prevede due giornate
tra miti e mestieri, con la realizzazione di mostre, laboratori, convegni.
Per quanto riguarda i servizi accessori, ad eccezione del Museo del
Vetro, gestito dalla Fondazione Musei Civici Veneziani, che ha esternalizzato il servizio di bookshop alla
societ Skyra, e il servizio di preno

*UDFR6SD]LGLFRQVXOWD]LRQH0XVHLSURJHWWR3DUVMDG
*UDNRQWXGLMVNLSURVWRULPX]HMLSURMHNWD3DUVMDG

6

Kot se je pokazalo v prejnjih poglavjih, je vidik oblik sodelovanja z
drugimi organizacijami in instituciI@LH M@ QDEDQDMMDL NYDLKIT K@GJN
stratekega pomena. Zaradi tega
smo tretji del raziskave namenili
prav analizi poglavitnih oblik sodelovanja, ki so jih arheoloki muzeji
M@OQNIDJSMDLNALNIT/@QRI@CQ@Yvili za izvajanje in ponudbo dejavnosti in storitev, navedenih v vpraalnikih.
V poglavju, ki obravnava nove
poslovne modele, smo omenili, da
je za uspeno izvajanje procesa proizvodnje-reprodukcije-distribucije
izdelka bistvenega pomena izdelaU@ LQDD RNCDKNU@MI@ HM Q@YLDQHI
z drugimi subjekti na ozemlju. Iz
analize podatkov precej jasno izhaja, da arheoloki muzeji sodelujejo
predvsem s olsko realnostjo, ki je
njihov glavni uporabnik, ter s kulSTQMHLH YCQTDMIH HM NQF@MHY@BHI@LH 
ki nudijo storitve vodenih obiskov
HM CHC@JSHMHG CDK@UMHB  5RH LTYDIH
odstopijo vsaj del vodenih obiskov
YTM@MIHLYCQTDMIDL@KHOQNRSNUNKIBDL $M@JNUDKI@STCHY@CHC@JSHMD
delavnice, ki jih kar 11 muzejev daje
v outsourcing.
Zelo tesna je tudi povezava z
Q@YKHMHLH TRS@MNU@LH HY ONCQNI@ znanstvenega raziskovanja, ki
jo je prijavilo kar devet muzejskih
RSQTJSTQ  QGDNKNJH LTYDIH M@LQD
pogosto sodelujejo v projektih vre

CMNSDMI@ @QGDNKNJD CDCHHMD HM U


arheolokih izkopih, ki se izvajajo v
sodelovanju z univerzami in ZavoCNLY@RONLDMHJNU@QRSUN 5@RT
teh projektov muzejska struktura
OQDCRS@UKI@ OQ@UB@SH KNFHRSHMH BDMSDQY@HDMIDHMOQUNJ@S@KNFHQ@MID
najdb. Sodelovanje z univerzami se
ONKDF M@SDSDF@ HYQ@@ STCH RJNYH
pripravo skupnih dejavnosti: predavanja, javne tribune, publikacije, vse
z namenom uveljavitve podobe muzeja in raziskovalne ustanove med
lokalno in iro javnostjo. V nekaterih primerih lahko arheoloki muzej
ONRS@MDSTCHOQ@UB@SNHYNAQ@DU@KMN
RQDCHD ,TYDIUDKHJHGQDJM@OQHLDQ
razpolaga z izjemno aktivnim restavratorskim laboratorijem, v katerem
NQF@MHYHQ@IN CDI@UMNRSH HYNAQ@Dvalnega pripravnitva za italijanske
in tuje tudente. *UDNRQ   2EOLNH
sodelovanja arheolokih muzejev na
SURMHNWQHPREPRMX3DUVMDG

Zelo razirjeno je tudi sodelovanje pri realizaciji raznovrstnih


kulturnih dogodkov: nedelje za
CQTHMRJD NAHRJD  FK@RADMH CNFNCki v muzejih, prireditve na temo
itd. Analiza posredovanih odgovorov na temo organizacije dogodkov
J@D  C@ LTYDIH M@ NYDLKIT OQNIDJta PArSJAd sodelujejo predvsem s
JTKSTQMHLH HM FK@RADMHLH YCQTDMIH 
Tak primer sta Narodni arheoloki
LTYDIU KSHMT JHRNCDKTIDY9CQTDnjem Diapason&Naima in Narodni
arheoloki muzej v Adrii, ki sodeluje
s Konzervatorijem Buzzollo. Poleg
tega nekateri muzeji ponujajo so-

delovanje skupinam za obnovo zgodovinskih dogodkov, kot na primer


Stalna razstava rimske centuriacije v
Villadosu, ki organizira kulturne dogodke in prireditve v sodelovanju z
9CQTDMIDL@MSHMHGOKDRNUHMRRJTpino Legio I Italica.
Na temo skupne izvedbe dogodkov naj omenimo e uspeno prireditev Z rokami v zgodovini, ki jo
organizira osebje Muzeja velikih rek
U 1NUHFT R ONLNIN YCQTDMI@ /@KDNVNQJHMF R RDCDDL U ONRKNOIT
muzeja) in tevilnih strokovnjakov
eksperimentalne arheologije. Dvodnevna prireditev se odvija med
LHSHHMONJKHBHHMUJKITTIDQ@YRS@UD 
delavnice in predavanja.
Preostali muzeji z izjemo Muzeja stekla (v upravi Fundacije benekih mestnih muzejev), ki je upravljanje muzejske knjigarne in trgovine
prepustil podjetju Skyra, rezervacije
in vodene obiske (samo za odrasle)
pa podjetju Codess Cultura s.r.l.
izvajajo SRPRQH VWRULWYH v lastni
QDHIH  RDUDC@ D RN SD U MIHGNUH ONnudbi.
1@YHRJ@KH RLN STCH UJKITDMNRS
muzejev v PX]HMVND RPUHMD LQ
sisteme DOQ@URNRJNQ@IURH@MJDSHQ@MBH NCFNUNQHKH  C@ RN UJKITDMH U
LQDNLTYDIDU O@IHGIDM@UOQ@@nje, s katerimi posameznimi organizacijami sodelujejo, le malo odgovorilo, da so to muzejske ustanove. To
neskladje daje misliti, da dananji
muzejski sistemi ne spodbujajo dialoga in sodelovanja med direktorji in
odgovornimi osebami posameznih
TRS@MNUULQDHHMC@M@MDJM@HM
nastopajo samo kot komunikacijski
J@M@KH MDO@STCHJNSQDEDQDMMHNQgan za usklajevanje in vrednotenje
UK@MIDMHGLTYDIDU 

1

3$6-$
.A Y@JKITJT @M@KHYD QDYTKS@SNU
raziskave trinajstih muzejskih realMNRSH M@ QDEDQDMMDL NALNIT OQHTINDF@ Q@YHRJNU@KMDF@ OQNIDJS@
DKHLN OQHJ@Y@SH ONFK@UHSMD YM@HKnosti celostne podobe stanja.
*NS RLN D ONTC@QHKH  FQD U UDHMH OQHLDQNU Y@ L@IGMD HM RQDCMID
velike strukture, ki pogosto zaradi
ONL@MIJ@MI@ Q@YONKNKIHUHG KNUDJHGUHQNUHMM@MMHGRQDCRSDURSD-

@UN CNRDF@IN OQHLDQMD RS@MC@QCD


CNUNKI ID  D NLDMHLN  C@ MDJ@SDQD
strukture ne morejo zagotoviti niti
24-urnega tedenskega odprtja, ki jih
zahtevajo minimalni standardi pristojnega ministrstva.
Z vidika SRQXGEHVWRULWHY je razvidno, da skoraj vsi muzeji ponujajo
HYNAQ@DU@KMDCDI@UMNRSH UDMC@QD
niso razvili dovolj raznolike ponudbe, da bi lahko zadostili potrebam
Q@YKHMHGBHKIMHGRJTOHM 3@JNRSQTJSTrirano ponudbo je najti samo v veIHGLDRSMHGLTYDIHG 
Kot je pokazala analiza merila
uspenosti (benchmark), so med
analiziranimi muzeji najuspeneji
tisti, ki razvijajo ponudbo interakSHUMHG CHC@JSHMHG CDI@UMNRSH  $CDM
od ciljev tovrstnega prizadevanja
je ustvariti produkt tako imenovaMDF@ HYJTDMIRJDF@ TDMI@  JH AH M@
MDJ M@HM NAKHJNU@K ONR@LDYMDF@
TONQ@AMHJ@ Y UHCHJ@ HYNAQ@DU@MI@ 
QDJQD@BHID  DRSDSHJD HM TRSUDMDF@
dojemanja.
/NKDF OQHOQ@UD HYNAQ@DU@KMDF@
okolja, ki predvideva rekonstrukcijo nekaterih eksponatov ali okolja,
na katerega so strokovnjaki naleteli med arheolokimi izkopavanji, ali
uporabo novih tehnologij, ki omoFN@IN ANKI ONCQNAMN NAQ@UM@UN 
poskuajo prej predstavljeni muzeji
ponuditi tudi delavnice, v katerih
otroci in odrasli aktivno sodelujejo
v lastni muzejski izkunji.
Eksperimentalna
arheologija,
prisotnost arheologov ali rokodelcev
YHYJTMI@LHUOQDCDK@UHRODBHMHG
materialov, ponudba nenavadnih
UNCDMHGNAHRJNUUCQTAHHFQ@KBDU JH
interpretirajo zgodovinske osebnosti, ali pravcati zgodovinski dogodki
(kot so tisti v Arlesu in tevilnih drugih evropskih arheolokih muzejih)
bi lahko pritegnili javnost (oziroma
ciljne skupine v njej) v svet arheologije. Z ustreznim prilagajanjem lokalnim ozemeljskim posebnostim bi
lahko arheoloki muzeji projektnega
NALNI@/ Q2) CTHMJNUHSNTONQ@bili v svoji ponudbi.
Analiza je opozorila tudi na zelo
ONLDLAMN SDL@SHJN  M@LQD M@
REOLNR XSUDYOMDQMD muzejskih orF@MHY@BHI  3@ ID M@ MDJ M@HM NCUHsna tudi od delnega pomanjkanja
sredstev, potrebnih za nemoteno in
kakovostno izvajanje storitev. Vseh
trinajst muzejev je v pristojnosti
I@UMHGNQF@MNUNAHMD ONJQ@IHMDHM

99

tazione e visite guidate (solo adulti) alla societ Codess Cultura s.r.l, il
resto dei musei gestisce autonomaLDMSDS@KDRDQUHYH PT@MCNNDQSH
Si inoltre indagato sulladesione dei musei a reti e sistemi museali. Nonostante quasi tutti i responsabili abbiano risposto di appartenere
a reti di musei, pochi sono coloro
che alla domanda sulle collaborazioni tra singole organizzazioni hanno
dichiarato di collaborare con altre
istituzioni museali. Tale discrepanza fa pensare che gli attuali sistemi
museali non stimolino il dialogo e
la collaborazione tra i direttori e responsabili delle singole istituzioni
appartenenti alla rete, e che in qualche modo concentrino la loro attivit
sugli aspetti comunicativi, piuttosto
che propriamente rappresentare un
organo di riferimento per il coordinamento e la valorizzazione dei musei partecipanti.

1

3$6-$

100

A conclusione dellanalisi dei risultati dellindagine svolta sulle 13


realt museali individuate nellarea
di riferimento per il presente progetto di ricerca, si ritiene utile delineare i tratti principali caratterizzanti lo
scenario complessivo.
Come gi sottolineato si tratta
nella maggioranza dei casi di strutture di medio-piccole dimensioni, che
molto spesso, a causa della scarsit
delle risorse umane disponibili cos
BNLD CDKKD ENMSH CH M@MYH@LDMSN 
faticano a raggiungere uno standard
di servizio adeguato: basti pensare che alcune strutture non riescono neppure a garantire le 24 ore di
apertura settimanali richieste dagli
standard minimi ministeriali.
In merito ai K=JNARAG=JLA, si evidenzia come quasi tutti i musei stiano facendo leva sullattivit didattica, ma non abbiano ancora sviluppaSN TM UDMS@FKHN CH NDQSD CHDQDMziate per i diversi target. Solo i musei
pi grandi e collocati in centri di medie dimensioni sembrano garantire
TMNDQS@RSQTSSTQ@S@ 
Come emerso dallanalisi benchmark, la tendenza dominante nei casi
virtuosi di musei e sistemi analizzati
quella di spostarsi sempre pi su

TMNDQS@CH@SSHUHSCHC@SSHBGDHMSDrattiva. Uno degli obiettivi che in tal


modo si tenta di conseguire la creazione di un prodotto esperienziale,
che risulti in un certo qual modo pi
incisivo sulla sfera educativa, ricreativa, estetica ed emotiva del singolo
fruitore.
Oltre alla creazione di allestimenti didattici, che prevedono la
ricostruzione di alcuni reperti o ambienti ritrovati nelle diverse campagne di scavo, oppure lutilizzo delle
nuove tecnologie che permettono
un maggior grado di approfondimento, i musei presentati nel secondo capitolo stanno cercando di proporre dei laboratori dove sia il bambino che ladulto diventino parte
attiva nella creazione della propria
esperienza di visita.
Il ricorso allarcheologia sperimentale e di conseguenza ad archeologi o artigiani specializzati nella
K@UNQ@YHNMD CH RODBHBH L@SDQH@KH  K@
proposta di visite guidate inconsuete, tenute da attori che interpretano personaggi passati, o di vere e
proprie rievocazioni storiche (come
avviene ad Arles o in molti altri musei e parchi archeologici europei)
potrebbero risultare delle iniziative
in grado di avvicinare il pubblico (di
PTDRSHRODBHBHS@QFDSCHQHEDQHLDMSN
al mondo dellarcheologia, che con
le dovute declinazioni rispetto alla
RODBHBHSCDKSDQQHSNQHN ONSQDAADQN
essere utilmente adottate da parte dei musei archeologici dellarea
PArSJAd.
4MSDL@CHRHFMHB@SHU@QHKDU@MY@
che sembra emergere dallanalisi,
quello relativo alla forma di gestione delle organizzazioni museali, che
in qualche modo legato anche alla
parziale mancanza dei fondi necessari per garantire unadeguata continuit e qualit del servizio erogato.
I 13 musei analizzati sono tutti di
propriet di enti pubblici (Comuni,
Provincie e Stato), sui quali ricade la
responsabilit della loro gestione.
Tale situazione evidenzia come
vi sia stata una scarsa adozione delle possibili forme di gestione introdotte dalla L. 142/1990, seguita
dal successivo art 113 bis del Tuel
(Testo Unico degli Enti Locali), cos
BNLD LNCHB@SN C@KK@QS  CDKK@ + 
448/2001, che regolamenta la modalit di gestione degli enti locali
privi di rilevanza industriale, a cui

appartengono i musei. Da una lettura dellart 113 bis si evince come sia
ONRRHAHKDC@QDHM@C@LDMSNCHQDSSN
tali servizi ad organizzazioni pubbliBGD  MNM OQNS D OQHU@SD  N L@MSDnerne la gestione in economia allinterno dellEnte locale.
La possibilit di rendere autonomi i singoli musei, esternalizzando
la gestione ad un ente esterno in
cambio di un canone annuo, oppure la creazione di unIstituzione indipendente, potrebbe rappresentare
unopportunit per alcune organizzazioni che nel prossimo futuro poSQDAADQN SQNU@QRH @ RNQHQD DBBDRRHU@LDMSD CDH S@FKH @H M@MYH@LDMSH
pubblici previsti a causa della crisi
economica. La mancanza di fondi, infatti, rappresenta la seconda grande
problematica che accomuna i musei
archeologici analizzati.
I musei che dipendono economicamente dagli enti proprietari, ricorQNMN @ M@MYH@LDMSH OQHU@SH RNKN HM
occasione di progetti, mostre, eventi
e manifestazioni temporanee, evidenziando solo una parziale attenzione allo sviluppo di processi di
fund raising volti alla sensibilizzazione di tutti i potenziali stakeholder
presenti nel territorio di rifermento,
soprattutto in unottica di lungo periodo.
Una possibile soluzione da offerta dalla creazione di sistemi e
reti museali, non obbligatoriamente
omogenei, cio non esclusivamente archeologici, ma adeguatamente
strutturati, che possano rappresentare un punto di coordinamento e
aggregazione, nonch in grado di
fare economie di scala su alcune
dimensioni gestionali. Come sostenuto dalla letteratura dedicata al
management museale e constatato
in alcuni casi di best practice, numerosi sono i vantaggi che un sistema
interorganizzativo pu apportare. In
OQHLHR  K@TLDMSN CDKKDBHDMY@ CDH
processi tramite lunione delle procedure e delle strutture gestione di
musei. In secondo luogo, lampliaLDMSN CDH OQNCNSSH C@ NQHQD @H UHsitatori, nonch la possibilit di garantire lapertura e la sopravvivenza
delle strutture museali di piccole dimensioni, che altrimenti rimarrebbero chiuse. Un caso di confronto utile
il Sistema Museale della Provincia
di Ravenna, la cui attivit mirata ad
aiutare i musei aderenti a raggiun-

gere determinati standard minimi


decretati dalla Regione Emilia RomaFM@ D C@KK@LOKH@LDMSN CDKKNDQS@
dei musei stessi, dotandoli di audio
guide, cataloghi e fornendo loro attivit di supporto per lattivit didatSHB@ (MMD HKBNMRDFTHLDMSNCHQHRTKtati sinergici, quali il miglioramento
dimmagine, lincremento di attrattivit, la progettazione di eventi complessi o di progetti innovativi, resi
possibili dallunione delle risorse e
delle competenze proprie di ciascun
attore formate la rete. Ci avviene,
ad esempio, nel Sistema Parchi della Val di Cornia che riuscito a rilanciare lintero territorio in chiave
culturale-turistica, dopo la crisi del
mercato dellacciaio avvenuta tra
gli anni 80-90 dello scorso secolo.
Tutto ci stato possibile grazie ad
elevato livello di coesione interna
degli attori coinvolti e dalla volont
CDKKNRS@CHQDMCDQDO@QSDBHOHSTSSD
le diverse categorie di stakeholder
presenti nel territorio.

Note
1
Per la Regione del Veneto le aree
interessate al progetto sono la provincia
di Venezia, esclusa la citt di Venezia, e
larea del Basso Polesine.
2
Per un maggior approfondimento
delle realt considerate si rimanda alle
schede e tabelle analitiche inserite a
MDB@OHSNKN
3
Ci si riferisce al Museo Archeologico Nazionale di Altino, al Centro Turistico San Basilio di Ariano nel Polesine, al
Museo Archeologico Nazionale di Portogruaro e al Palazzo Municipale di Concordia Sagittaria.
4
Dai dati emerge che il servizio di
guardaroba presente in sole 4 struttuQD HKANNJRGNOHMDK@B@DSSDQH@RNKN
nel Museo Nazionale di Adria.

CQ@U@ JHRNSNQDINCFNUNQMHY@MIHhovo upravljanje.


2S@MID J@D M@ MDTRSQDYMN TONrabo oblik upravljanja, uzakonjenih
z zakonom 142/1990, in kasnejHL  AHR KDMNL 3TDK $MNSMN
besedilo o lokalni samoupravi) ter
J@RMDIN ROQDLDLAN R   KDMNL
Y@JNM@    JH TQDI@ M@HM
upravljanja lokalnih ustanov brez industrijskega pomena, kamor sodijo
STCHLTYDIH  AHRKDMCNKN@ C@
RD K@GJN SNUQRSMD MDOQNSMD @KH Y@sebne javne storitve in organizacije
neposredno oddajo v upravljanje
ali pa z njimi e naprej neposredno
upravlja lokalni organ.
,NMNRS @USNMNLHID ONR@LDYMHGLTYDIDUYNCC@INM@QNHKYTM@njim izvajalcem v zamenjavo za letno nadomestilo, ali pa ustanovitev
samostojne ustanove, bi torej lahko
OQDCRS@UKI@KH OQHKNMNRS Y@ MDJ@SDQD
organizacije, ki se bodo v prihodnoRSHYM@KDUMDTFNCMDLONKN@ITY@radi predvidenega manjega priliva
javnih sredstev, ki mu botruje gospodarska kriza. Pomanjkanje sredRSDUIDM@LQDDDM@UDKHJ@SD@U@ 
s katero se spopadajo vsi analizirani
arheoloki muzeji.
,TYDIH  JH RN M@MMN NCUHRMH
od ustanov-lastnikov, si s sredstvi iz
zasebnega sektorja pomagajo samo
Y@ HYODKI@UN OQHKNMNRSMHG OQNIDJtov, razstav, dogodkov in prireditev.
Razvoju procesov IXQG UDLVLQJ-a,
namenjenega sensibilizaciji vseh
morebitnih interesiranih stranih na
QDEDQDMMDL ONCQNIT RD SNQDI  D
ONRDADI Y CNKFNQNMDF@ UHCHJ@  D
UDCMNONRUD@OQDL@KNONYNQMNRSH 
$MN NC LNMHG QDHSDU ONMTI@
vzpostavitev PX]HMVNLK VLVWHPRY
LQ PUH. Ni sicer nujno, da so te
GNLNFDMD  SNQDI HYJKITMN @QGDNKNke, vendar pa morajo biti ustrezno
strukturirane tako, da bodo predstaUKI@KDRSHMNSNJNY@TRJK@IDU@MIDHM
YCQTDU@MIDSDQSTCH C@ANCNK@GJN
reevale tudi nekatere problematike
TOQ@UKI@MI@  +HSDQ@STQ@ M@ ONCQNIT
LDMCDCLDMS@ CDKH LMDMID  OQDverjeno tudi v nekaterih primerih
dobre prakse, da medorganizacijski
sistem prinaa s seboj tevilne predMNRSH  -@IONLDLAMDI@ ID ONUD@MID THMJNUHSNRSH OQNBDRNU Y@Q@CH
YCQTDU@MI@ ONRSNOJNU HM RHRSDLNU
upravljanja muzejev.
Drugo prednost predstavlja raziritev palete izdelkov v ponudbi


NAHRJNU@KBDU  O@ STCH LNMNRS OQDHUDSI@L@IGMHGLTYDIRJHGQD@KMNRSH 


ki bi sicer morale zapreti svoja vrata.
4ONQ@ADM OQHLDQ SNUQRSMD LQDD ID
Sistem muzejev pokrajine Ravenna,
JH ID M@LDMIDM ONCONQH UK@MIDMHL
LTYDIDL OQH CNRDF@MIT CNKNDMHG
minimalnih standardov, predpisanih
R RSQ@MH #DDKD $LHKHID 1NL@MID SDQ
ONLNHOQHHQHSUHMIHGNUDONMTCADY
@UCHN UNCHH  J@S@KNFH HM NOQDLN Y@
CHC@JSHMD CDI@UMNRSH  9@CMI@  @ MD
zanemarljiva prednost pa je dosegaMIDRHMDQFHMHGQDYTKS@SNU JNSRNHYANKI@M@ ONCNA@  UDI@ OQHUK@MNRS 
M@QSNU@MIDJNLOKDJRMHGCNFNCJNU
ali inovativnih projektov, izvedljivih
Y@Q@CHYCQTDU@MI@RQDCRSDUHMYM@MI
RKDGDQMDF@TCDKDDMB@RJTOMDLQDD  $CDM S@JHG OQHLDQNU ID 2HRSDL
parkov v dolini Val di Cornia, ki mu
IDTRODK@JTKSTQMN STQHRSHM@OQNLNcija celotnega teritorija po krizi, ki je
v osemdesetih in devetdesetih letih
preteklega stoletja zajela trg jekla.
Uspeh je rezultat tesne povezave
LDCURDLHTCDKDDMHLHHMOQHY@CDvanj osebja, da k sodelovanju pritegnejo vse raznolike kategorije interesiranih strani na ozemlju.

*UDFR&ROODERUD]LRQLDWWLYDWHGDL0XVHL$UFKHRORJLFLGHOODUHD3DUVMDG
*UDNRQ2EOLNHVRGHORYDQMDDUKHRORNLKPX]HMHYQDSURMHNWQHPREPRMX3DUVMDG

Opombe
1
 5 CDDKH !DMDHIH RN OQNIDJSM@ NALNI@ /NJQ@IHM@ !DMDSJD AQDY LDRS@
!DMDSJDHMNALNID!@RRN/NKDRHMD
2
Za podrobnejo predstavo o upoSDU@MHG NALNIHG FKDI J@S@KNJD OQDCRS@UHSUD HM @M@KHSHMD S@ADKD M@ JNMBT
poglavja.
3
Gre za Narodni arheoloki muzej
KSHMN 3TQHRSHMNRQDCHD2@M!@RHKHNCH
Ariano nel Polesine, Narodni arheoloki
LTYDI /NQSNFQT@QN HM ,DRSMN O@K@N
Concordia Sagittaria.
4
 /NC@SJH J@DIN  C@ RN R@LN SHQH
strukture opremljene s prostorom za
garderobe, pet jih ima lastno knjigarno,
kavarna pa je odprta samo v Narodnem
muzeju Adria.

101

4
&RPXQLWGLSURJHWWRQHOODOWLQDWH
8QHVSHULHQ]DGLSLDQLFD]LRQHFXOWXUDOH
a valenza archeologica*
Moreno Baccichet, Davide Longhi, Domenico Patassini

3
Il potenziale archeologico dei
territori altinati e la loro apparteMDMY@@CTMSQ@MRDSSNCHCDQHU@EQ@
FQNMC@DK@FTM@BNMRHFKH@MNRHFMHcativi aggiornamenti degli strumenti
D CDH OQNBDRRH CH OH@MHB@YHNMD  2D
va riconosciuta ai dispositivi regolaSHUH KHCDMSHB@YHNMD CDH KHLHSH  BNM
BNMRDFTDMSDLNCHB@CHNOONQSTMHSDFDNFQ@DCDHU@KNQH DLDQFDTM
certo disagio nell acquisire in progetto il potenziale come risorsa civica e culturale.
Per questa ragione, durante la
ricerca Parsjad si attivato un percorso sperimentale tipico della piaMHB@YHNMDBTKSTQ@KD /@QSDMCNC@KKD
scoperte archeologiche, dal ruolo
riconosciuto alle nuove tecnologie
di osservazione della terra e ai processi partecipativi, si cercato di riposizionare larcheologia preventiva
dalla stima del rischio alla interpreS@YHNMD BNMSDRST@KD  0TDRSN @BBNQgimento, oramai consuetudine nei
OH@MH CH HMSDQOQDS@YHNMD CH RBTNK@
francese e anglosassone, consente
non soltanto di riconoscere, ma anche di trasmettere i valori dei luoghi
con linguaggi opportuni.
-DKKN RODBHBN @KSHM@SD  KHMSDQpretazione maturata costruendo
itinerari e racconti che, nei laboratori condotti in forma di charrette,
hanno riconosciuto valenza empiQHB@ @C TM@ BNLTMHS CH OQNFDSSN 
0TDRS@BNLTMHS UNKNMS@QH@DOQNUvisoria, ha prodotto un portfolio progetti che, oltre a disegnare paesagFH CDKK@QBGDNKNFH@ ODQBDOHS@ BNLD

nuova consapevolezza sociale, si


legittimata nel discorso urbanistico
e territoriale. Alle due scale si sono
ipotizzate connessioni fra patrimonio storico-culturale e risorse ambientali di gronda, enfatizzando cos
i potenziali impatti cumulativi dei
grandi progetti infrastrutturali in discussione nella complessa agenda
veneziana.
1HRONMCDMCN@CTM@HRS@MY@OQDventiva allargata si disegnato uno
scenario di valorizzazione estesa basato su una ipotesi di parco integrato
(agro-naturalistico e archeologico).
0TDRSNRBDM@QHNQHMUH@@CTMLNCDKlo di gestione con pivot sulla ricerca
archeologica e sullosservazione del
O@DR@FFHNCHFQNMC@F 

8
$
Recenti studi da telerilevamento
integrati con elaborazione di dati forniti da riprese aeree multi-spettrali1
HCDMSHB@MNHM KSHMNTM@RHST@YHNMD
archeologica quasi unica (MOZZI et
alii 2011, p. 203). Al suo lento abbandono, contemporaneo alla formazione di duraturi e pi estesi insediamenti nella laguna nord e cenSQ@KD MNMRNMNRDFTHSDRSQ@SHB@YHNMH
insediative tardo-antiche, medievali
e moderne di spessore tale da rendere inaccessibili le straordinarie
tracce dellimpianto romano e dei
suoi principali innesti.
Limpianto urbanistico romano,
formatosi fra la seconda met del III
secolo a.C. e il IV secolo d.C., loca-

* La documentazione di ricerca utilizzata in questo testo aggiornata a Dicembre 2012.

[

4
3URMHNWQDVNXSQRVWDOWLQDW
,]NXQMDNXOWXUQHJDQDUWRYDQMD
z arheolokim pomenom*
Moreno Baccichet, Davide Longhi, Domenico Patassini

3
Arheoloki potencial ozemlja altiM@SD FQD Y@ NALNI@ NAHMD 0T@QSN
d'Altino, zaradi poenostavitve se v nadaljevanju navajajo z italijanskim imeMNL  NO OQDU  HM MIDFNUDF@ ONKN@I@
transekta na prehodu med grondi
FQDY@O@RS@JNIY@YHMNQSNK@FTne, za katerega so znailna mokria,
od tu tudi izraz gronda, ustrezen sloUDMRJDLT KDAT  NO OQDU  HM R@LN
laguno klie po posodobitvi orodjih
in procesov za svojo nartovanje. Zakonodajni predpisi doloajo omejiSUDi HM R SDL UOKHU@IN M@ OQHKNMNRSH
HMM@FDNFQ@INUQDCMNS Y@Q@CHDR@Q
se pojavlja doloeno nelagodje pri
CNIDL@MIT ONSDMBH@K@ JNS CQTADMDga in kulturnega vira.
Iz tega razloga smo v okviru projekta Parsjad vpeljali eksperimentalni
postopek, ki je tudi sicer znailen za
kulturno nartovanje. Na podlagi arheolokih najdb in vloge, ki se priznava novim tehnologijam opazovanja
povrja in participativnim procesom,
smo poskusili preventivno arheologijo premakniti za korak naprej, od
ocene tveganja do kontekstualne razK@FD 3@OQHIDL JHIDRHBDQDNAH@IDM
na razlagalnih ravneh francoske in
anglosake ole, se ne omeji na prepoznavanje vrednot v prostoru, pa
pa tudi njihov prenos v ustreznem
jeziku.
5 RODBHMDL OQHLDQT NYDLKI@
altinate je njegovo interpretiranje
dozorelo skozi izdelavo poti in pripovedi, ki so v delavnicah po metodi
charrette potrdile empirini pomen
projektne skupnosti. Ta prostovolj-

M@ HM OQHKNMNRSM@ RJTOMNRS ID HYCDlala projektno mapo, ki poleg orisa
arheoloke krajine, ki se dojema
JNS MNUN CQTADMN YM@MID  URDATID
tudi podatke o lokalnih urbanistinih
in upravnih aktih. Za obe ravni smo
predpostavili povezanost med zgodovinsko in kulturno dediino ter
okoljskimi viri v obmoju gronde,
ter na ta nain poudarili morebitne
naraajoe vplive velikih infrastrukturnih del, o katerih je govora v kompleksni beneki agendi.
V odgovor na potrebo po ire
zastavljeni preventivi smo zartali
scenarij razirjene valorizacije na
podlagi zamisli o integriranem kmetijsko-naravoslovnem in arheolokem
parku. Scenarij se nanaa na model
upravljanja s poudarkom na arheolokem raziskovanju in na opazovanju
pokrajine gronde (sl. 1).

(
$
Nedavni podatki daljinskega zaznavanja so skupaj z obdelanimi
podatki, zbranimi iz multispektralnih zranih posnetkov1 pokazali, da
gre v Altinu za skorajda edinstveno arheoloko situacijo (MOZZI et
alii 2011, str. 203). Po poasnemu
umikanju lagune, ki so mu sledile
SQ@IMD HM NARDMDID ONRDKHSUD MIDnih severnih in osrednjih predelov,
prisotnost prievanj pozne antike,
srednjega veka in moderne dobe v
zemeljskih slojih ni tolikna, da bi
prepreila dostop do izjemnih sledi
ostalin rimske urbanizacije in njenih

* 5OQHTINDLADRDCHKTTONQ@AKIDMNQ@YHRJNU@KMNFQ@CHUNIDAHKNONRNCNAKIDMNCDBDLAQ@

103

104

lizzato quasi sul vertice del triangolo


che comprende i dati salienti della
struttura geomorfologica del territoQHNCDK"NLTMDCH0T@QSNC KSHMN +@
base maggiore settentrionale si distende lungo il corso del Sile a Nord
che connette gli insediamenti di
0T@QSN  3QDO@K@CD  " "NQMDQ D /NQtegrandi. Il lato orientale segnato
dal canale Silone che prosegue lunFNU@KKD/DQHMHMN@CHMSDQRDB@QDHK
Dese (ora propaggine-canale) sulla
BNMTDMY@ MDK "@M@KD !NQFNFMNMH
fra Torcello, Mazzorbo, Mazzorbetto
e Burano. Il lato occidentale in gran
parte segnato dallo Zero e dal Dese
(che lo Zero alimenta) nella gronda
prossima alla palude di Cona. Se si
HMBKTCDRRDQN KD RTODQBH @BPTDD CH
valle Perini e della palude di Cona,
risalendo lingressione marina, il vertice si stabilizzerebbe sul clusterr di
Torcello, enfatizzando segni di crisi e
fondazione.
Localizzata nella parte meridionaKDCDKSDQYNPT@CQ@MSDCDKK@BHSSQNmana2, la sede del nuovo Museo asRTLDTMHLONQS@MSDRHFMHB@SNRSNQHBNDFDNFQ@BNRSNQHBN ODQBGRHSQN-

U@HMKNB@KHS%NQM@BD KTNFNCDKR@Mtuario dedicato al dio Altino e punto


nevralgico della nascita dellinsediaLDMSN FDNFQ@BN  ODQBG OHUNS CH
TM@ M@STQ@KD QDK@YHNMD EQ@ FQNMC@ 
K@FTM@DE@RBH@KHSNQ@MD@F 
Le recenti scoperte richiedono
una sostanziale revisione dellapproccio urbanistico3 sia sul piano
diagnostico che su quello gestionale. Sul piano diagnostico lemersione
delle tracce della citt antica restituisce un patrimonio caratterizzabile per geometrie e funzioni che aliLDMS@MNKDDRODQHDMYDCHO@DR@FFHN
lagunare. Collocata fra una pluraliS CH BNMS@SSH CH BHBKH RSNQHBH  KSHMN
merita uno sforzo di immaginazione
perch, citando uno dei giganti delK@ KNRN@ CDK -NUDBDMSN  PTH NBBNQQDMNMRNKS@MSNE@AAQHB@QDHE@SSH
L@ @MBGD QDMCDQKH BNQQDSS@LDMSD
(GOODMAN 1978).
In queste due azioni eminentemente progettuali si riconoscono
diverse tensioni e tutte, in varia miRTQ@  BNMSQHATHRBNMN @ CDMHQD RSQ@tegie culturali, in assenza delle quali
il discorso su Altino perderebbe di

senso. Diverse sono le azioni esplorative in grado di combinare conoRBDMYD RBHDMSHBGD D BNMSDRST@KH HM
percorsi, racconti, mappe di comunit e portfoli progetti.
0TDRte azioni cercano di rendere:
a. noto lignoto o ci che appena intuito (conoscenza
b. visibile linvisibile, per vedere oltre
quel che c (visibilit
c. denominato il senza nome (linguaggio, comunicazione, toponimica
d. vivo linanimato (vita e fruizione
e. integrato lisolato (integrazione
f. accessibile linaccessibile (accessibilit
g. apprezzato limmateriale (valore
h. risorsa il vincolo (innovazione e creativit
i. potenziale strategico il rischio e il
timore di perdere (sicurezza).
Per favorire questi passaggi ed
NQHQKH BNDQDMSDLDMSD @KK@SSHUHS K@boratoriale stato realizzato un proSNSHONCHQD@KS@TLDMS@S@1@BNM
software compatibile con Smartphone Android.
La tecnologia Ra consente di sovrapporre livelli informativi inediti a

realt percepite, ma pu contribuire


anche a combinare e ad espandere
le percezioni sensoriali. Si tratta di
un applicativo ospitato in Smartphone o Tablet, con videocamera e strumenti di georeferenziazione. LaccesRNCHTRN@CTM@OKTQ@KHSCHTSDMYD
la semplicit duso e la capillare distribuzione permettono un utilizzo
FDMDQHBN N RODBH@KHRSHBN  @ MH BNLmerciali, turistici, logistici o di servizio, in social network, ma anche per
attivit gestionali e progettuali.
La visualizzazione dei livelli informativi pu essere realizzata in
diversi modi: in forma di elenco, con
punti ordinati in base alla distanza
C@KK@ ONRHYHNMD CDKKNRRDQU@SNQD HM
forma di mappa, che visualizza la posizione dellosservatore e dei punti
di interesse (POI) e in forma Ra. In
questultimo caso limmagine restituita dalla fotocamera arricchita di
RDFM@ONRSNQDK@SHUH@HOTMSHFDN KNB@KHYY@SH HMSNQMN @KKNRRDQU@SNQD F
 (KOQNSNSHONONQS@HMRTODQBHDHK
racconto del sottosuolo e lo raccorda con altre evidenze patrimoniali,
di tipo ambientale, insediativo, eco

logico o storico-culturale. Stimola itiMDQ@QHRODBHBHD@HTS@@ONRHYHNM@QD


il patrimonio archeologico visibile e
invisibile nel paesaggio contemporaneo.
Linsieme dei punti archiviati
DRDLOKHB@SHUN CDKK@ BNLOKDRRHS CDKKHMRDCH@LDMSN QNL@MN MNra interpretato. Le componenti si
interfacciano in ununica base-dati
BNRSQTHS@BNM,X20+ 2HSQ@SS@CHA@se-dati relazionale open source, supportata da Oracle con licenza GPL. Il
databaseRTBHDMSDLDMSDONSDMSD
C@QDFFDQDK@BNMFTQ@YHNMDCHOQNgetto4.

&


106

Nellintrodurre il libro di SOLNIT


(2002)5 +@ "DBK@ CDMHRBD HK B@Lminare il passo dei pensieri come
se camminare e pensare fossero
complementari. Costruire percorsi
territoriali consapevoli, che chiunque pu sviluppare e reinterpretare,
equivale a ridisegnare territori che

spesso non si presentano come racconti coerenti ed esaustivi.


Camminare pu essere un rituale,
pubblico o personale, oppure unoccasione dindagine, o entrambe le
cose, perch nulla pi mutevole di
un paesaggio percorso e ripercorso.
Come scrive Solnit, muoversi a piedi sembra rendere pi facile muoversi nel tempo. Gli oggetti osservati da pi punti di vista, se interpellati,
raccontano la storia continua e lunga del possesso e della gestione di
un territorio, qualsiasi sia. Lo spazio
pubblico si dilata in una componente paesaggistica e visuale che abbraccia gli spazi privati delle coltivazioni, i territori urbanizzati, i boschi o
le cime delle montagne. Camminare,
guardare e pensare sono tre azioni
importanti per dare vita al paesaggio. Attrezzando gli spazi con percorRHRH@SSQHATHRBNMNMTNUHRHFMHB@SH@K
nostro essere indigeni (come suggerisce lAragon di Paesano di Parigi)
e nuove prospettive di conoscenza
esplorativa anche agli ambienti socialmente pi densi (come nellesperienza di W Benjamin).

La pratica di percorrere i luoghi


cercando di interpretarli, condividendo con altri le diverse e personali letture, fu utilizzata anche dai
dadaisti francesi che allinizio del
 ODQBNQQDU@MN /@QHFH NRRDQU@Mdola come unopera darte. Ogni ogFDSSN OH@YY@ RSQ@C@ DCHBHNNO@QBN
@RRTLDU@ TM MTNUN RHFMHB@SN FQ@zie allatteggiamento curioso di chi
lo osservava. Come a dire che la citSDHKSDQQHSNQHNQHDSSNMNKHLL@FHMD
di chi, indagando quei luoghi in una
deriva6 pi o meno consapevole, li
interpella.
2TKKDCDQHUDL@QHMDDCDKSHYHDDH
BHBKHSDQQHSNQH@KHCHQHEDQHLDMSNNODQ@
litinerario altinate lungo il transetto
Altino-Torcello. Litinerario attivato
C@L@OODCHBNMMDRRHNMDBGDUDMgono testate con diversi soggetti.
+HSHMDQ@QHN  RUHKTOO@MCNRH ODQ
punti di vista e rendendo lutente riconoscibile al contesto, suggerisce
diverse ipotesi di integrazione e di
attribuzione di valore. Il test assuLDK@ENQL@CHK@ANQ@SNQHN@CHUDQRN
contenuto contestuale.

&KDUUHWWH
La charrette un processo di
confronto e di co-progettazione che
aiuta ad esprimere in modo collettivo idee, pratiche e punti di vista
M@KHYY@SN @ N HMCHODMCDMSD C@ TM
OQNBDRRN CH OH@MHB@YHNMD  $RRN HMcoraggia contributi e collaborazione,
facilitando esplorazioni e decisioni,
QHRNKUDMCNRHST@YHNMHCHRS@KKNMN@
testare ipotesi di fattibilit.
La charretteNQF@MHYY@S@@0T@QSN
dAltino ha consentito di attivare un
mini-laboratorio di urbanistica partecipata orientato al riconoscimento
dei valori territoriali, del paesaggio
agrario e delle memorie storiche.
0TDRSNLDSNCNLNKSNTSHKHYY@SN
dal new urbanism anglosassone soprattutto per mettere a punto nuovi
codici di regolamentazione urbana (i
cosiddetti form based code) che combinano standard quali-quantitativi
(tipo-morfologici) nelluso del suolo.
Nellambito della ricerca Parsjad
stata proposta lapplicazione di
questo metodo alle carte del paesaggio francesi con esito positivo sia
in fase esplorativa che in fase riepi

napomembnejih vpadnic.
Urbanistina zasnova rimskega
mesta, ki se je razvilo med drugo polovico 3. stol. pr. n. t. in 4. stoletjem
M S KDHRJNQ@IM@UQGTSQHJNSMHJ@ JH
vsebuje tudi najpomembneje podatke o geomorfoloki sestavi ozeLKI@ NAHMD 0T@QSN C KSHMN  2DUDQM@HMM@IC@KI@RSQ@MHB@KDHNAQDMH
strugi reke Sile, ki povezuje zaselke
0T@QSN 3QDO@K@CD ""NQMDQHM/NQtegrandi. Vzhodno stranico predstavlja kanal Silone, ki se nadaljuje
po dolini Perini, kjer se srea z reko
Dese (zdaj veja - kanal), od koder se
izlije v kanal Borgognoni med otoki
Torcello, Mazzorbo, Mazzorbetto in
Burano. Veji del zahodne stranice
doloata reki Dese in njen pritok
Zero v pasu gronde ob movirju
Cona. e bi sem vkljuili e vodne
povrine doline Perini in movirja
Cona, bi vrh lahko sovpadal z gruo
otokov pri Torcellu.
2DCD MNUDF@ LTYDI@ U ITMDL
delu tretjega kvadranta rimskega
mesta2 ima velik zgodovinski in geografski pomen: zgodovinski, saj se
M@G@I@ M@ KNJ@BHIH %NQM@BD  RDCDT
svetia, posveenega bogu Altinu
in nevralgini toki zametkov naselAHMD FDNFQ@ERJH O@  JDQ OQDCRS@UKI@
os naravnega razmerja med grondo, laguno in obalnim pasom (Sl. 2).
Zaradi nedavnih odkritij bo potrebno korenito obnoviti urbanistini
pristop3 tako na diagnostini kot
upravni ravni. Z diagnostinega vidika so sledi starodavnega mesta
nedvomno pomembna dediina
zaradi geometrije prostora in funkcij, ki bogatijo izkunjo lagunske
krajine.
Mesto Altino, ki je bilo v stiku z
razlinimi zgodovinskimi obdobji,
je potrebno dojemati z veliko mero
domiljije, saj, e navedemo enega
NC UDKHJHG KNYNENU CU@IRDSDF@ RSNletja, tu ne moremo samo izdelati
dejstev, pa pa jih moramo tudi
pravilno posredovati (GOODMAN
1978).
V obeh projektnih pristopih je
mogoe prepoznati razline napetosti, ki vsaka po svoje prispevajo k
opredelitvi kulturnih strategij, brez
katerih bi bil pogovor o Altinu brezsmiseln.
Veliko je raziskovalnih metod, ki
URDAHYCQTTIDINYM@MRSUDM@HMJNMtekstualna znanja, poti, pripovedi,
mape skupnosti in projektne mape.


Vsem pa so skupna prizadevanja, da


bi loili:
a. poznano od nepoznanega oziroma intuicije (poznavanje
b. vidno od nevidnega, da bi znali
pogledati ez meje tistega, kar obstaja (vidnost
c. imenovano od neimenovanega
(jezik, komunikacija, toponimika
C  HUN NC MDHUDF@ LYOMHQMH LQ
izkorianje
e. vkljueno od osamljenega (vklju
enost
f. dostopno od nedostopnega (dostopnost
g. cenjeno od nematerialnega (vrednost
h. vir od ovire (inovacija in kreativnost
i. strateki potencial od tveganja in
strahu pred izgubo (varnost).
Za bolj uinkovito prehajanje
in dosledno ponudbo v okviru delavnic smo razvili prototip poveane
stvarnosti (Ra) programsko opremo, kompaktibilno z okoljem Android za pametne telefone.
Tehnologija omogoa prekrivanje stvarnosti, kot jo dojemamo, z
novimi informacijami: pomaga pa
lahko tudi pri kombiniranju in poglabljanju utnih zaznav. Gre za aplikacijo za pametne telefone ali tabline
raunalnike, opremljene z videokamero in orodji za georeferenciranje.
Razirjen dostop razlinih uporabnikov, enostavna uporaba in dobra
distribucija omogoajo uporabo
s strani obiajnih uporabnikov ali
RSQNJNUMI@JNU  Y@ SQMD  STQHRSHMD 
logistine ali storitvene potrebe, v
CQTADMHG NLQDIHG  O@ STCH Y@ ONtrebe upravljanja in projektiranja.
Informacije se lahko prikazujejo na ve nainov: kot seznam, po
tokah na osnovi podatkov o razdaKIHNCNO@YNU@KMDF@LDRS@UL@O@G 
JHOQHJ@YTIDINONKN@INO@YNU@KB@HM
zanimivosti (POI) ter v formatu Ra. V
zadnjem primeru je fotograski posnetek oznaen z znamenjem za
posamezne locirane toke v okolici
opazovalca (sl. 3).
Prototip razgalja zgodbo izpod povrja in jo povezuje z okoljskimi, naselbinskimi, ekolokimi in
kulturnozgodovinskimi prievanji.
2ONCATI@ J GNIH ON RODBHMHG ONteh in pomaga pri umeanju vidne
in nevidne arheoloke dediine v
kontekst dananje pokrajine.
Sklop arhiviranih mest nazorno

prikazuje razlenjenost do sedaj odkrite rimske naselbine. Posamezni


elementi se prepletajo v eni sami
zbirki podatkov, izdelani s prograLNL ,X20+  &QD Y@ ONC@SJNUMN
zbirko open source, podprto z Oraclom, z licenco GPL. Database je doUNKIYLNFKIHU C@yOQDMDRDiJNMFTracijo projekta4.

6

V uvodu knjige SOLNIT (2002)5
+@"DBK@CDMHQ@GNINJNSyJNQ@JLHsli, kot da se hoja in misli med seboj
dopolnjujejo. Izdelati ozaveene
poti v prostoru, ki jih lahko kdorkoli razvija in reinterpretira, je enako
ponovnemu risanju potez ozemelj,
katerih pripoved pogosto ni skladna
in celovita.
Hoja je lahko javni ali osebni riST@K OQHKNMNRSY@Q@YHRJNU@MID@KHO@
oboje, saj ni ni bolj spremenljivega
od pokrajine, ki jo vedno znova prehodimo. Kot pie Solnit: e hodi,
RD YCH ONSNU@MID RJNYH @R K@ID 
e predmete opazuje iz ve zornih
kotov in jim zastavlja vpraanja, ti
bodo povedali neprekinjeno in dolgo zgodbo o posedovanju in nadzoQNLM@CNYDLKIT O@J@JQMNJNKHD
zgodba je. Javni prostor se razpri na
krajinsko - vizualno komponento, ki
objame zasebne sfere polj, naselij,
gozdov ali gorskih vrhov. Hoditi, gledati in misliti: tri pomembna dejanja,
JH ONJQ@IHMH UC@GMDIN HUKIDMID  /Q@vilno speljane poti pripiejo nove
pomene nai potrebi po domanosti
(kot pravi Aragon v 3RGHHODQXY3Drizu) in nova obzorja raziskovalnega
YM@MI@STCHUyCQTADMNFNRSDIDLi
okolju (kot v izkunji W Benjamina).
Navado hoje po krajih in poskusa njihove razlage, nato pa poskusa
delitve vseh in vsakega intimnega
tolmaenja z drugimi so uporabili tudi francoski dadaisti, ki so na
zaetku dvajsetega stoletja med
hojo po Parizu tega opazovali, kot
da bi lo za umetniko delo. Vsak
predmet, trg, ulica, stavba ali park
so zaradi radovednosti tistega, ki
jih je opazoval, dobili povsem nov
pomen. Lahko bi rekli, da mesto ali
ozemlje zrcalijo podobo tistega, ki
med svojim opazovanjem bolj ali
manj zavedno vzpostavi z njimi nekaen prehod misli6 in vpraanj.

Poti altinat se vijejo med morskimi obalami, ob ustju rek in po kopenskih krogih transekta Altino-Torcello. Doloajo jih povezovalne
mape, ki jih vsak po svoje preskusijo razlini subjekti.
Pot, ki se oblikuje glede na zorne
kote obiskovalca, ki je torej prepoznaven len v kontekstu, predlaga
razline naine vkljuevanja in pripisa vrednosti. Preizkus se spremeni
v delavnico z razlinimi kontekstualnimi vsebinami.
&KDUUHWWH
Metoda charrette je proces primerjave in skupnega nartovanja,
JHONL@F@OQHJNKDJSHUMDLHYQ@@MIT
idej, praks in vidikov z namenom
(oziroma neodvisno od) procesa
nartovanja. Metoda spodbuja k prispevanju in sodelovanju in pomaga
pri preiskovanju in odloitvah, saj
reuje mrtve trenutke in zastoje
ter preizkua izvedljivost namere.
Charrette, ki smo jo organizirali v
0T@QST C KSHMT  ID NLNFNHK@ QD@KHzacijo urbanistine mini-delavnice
na temo prepoznavanja ozemeljskih vrednot, kmetijske pokrajine in
antinih spominov.
To metodo precej uporablja smer
anglosakega novega urbanizma,
zlasti za doloanje novih kod za
urbanistine ureditve (tako imenovanih form based code), ki kombinirajo standarde kakovosti in koliine
(tipo-morfoloke standarde) pri
uporabi tal.
V okviru projekta Parsjad smo
predlagali uporabo te metode za
izdelavo francoskih krajinskih zemljevidov. Rezultat je bil pozitiven
v obeh fazah projekta, v raziskovalni
in v zakljuni. Na podlagi predhodne
tudije dokumentacije smo izdelali
mapo vrednot in dve tudijski poti.
Na poteku obeh poteku od zaledja
proti laguni so oznaene razgledne
toke v smeri Torcella in zapuenih
mest Ammiana in Costanziaco. Te
toke so smernice za izletniko pot.
Prva ekipa se je odpravila v smeQH 0T@QS@ C KSHM@  KSHM@  K@FTMD HM
Montirona, druga pa v smeri Portegrandi, Trezze, laguna, Marzi, nato pa
se je vrnila v Portegrandi.
Na podlagi rezultatov tudijskih poti smo izdelali projektno
mapo. Ta je skupaj z mapo skupnosti omogoila izdelavo Zemljevida
pokrajine in arheologije, predvsem

107

108


Cortine arboree di mitigazione alla nuova bretella


connessioni ciclabili

77

Dai miliari stradali ai cippi della


conterminazione: rinvio alle iscrizioni su
monoliti di pietra
Claudia Augusta ad Altino negli anni 30 con il
sedime originale e le marginature con alberi
capitozzati

Nuove piantagioni che delimitano loriginario limite


della strada

109


110

O@ ID ONMTCHK@ LNMNRS  C@ RLN


ustrezno kontekstualizirali tevilne
OQNAKDL@SHJD HM OQHKNMNRSH  /QU@
Y@CDU@SQ@MYHSMHOQNLDS JHONKDFD
YM@MHG UOKHUNU ONUYQN@ STCH SD@ve z razmejitvijo in dostopom. Drug
problem se nanaa na lastnika razLDQI@  Y@Q@CH J@SDQHG ID NSDJNDM
dostop do kmetijskih povrin, do
pasu gronde in do ribolovnih zajetij.
A najpomembneji element je voCMN NLQDID  UFQ@IDMN U GHCQNCHM@miko lagune.
Zemljevid je v resnici izhodina
toka, namenjena prebivalcem Altina in okolice. Zaradi tega je shranjen
na obinski spletni strani in se trenutno posodablja s podatki iz vpraalnikov za gospodinjstva in ole.
Zaasni rezultati te izkunje so bili
predstavljeni kot dopolnilna dejavnost na 13. Bienalu arhitekture
Common Ground jeseni leta 2012
(sl. 4).
 0DSD VNXSQRVWL H] PHMH NXOWXUHRELDMQHJD
Projektna mapa skupaj z mapo
skupnosti ponuja izhodia za izdelavo zemljevida krajine in arheoloFHID /QHKNMNRSHHMJQHSHMDSNJDRN
ONJ@Y@KD M@ yONS JTKSTQDi  JH J@D
M@LNMNRSQTJSTQMNCHLDMYHINM@Czora ozemlja, zaeni od arheolokih komponent.
Gre za posebno vrsto pristopa do
kulturnega nartovanja skozi:
a) opis znailnosti krajev s pomojo
NAKHJJNMSDJRST@KMDF@YM@MI@
b) prikaz strukture ozemlja na podlagi opisanih krajev, ne na podlagi
CQTF@M@CQTFNM@KNDMHGL@SQHBY@
ONFNID RS@MIDHMTONQ@AN
c) izpostavitev sistema obstojeih
vrednot, iz katerih lahko izhajajo
tudi druge vrednote. Skupna raba
teh vrednot lahko okrepi pogojevalska izhodia na lokalni, pa tudi
NYDLDKIRJHQ@UMH
d) operativno in dinamino opredelitev ozemeljske strukture: projektna
mapa nudi povzetek tovrstne strukture in se posodablja v sestavi in izU@I@MIT
D NUQDCMNSDMID RODBHMHG NAKHJ
osnutka projekta preko meja zakonodaje in omejitev, z uinkovitejo
JU@KHJ@BHINSDQHSNQH@KMDRSQTJSTQDHM
TOQ@UKI@MI@
f) uporabo mape skupnosti, ki se
lahko posodablja z nenehnimi tuCHI@LHSTCHM@CQTADMHGNLQDIHG 


za spremljanje in vrednotenje postopkov. Zemljevid krajine in arheologije poleg klasinih pokazateljev


omogoa tudi spremljanje in vrednotenje v sliki.
Mapo sestavlja 14 projektnih
listov. Uporabna je za prostorsko
nartovanje, e posebej pa za pripravo integriranega kmetijsko-naravoslovnega in arheolokega parka okoli
KSHM@ HYFHMTKDF@LDRS@RK   
Vsak projektni list obravnava
dalje zgodovinsko obdobje, katerega intervale zaznamujejo Kiegskarte
iz leta 1805, avstrijski kataster iz
leta 1841, zrani posnetek iz leta
1975 in sodobni fotograski posnetek. Vsak od listov je tematski, kot je
to navedeno v nadaljevanju:
1. Claudia Augusta: peat ureditve
2. Od kraja Le Crete do Altina
3. Odkrijmo vio Annio
4. Obnova Carmasona
5. Via Opitergina in Acquador
6. Pot po spominih ob reki Zero
7. Altino, izginulo mesto
8. Most proti Tesseri in Mestram
9. Antino pristanile in trstje reke
Sile
10. Pot po Siloncellu
11. Povezati Altino, laguno in Portegrandi
12. Altinska laguna in izginula mesta
13. Ribolov s kopnega, ribolov v laguni
14. La Fossetta (sl. 7).
Podporno ogrodje predstavlja
LQD@ ROQDG@I@KMHG HM JNKDR@QRJHG
stez (mestoma pa tudi jahalnih poti).
Poleg ovrednotenja obstojeih poti
omogoa dostop do arheolokega
najdia, povezuje veje in manje vodne poti med seboj in ponuja
panoramski razgled na laguno. Pot
.C JQ@I@ +D "QDSD CN KSHM@ ONMTja predvsem povezave in razgledne
toke ob reki Zero.
Sistem kolesarskih in sprehajalnih poti se razlikuje glede na vrsto
yONCK@FDiK@GJNSDDNANARSNIDH
ali sovpada s starodavno cesto, sledi
QDMH AQDHMH @KH O@ ODKID ON L@J@damski capezzagni. Capezzagna, ali
cavedagna je kolovoz iz zbite zemlje, ki vodi do njiv. Vasih se zvija med vrstami vinske trte ali med
sadnim drevjem, kjer je zemlja nerodovitna, a e vedno uporabna za
dostop do kultur. Nekateri kolovozi
so namenjeni samo meji med dvema parcelama in jih vasih oznaijo
z mejniki ali grmovjem, ostale pa so

se sasoma spremenile v prave poljske ceste, odprte proti poljem ali pa


NAC@MDYHUNLDIN 
3DL@SRJ@ONS,NRSOQNSH3DRRDQH
in Mestram poteka dale od prometnih cest. Ozek most ali trajekt
U AKHHMH UNCMHG QO@KJ 9TBB@QDKKN
povezujeta obino Marcon z obino
0T@QSNC KSHMN /NCLNRSNLOKTIDjo lokalne in turistine barke, vodne
rpalke pa dihajo svojo zgodbo.
V projektu poljedelske pokrajine
LQD@RONCATI@UJKITDU@MID
Vrste drevja in med njimi ozki
pasovi travnikov spremljajo sledi
antinih cest (via Annia in via Claudia Augusta) in primestne centuriaBHID OQ@US@JNJNSUOQDCDKTUYCNK
Carmasona. Zaradi te parcelacije
YDLKID AH AHKN STCH ST M@ SD@UN
smo naleteli tudi pri tematski poti
'Claudia Augusta, peat ureditve')
potrebno zaprositi za dovoljenje za
prehod in uporabo tal. S pritegnitvijo najpomembnejih kmetijskih
zadrug k sodelovanju se bi lahko
morebitno nadomestilo uporabnine
uredilo v skladu s smernicami Psr
e della Pac 2014-2020 (italijanski
SUHGSLVL R UD]YRMX SRGHHOMD LQ NPHtijskih povrin).
,QD@ UJKITTID RHRSDL NO@YNvalnih tok notranjih (na primer izgonske struge) in zunanjih elementov (kopno in laguna), poleg njih pa
tudi poivalia in ustrezne oznake
poti. Vizualne pregrade iz zasajenih
rastlin in popravki poljedelskih kultur deloma skrijejo hie za njimi in
kmeka opravila v teku. Eden tovrstnih popravkov v smislu preventivne arheologije je tudi pohodna poUQHM@HYK@IHGL@SDQH@KNU
,QD@ NLNFN@ K@ID OQDONznavanje mikro-toponimov, vozli
povezav z mejniki in spominskimi
J@LMH  RONLHMRJHG LDRS /NS ON
spominih ob reki Zero) in opazovalnih tok. Osmisli dejavnosti izkopov, kot to velja za hio Brustolade (najdie kultnih predmetov).
Hio bi lahko namenili dejavnosti
kmekega turizma ali jo uporabili
kot gostie. Namen tematske poti
/NS ON 2HKNMBDKKT ID U@KNQHY@BHI@
benekega zajetja Trepalade (vodna
dela za preusmeritev reke Sile) s
ostanki poivalia, danes samo e
s funkcijo prometnega otoka.
Na levem bregu Siloncella je
predvidena kolesarska/sprehajalna
steza, ki naj bi povezala kolesarsko

stezo ob reki Sile z Altinom.


Opazovalci ujamejo podobe vizualnih konusov in pomagajo pri
preizkuanju zaznavnih predpoRS@UJ 3DRDK@GJNNAKHJTIDINYCNHvljanjem travnikov med obdelanimi
ONKIH HM CQDUIDL  5H@ MMH@ ID D U
preteklosti tekla po tej nehomogeni
pokrajini na prehodu med mokrii
in obdelano zemljo ter prekala goRSNLQDNUNCMHGSNJNUNAK@FTMRJDga pasu - gronde. Ta se je s asom
spreminjala zaradi lovekih rok,
preusmeritve struge renih tokov
ter zaradi poasnega hidromorfolokega spreminjanja pokrajine na
ekotonskem ozemlju, za katerega so
znailne meandrine reke.
/NS .AMNU@ "@QL@RNM@ RD
osredotoa na staro reno strugo, ki
je e vedno nekoliko aktivna, eprav
se zdi, da v vodnem sistemu nima
ve posebne funkcije. V tridesetih
letih prejnjega stoletja se je Carmason v obliki loka usmeril v reko Zero,
kjer vodna rpalka dvigne njegovo
vodo in jo izpusti v reko. Cilj projekS@ ID NADKDHSH S@ @MSHMH UNCMH SNJ 
DCDI@UDMUQHLRJDLHMEQ@RSQTJSTQnem sistemu.
Obnovi se tudi neposredni
prikljuek na cesto Claudia Augusta
(antini sifon ni ve viden) in povezava s predelom Portoni di Altino,
JIDQ ID AHKN MDJN JQHHD LDC UH@
Annio in cesto proti Opitergiumu.
/NTC@QDJ OQNIDJS@ 5H@ .OHSDQFHM@
e Acquador je na valorizaciji vodne
LQDD  BPT@CNQ ONUDYTID L@MID
vodotoke z reko Silo in jim zagotavlja prehodnost.
/QNIDJS MSHMN OQHRS@MHD HM
trstje reke Sile pripoveduje o odnosu z laguno. Tematska pot povezuje
ostanke antinega mesta (iz obdobja republike) in obmoje mesta in
OQHRS@MH@ JHRS@CNHUDK@Q@YBUDSU
cesarskem obdobju. Pristanike infrastukture (e vedno neodkrite) so
M@IAQ KD@KD UHID NC MDC@UMN NCkritih pristajali v Torcellu (201113). Dve razgledni toki nudita lep
ONFKDC M@ K@FTMN U AKHHMH LNRSNU
na pristaniki otok. Tu se lahko po
tlakovani poti sprehodimo po renih
bregovih. Manji vodotok z izlivom v
K@FTMH M@O@I@ NARDM@ SQRSHI@  #Nstop do arheolokih obmoij severMN NC CQ@UMD BDRSD ID OQH UNCMDL
zbiralniku Valle Rossa.
Ob robu lagune (gronda) in breHMH UNCNSNJ@ 2HKNM@ RD Q@YUHI@ JQN-

111

logativa. Sulla base di un preliminare


studio documentario si sono costruiti una mappa dei valori e due itinerari di ricomposizione. I due itinerari
evidenziano dallentroterra alla laguna le prospettive verso Torcello e
i luoghi delle citt abbandonate di
Ammiana e Costanziaco. Essi orientano le escursioni.
La prima escursione si mossa
KTMFN K@ CHQDSSQHBD  0T@QSN C KSHMN 
Altino, laguna e Montiron. La seconda, lungo la direttrice Portegrandi,
Trezze, laguna, i Marzi, con rientro a
Portegrandi.
I risultati delle escursioni hanno
consentito lelaborazione del portfolio progetti. Il portfolio progetti,
ancorato alla mappa di comunit,
G@ BNMRDMSHSN CH BNLONQQD K@ "@QS@
del paesaggio e dellarcheologia,
ma soprattutto di contestualizzare
numerosi problemi/opportunit. Il
OQHLNQHFT@QC@HKSQ@BNCH@SSQ@UDQsamento che, oltre ai noti impatti,
FDMDQ@KNFHBGDCHBNMM@LDMSNDCH
accesso. Il secondo problema rinvia
alla struttura proprietaria con riduzione della permeabilit del territorio agricolo, nelle fasce di gronda e
nelle valli da pesca. Ma lelemento
saliente il reticolo idrico integrato
allidrodinamica lagunare.
La Carta unipotesi rivolta alla
popolazione altinate. Per questo
ospitata nel sito del comune ed in
fase di aggiornamento con apposita
survey presso famiglie e scuole. Gli
esiti intermedi di questa esperienza
sono stati presentati come attivit
BNKK@SDQ@KD @KK@ 7((( !HDMM@KD CH Qchitettura Common Ground nellauSTMMNF 
3RUWIROLRGLFRPXQLWROWUHOD
FXOWXUDGHOORUGLQDULR

112

Il portfolio progetti ancorato alla


mappa di comunit fornisce spunti
per la composizione di una carta del
paesaggio e della archeologia. Opportunit e criticit emergono da un
ODQBNQRNBTKSTQ@KDBGDBNMMNS@TM@
possibile dimensione strutturale del
governo del territorio a partire da
componenti archeologiche.
Lapproccio una declinazione
RODBHB@ CDK cultural planning mediante:
a) caratterizzazione dei luoghi con
laiuto di forme di conoscenza conSDRST@KD
b) rappresentazione della struttura

territoriale per luoghi caratterizzati e


MNMODQL@SQHBHRNUQ@OONRSDCHBNMCHYHNMD RS@SNDTRN
c) emersione di un sistema di valori
di esistenza da cui possono derivare
altri valori. La condivisione di questi
U@KNQHOTQ@NQY@QDONRHYHNMHMDFNziali a scala territoriale e non soltanSNKNB@KD
C CDMHYHNMD NODQ@SHU@ D CHM@LHB@
della struttura territoriale: il portfoKHNOQNFDSSHNQDTM@RHMSDRHRSQTSSTrale e si aggiorna per composizione
D@SST@YHNMD
D QHU@KTS@YHNMD CH ENQLD RODBHBGD
CDKOQNFDSSN MNQL@NKSQDHKHLHSHQDFNK@SHUHDUHMBNKHRSHBH BNMOHDB@BDPT@KHB@YHNMDCDKK@RSQTSSTQ@SDQQHSNQH@KDDCDKK@FDRSHNMD
ETRNCDKK@L@OO@CHBNLTMHS@Fgiornabile da survey continue (anche in forma di social networking)
per attivit di monitoraggio e valutazione. La carta del paesaggio e della
archeologia consente la sperimentazione di monitoraggio e valutazione
ODQFTQDDMNMRNKNODQHMCHB@SNQH
ll portfolio composto da 14
schede di progetto, contribuisce al
disegno territoriale e, in particolare,
@KK@ CDMHYHNMD CDK O@QBN HMSDFQ@SN
(agro-naturalistico e archeologico)
@SSNQMN @C KSHMN  BHSS RBNLO@QR@
FF  
Ogni scheda di progetto valorizza
una lettura di lungo periodo cadenzata dalla Kiegskarte del 1805, dal
Catasto Austriaco del 1841, da una
foto aerea del 1975 e da una foto
contemporanea. Ogni scheda di progetto tematizzata, come di seguito
indicato:
1. Claudia Augusta: il segno ordinatore
2. Collegamento delle Crete ad Altino
3. Scopriamo la via Annia
4. Restauro del Carmason
5. Via Opitergina e Acquador
6. Percorso della memoria sullo Zero
7. Altino, citt scomparsa
8. Ponte verso Tessera e Mestre
9. Porto antico e canneti del Sile
10. Percorrere il Siloncello
11. Collegare Altino, laguna e Portegrandi
12. Laguna di Altino e citt scomparse
13. Pesca di terra, pesca di laguna
14. La Fossetta
F 
Larmatura di supporto costituita da una rete ciclo-pedonale (e in
parte ciclo-ippica) che, oltre a valorizzare i percorsi esistenti, migliora

gli accessi al sito archeologico, le


connessioni alla rete idrica maggioQDDLHMNQDDK@@BBHN@KK@K@FTM@ (K
"NKKDF@LDMSNCDKKD"QDSD@C KSHMN
OQNONMD BNMMDRRHNMH D @@BBHN  HM
particolare lungo lo Zero.
La rete ciclo-pedonale varia per
SHONCHRTOONQSNOT@@MB@QDTM@
strada esistente, marcare una strada
antica, seguire un argine o una caODYY@FM@ HM SDQQ@ A@SSTS@  +@^ B@ODYY@FM@ ^ N B@UDC@FM@   TM@ RSQ@CHM@
sterrata di servizio agli appezzamenSHBNKSHU@SH  UNKSDBNKKNB@S@EQ@K@QH
di viti o di alberi da frutto, resta una
RTODQBHD HLOQNCTSSHU@ L@ ETMYHNnale alla gestione delle colture. Alcune capezzagne si limitano a segnare il limite di appezzamenti con
K@HTSN CH OHDSQD N OH@MSD BNMM@QHD 
altre diventano, con il tempo, vere e
proprie strade di campagna aperte o
chiuse da siepi.
(M/NMSDUDQRN3DRRDQ@D,DRSQD
laccessibilit ciclo-pedonale viene
@KKNMS@M@S@ C@K SQ@BN @TSNLNAHKHstico. Una passerella o un traghetto
nei pressi dellidrovora Zuccarello
connette a sud il comune di Marcon
BNM 0T@QSN C KSHMN  BNMRDMSDMCN HK
transito delle imbarcazioni e ispirando il racconto delle idrovore.
In un progetto di assetto colturale e paesaggistico la rete favorisce
lintegrazione.
Filari e fasce a prato accompagnano i segni delle antiche vie (Annia e Claudia Augusta) e della centuriazione urbana, come lungo il Carmason. Il disegno di questa armatura
richiede la negoziazione di diritti di
transito e di uso del suolo, come nel
B@RN CH "K@TCH@ TFTRS@ HK RDFMN
ordinatore. Il coinvolgimento delle
principali aziende agricole potrebbe
orientare eventuali compensazioni
PT@KHB@MCN FKH HMCHQHYYH CDK /RQ D
della Pac 2014-2020.
La rete dotata di un sistema di
osservatori verso linterno (rilievo del
dosso, ad esempio) e lesterno (terraferma e laguna), ma anche di servizi
di sosta e di segnalazione. Interventi di piantumazione e adeguamenti
colturali mitigano gli impatti dellurbanizzazione e delle attivit agricole
correnti. Gli adeguamenti accompagnano un modello di uso del suolo
pi leggero, irrobustendo i principi
della archeologia preventiva.
+@QDSDE@BHKHS@KHCDMSHB@YHNMDCH
micro-toponimi, nodi di connessio-

ne con miliari e cippi lapidei, luoghi


CDKK@ LDLNQH@ /DQBNQRN CDKK@ LDmoria sullo Zero) e osservatori. D
senso ad attivit di recupero puntuali, come per la casa Brustolade (gi
sito di rinvenimento di oggetti di culto). La casa potrebbe essere destinata ad agriturismo o utilizzata come
ENQDRSDQH@  (K OQNFDSSN /DQBNQQDQD HK
Siloncello propone la valorizzazione
del sistema della conca veneziana di
Trepalade (opera idraulica per diversione del Sile), con osteria di passo,
NFFHQHCNSS@@RO@QSHSQ@BN
Una ciclopedonale prevista sulla riva sinistra del Siloncello per collegare la ciclabile del Sile con Altino.
Gli osservatori ncorano coni visivi e aiutano a testare ipotesi percettive. Le ipotesi possono essere
costruite sperimentando discontinuit colturali a prato e con essenze ad
alto fusto. La via Annia gi segnava
la discontinuit fra paludi e zone colSHU@SD HMSDQRDB@MCNK@SS@QDSDHCQHB@CHFQNMC@ 0TDRS@RH@MC@S@LNCHB@MCN MDK SDLON ODQ HMSDQUDMSN
antropico, deviazioni degli immissari
lagunari, e per lente variazioni idromorfologiche in territori ecotonali
caratterizzati da strutture meandriformi.
(K 1DRS@TQN CDK "@QL@RNM  @Stento al paleoalveo che mantiene
una certa attivit anche se non sembra avere una rilevante funzionalit
idraulica. Di forma arcuata, Carmason stato deviato verso lo Zero
negli anni 30 dove unidrovora solKDU@ K@BPT@ RB@QHB@MCNK@ MDK TLD 
Il progetto cerca di rendere riconoscibile lantico corso dacqua, gi integrato nel sistema infrastrutturale
romano.
Si recupera anche la connessione
diretta alla Claudia Augusta (lantico
sifone non pi visibile) e la connessione alla zona Portoni di Altino,
gi raccordo fra via Annia e la strada
per Opitergium. Orientato alla valorizzazione della rete idrica il proFDSSN5H@.OHSDQFHM@D BPT@CNQ
Acquador connette la rete idrica
minore al Sile e ne garantisce la percorribilit.
Il rapporto con la laguna viene
RUHKTOO@SNC@KOQNFDSSN/NQSN@MSHBN
e canneti del Sile. Il progetto propone una connessione fra sedime della
citt antica (repubblicana) e la zona
di espansione imperiale e del porto. Le infrastrutture portuali, ancora

M@ JNKDR@QRJ@ROQDG@I@KM@ RSDY@ 


Horizonti se odpirajo po dolini Perini, pogled pa se usmeri tudi proti
Businellu in plovni kotanji Conca, ki
ONUDYTID2HKDY+@FTMN/NUDY@SH Ktino, laguno in Portegrandi).
Naravoslovna in kolesarska/
sprehajalna pot ob Fossetti (preka
tevilne vodne tokove) obuja spomin na antine povezave med Piavo
HM +@FTMN  2OQDG@I@KM@ AQU U AKHHMH UH@ !Q@F@FHNKN NHUKI@ KHSDQ@QMD
spomine in poudarja pomen enega
glavnih dostopov do otokih Benetk.
Fossetta povezuje Portegrandi s
%NRR@KSNCH/H@UDUYCNKRS@QNC@UMD
poti, po kateri plujejo trajekti in barke, namenjene v Furlanijo. Iz Fossette se odpirajo pogledi na neskonne
njive izsuenih delov lagune in razgibano dolinsko pokrajino (enako
tisti v dolini C Zane).
Altino spominja na izginula meRS@  5 OQNIDJST KSHMRJ@ K@FTM@ HM
izginula mesta se kopno Altina spogleduje z odprto laguno. Obnovi
RD AQDHM@  JIDQ RD TQDCH SDL@SRJ@
pot, in zaporedje panoramskih to
do hie Marzi, ki se nahaja na koncu izgonskega grebena reke Sile, z
dvema starima zaselkoma, ki ju je
MDJC@I NAJQN@KN LNUHQID  5HCMN
je tudi leta 2009 odkrito najdie
HYDKDYMDCNADNAOQUNSMHHYFNMRJH
RSQTFHQDJD2HKD +@,@BBGHMDSS@ONstane toka za opazovanje ostankov
zapuenih mest iz zgodnjega srednjega veka (predvsem Costanziaco
in Ammiana).
Dananji nasip se spremeni v
tematsko pot ob robu lagune. Pot
UYCNKQNJ@U@QDJD2HKDONUDD KSHno z laguno, v kateri stopnjo slanosti uravnavajo t. i. vincianska vrata
RHENM@ U ,DNKT  3@ YKNM@ ONS KDON
CNONKMITID LQDN SDL@SRJHG ONSH
in vabi k dvema vrstama ribolova,
sladkovodnemu z renega brega ali
morskemu s olna v laguni. Idejni Muzej voda bi lahko obudil spomin na preusmeritev toka reke Sile
v strugo Stare Piave v 17. stol., na
splono pa tudi na ciklino dejavnost vodotokov z izlivom v laguni.
Zaradi preusmeritve je voda v laguni
ONRS@K@ ANKI RK@M@  NARDM@ SQRSHI@
pa je nadomestilo rastlinje, tipino
Y@G@AHS@SA@QDMD1HANKNURJNOMDga, ribolov v laguni) (sl. 8).

6
9@Q@CH NARDMNRSH HM RDRS@UD @Qheoloke dediine v altinatih je
izhodina domneva ta, da je potencial7 (in posledino zmanjanje tveganja na najmanjo mero)
toliko bolj uinkovit, kolikor bolj
upraviena je nova omejitev in kolikor bolj slednja postane obnova
(v smislu restavriranja) ozemlja.
Scenariji se oblikujejo s preizkuanjem omejitev na podroju restavriranja in prav na podlagi rezultatov tega testiranja dozorevajo
OQDCONRS@UJDOQNIDJS@ DC@MDRRN
prepoznavni bistveni znaki, liki ozemlja ali pokrajine8 in iztonice za
osveeno uporabnost krajev9. A
gre le za prve korake.
Cilj prej opisane predpostavke
varovanja je zmanjati ne samo arheoloke, pa pa tudi krajinske in
vodne dejavnike tveganja. Zaeni
s to predpostavko lahko oblikujemo
tri scenarije10.
Vsi trije predpostavljajo odprtje
novega arheolokega muzeja in se
ocenjujejo na podlagi dveh splonih kriterijev: notranja in zunanja
uinkovitost modela upravljanja in
orodij za nartovanje in upravljanje.
Notranja uinkovitost meri raven
izpolnjevanja predhodno zastavljenih ciljev, zunanja uinkovitost pa
oznauje sposobnost prepletanja in
sodelovanja z drugimi projekti, programi, narti in politikami. Sploni
kriterij je zelo pomemben z vidika
kulture, saj predstavlja vezni len
med upravljanjem in nartovanjem.
Prvi scenarij je izdelan na osnovi
zakonskih omejitev z varovalko z
vidika dodatne uporabe tal. Z zakonom o kulturnih in okoljskih dobrinah in kasnejimi spremembami in
dopolnitvami ima skupen zakonsko
doloen pristop in se omejuje na
HYCDK@UN NJUHQI@ U@QRSU@ RODBHMHG
predelov in pripadajoih varovalnih pasov. Dopolnjujejo ga omejitve (1., 2. in 3. tipa) v fazi priprave
in prvi podrobni nart v skladu s
OQUNU@QH@MSNCDDKMDF@OQNRSNQRJDga narta PTRC (2013). Omejitve se
M@M@@INM@KNJ@KMNRKHJNNFQNDMHG
arheolokih dobrin, na skupne krajinske podobe in na strukturno
zasnovo na podlagi obinskega prostorskega plana v pripravi.
Drugi scenarij nekoliko omi-

li zakonske omejitve z izhodino


zamislijo stalnega lokalnega vrednotenja, povezanega z dinamiko
stanovanjskega trga in s pritiskom
okolikih naselij. Izhodia vrednotenja se nanaajo na infrastrukture,
storitve in turistine dejavnosti. V
zadnjem asu tevilo turistov nekoliko naraa (8-9000 obiskov letno).
Tretji scenarij predlaga razirjeno vrednotenje arheolokih dobrin
UCNLMDUMHYHMHHMTOQ@UMHLQDH 
v kateri sodelujejo sosednje obine
in novo letaliko mesto. tevilo turistov bi lahko v tem primeru
obutno naraslo.
V prvem scenariju je upravnonartovalno orodje v podporo pri
posodabljanju zakonskih omejitev, zaeni od arheolokih najdb
in ocene potenciala. V drugem isto
orodje prispeva k lokalnemu razvoju
s poudarkom na skupnem vrednotenju arheolokih dobrin in njihovega
vpliva, tretji pa deluje v irem, bolj
odprtem sistemu.
Vsi ti scenariji na razline naine
utemeljijo potrebo po parku, a samo
tretji bo tisti, ki jo bo tudi vodil in se
razvijal v tem kontekstu.

ni pas okoli najdi). Vsa ta obmoja


se uvrajo v kategorijo obmoij s
krajinskim in okoljskim pomenom.
Veljavni prostorski nart v skladu z obmonim nartom Palav in
odobritvijo s strani Spomenikega
zavoda varuje tudi naravno okolje
lagune. e se ob izkopavanju naleti
na arheoloko zanimive elemente,
je za posledino prepoved gradnje
OQDCUHCDM@ LNMNRS Y@LDMI@UD
zemljia z obino, poravnave in
izplaila zneskov za nadomestno
gradnjo. Zamenjava, poravnava ali
izplailo morajo ustrezati posebnostim konteksta in projekta za varovanje/vrednotenje, kar pomeni, da
je treba prepreiti posploevanje
kriterijev.
V tem smislu iz scenarija izstopa
e tretji dejavnik, ki ga predstavljata
obseg arheolokih virov in njihove
morfoloke znailnosti na povrju
in pod njim. Obseg in morfoloki
elementi vodijo do etrtega dejavnika: razmerje med pozitivnimi in
negativnimi vrednotami urbanega
in kmetijskega/kmetijskopredelovalnega, okoljskega in krajinskega.

Scenarij zakonskih omejitev

Scenarij lokalnega vrednotenja in


razvoja12

V skladu s tem scenarijem se arheoloki viri prevzamejo v vsem


svojem obsegu poznanega in nepoznanega kot strukturni element
altinat. Poznane dimenzije so lahko
vidne ali skrite, nepoznane pa se
upotevajo kot indici, domneve in
drugae verodostojni podatki.
Prevzem in vnos arheolokega
vira v strukturo poteka istoasno
z morfolokega, zakonodajnega in
upravnega vidika. Veja povezanost
teh treh vidikov zagotavlja tudi bolj
dosleden in uinkovit postopek popisa virov.
Na morfoloko opredelitev strukture vpliva ve dejavnikov. Dva pomembna sta pokritje in porazdelitev arheolokih virov v prostoru
(en kvadratni kilometer rimskega
mesta, ki mu je treba dodati e ostala najdia, porazdeljena po 28
kvadratnih kilometrih obinskega
NYDLKI@  .ALNI@ RN Y@ADKDDM@
U CQ@UMHG /SQB HM /@K@U11) ter lokalnih dokumentih prostorskega
nartovanja kot rezervna, torej
predeli, na katerih so se dejansko
nale arheoloke najdbine, in predeli z arheolokim pomenom (varoval-

Scenarij predlaga lokalni razvoj


s poudarkom na vrednotenju arheolokih virov in njihovega vpliva.
Arheoloki vir je lahko stratekega pomena za lokalni razvoj tako v
pozitivnem kot tudi v negativnem
smislu. Pozitivno vpliva, e prepoznavanju dediine sledi tudi njeno
NUQDCMNSDMID UYCNK BDKNSMD UDQHFD HM R OQNRSNQRJN ONUDY@UN ONYHtivno pa, e arheoloka dediina
ne ostaja samo neizkoriena z
vidika kulture, pa pa pasivno ovira lokalni razvoj gospodarstva in s
tem istoasno povzroa ranljivost
obinskega prostora pred zunanjimi pritiski13.
Strateka vrednost arheolokih
UHQNU RD ONJ@D  JN ONRJT@LN
osnovnemu produktu dediine
dodati njeno uinkovito predstavitev, torej nekaken projekt zaite
HMYHMN ETMJBHNM@KMHLNCDKSQ@IMDga in policentrinega izkorianja.
Veliko artefaktov je dandanes deloma ali v celoti neizkorienih. Njihova uporaba bi lahko okrepila podporo znotraj modela integriranega
upravljanja.
S tovrstnim orodjem bi lahko

113

114

115


parco naturalistico
quarto daltino

parco
archeologico
parco agronaturalistico

aeroporto marco polo

10

116

CH HMBDQS@ HCDMSHB@YHNMD  RDLAQ@no marcare una linea a monte degli approdi scoperti recentemente
a Torcello (2011-13). Due belvedeQD RTKK@ K@FTM@ NQNMN TMN ROTMSN
RHFMHB@SHUN MDH OQDRRH CDH ONMSH CH
attraversamento dellisola portuale.
0TH O@UHLDMS@YHNMHHMOHDSQ@ RDFM@no il passo su argini resi accessibili.
4M ODQBNQRN C@BPT@ CNKBD MN @KK@
laguna rivaluta il sistema a canneto.
Lingresso alle aree archeologiche a
nord della statale in corrispondenza del collettore Valle Rossa.
Lungo il bordo lagunare (gronda)
e largine del Silone si propone un
anello ciclo-pedonale con prospettive su valle Perini, ma anche verso il
Businello e la Conca di navigazione
BGDBNKKDF@HK2HKD@KK@+@FTM@"NKlegare Altino, laguna e Portegrandi).
Il percorso naturalistico ciclo-pedonale lungo la Fossetta (con numerose intersezioni di corsi dacqua) rievoca antichi collegamenti fra Piave
e Laguna. Una passerella allaltezza
di via Bragagiolo stimola memorie
letterarie e sottolinea limportanza
di una delle principali porte di accesRN @ 5DMDYH@ HMRTK@QD  +@ %NRRDSS@
collega Portegrandi con Fossalta di
Piave lungo un percorso storico fre-

quentato dai traghetti e dalle barche


dirette verso il Friuli. Dalla Fossetta
si apprezza la profondit dei campi
@ODQSH CDKK@ ANMHB@ D HK O@DR@FFHN
U@KKHUNBNLDPTDKKNNDQSNC@U@KKD
di C Zane).
Altino richiama le citt scomparRD  -DK OQNFDSSN +@FTM@ CH KSHMN D
citt scomparse i territori altinati
guardano alla laguna aperta. Si recuperano largine come percorso e
sequenza di punti di vista e la casa
CDH ,@QYH  BNQQHRONMCDMSD @KK@ MD
CDK CNRRN TUH@KD CDK 2HKD  BNM CTD
vecchi nuclei abitati un tempo circondati da palude. Si nota anche il
sito dellet del ferro scoperto nel
2009 lungo il paleo-dosso del Sile.
+@ ,@BBGHMDSS@ CHUDMS@ NRRDQU@SNrio sui siti delle citt alto-medievali
abbandonate (Costanziaco e Ammiana, soprattutto).
Lattuale barriera viene trasformata in percorso di bordo lagunare.
Seguendo il taglio del Sile , si rende Altino contigua alla laguna, dove
il gradiente di salinit regolato da
porte vinciane sul sifone del Meolo.
un percorso di cesura che completa la rete e consiglia due modalit di
pesca, in acqua dolce e vagantiva. La
realizzazione di un Museo delle ac-

que pu ricordare la diversione del


75(( RDBNKN CDK 2HKD MDKK@KUDN CDKK@
Piave vecchia e, pi in generale, i ciclici ritorni degli immissari deviati.
Allora la diversione fece aumentare
la salinit, favorendo la scomparsa
del canneto per un ambiente bareMHBNKN/DRB@CHSDQQ@ ODRB@CHK@FTM@F 

6
Considerata lampiezza e la composizione del patrimonio archeologico altinate, lipotesi di partenza
BGD K@ STSDK@ CDK ONSDMYH@KD7 (e di
conseguenza la minimizzazione del
QHRBGHN RH@ S@MSN OH DB@BD PT@Mto pi motivato si presenta il nuovo
UHMBNKN D PT@MSN OH DRRN CHUDMS@
restauro del territorio.
Gli scenari vengono costruiti testando il vincolo nel restauro ed su
questo test che maturano le ipotesi
progettuali. Gi oggi si possono ricoMNRBDQDRDFMHR@KHDMSH FTQDSDQQHSNriali o di paesaggio8 e spunti per una
EQTHAHKHS HMENQL@S@ CDH KTNFGH9. Ma
si tratta di primi passi.
Lipotesi di tutela sopra enunciaS@  M@KHYY@S@ @KK@ LHMHLHYY@YHNMD

dei fattori di rischio non soltanto archeologico, ma anche paesaggistico


e idraulico. A partire da questa ipotesi si possono costruire tre scenari10.
I tre scenari assumono la entrata in funzione del nuovo Museo archeologico e sono valutati rispetto a
CTDBQHSDQHFDMDQ@KHK@DB@BH@HMSDQna ed esterna del dispositivo gestioM@KD D CDFKH RSQTLDMSH CH OH@MHB@YHNMD D FDRSHNMD  +DB@BH@ HMSDQM@
misura il grado di raggiungimento
degli obiettivi dichiarati, mentre lefB@BH@DRSDQM@DUHCDMYH@K@B@O@BHS
di interazione con altri progetti, programmi, piani e politiche. Il criterio
FDMDQ@KD G@ RHFMHB@SHU@ U@KDMY@
culturale in quanto raccordo fra geRSHNMDDOH@MHB@YHNMD
Il primo scenario vincolistico
DCHSQDMCLHSHF@SNC@KOTMSNCHUHsta del consumo di suolo aggiuntivo.
Condividendo lapproccio regolativo
proposto dal Codice e s.m.i., il primo
RBDM@QHNRHKHLHS@@BNMFTQ@QDHKPT@CQNCDKKDSTSDKDRT@QDDRODBHBGDD
relativi EXHU. aggiornato dalla vestizione dei vincoli (di I,II e III tipo)
in corso e dal primo piano dambito
in coerenza alla Prima Variante del
PTRC (2013). I vincoli sono ancorati
@KK@ KNB@KD FDNFQ@@ CDK QHRBGHN @Q

zakonske omejitve dopolnili z novo


vsebino in preusmerili pozornost z
njihove samo delne prenosljivosti
M@ DJNMNLRJN  CQTADMN HM JTKSTQno uinkovitost lokalnega projekta.
Ta scenarij je seveda dale od
tega, da bi omilil zakonsko omejitev
JNS S@JN ID R@LN OQDHYJTR HYGNCH
za redno vrednotenje, povezanih z
QDJU@KHJ@BHIN HM NAMNUN NYDLKI@
kot odgovor na pritiske okolikih
naselij. Predpostavke vrednotenja
vodijo do razvoja infrastruktur, storitev in turistinih dejavnosti s predvidevanjem o nekolikni rasti tevila
turistinih obiskov v srednjeronem
in dolgoronem obdobju.
Scenarij razirjenega vrednotenja
Tretji scenarij predlaga razirjeno vrednotenje arheolokih virov
NAOQDCONRS@UJHYHMDHMTOQ@UMD
LQDD  U J@SDQN RN UJKITDMD STCH
sosednje obine Benetke, Musile
di Piave, San Don, Concordia Sagittaria, Portogruaro, Jesolo. Zaita
in vrednotenje dobita tem primeQT HQH NYDLDKIRJH ONLDM ONI@UHjo se pojmi vozlia, povezave in
transekta, znailni za severni del
projektnega ozemlja Parsjad. Svoj
pristop do ozemlja razvijajo s poudarkom na morfogenezi v najirem pomenu14.
Razlogi in uinkovitost varstva
pridejo do izraza znotraj ozemeljskega ogrodja in v smislu umestitve na to ozemlje. Nateti orodji pomagata pri nameanju ozemlja
Altina in njegovega arheolokega
jedra v okvir pomembnih meril na
podroju gronde in mest s pogledom na laguno15. Pod razlino velikimi koti se lahko doloajo krajinske
ONCNAD HM yFTQ@SHUMH JNMSDJRSHi 
ki povezujejo arheoloke vire z okoljem gronde, lagune in morja, voCMDF@ NLQDI@  HYRTDMN ONJQ@IHMN 
ki se e vedno sooa z nevarnostjo
poplav, pa vse do kulturne in zgodovinske dediine.
Scenarij usmerja zamisli o podobi ozemlja in ustanovitev bodoega
kmetijsko-naravoslovnega in arheolokega parka, obvea pristojne naslove o predlogih za eksperimentalni krajinski observatorij. Poleg tega
predlaga sprejetje obinskega prostorskega narta, povezanega s tematiko irega arheolokega potenBH@K@HMNUQDCMNSDMI@LQDDLTYDIDU
z mednarodnim ugledom16 (sl. 9).


3


5.1 Pet potez
Scenarij razirjenega vrednotenja deli dediinsko strategijo
na pet korakov. Vsak od njih lahko
predstavlja pogoj za zaetek procesa kulturnega nartovanja.
Gre za naslednje korake:
1.opredelitev
okvirne
strategije, ki obmoje altinat umesti v
potekajoe procese kot vozlie
kulturnih, turistinih in rekreacijRJHGONSH
2.projekt venamenskega kmetijsko-naravoslovnega parka v proizvodne, rekreativne in turistine namene. Ustanovitev parka zahteva
prilagoditev prepustnosti pasu do
KNJ@BHID
3.projekt arheolokega parka odprtega tipa s potmi, oznakami tal in
podpornim orodjem za oznabe
lokacij (ostaline in sledi, skrite pod
povrjem, se doloijo s pomojo
@OKHJ@BHIDyONUD@MDRSU@QMNRSHi
4.NOQDCDKHSDU OQ@UHK HM FTQ  JH IHG
je mogoe uvrstiti v Ozemeljski
prostorski nart (Pat/i) in v Nart
krajinske arhitekture v pripravi (I
/OQ@
5.ustanovitev
eksperimentalnega
observatorija krajine z arheolokim
pomenom, vkljuno z postopnim
posodabljanjem mape skupnosti in
projektne mape in s spremljanjem
uinkovitosti upravnega aparata
(sl. 10)
3RJRMLLQYLULYNRQWHNVWX
V zvezi s to temo se odpirajo tevilna vpraanja. Prvo se nanaa na
skupno urbanistino ureditev tirih
NAHM 0T@QSN C KSHMN HM 5DMDYH@ 
O@ STCH ,@QBNM HM 1NMB@CD CQTFN
zadeva lastnitvo, saj je projektno
obmoje v lasti tirih velikih lastniJNU  J@Q OQDCRS@UKI@ OQHKNMNRS Y@
projektno in upravno partnerstvo.
3DL@SHJ@L@
RD
OQHCQTTID
tudi vpraanje o prihodnosti treh
stvarnosti v okolici arheolokega
najdia: letalie v Tesseri, laguna
severno od Benetk in Bosco di Mestre. Ker so predmet tevilnih proIDJSNUSDQY@LHRKHNQDJU@KHJ@BHIHHM
povezavah, bi lahko neizbrisno vplivale na izgled krajine.
/QHKNMNRS Y@ JTKSTQMN Y@HSN 

YCQTHSDU HM NUQDCMNSDMID RD J@D


v Prvem nartu krajinske arhitektuQD/OQ@CDDKD!DMDHID YHYUDCAN
1. Variante za Ptrc 2009, ki bo zajel
celotni obalni pas od Altina do Polesina. K temu dodajmo e posege,
ki jih predvideva Morfoloki nart
beneke lagune (Pmlv 2013, v
zakljuni fazi) in Nart upravljanja
Y@HSDMDF@ NALNI@ 4MDRB@ !Dnetke in njihova laguna za obmoje
pasu gronde ob obalah lagune.
.AHM@ 0T@QSN C KSHMN @JSHUMN RNdeluje pri pripravi Narta upravljanja in morfolokega narta zaradi
pomena, ki ga ima ta za morfologiIN U RLHRKT UYCQDU@MI@ HM NAMNUD
obmoja plimovanja), hidrodinamiko (revitalizacija in omejevanje
voda), ekologijo (habitat in njegove
vrste), pa tudi za kakovost voda in
naplavin.
Zadnja, a zato ni manj pomembna spremenljivka za razumevanje
konteksta ozemlja altinat je gradnja
ADMDJD OQHLDRSMD DKDYMHBD  /Q@U
je, da opozorimo, da njena predUHCDM@ LQD@ ONUDY@U R ONJQ@IHMN
Benetke ni na ravni izrpnih tudij,
ki so se zaele v asu Projekta80 o
procesu metropolitanizacije Italije. A tudi pojav hibridizacije benekega zaledja, ki so ga v preteklosti
povzroiti ti procesi, ne bo naletel
na ugodne ocene. e manj pohvale
RHY@RKTHNODQ@SHUMNNCRSNO@MIDNC
koncepta tretje Beneije, ki ga je
predlagal 2009.
Tretji scenarij predvideva razvoj
nartovanja s fazo predhodnega
preizkuanja in sodelovanja, v kateri se zbirajo rezultati odziva interesnega podroja na dinamike in
povzroitelje stresa. Gre za svojevrstno kulturno obogatitev rednega
nartovanja.
Novi urbanistini narti (PAT)
sosednjih obin s projektnim
obmojem ravnajo, kot bi lo za ostanek, obrobni element obinskega
ozemlja. V obini Marcon se na
primer obmoje altinat nahaja na
skrajnem vzhodu obinskega ozemlja, dale od naselij, proizvodnje
in trgovskih sredi, na drugi strani
avtoceste. Ravno tako obrobno je
tudi zanimanje gradbene stroke in
investicijskih akterjev. Enako velja
za Roncade v pokrajini Treviso, kjer
RD M@IUD M@RDKHI M@G@I@ UYCNK NRH
3QDUHRN 0T@QSN C KSHMN ,DRSQD  ONpolnoma kmetijske povrine pa le-

HINNAQDMHNRHQDJD2HKDHMNA/NJQ@IHMRJDL O@QJT  5 NAHMH 0T@QSN


dAltino je vpraanje nekoliko bolj
zapleteno in spremenljivo. eprav
RD 0T@QSN M@G@I@ Y@GNCMN NC @Qheolokega obmoja, je kraj z njim
povezan z antino rimsko cesto.
Kot je postalo razvidno iz delavnice
charrette, nartovanje obmoja altinat predstavlja odprto vpraanje za
prihodnost arheolokega obmoja.
Za Benetke veljajo posebni pogoji, saj je obmoje sicer resda obrobno glede na lego obinskega
ozemlja, vendar istoasno stratekega pomena zaradi letalikih infrastruktur v fazi prenove. Poleg tega
mestu v laguni os Altino-Torcello
predstavlja transekt zgodovinskega prehoda, zemljepisni dostop do
preteklosti v veliki vrzeli (cfr. A.
Zanzotto).
Projekt lokalne ekoloke mreD HM UYONRS@UHSUD Q@UMNUDRI@ U
obinski krajini, imenovan Bosco di
Mestre, je v fazi akanja na strategijo oblikovanja krajinske podobe kopenskega dela benekega ozemlja.
*KITAAKHHMHNALNI@@KSHM@SO@NARDM@ NYDLKI@ !NRBN CH ,DRSQD MD
predstavljajo pomembnih elemenSNU U LQDH ON@RMHG ONUDY@U HM U
kmetijskem RPUHMX (sl. 11).
7YHJDQMD
Razvoj letalia v Tesseri odpira pomembna vpraanja za prihodnost arheolokega obmoja v AltiMT *@D C@RNMDJ@SDQHDKDLDMSHU
SDLSQDMTSJTDCNKNDMH 9@LHRDKN
OQHLDRSMH DKDYMHBH LDC KDS@KHDL 
arzenalom in Lidom je trenutno
tehnino e preve zahtevna, poleg
tega pa zanjo ni dovolj podatkov o
oceni tehnine in ekonomske izvedljivosti, da bi bila izvedljiva s sprejemljivimi stroki in zmanjanimi
okoljskimi vplivi.
Realizacija visokohitrostne poveY@UDYITMHLCDKNLKDS@KH@RDYCH
bolj izvedljiva, e ji ne bi nasprotovalo dejstvo, da bi morali tako hitri
vlaki obiti Mestre in Benetke, e naj
bi bili konkurenni. S to zamislijo bi
letalie Marco Polo postalo zelo zanimivo, saj bi lahko svoje interesno
obmoje poleg Furlanije, od koder
D C@MDR OQHG@I@IN KDS@KRJH ONSMHki, razirilo do Emilije Romanje in
Lombardije. Kljub temu pa je tevilo
potnikov v odhodih in prihodih na
letalie gotovo manje od tistih,

117

un quarto fattore, la pertinenza di relazione con valori e disvalori dellurA@MHYY@SNDCDKKTSHKHYY@SN@MH@FQHcoli o agroindustriali, ambientali e
paesaggistici.
Scenario di valorizzazione locale12

11

118

BGDNKNFHBN @FTQDO@DR@FFHRSHBGD
condivise e ad un assetto strutturale
acquisibile dal Pat in formazione.
Il secondo scenario mitiga il vincolo con ipotesi di valorizzazione
locale e ordinaria connesse alle dinamiche del mercato abitativo e alla
pressione degli insediamenti contigui. Le ipotesi di valorizzazione riguardano infrastrutture, servizi e attivit turistiche. Si assume un leggero incremento delle presenze, oggi
attestate sulle 8-9000 unit annue.
Il terzo scenario propone una
U@KNQHYY@YHNMD DRSDR@ CDKKD QHRNQRD
archeologiche in unipotesi di rete
RHB@ D FDRSHNM@KD BGD BNHMUNKFD H
BNLTMH BNMSDQLHMH D K@ MTNU@ BHSt aeroportuale. Lincremento delle
presenze potrebbe essere in questo
caso molto pi consistente.
Nel primo scenario il dispositivo
FDRSHNM@KD OH@MHB@SNQHN BNMSQHATHsce ad aggiornare i vincoli a partire
dai reperti, cos come dal potenziale
stimato. Nel secondo, contribuisce
ad uno sviluppo locale centrato sulla valorizzazione concertata della risorsa archeologica e del suo indotto,
mentre nel terzo opera in una prospettiva pi aperta e di rete.
0TDRSHRBDM@QHLNSHU@MNCHUDQR@-

mente le ipotesi di parco, anche se


sar soltanto il terzo ad assumerne
la guida e ad essere sviluppato in
questo contesto.
Scenario vincolistico
Secondo questo scenario, la riRNQR@ @QBGDNKNFHB@  @BPTHRHS@ MDKle sue dimensioni note e non note
come componente strutturale del
territorio altinate. Le dimensioni
note sono visibili o nascoste, mentre
quelle non note si presentano come
indiziarie, ipotetiche e a diversa verosimiglianza.
Lacquisizione della risorsa arBGDNKNFHB@ @KK@ RSQTSSTQ@ @UUHDMD
in termini morfologici, normativi e
gestionali e loperazione tanto pi
DB@BD PT@MSN OH BNMMDRRD RNMN
le tre dimensioni in un progetto di
comunit.
Alla caratterizzazione morfologica della componente strutturale
contribuiscono diversi fattori. Due
E@SSNQHQHKDU@MSHRNMNK@BNODQSTQ@D
la distribuzione spaziale della risorsa archeologica (1 kmq della citt romana a cui si aggiungono altri siti diRSQHATHSHRTH*LPCDKK@RTODQBHD
comunale) che delimitano le condi-

zioni di appartenenza degli insediamenti urbani e rurali. Ci indicato


C@FKHRSQTLDMSHCHOH@MHB@YHNMDRNvraordinata (Ptrc e Palav11) e locale
HMSDQLHMHCHQHRDQU@ NUUDQNCH@QD@
direttamente interessata dal rinvenimento dei reperti e di area di interesse archeologico (fascia tampone a
protezione del sito). Si tratta di aree
connettibili con quelle di interesse
paesistico e ambientale.
Il Prg in vigore tutela anche lambito lagunare in conformit al Palav
e con nulla osta preventivo della
Sovrintendenza. Se il saggio di scavo evidenzia elementi di interesse
archeologico, la conseguente inediB@AHKHSOQDUDCDONRRHAHKHSCHODQmuta con il Comune, formule perequative e di trasferimento di crediti
edilizi. Permuta, perequazione e crediti dovrebbero essere calibrati con
KDRODBHBHSCDKBNMSDRSNDHKOQNFDSto di tutela/valorizzazione, evitando
generiche parametrazioni. In questa
prospettiva lo scenario consente di
apprezzare un terzo fattore, costituito dalla consistenza archeologica e
C@KKDRTDLNQENKNFHDHMRTODQBHDD
nel sottosuolo. Consistenza e morfologie si relazionano a loro volta ad

0TDRSN RBDM@QHN OQNONMD TMN RUHluppo locale centrato sulla valorizzazione della risorsa archeologica
e del suo indotto. La risorsa archeologica pu essere strategica per lo
sviluppo locale sia in termini positivi
che negativi.
Lo in termini positivi se al riconoscimento del patrimonio corrisponCD TM@ RT@ U@KNQHYY@YHNMD CH KHDQ@
D CH BNMMDRRHNMD RO@YH@KD KN  HM
termini negativi quando il patrimonio archeologico oltre a non essere
culturalmente fruito vincola passivamente leconomia locale, rendendo al contempo vulnerabili i territori
BNLTM@KH@OQDRRHNMHDRSDQMD13.
Il valore strategico della risorsa
@QBGDNKNFHB@ DLDQFD @@MB@MCN
alla armatura patrimoniale una sua
DB@BD Q@OOQDRDMS@YHNMD  TM OQNFDSSNCHSTSDK@DTMLNCDKKNRHBN
funzionale di fruizione continua e
ONKHBDMSQHB@  $RHRSNMN L@MTE@SSH
oggi parzialmente o del tutto inutilizzati, il cui riutilizzo potrebbe arricchire le dotazioni di supporto entro
un modello di gestione integrata.
Un impianto del genere consentirebbe di arricchire di nuovi contenuti i vincoli e di spostare lattenzione dalla loro parziale negoziabiKHS@KKDB@BH@DBNMNLHB@ RNBH@KDD
culturale del progetto locale.
0TDRSN RBDM@QHN  KTMFH C@K LHSHgare il vincolo in quanto tale, sperimenta ipotesi di valorizzazione
NQCHM@QH@ BNMMDRRD @KK@ QHPT@KHB@zione/rigenerazione del territorio
come risposta alla pressione degli
insediamenti contigui. Le ipotesi di
valorizzazione rinviano allo sviluppo di infrastrutture, servizi e attivit
turistiche, assumendo un leggero incremento delle presenze nel mediolungo periodo.
Scenario di valorizzazione estesa
Il terzo scenario propone una
U@KNQHYY@YHNMD DRSDR@ CDKKD QHRNQRD
archeologiche in unipotesi di rete
RHB@DFDRSHNM@KDBGDBNHMUNKFD@Mche i comuni contermini di Venezia,
Musile di Piave, San Don, Concordia

ki prihajajo obiskat Benetke. Hitra


in pogosta povezava z Mestri in Benetkami (shuttle) se torej zdi bolja
in ceneja reitev od tunela, ki bi ga
bilo treba zgraditi za prihod vlaka za
visoke hitrosti na letalie.
Odprto ostaja tudi vpraanje o
infrastrukturah, predvidenih v tako
imenovanem kvadrantu Tessere (Quadrante Tessera  JH Y@CDU@IN NARDMN
podroje in predstavljajo najvejo
nevarnost za bodonost obmoja altinat.
Podrobni krajinski nart, ki ga
pripravlja Uprava ozemeljskega
HM RSQ@SDJDF@ M@QSNU@MI@ CDDle Beneije, lahko na primeren
nain rei problematiko celotnega
obmoja z uporabo zakonskih predpisov varstva, vkljuevanja in vrednotenja.
Nart druge pristajalne steze
HM 0T@CQ@MS@ OQDCRS@UKI@ DMN NC
M@IUDIHG FQNDMI Y@ @QGDNKNJN
obmoje Altina, e posebej, ker se
je le-to desetletja dolgo zanemarjalo in je e vedno skoraj povsem
prezrto pri doloanju prednostnih
nalog kulturnega prostora Benetk.
V obdobju med letoma 2002 in
2009 je PRG (prostorski nart) Benetke odobril varianto, imenovano
0T@CQ@MSD3DRRDQ@ HMRSDLCNKNHK
NJUHQONRDF@MI@ /QU@LNMNRS JHIN
je predlagal Pokrajinski svet Benetke, loi tercialna obmoja novega
obinskega stadiona in nove igralnice (vse pod obinsko upravo) od
sosednjega letalikega terminala.
Ta naj bi se raziril, na njem pa bi se
zgradile intermodalne infrastruktuQD U OQHRSNIMNRSH CDDKD !DMDHID  5
letih 2004-2005 je Save kupila 200
hektarjev, na katerih naj bi zgradila
novo letaliko stezo v smeri proti
zahodu. V istih letih so se doloili
elementi intermodalnih struktur,
vkljuno s t.i. vodnimi vrati (vodno letalie), ki jih je zasnoval F. O.
Gehry. Razlog za raziritev naj bi bila
napovedana rast potnikov v tranzitu, zaradi katerih se letalie Marco Polo spreminja v tretji najveji
terminal v Italiji. Nedavni Narodni
nart letali (2012-2013) potrjuje
ta scenarij.
Glavni nart intermodalnega vozlia predvideva, da bo ob
zakljuku del leta 2030 vlak za visoke hitrosti uporabilo 3,8 milijonov
ONSMHJNU KDSMN RJTOMo tevilo poSMHJNUM@ONCYDLMHDKDYMHBHONCK@

guno, na regionalni progi Sfmr in na


progi za visoke hitrosti celo 6,6 milijona letno. Poleg tega se ocenjuje,
C@ANMNUNDKDYMHJNONRS@INTONrabilo 9,3 milijona potnikov letno,
letaliki terminal pa kar 13 milijonov
potnikov. Skupno tevilo potnikov,
ki bodo potovali skozi intermodalno vozlie, naj bi bilo 19 milijonov.
Ocene so zaasne in ne upotevajo
neto uinka, ki ga bodo povzroile
konkurenne in sinergine dinaLHJD KDS@KH@ "@MNU@U 3QDUHRT  5
tem trenutku tudi ni mogoe oceniti
uinka predvidenih preusmeritev
velikih ladij iz beneke lagune17.
Gre torej za kompleksen in negotov scenarij, ki oitno ne upoteva naravnanosti predelov okoli
kvadranta Tessere: morfologije lagune in ribolovnih zajetij, mestnega
sredia Tessere, kmetijskih povrin,
krajinskega potenciala, razirjenih
vplivov podnebnih sprememb na izsuenih podrojih, razvoja parka ob
reki Sile in z njim povezane ekoloke
LQDDSDQ MDM@Y@CMID @QGDNKNJDF@
obmoja altinat skupaj z arheolokimi obmoji lagune in pasu ob njej.
Zaradi teh razlogov smo izbrali raziskovalni pristop, namenjen
JNMFTQ@BHIH JHIDYCQTKIHU@RROQDmembami celotnega projektnega
obmoja. Idejna reitev je zaititi
in ovrednotiti obmoja, ki jih projekt
kvadranta ne zajema in ozemlju alSHM@SMTCHSHLNMNRS C@RDRKHHSTCH
njegov glas (sl. 12, 13, 14, 15).
5.4 Povezave
Za razvoj lokalne strategije so
pomembne povezave Altina z Benetkami in z otoki severne lagune. AltiMNNFQN@KDS@KHD RSHJ@YNSNJHRDverne lagune pa nima. Ti so namre
konne postaje plovnih poti, ki
vodijo od Benetk proti laguni.
Trenutna poasna linija mestnega potnikega prometa Actv, ki
povezuje Fondamenta Nuove v Benetkah z otoki San Michele-Murano-Burano-Mazzorbo-Torcello, njena
varianta pa SantErasmo in Cavallino, je na udaru turistov, zaradi esar
so konna destinacija Torcello in
drugi otoki v severni laguni mono
prikrajani. as plovbe od beneke
DKDYMHJD ONRS@ID 2@MS@ +TBH@ CN
Torcella je kar 75 minuti, torej enako asu, ki ga popotnik porabi za
potovanje z vlakom iz iste postaje
do Ferrare (vkljuno z enim presto-

panjem) ali do Verone z vlakom Bela


puica.
e predpostavimo, da hitra meRSM@DKDYMHB@MDAHOQHK@R@LNCN
letalia, pa pa da bi progo podaljali do Altina, nato pa bi vaporetto
plul iz Altina do Torcella, bi to potovanje verjetno trajalao enako kot
opisano, vendar pa bi del turistov
preusmerili tudi v laguno severno
od Benetk z izhodiem v Altinu.
Ta logika direfenciacije dostopov
RDUDC@ROQNHOQNAKDLUQRSDONMTCbe, ki bi lahko privabila turiste, ki jih
danes predvsem zanima glavno mesto lagune. V ponudbi bi lahko zdruHKH UD M@Q@UMHG DKDLDMSNU  JNS RN
laguna, ribolovna zajetja, sistem kanalov, park reke Sile, z zgodovinsko
in umetnostno ponudbo, povezano
z monumentalnimi objekti Torcella
in enkratno mestno zasnovo Burana. Povezava s poljedelskim otokom
SantErasma in Vignol bi lahko predstavljala dodatni vir turistinih zanimivosti.
e ponudba Altino-Torcello-severna Laguna ne bi bila dovolj zaniLHU@ C@AHRDNJNKHMIDQ@YUHK@SQM@
nia uporabnikov, bi lahko potencialne obiskovalce prestregli na bliMIDLKDS@KHT,@QBN/NKN
Ob tem se porodi prvo vpraanje:
pri preoblikovanju podobe in razvoja letalia je strateko razmiljati o
njegovi stabilni povezavi z Altinom v
njegovi vlogi vrat v severno laguno.
Vendar pa obmoje Altina ne sme
predstavljati samo dostopa do laguMD R@IAHRDRSDLNCQDJKHLNMNRSH 
C@ K@GJN R@LN OQDRSQDD CNKNDMN
tevilo turistov z ustrezno preobrazbo svoje krajinske podobe in z
Q@YUNIMHLH LNMNRSLH Y@ Q@YHQHSDU
arheolokega muzeja v smislu razstav, restavratorstva in raziskovanja.
Dananji muzejski kompleks namre
ustreza tevilu obiskovalcev, ki obisku ne namenijo ve kot eno uro.
/N NCOQSIT MNUDF@ RDCD@ RD OQDCvideva, da bo obisk muzeja trajal
vsaj dve uri. Toda zaradi pomanjkanja prostora je komajda verjetno,
da bi muzej lahko postal katalizator
in da bi lahko privabil ljubitelje arheologije. Jasno je, da bodo zaradi
pomanjkanja turistine privlanosti
ti kraji, njihov potencial in kontekst
lagune vedno bolj drseli na obrobje
dogajanja.
Tovrstni trend bi lahko nevtralizirali s tremi vrstami ukrepov. S prvim

RDUODKIDINRSQ@SDFHID JHRNYCQTKIHUD
YNALNIDLFKDCDM@Q@YUNIAKHMIDga kvadranta Tessere. Drugi ukrep
predvideva pripravo kmetijsko M@Q@UNRKNUMDF@ O@QJ@ U AKHMIDL
okoliu z vkljuitvijo turistinih in
nastanitvenih kapacitet ter kolesarskih in sprehajalnih poti od obalne
rte do zaledja. Tretji pa predvideva ustanovitev arheolokega parka
s posebnim modelom upravljanja:
MNUHHU@GMHONKADMDJD@QGDNKNJD
raziskovalne dejavnosti. V tem poFKDCTRDK@GJNNBDMHSTCHOQHKNMNRS
za ustanovitev Fundacije po vzoru
Classe (Ravenna)18.
5.5 Kmetijsko-naravoslovni park
Ozemlje, ki obdaja arheoloko
M@ICHD  J@D ONCNAN NAHQMDF@
kmetijskega predela, za katerega so
znailna melioracijska dela iz dvajRDSDF@RSNKDSI@S@RNRJNQ@IUBDKNSH
HYAQHR@K@ ONRDAMH ONKN@I  JH F@ ID
zavzemalo antino mesto na stini
toki z laguno. Pokrajino prepredajo
tevilni vodni toki in jo zaznamujejo
starodavne rene struge. Pogled se
odpre na irok odprt prostor, ki ga
le tu in tam omejujejo nasipi rek in
vzpetina, na kateri je stalo antino
LDRSN  #QDUI@ ID L@KN U OQDSDJKHG
desetletjih se je razredilo predvsem zaradi senje drevoredov ob
nekaterih rimskih vpadnicah in ob
ONSDGRS@QNC@UMDLQDDLDCMIHLH
Dostop do lagune je e dodatno
OQDJHMHK@ CQ@UM@ BDRS@ 3QHDRSHM@ 
Kolesarskih in sprehajalnih poti skorajda ni, cestni mostovi so speljani
tako nizko, da se skorajda zajedajo
U FNRSN UNCMN NLQDID M@ Q@UMHBH 
Glavni reni tokovi, ujeti med nasipe, so edini e preostali sledovi povezanosti obmoja z otoki v laguni.
Na poljih se veinoma prideluIDIN HS@QHBD NACDK@MD ONUQHMD RN
YDKN NARDMD  JLDSNU@MID O@ HMCTstrializirano. Leta 2000 je obdelana
kmetijska povrina (Sau) v obini
0T@QSN C KSHMN ONJQHU@K@ J@Q 
ozemlja obine: 19.7 km2 od skupaj
28.16 km2.
Najpomembneji so poljski pridelki: 686 hektarjev je namenjenih vzgoji industrijskih rastlin, 679
ha soji, 453 za koruzi (brez krmnih
rastlin), 255 sladkorni pesi in 208
LDGJHODMHBH /QHAKHMNGDJS@Qjev je namenjenih razlinim krmnim
rastlinam, od teh 71 voeni koruzi
in 22 drugim rastlinam. K temu je

119

12

120

Sagittaria, Portogruaro, Jesolo. Tutela


e valorizzazione assumono in questo
caso valenza territoriale, rinviando
ai concetti di nodo, connessione e
transetto propri della parte pi settentrionale dellarea interessata dal
,DS@OQNFDSSN /@QRI@C  0TDRSH BNMcetti sviluppano lapproccio areale
BNM@SSDMYHNMD@KK@LNQENFDMDRHHM
senso lato14.
1@FHNMH DC DB@BH@ CDKK@ STSDK@
possono essere apprezzate allinterMNCH@QL@STQDSDQQHSNQH@KHDBNMQHEDrimento a ipotesi di inquadramento
SDQQHSNQH@KDBGD@HTS@MN@ONRHYHNM@re il territorio altinate e il suo core
archeologico rispetto a benchmark
RHFMHB@SHUH HM FQNMC@ D RTFKH @@Bci lagunari15. Con triangolazioni di
diversa ampiezza possono essere
HCDMSHB@SD FTQD CH O@DR@FFHN D
BNMSDRSH FTQ@SHUH BGD BNMMDSSNMN
la risorsa archeologica allambiente di gronda, lagunare e marino, alla
rete idrica, al paesaggio delle boniBGD D CDK QHRBGHN HCQ@TKHBN  MN @K
patrimonio storico-culturale.
0TDRSNRBDM@QHNFTHC@KDHONSDRH
di assetto territoriale, listituzione
del parco agro-naturalistico e archeologico, informa gli indirizzi ge-

stionali e le proposte per un osservatorio sperimentale del paesaggio.


Suggerisce, a latere, ladozione di un
Pati ancorato al tema del potenziale
archeologico allargato e alla valorizzazione di una rete museale di rilevanza internazionale16 F 

 ,   


&LQTXHPRVVH
Lo scenario di valorizzazione
DRSDR@ NQHDMS@ TM@ RSQ@SDFH@ O@SQHmoniale su cinque mosse. Ciascuna
pu essere assunta come condizione
per lattivazione di un processo di
OH@MHB@YHNMDBTKSTQ@KD 
-DKKNRODBHBN RHOQNBDCDBNM
1.CDMHYHNMD CH TM@ RSQ@SDFH@ C@Lbito che colloca laltinate allinterno dei processi in atto come nodo
di itinerari culturali, turistici e riBDSSHUH
2.progetto di un parco agro-natuQ@KHRSHBN LTKSHETMYHNM@KD BNM MH
produttivi, ricreativi e ricettivi. Listituzione del parco richiede un

adeguamento della permeabilit


HMSDQONCDQ@KD
3.progetto di parco archeologico
aperto, con percorsi, riferimenti
al suolo e dispositivo di supporto
ODQK@B@Q@SSDQHYY@YHNMDCDHKTNFGH
QDRSHDSQ@BBDMNM@NQ@MSHRHONsizionano con laiuto di un App di
QD@KS@TLDMS@S@
4.CDMHYHNMD CH QDFNKD D FTQD @Bquisibili nel Piano di assetto territoriale (Pat/i) e nel Piano dambito
paesaggistico in corso di realizzaYHNMD(/OQ@
5.istituzione di un osservatorio sperimentale sul paesaggio a valenza
archeologica, con aggiornamento
incrementale della mappa di comunit e del portfolio progetti, e
LNMHSNQ@FFHN CDKKDB@BH@ CDK CHRONRHSHUNFDRSHNM@KDF 
5.2 Condizioni e risorse di
contesto
Diverse sono le questioni da affrontare in proposito. La prima questione rinvia alla ricomposizione territoriale delle scelte urbanistiche di
PT@SSQN BNLTMH RH SQ@SS@ CH 0T@QSN
dAltino e Venezia, ma anche di MarBNMD1NMB@CDK@RDBNMC@ @KK@RSQTS-

tura proprietaria, perch nellarea


di progetto insistono quattro grandi
propriet che costituiscono opportunit di partnership progettuale e
gestionale.
A questi due temi si aggiunge il
futuro di tre realt contigue al sito
archeologico: laeroporto di Tessera,
la Laguna nord di Venezia e il Bosco
di Mestre. Oggetto di numerosi proFDSSH CHHONSDRHCHQHPT@KHB@YHNMDD
connessione, potrebbero contribuire a cambiare lassetto spaziale in
modo irreversibile.
Una opportunit in termini di tutela, integrazione e valorizzazione
culturale costituita dal primo Piano paesaggistico dambito (Ppra) del
Veneto, in attuazione della I Variante al Ptrc 2009, che investir lintero
arco costiero da Altino al Polesine. A
ci si aggiunga quanto previsto sulla
gronda lagunare dal Piano Morfologico della Laguna di Venezia (Pmlv
2013, in ultimazione) e dal Piano di
&DRSHNMDCDKRHSN4MDRBN5DMDYH@D
K@ RT@ K@FTM@  (K "NLTMD CH 0T@QSN
dAltino soggetto attivo sia nel Piano di Gestione che nel Pmlv per limportanza che questultimo assume in
termini morfologici (mantenimento


13

14

15

121

16

122


quarto
daltino

parco agro naturalistico

laboratorio di ricerca
visitabile su area dei
privati

vecchio
museo

nuovo
museo

torcello

17

123


124

D QHOQHRSHMN CH RTODQBH HMSDQSHC@KH 


HCQNCHM@LHBH UHUHB@YHNMD D BNMnamento delle acque), ecologici (habitat e specie), oltre che in termini di
qualit delle acque e dei sedimenti.
Unultima, ma non meno importante variabile per linterpretazione
del contesto altinate, la creazione dellArea Metropolitana veneziana. Vale la pena sottolineare che
la sua ipotizzata coincidenza con la
Provincia di Venezia non restituisce
la ricchezza degli studi iniziati allepoca del Progetto 80 sui processi di
metropolizzazione in Italia. Ma non
sembra neppure apprezzare libridazione che questi processi hanno
RSNQHB@LDMSD@UTSNBNMK@CHTRHNMD
insediativa nel Veneto, e tanto meno
la declinazione operativa del conBDSSN CH SDQYN 5DMDSN OQNONRSN C@K
Ptrc del 2009.
Secondo il terzo scenario si sviluppa un esercizio di progettazione tentativa e partecipata che ha lo
scopo di evidenziare le modalit di
risposta dellarea-studio a dinamiche e stressor 2HSQ@SS@CHTM@QQHBBGHLDMSNBTKSTQ@KDCDKK@OH@MHB@YHNMD
ordinaria.
I nuovi PAT dei comuni contigui
trattano larea di progetto come se
fosse un residuo, una componente
marginale rispetto ai territori comunali. Per Marcon, ad esempio, larea
altinate allestremo est del territorio comunale, lontano dall abitato e
dalle zone commerciali, oltre la barriera dellasse autostradale. marginale anche rispetto alle pressioni
edilizie e di investimento territoriale. Lo stesso accade per il Comune
di Roncade, in provincia di Treviso,
con il suo nucleo abitato lungo lasse
3QDUHRN 0T@QSN C KSHMN ,DRSQD D KD
aree totalmente agricole che si colKDF@MN@KK@RS@TUH@KDCDK2HKDDCDK
/@QBN1DFHNM@KD /DQ0T@QSNC KSHMN
K@PTDRSHNMDOHBNLOKDRR@DTHC@ 2DC@TMK@SN0T@QSNKNB@KHYY@ta ad ovest dellarea archeologica, il
centro abitato vi connesso con una
antica strada romana. Come evidenziato dalla charrette lassetto dellarea altinate una questione aperta
per il futuro dellarea archeologica.
Per Venezia la questione si pone
in termini diversi in quanto larea
risulta marginale rispetto allestensione del territorio comunale, ma al
tempo stesso strategica per la presenza delle infrastrutture aeropor-

tuali in fase di riordino. Per Venezia


lasse Altino-Torcello , inoltre, il
SQ@MRDSSN CH TM@ CDQHU@ RSNQHB@  TM
@BBDRRN FDNFQ@BN C@K O@RR@SN @K
OQDRDMSD  CDMSQN K@ FQ@MCD K@BTM@
zanzottiana.
Lo sviluppo del progetto della
rete ecologica locale e del riequilibrio ambientale comunale, denominata Bosco di Mestre, in attesa di
una strategia legata allassetto del
territorio veneziano di terraferma.
Nonostante la prossimit allarea
altinate, le grandi aree del Bosco di
Mestre non si pongono ancora come
DKDLDMSHRHFMHB@SHUHCDKK@QDSDCDKK@
mobilit slow e di networking agricoKNF 
5LVFKL
Lo sviluppo dellaeroporto di
Tessera pone questioni rilevanti per
il futuro dellarea archeologica di
Altino. Alcuni elementi sembrano al
LNLDMSNCDMHSH +@KHMD@RTA K@FTnare metropolitana tra laeroporto,
K@QRDM@KDDHK+HCNRHBNMFTQ@BNLD
progetto ancora troppo complesso
tecnicamente e poco supportato da
valutazioni di fattibilit tecnica ed
economica, per essere realizzabile a
costi sostenibili e con impatti ecologici ridotti.
La realizzazione di una connessione verso sud dellaerostazione
con lalta velocit sembra un progetto pi percorribile se non fosse che
i treni veloci, per essere competitivi, dovrebbero bypassare Mestre e
5DMDYH@  0TDRS@ HONSDRH QDMCDQDAAD
molto competitivo laeroporto Marco Polo espandendo il suo bacino
dallEmilia alla Lombardia, oltre che
nel Friuli come gi oggi. Tuttavia,
la componente-passeggeri che ha
come meta di partenza-arrivo laeroporto sicuramente minoritaria rispetto a quella che ha come meta il
centro storico di Venezia. La soluzione di una navetta frequente e veloce
che, transitando su Mestre, arrivi a
Venezia sembra la soluzione migliore e meno costosa del tunnel che
si dovrebbe realizzare per arrivare
allaerostazione con lalta velocit.
Rimane la questione delle infrastrutture previste nel cosiddetto
0T@CQ@MSD 3DRRDQ@ BGD HMSDQDRR@MN
una ampia zona di trasformazione, il
detrattore pi pericoloso per il futuro dell area altinate.
Il Piano paesaggistico dambito,

in corso di elaborazione presso la DiQDYHNMD /H@MHB@YHNMD 3DQQHSNQH@KD D


Strategica della Regione Veneto, pu
@QNMS@QD@RB@K@BNQQDSS@K@PTDRSHNne territoriale dellintera area facendo convergere le istanze di tutela,
integrazione e valorizzazione.
Il disegno della seconda pista
D CDK 0T@CQ@MSD RDLAQ@ TM@ CDKKD
minacce maggiori per larea archeologica di Altino, con laggravante
che questarea stata ignorata per
decenni, e continua ad essere quasi assente dalle priorit dellarmatura culturale veneta. Tra il 2002 e il
2009, con lapprovazione della variante al PRG di Venezia, denominata
0T@CQ@MSD3DRRDQ@ RHCDMHSNTM
OQNKNCHHMSDQUDMSN +@OQHL@RBDKS@ 
suggerita dalla Provincia di Venezia,
distingue le aree terziarie, del nuovo stadio comunale e del nuovo casin (tutte di competenza comunale)
dallarea adiacente allaerostazione.
0TDRS@ UDQQDAAD CDRSHM@S@ @K RTN
ampliamento e per la realizzazione
delle infrastrutture intermodali, di
competenza della Regione Veneto.
Nel 2004-2005 la Save ha acquistato
200 ettari per la realizzazione della
nuova pista verso ovest. Negli stesRH@MMHRNMNRS@SHCDMHSHDKDLDMSHCH
intermodalit, tra cui la porta dacqua aeroportuale progettata da F.
O. Gehry. I progetti di ampliamento
sembrano motivati da previsioni di
crescita del movimento-passeggeri
che tendono a trasformare laeroRS@YHNMD,@QBN/NKNMDKSDQYN@DQNporto italiano. Le ipotesi del recente
Piano Nazionale Aeroporti (20122013) confermano questo scenario.
Il Master Plan del nodo intermodale prevede che, con il completamento delle opere, nel 2030 vi
saranno 3,8 milioni di passeggeri/
anno per lalta velocit e, complessivamente, 6,6 milioni di passeggeri/anno su tram/sublagunare, linea
ferroviaria regionale Sfmr e linea
ferroviaria Av. Inoltre, si stima che
9,3 milioni di passeggeri/anno transiteranno nella nuova stazione ferroviaria e 13 milioni di passeggeri/
anno potranno utilizzare il terminal
aeroportuale. In totale, si prevede
che 19 milioni di passeggeri/anno
transitino per il nodo intermodale.
Le stime sono provvisorie e non tenFNMN BNMSN CDKKDDSSN MDSSN FDMDrato da dinamiche competitive e siMDQFHBGD CDKK@DQNONQSN "@MNU@ CH

Treviso. N , per il momento, stimaAHKDKDDSSNRTKMNCNCDKKDOQDUHRSD


variazioni di rotta delle grandi navi
in laguna17.
Si tratta di uno scenario complesso e incerto che sembra ignorare le
vocazioni delle aree circostanti il
0T@CQ@MSD CH 3DRRDQ@ K@ LNQENKNFH@
lagunare e le valli da pesca, il nucleo
urbano di Tessera, larea agricola, il
ONSDMYH@KD O@DR@FFHRSHBN  FKH DDSSH
CHTRHCDHB@LAH@LDMSHBKHL@SHBHRTH
SDQQHSNQH CH ANMHB@  KN RUHKTOON CDK
parco del Sile e della rete ecologica connessa, e non ultima, larea archeologica altinate in relazione alle
aree archeologiche lagunari e perilagunari.
Per queste ragioni si sceglie un
@OOQNBBHN DROKNQ@SHUN M@KHYY@SN @C
TM@BNMFTQ@YHNMDBNLO@SHAHKDBNM
le trasformazioni dellintera areastudio. Lidea tutelare e valorizzazione le aree escluse dal progetto
CDK 0T@CQ@MSD  C@MCN UNBD @H SDQQHSNQH@KSHM@SH FF    
5.4 Connessioni
Per lelaborazione di strategie locali sono importanti le connessioni
di Altino con Venezia e le isole della laguna nord. Altino subisce un incombente aeroporto, ma sconnesR@C@KKDHRNKDK@FTM@QH 0TDRSDRNMN
a loro volta mete terminali delle rotte che da Venezia vanno verso la laguna.
+@SST@KD RDQUHYHN KDMSN NDQSN
dalla linea Actv, che dalle Fondamenta Nuove raggiunge San Michele-Murano-Burano-Mazzorbo-Torcello, con la variante verso SantErasmo
e Cavallino, un itinerario turistico
BGD ODM@KHYY@ K@ LDS@ M@KD CH 3NQcello e le altre isole della laguna
nord. Dalla stazione di Venezia SanS@+TBH@HKSDLONCHODQBNQQDMY@MN
a Torcello di 75 minuti, lo stesso
tempo che un viaggiatore, dalla stazione impiega in treno per arrivare a
Ferrara (con un cambio) o a Verona
con la Freccia Bianca.
Se si ipotizza che Sfmr arrivi non
solo allaerostazione, ma che si possano attivare una ulteriore fermata
ad Altino e una connessione in vaporetto verso Torcello, i tempi di percorrenza dalla stazione ferroviaria di
Venezia Santa Lucia sarebbero probabilmente analoghi, ma diventerebbe una meta turistica alternativa
al polo della laguna nord di Venezia,


18

treba dodati 154 hektarjev prahe,


od katerih je 146 v podpornem reHLT   GDJS@QIDU ID M@LDMIDMHG
stalnim travnikom. Lesnate rastline
so rastejo na 48 hektarjih, od tega je
34 ha vinogradov, 14 ha sadovnjakov, veinoma hruk.
Vrtarstvo je slabo razirjeno:
eprav se z njim poklicno ukvarja
84 pravnih subjektov (po Istatu klaRHBHQ@MHGJNSONCIDSI@ RNUQSNUNL
namenjeni samo trije hektarji. Gre
Y@CQTHMRJDUQSNUDONUOQDMDUDKHkosti 357 m2 na vrt.
Za obmoje so znailne tevilne
ONCDDKRJDGHD MDJC@IONUDY@MDR
kmetijstvom, ki pa se danes le redko
uporabljajo v ta namen.
Obstojea gradnja je v precej
RK@ADL RS@MIT  @ Y LNMNRSIN ONnovne uporabe. tiri velika posestva
bi lahko predstavljala pomemben
vir za preobrazbo v kmetijsko-naravoslovni park. Z njo bi lahko izONKMHKH CU@ K@GJN YCQTKIHU@ BHKI@
venamenskost in varstvo obmoja
po naelih ekolokega kmetovanja z
neobremenjujoo pridelavo.
Globoko oranje in intenzivna
uporaba gnojil in pesticidov namre
CNC@SMN NFQN@IN @QGDNKNJD CNAQHMD  JNS ID @K Q@YUHCMN HY HYJTenj raziskav evropske federacije
mestnih in obmestnih parkov Federnatur, ustanovljene leta 1997.


Venamenskost in varstvo lahko


prispevata k poveanju turistinega
interesa za obmoje in na razline
naine obogatita turistino ponudbo: ribolov, prosti as, nastanitev.
Ozemlje altinat ima na voljo tevilne vire za kulturno ovrednotenje
svojih dobrin:
- kakovost krajine oblagunskega
NYDLKI@
AKHHM@UDKHJHGM@RDKIDMHGNALNHI 
ki bi jim lahko ponudili kakovostne
kmetijske izdelke s kratko dobavno
UDQHFN
- lokalna skupnost, ki je mono navezana na lokalno zgodovino in kulSTQN
- zgodovinska poslopja z dodatno
UQDCMNRSIN JNSIDTSQCA@%NQSD/DOD
- znatna koliina arheolokih najdb
v muzejih Altina in Torcella, in veliko
OQDCDKNU JHIHGSQDA@DQ@YHRJ@SH
- dragocena naravoslovna obmoja
in tevilni vodni tokovi, kjer se v zadnjem asu razvija dejavnost najema t.i. hi na vodi (house boats
- veliko neizkorienega stavbnega
potenciala, ki bi se lahko obnovil in
uporabil za razvoj kmetijstva.
e bi se v posodobljenem zeLKIDUHCTOQDLNDMI@iUQHR@KHSHDKDmenti in njihova vrednost (denarna
ali druga), bi postali: manj abstraktni
postopki poravnave in nadomestila
za uporabo zemljia, bolj uteme-

ljena morebitna prenos kredita in


izdaja dovoljenj za nadomestno gradnjo, pravineja izbira obdavitve
nepreminin. Okrepila bi se tudi
razlaga arheolokih zakonskih omeIHSDUM@NFQNDMHGNALNIHGHMNBDna ekonomskih strokov zaradi
njihovega neupotevanja.
Nekatere opisane raziskovalne
CDI@UMNRSH RD K@GJN YCQTHIN U OQDdlog uporabe kmetijskih povrin v
dogovoru z lastniki in kmeti, predlog
O@RDUKNHUOQNIDJSMNL@ON(sl. 16).
Najdie se danes skriva pod polji z enakomernim naklonom, ki bi
jih lahko ustrezno spremenili tako,
da bi skrito strukturo delno razkrili. Obliko in sestavne elemente te
strukture lahko vrnemo na povrje
tako, da s posebnimi postopki tal,
Y@R@CHSUHIN HM LQDN UNCMHG SNJNU
(jarki itd.) spremenimo podobo polj
v primerjavi z okolikim terenom.
Drugana sestava tal pa seveda zahteva prilagojeno upravljanje kmetijskih povrin. e bi zaradi posegov
prilo do zmanjanja donosa in skupne proizvodnje, bi se lahko z namenom krepitve muzejskih dejavnosti
OQDCUHCDKD M@MMD RONCATCD HM
ali odkodnine.
V dogovoru z Veneto Agricoltura,
v skladu s smernicami prostorskega
narta Psr in s trenutnimi strategijami za doloanje 8. okvirnega pro-

grama, ki bolj natanno valorizirajo


odnos med kmetijstvom in krajino,
se lahko doloijo spodbude za arGDNKNJN YCQTKIHUN JLDSHIRSUN  .A
predpostavki, da se kmetijska povrina z arhitekturnim potencialom
izloi iz seznama izkorianih kmetijskih povrin (Sau), uporaba sredstev iz stanovanjskega sklada kot
spodbuda ne bi bila sprejemljiva.
Odkodnina za lastnike in/ali
JLDSDRDK@GJNCNRDDSTCHRONCONro dejavnosti muzeja in s prej opisanim kulturnim aparatom. Muzejska
dejavnost in aparat predvidevata
dejavnost raziskovanja, nartovanja
in koordinacije izkopavanj, za katere so poleg pridobivanja ustreznih
koncesij s strani Zavoda za spomeniko varstvo potrebne tudi podporne storitve (prenoia, laboratoriji,
skladia in podobno). Predvidevamo, da bodo za te storitve potrebni
ustrezni objekti, katerih lokacija je
odvisna od naina predstavitve arheolokega najdia skupnosti in
raziskovalnim krogom.
S primernim pogajanjem bi bilo
mogoe dosei oceno povrin, na
katerih se bo izvajal projekt.
Kmetijski park se lahko opira na
nekatere strukturne predpostavke.
Predvsem lahko metropolitansko
obmoje Mester predstavlja odlino
zaledje za odkup kakovostnih vr-

125

126

con caposaldo ad Altino.


0TDRS@ KNFHB@ CH CHDQDMYH@YHNne degli accessi pone comunque il
OQNAKDL@ CDK SHON CH NDQS@ ODQ @Stirare parte del turismo oggi orientato al polo del capoluogo lagunare.
+NDQS@ONSQDAADBNLAHM@QDCHUDQRH
elementi naturali, come la laguna, le
valli da pesca, il sistema dei canali,
il parco del Sile unitamente ad una
NDQS@ RSNQHBN @QSHRSHB@ KDF@S@ @KKD
presenze monumentali di Torcello,
e alloriginale tessuto urbano di Burano. La connessione con lisola agricola di SantErasmo e delle Vignole
pu costituire una ulteriore risorsa.
2D KNDQS@ CH KSHMN 3NQBDKKN +@FTM@MNQCMNMRDLAQ@RTBHDMSD@
creare un mercato di fruitori, la polaQHSCDKK@QDNONQSN,@QBN/NKNNQD
TMONSDMYH@KDTRRNCHUHRHS@SNQHHMtercettabili.
Si pone cos la prima questioMDMDKK@QHCDMHYHNMDCDKK@RRDSSND
dello sviluppo aeroportuale strategico immaginare la connessione
stabile con Altino come porta della
laguna nord. Riconoscere nellarea
altinate solo un accesso verso la laFTM@ RHFMHB@  STSS@UH@  QHMTMBH@QD
alla possibilit che Altino possa inSDQBDSS@QDPTNSDCHTRRNBNMNOONQtune trasformazioni del suo assetto
territoriale e con prospettive di potenziamento del museo archeologico in chiave espositiva, di restauro
e di ricerca. Oggi il polo museale
dimensionato per utenze che non
dedicano pi di unora alla visita.
Dopo lapertura della nuova sede la
visita potrebbe protrarsi almeno per
due ore. Ma per carenza di spazi difBHKLDMSD HK LTRDN ONSQ CHUDMS@QD
un catalizzatore e attrarre visitatori
interessati allarcheologia. evidente che la scarsa attrattivit turistica
dellarea tender a marginalizzare le
potenzialit del sito e del suo contesto lagunare.
Per contrastare questa tendenza
si propongono tre tipi di azioni. Con
la prima si attivano strategie compatibili per larea rispetto allo sviluppo
CDK 0T@CQ@MSD 3DRRDQ@  +@ RDBNMC@
intende creare un parco agro-naturalistico nellarea circostante, con innesto di strutture ricettive e percorsi
ciclo-pedonali dal waterfront alle
zone pi interne. La terza prevede
la creazione di un parco archeologiBNBNMRODBHBNLNCDKKNFDRSHNM@KD
un nuovo polo pulsante della ricerca

archeologica veneta. In questa prospettiva pu essere valutata lopportunit di istituire una Fondazione sul
modello di Classe (Ravenna)18.
3DUFRDJURQDWXUDOLVWLFR
Il territorio che circonda il sito
archeologico si presenta come una
estesa area agricola caratterizzata
C@KKD MNUDBDMSDRBGD ANMHBGD BGD
hanno cancellato quasi del tutto il
rapporto dellantica area urbana con
la laguna. Attraversato da numerosi corsi dacqua e segnato da paleoalvei, il paesaggio si presenta con
ampi spazi aperti, delimitati dagli argini e dal dosso costituito dalla citt
antica. Le alberature sono rade e negli anni si sono ridotte notevolmente
RNOQ@SSTSSNODQHKS@FKHNCDHK@QHKTMgo alcune delle vie romane daccesso e dellantico reticolo interno.
Il rapporto con la laguna ulteriormente interrotto dalla statale
3QHDRSHM@ D C@KK@ L@MB@MY@ CH BNMnessioni ciclopedonali, ma anche dal
basso livello dei ponti stradali che
quasi intersecano sul piano di camO@FM@K@SS@QDSDHCQHB@ (BNQRHC@Bqua principali, racchiusi da argini, riL@MFNMNFKHTMHBHRDFMHRHFMHB@SHUH
del rapporto dellarea con le isole
della laguna.
Le coltivazioni sono prevalentemente legate alla produzione di
graminacee con campi molto ampi
e coltivazioni industrializzate. Nel
K@RTODQBHD@FQHBNK@TSHKHYY@S@
2@TMDK"NLTMDCH0T@QSNC KSHMN
Q@FFHTMFDU@HKCDKK@RTODQBHD
comunale: 19.7 Kmq su un totale
di 28.16 Kmq. Le principali colture
sono a seminativo, con 686 ettari
destinati alla produzione di piante
industriali, 679 a soia, 453 a granoturco (escluse le foraggiere), 255 a
barbabietola e 208 a frumento tenero. Circa 100 ettari sono destinati
alle foraggiere avvicendate, di cui 71
a granoturco a maturazione cerosa e
22 ad altri prati avvicendati. I terreni a riposo raggiungono i 154 ettari,
di cui 146 soggetti a regime di aiuto.
39 ettari sono a prato permanente.
Le coltivazioni legnose interessano
48 ettari, di cui 34 a vite, 14 fruttiferi
in gran parte a pero.
Limitata la produzione orticola:
nonostante vi siano 84 soggetti inSDQDRR@SHDBK@RRHB@SHBNLD@YHDMCD
C@KK(RS@S K@ RTODQBHD SNS@KD CDRSHnata ad orto di 3 ettari. Si tratta di

orti familiari con una media di 357


mq/orto.
Larea si caratterizza per una siFMHB@SHU@OQDRDMY@CHDCHBHQTQ@KHD
CHFQ@MCHDCHBHQDRHCDMYH@KHTMSDLpo legati allagricoltura e oggi utilizzati solo in parte.
Lo stock edilizio piuttosto degradato, ma con potenzialit di riuso.
La presenza di quattro grandi propriet potrebbe costituire una importante risorsa per la riconversione
in parco agro-naturalistico. Essa potrebbe consentire il raggiungimento
di due obiettivi facilmente integrabili: la multifunzionalit e la tutela del
sito secondo i principi dellagro-ecologia mediante coltivazione leggera.
Le arature profonde assieme
allutilizzo intensivo di fertilizzanti e
anticrittogamici aumentano il rischio
archeologico, come ampiamente dimostrato dalle esperienze condotte
da Federnatur, la Federazione europea dei parchi urbani e peri-urbani
nata nel 1997. Multifunzionalit e
tutela possono contribuire ad aumentare linteresse turistico per larea, valorizzando presenze e arrivi
con motivazioni diverse: pesca, diONQSHRSHB@ QHBDSSHUHSCHTR@
Le risorse che il territorio altinate
NQD ODQ K@ U@KNQHYY@YHNMD BTKSTQ@KD
del suo patrimonio sono molteplici:
- qualit paesaggistica del territorio
ODQHK@FTM@QD
- prossimit a grandi aree abitate che
potrebbero interfacciarsi positivaLDMSDBNMKNDQS@CHOQNCNSSH@FQHBNKHCHPT@KHSHMKHDQ@BNQS@
- una comunit locale molto legata
@KK@RSNQH@D@KK@BTKSTQ@KNB@KD
DCHBHRSNQHBHCHU@KNQDBNLDHK%NQSD
/DOD
RHFMHB@SHU@OQDRDMY@CHQDODQSH@Qcheologici nei musei di Altino e Torcello, e molte aree ancora da esploQ@QD
-presenza di aree naturalistiche di
pregio e di numerosi corsi dacqua
sui quali si stanno sviluppando attivit di noleggio di house boat
-presenza di uno stock edilizio sottoutilizzato che potrebbe essere
rifunzionalizzato per lo sviluppo
dellagricoltura.
2D TM@ @FFHNQM@S@ L@OO@ O@SQHmoniale riportasse queste componenti e i valori connessi (monetari e
non) diventerebbero meno astratti
gli schemi perequativi e di uso del
suolo, pi motivati eventuali trasfe-

QHLDMSH CH BQDCHSH D CHQHSSH DCHB@SNQH


EQ@ BNLO@QSH  OH DPTD KD RBDKSD CH
RB@KHS HLLNAHKH@QD  2H Q@NQYDQDAbero anche linterpretazione del vincolo archeologico in aree a rischio e
K@ U@KTS@YHNMD CDH BNRSH DBNMNLHBH
di un suo mancato rispetto.
Alcune delle azioni esplorative
descritte possono convergere in una
proposta di uso del suolo agricolo
concordata con proprietari e coltivatori e integrata al porftolio progetti
F 
Il sito oggi nascosto da una tessitura dei campi ad inclinazione uniforme che potrebbe essere opportunamente deformata per dare parziale visibilit alla struttura latente.
La forma e gli elementi costitutivi di
questa struttura possono essere reRSHSTHSHHMRTODQBHDC@TM@SDRRHSTQ@
dei campi diversa da quella contigua
BNMRODBHBGDK@UNQ@YHNMHCDKRTNKN 
piantumazione e reticolo idraulico
(scoline, ecc.). La diversa tessitura
richiede un adeguamento nella geRSHNMD CDKKD RTODQBH @FQHBNKD  2D 
ODQDDSSNCDKKHMSDQUDMSN KDQDRDD
la produzione totale diminuiscono
possono essere previsti incentivi e/o
@SSHU@SDBNLODMR@YHNMHM@KHYY@SD@K
Q@NQY@LDMSNCDKKD@SSHUHSLTRD@KH 
In sintonia con Veneto Agricoltura, con gli indirizzi del Psr e con le
RSQ@SDFHDHMBNQRNCHCDMHYHNMDODQ
K5(((/QNFQ@LL@0T@CQNBGDU@KNQHYzano in modo pi esplicito i rapporti
fra agricoltura e paesaggi, si possoMNCDMHQDHMBDMSHUHODQK@FQHBNKSTQ@
archeo-compatibile. In una ipotesi
CH DRBKTRHNMD CDKK@ RTODQBHD @FQHcola dotata di potenziale archeologico dal conteggio Sau non sarebbe
ammissibile il ricorso a crediti edilizi
come incentivo.
Le compensazioni a proprietari
e/o coltivatori possono realizzarsi
con interventi di supporto alla attivit museale e al dispositivo culturale descritto in precedenza. Lattivit
museale e il dispositivo prevedono
attivit di ricerca, programmazione
e coordinamento delle campagne di
scavo che, oltre a richiedere le dovute concessioni alla Sovrintendenza,
necessitano di servizi di supporto
(guest house, laboratori, depositi e
cos via).
Si prevede che questi servizi vengano ospitati in opportune strutture la cui localizzazione dipende dal
modo in cui si intende rappresen

tare il sito archeologico rispetto ai


racconti di comunit e alle istanze di
ricerca. Con opportuna negoziazione
si pu giungere alla stima della suODQBHD CHRONMHAHKD ODQ HK OQNFDSSN
operativo.
Il parco agricolo pu reggersi su
alcuni presupposti strutturali. In primo luogo, la prossimit con larea
metropolitana di Mestre potrebbe
essere un ottimo bacino di acquisto
di beni orticoli di qualit, garantendo
redditivit per laccorciamento della
KHDQ@  (M RDBNMCN KTNFN  K@ OQDRDMza dellaeroporto pu permettere la
nascita di attivit legate al pernotS@LDMSN AQDUD CHTRN D BNMRDMSHQD
lo sviluppo di una nicchia turistica
su un brand dambito per prodotti e
territori. Lo stesso aeroporto potrebbe diventare una opportunit se con
il suo ampliamento migliorasse laccessibilit allarea, contrariamente a
quanto prevede il master plan attuale che relega larea agricola di Altino in posizione residuale. Nellambito delle trattative per lo sviluppo
dellaeroporto e del quadrante Tessera, proponibile come possibile
compensazione una connessione
terrestre con laeroporto e una connessione dacqua con Torcello.
La riconversione delle colture
estensive in colture di qualit sembra essere molto pi complessa, non
tanto per i problemi del cuneo salino
BGDE@BHKHS@MNK@CHTRHNMDCHBNKSTQD
@KNKD L@ODQK@LNCHB@CDKKDSDBniche colturali, dei processi produttivi
e per lapporto lavorativo necessario.
4M@NDQS@SDQQHSNQH@KDCHPTDRSN
tipo richiede, inoltre, una rete di percorsi ciclopedonali di carattere naturalistico come indicato nel progetto
CHBNLTMHSF 

3

9DORULHJUDPPDWLFKH

128

La costruzione di un parco archeologico richiede la messa a punto di


TMN N OH CHRONRHSHUH CH NDQS@ BGD
ODQRDLOKHBHSBGH@LDQDLNOHUNS (K
OHUNSBNMRHCDQ@SNB@QCHMD ODQMN 
OTMSN BDMSQ@KD CH TM RHRSDL@ OT
essere riferito ad un manufatto o a
un complesso di manufatti, ad un
luogo o ad un insieme di luoghi, ad
un attrattore o ad un generatore di

RHFMHB@SH OT DRRDQD TM DKDLDMSN


puntuale o areale, ma anche un cluster di punti o un aggregato di aree
contigue.
In generale, gli elementi principali del sistema sono siti archeologici selezionati per rilevanza documentale e patrimoniale, perch
NQNMN ROTMSH CH QHBDQB@ D CH RODQHLDMS@YHNMDDODQKDQDK@YHNMHDDStive e potenziali) che attivano con il
sistema culturale pi generale. SemAQ@ STSS@UH@ OQNBTN @MC@QD NKSQD
questa concezione eminentemente
descrittiva in favore di una concezione operativa motivata dalla compreRDMY@ MDKK@QD@ CH OQNFDSSN CH QD@Kt archeologiche palesi e nascoste,
note e ignote, connettibili fra loro e
BNM@KSQDRHFMHB@SHUDETMYHNMH 
Il bene archeologico pu geneQ@QD RHFMHB@SH  LDRR@FFH D BNMMDRsioni in modo diretto o derivato: in
LNCNCHQDSSNPT@MCNCNLHM@K@RBDna e si pone con forza allattenzione
CDKEQTHSNQDHMLNCNCDQHU@SNPT@Mdo sono altre funzioni che lo fanno
emergere come opportunit. In enSQ@LADKDONRSTQDCHQDSS@DCDQHU@ta) il bene archeologico richiede di
DRRDQDQHBNMNRBHTSNBNMBTQ@ RDQUHYHDUHMBNKH +@BHSS@CHM@MY@K@BTQ@
CDHADMHBNLTMH" 22 -.nalizzata non soltanto allutilit economica. I servizi rendono il bene fruibile, mentre i vincoli dovrebbero
puntare non soltanto alla tutela, ma
alla costruzione di una grammatica
possibile.

MTLDQN  PT@KHS CDH RDQUHYH NDQSH D


spazi.
Connettendo il nuovo al vecchio
museo, un percorso intercetter alcune aree gi esplorate e alcuni elementi del paesaggio. Ma resta complessa e incerta la percezione del
sottosuolo. Si pongono cos due problemi: come permettere ai visitatori
CHE@QDTM@DRODQHDMY@OHRHFMHB@tiva rispetto alla sola visita alle sale
del museo e ad alcune aree di scavo
e come operare sul territorio archeologico in modo che laspetto funzionale ed estetico degli interventi a
terra sia compatibile con il contesto
paesaggistico.
Un nodo centrale il ruolo di
@MHL@SNQDCHO@DR@FFHBGDHKLTRDN
potrebbe assumere. Oggi il museo
pensato come luogo per addetti
ai lavori o per visitatori e non come
spazio di relazione culturale. Spazi
per attivit collaterali di animazione
culturale, di promozione della conoscenza dei luoghi, per la formazione
degli agricoltori, nellottica della creazione del parco agro-naturalistico
e dello sviluppo di una ricettivit
CHTR@  ONRRNMN DRRDQD QHB@U@SH MDgli attuali magazzini che ospitano
funzioni trasferibili al nuovo museo.
Tuttavia, questi spazi non sembrano
RTBHDMSH @MBGD BNMRHCDQ@MCN KD
sale civiche disponibili. Un possibile
contenitore potrebbe essere lidrovora antistante il museo il cui utilizzo comporterebbe comunque una
RDO@Q@YHNMDRHB@CDKKDETMYHNMH

1XRYRPXVHRFRPHSLYRW

$FFHVVR

Il sito archeologico di Altino un


luogo in trasformazione. Inizia con lo
storico museo del 1960, realizzato
su progetto dellarchitetto Ferdinando Forlati, con il contributo del Conte Marcello e della Soprintendenza
Archeologica di Venezia. costituito
C@CTDR@KDDRONRHSHUD TBHD@MFTsti spazi per il lavoro sui reperti. Lo
completano i magazzini che si integrano ad un lapidarium nel cortile
del complesso e due aree di scavo
@BBDRRHAHKH K@ ONQS@ TQAHB@ D K@ RTODQBHDHMRDKBH@SN@MSHRS@MSDHKLTseo con interessanti pavimenti in
mosaico di antiche residenze.
Il nuovo progetto, in fase di ultimazione, prevede il recupero di
CTDDCHBHQTQ@KHDSQDMTNUHBNQOHCH
E@AAQHB@ BNMFTQ@MCNTMLTRDN@Qcheologico fra i primi del Veneto per

Il progetto prevede la costruzione di un approdo nei pressi del nuovo museo. Dallapprodo si pu accedere alle aree di sosta e alle strutture museali con pavimentazioni di
materiale permeabile in terra battuta e aggreganti. A partire dal fronte
laguna del museo inizia un percorso
di raccordo collocato fra il canale e
lasse parallelo al cardo. Il percorso
restituisce il ritmo dei decumani minori sottolineato da siepi ospitate in
NQHDQD@OONFFH@SDRTKSDQQDMN
Il percorso pu essere realizzaSNHMFGH@HMNMN@CTM@AQDUDBNMnessione allarea del vecchio museo
che continuer a svolgere attivit di
supporto. Con una fascia larga circa
30 metri possibile cadenzare eventuali scavi, in una sequenza di avvicinamento al core urbano. La sequen-

za si basa su una sorta di spina ad


areole di dimensione variabile che
connette il nuovo al vecchio museo
DPTHMCH@KK@ONQS@TQAHB@D@KKDDUHdenze archeologiche contigue.
La ripavimentazione della piazza antistante il vecchio museo e di
ridotta sezione stradale creano una
importante discontinuit.
Oltre il canale, sul retro dellattuale area archeologica, si sviluppa
un asse di penetrazione parallelo
@K CDBTL@MN L@RRHLN MN @K ENQN 
+@RRDOQNRDFTDMN@KKHMSDQRDYHNMD
fra via Annia e via Claudia Augusta e
pu essere utilizzato come dispositivo di orientamento di scavi mirati al
cuore della citt romana. Larea, resa
pubblica, pu cos diventare accessibile, con porta daccesso gestita dal
proprietario e in accordo con il Museo. Si tratta di unarea importante
ODQBGHKENQNK@LHRTQ@CDKK@BHSS 
Il foro pu essere recintato da una
struttura lignea leggera su cui montare le informazioni relative ai risultati della ricerca, degli scavi e dei laboratori comunitari.
Una piantumazione lineare di alberature o di gabbie in pietrame pu
marcare la cinta muraria ed evidenziare lo zoccolo su cui stata costruita la citt.
Una convenzione con i proprietari pu rendere disponibile lattuale
stalla, localizzata in zona centrale, per
depositi, workshop, laboratori, guest
house, ma anche per ospitare uno
spaccio dei prodotti agricoli locali.
Lintera area archeologica attraversata da percorsi di interesse paeR@FFHRSHBN  CDMHSH CTQ@MSD H K@ANQ@tori-charrette, e che possono arricBGHQDHKCHRONRHSHUNCHQD@KS@TLDMtata. Il progetto pu essere utilizzato
ODQ CDMHQD DUDMST@KH OQNFQ@LLH CH
scavo con relativa zonizzazione e
BNMBDRRHNMD F  
6.4 Osservazione e monitoraggio
La Lr n. 10 del 26/5/2011 istituisce lOsservatorio regionale del paesaggio, oltre a disciplinare le competenze regionali, provinciali, comunali
e degli enti-parco in materia. Con
delibera n. 826 del 15/5/2012, la
Giunta Regionale del Veneto ha attivato cinque Osservatori Locali Sperimentali che si aggiungono a quello
FH@SSHU@SNMDKODQKD"NKKHMD
CDKK KS@ ,@QB@ BNM DMSD B@ONK@ HK
Comune di Pieve di Soligo. Si tratta


20

tnih pridelkov, katerih donosnost


je zagotovljena zaradi skrajane trMD UDQHFD  !KHHM@ KDS@KH@ K@GJN
OQDCRS@UKI@ OQHKNMNRS Y@ CDI@UMNsti krajih noitev v irem merilu
in razvoj turistine nie ponudbe
lokalnih blagovnih znamk po izdelkih in ozemeljski pripadnosti. Tudi
letalie samo bi lahko bilo priloMNRSY@Q@YUNI DAHMIDFNU@HQHSDU
za seboj potegnila tudi bolji doRSNOCNNALNI@ DR@Q@KSQDMTSMH
prostorski nart ne predvideva, saj
je kmetijska obmoja Altina porinil
na rob dogajanja. V okviru dogovorov za razvoj letalia in kvadranta
Tessera bi lahko kot obliko kompenzacije izpogajali kopensko povezavo
z letaliem in vodno povezavo s
Torcellom.
Preusmeritev iz ekstenzivnega
gojenja v kakovostne pridelke se zdi
veliko bolj zahtevna, ne toliko zaradi
problema soli v zemlji, ki spodbuja
Q@YLMNDU@MID@KNKMHGUQRS O@O@
predvsem zaradi spreminjanja pridelovalnih metod, proizvodnih proceRNUHMUDIDONSQDADONUKNJTCDK@
Tovrstna ozemeljska ponudba


mora poleg ostalega vkljuiti tudi


LQDN JNKDR@QRJHG HM ROQDG@I@KMHG
ONSHYM@Q@UNRKNUMHLNADKDIDL JNS
je to navedeno v projektu skupnosti
(sl. 17).

$

9UHGQRWHLQJUDPDWLND
Za realizacijo arheolokega parka je potrebno izdelati enega ali ve
mehanizmov ponudbe, ki jih bomo
HLDMNU@KH DMNRS@UMN OHUNS  (YQ@Y
OHUNS ONLDMH NR  SD@I  RQDCHD
MDJDF@ RHRSDL@ K@GJN RD M@M@@
na izdelek ali na sklop izdelkov, na
doloen kraj ali na skupino krajev,
na privlano silo ali na generatorja
- izdelovalca pomenov: lahko gre za
tokovni ali obmoni element, pa
STCHY@RJTODJSNJ@KHYCQTANAKHMIHGNALNHI 
Okvirno gledano so osnovni elementi sistema arheoloka najdia,
izbrana zaradi ustreznega dokumentiranega in dediinskega pomena,

R@IONMTI@INOQHKNMNRSY@Q@YHRJ@UD 
eksperimentiranje in za odnose (dejanske in potencialne), ki jih vzpostavijo s irim kulturnim sistemom.
Vseeno pa bi bilo koristno, da
stopimo korak naprej od tega nadvse opisnega pojmovanja in se raje
osredotoimo na operativni koncept, ki ga narekuje sobivanje arheolokih stvarnosti na projektnem
obmoju, oitnih in skritih, poznaMHGHMMDONYM@MHG YCQTKIHUHGHMMNsilcev drugih pomembnih funkcij.
Arheoloka dobrina lahko posredno ali neposredno ustvarja pomeMD RONQNHK@HMONUDY@UDMDONRQDdno takrat, ko dominira na sceni
in uporabnika dobesedno prisili k
ONYNQMNRSH ONRQDCMN O@  JN RD JNS
OQHKNMNRS ONJ@D DKD RJNYH CQTFD
funkcije. V obeh vlogah (posredni
in neposredni) pa arheoloka dobrina zahteva, da se jo prepoznava
skrbno, z ustreznimi storitvami in
NLDIHSU@LH  y#Q@UKI@MRSUN ONLDMH
skrb za skupne dobrine (CASSANO
2004), in sicer ne samo v smislu gospodarske koristi. Storitve zagotovijo, da lahko dobrino izkoristimo,

cilj omejitev pa ne bi smel biti samo


njena zaita, temve tudi izdelava
LNMDRKNUMHBDY@MIN
1RYLPX]HMNRWSLYRW
Arheoloko najdie v Altinu je
kraj nenehnega spreminjanja. Zael
se je s prvotnim muzejem leta 1960,
zgrajenim po nartu arhitekta Ferdinanda Forlatija s pomojo grofa
Marcella in Zavoda za arheoloko
varstvo v Benetkah. Sestavljata ga
dve razstavni dvorani, pisarne in
utesnjeni prostori za delo na eksponatih. Podobo dopolnjujejo
skladia, v katera je vkljuen lapidarium na dvoriu poslopja, ter dve
dostopni mesti izkopavanj: mestna
vrata (porta urbica) in tlakovana tla
pred muzejem z zanimivimi mozaiki
iz antinih domovanj.
Novi projekt, ki je trenutno v
zakljuni fazi, predvideva obnovo
dveh kmekih poslopij in treh novih
tovarnikih hal. Novi arheoloki muzej naj bi tako postal med vodilnimi
v Beneiji po tevilu in kakovosti
storitev in prostorov.
Na prehodu iz starega v novi

129

130

CDFKHNRRDQU@SNQH#NKNLHSHBNMDMSD
B@ONK@HK"NLTMDCH"NQSHM@C LODYYN &Q@SHBNK@SN1NL@MN/QNUHMBH@ CH /@CNU@  !NMHB@ CDK 5DMDSN
Orientale (Comune di Torre di MoRSN /H@MTQ@5DQNMDRD"NMRNQYHNCH
!NMHB@5DQNMDRD "@M@KDCH!QDMS@
(Comunit Montana del Brenta). La
natura locale degli osservatori enfatizza le peculiarit paesaggistiche,
ADM NKSQD H OQNKH C@LAHSN  (K O@SQHmonio archeologico dei territori alSHM@SHDCDHSDQQHSNQHBNMSDQLHMHNQD
unopportunit tematica ad elevato
valore sperimentale con particolare
riferimento ai seguenti temi:
a) aggiornamento e vestizione sistematica delle diverse tipologie di vincoli19 con attenzione ai contesti indiziati di rilevanza archeologica e di
RHFMHB@SHUDBNMMDRRHNMH@KBNMSDRSN
O@DR@FFHRSHBN
b) impostazione del primo piano
dambito paesaggistico (Ppra della
E@RBH@BNRSHDQ@
BLNMHSNQ@FFHNCDKKDRDLOKHB@YHNni di carattere amministrativo previste dal Codice. Con Ptrc a valenza
paesaggistica e piani dambito le
autorizzazioni paesaggistiche potranno essere esonerate dal parere vincolante delle Sovrintendenze,
alleggerendo le procedure e introCTBDMCN TM@ CHRBHOKHM@ OH@MHB@SNria che dovrebbe essere in grado di
orientare le politiche di tutela e valorizzazione paesaggistica. Lalleggerimento non d di per s alcuna
garanzia in quanto richiede, assieme
al giudizio di compatibilit, un proFDSSNO@DR@FFHRSHBNCDHKTNFGH
C BNMRHCDQ@QD HK O@DR@FFHN BNLD
prospettiva di valutazione di ogni
azione incidente sul territorio caO@BDCH@SSHU@QDFTQDSDQQHSNQH@KHN
concetti simili come criteri complessi (relazione con Vas, Vinca e speciB@ U@KTS@YHNMD CH HMBHCDMY@ @QBGDNKNFHB@
e) larcheologia pu assumere un
ruolo importante nella determinazione della valenza paesaggistica di
Pat/i cos come nei Piani paesaggistici di dettaglio20 e negli Osservatori sperimentali locali.
Come indicato in apertura, le
esperienze di Osservatorio sperimentale locale in Veneto sono agli
inizi. Si stanno mettendo a punto
progetti in ambiente montano, collinare, vallivo e di pianura secondo
un approccio che tende a riconosce-

QD C@K A@RRN K@ QHRNQR@ O@DR@FFHRSHB@RDMY@BNMPTDRSNBNMHFFDQDBNM


approcci macro-territoriali (o dambito). Lintegrazione dei piani dambito
con gli osservatori locali meriterebADTMSDRSOQNFDSST@KDHBTHDRHSHL@
si tratta di uno degli esiti possibili)
potrebbero suggerire una riorganizzazione delle competenze in sede
QDFHNM@KD D KNDQS@ CH TM L@FFHNQD
expertise nelle Commissioni locali
TMHB@SDDCHKHYH@DO@DR@FFHN (MNKtre, una valutazione comparata dei
OQNCNSSHCDFKH.RRDQU@SNQHONSQDAAD
far apprezzare lancoraggio tematico
rispetto al formato generalista. La
QDSDCDFKH.RRDQU@SNQHSDL@SHBHOT
OQNCTQQD TMN RODBHBN U@KNQD @Fgiunto. Linteresse degli osservatori
locali sta, infatti, nel riconoscimenSNLHMTSNCDKKDFTQDCHO@DR@FFHN
e nelle esperienze progettuali che
possono stimolare a livello comuniS@QHNF 
6.5 &RQFOXVLRQL
Nel corso dei millenni diversi paesaggi si sono succeduti nella
bassa pianura alluvionale e costiera
dellAlto Adriatico e la convergenza
di linguaggi analitico-interpretativi
MDBNMRDMSDKHCDMSHB@YHNMD (MMNvative tecnologie di osservazione
della terra si accompagnano a sperimentate tecniche di ricerca biblioFQ@B@ RTK MNSN  @ RNOQ@KKTNFGH D
schedature dei siti e dei caratteri del
paesaggio agrario antico. Insieme,
questi approcci consentono unanalisi diacronica a scala vasta con detezione e studio di importanti tracce:
insediamenti e percorsi viari sepolti,
partizioni agrarie o boschive relitte,
O@KDN@KUDH TUH@KH D B@M@KH K@FTM@QH
abbandonati, dossi alluvionali e cordoni litoranei, dune fossili.
2T RODBHBGD @QDD B@LOHNMD KD
TMHSCHQHBDQB@G@MMNDDSST@SNQHKDvamenti di tipo geologico e geomorfologico, con carotaggi geognostici e
CHRDYHNMHRSQ@SHFQ@BGD @M@KHRHO@KDobotaniche e datazioni radiometriche. Le attivit di campagna si sono
associate a survey secondo un metodo estensivo in grado di coprire
porzioni di territorio relativamente
estese.
Lanalisi integrata dei diversi elementi ha permesso di suddividere
larea di studio in Unit di PaesagFHN MSHBN4/  0TDRSDTMHSQHBNnoscono ambiti territoriali formatisi

HM RODBHBGD MDRSQD BQNMNKNFHBGD


(ad esempio, durante l et del Ferro,
nel periodo di Roma repubblicana o
imperiale, nell alto medioevo) per
DDSSN CH OQNBDRRH FDNLNQENKNFHBH
CH M@STQ@ TUH@KD  K@FTM@QD N L@rina e in particolari contesti paleoambientali. I pi importanti sono la
pianura alluvionale, larea costieroKHSNQ@MD@  KD O@KTCH NQ@ ANMHB@SD 
alcuni geositi.
Integrando conoscenze e tecnologie proprie della geomorfologia e
dellarcheologia si sono sviluppati
modelli di valutazione preventiva
della risorsa archeologica, non nota
o parzialmente nota, sia nelle singole UPA sia nelle aree-campione selezionate per approfondimento.
In una di queste, lAltinate, stato attivato un originale percorso di
OH@MHB@YHNMD BTKSTQ@KD M@KHYY@SN
@KK@OQNCTYHNMDCHO@DR@FFHNBNLD
integrazione fra valori ambientali e
archeologici e al suo riconoscimento
come risorsa civica e culturale.
Il potenziale archeologico di
questi territori (in gran parte invisibile e non completamente interpreS@SN @OO@QSHDMD @C TM SQ@MRDSSN CH
deriva fra gronda e laguna che ha
ispirato una grande variet di itinerari e racconti. Con essi si cercato
di riposizionare larcheologia preventiva dalla mera stima del rischio
alla sua interpretazione contestuale,
riconoscendo valenza empirica ad
TM@ LHMTS@  L@ @FFTDQQHS@  BNLTMHS CH OQNFDSSN  0TDRS@ BNLTMHS 
volontaria e provvisoria, ha prodotto
un portfolio progetti che, oltre a proONQQDO@DR@FFHCDKK@QBGDNKNFH@ODQcepita come nuova consapevolezza
sociale, ha intercettato le locali pratiche urbanistiche e di governo del
territorio.
1HRONMCDMCN@CTM@HRS@MY@OQDventiva allargata, si formulata una
ipotesi di parco integrato (agro-naturalistico e archeologico). Il parco attiva un modello di gestione con pivot sulla ricerca archeologica e sulle
attivit di un possibile Osservatorio
sperimentale.
Pi in generale, e con riferimento allintera area di progetto, si sono
formulate ipotesi di sviluppo delle
risorse archeologiche in chiave di
valorizzazione sostenibile dal punto di vista economico e manageriale.
2H RNMN HCDMSHB@SD BNLD OQHMBHO@KH
risorse gli strumenti di management

e i prodotti culturali di tredici realt


museali: nove prettamente archeologiche e quattro composite, dove
i reperti archeologici si accostano
a collezioni darte o naturalistiche.
Complessivamente, si tratta di musei
pubblici di medio-piccole dimensioMH  HM FQ@M O@QSD CH MTNU@ FDMDQ@zione, siti in centri intermedi (Rovigo, Chioggia, Portogruaro) o in zone
rurali periferiche, alcune delle quali
collegate direttamente alle aree archeologiche di scavo.
La ricerca produce tre risultati salienti con evidenti implicazioni operative.
(MOQHLNKTNFNQ@NQY@HKCHRBNQRN
archeologico ancorandolo ad analisi
geo-morfologiche di lungo periodo
D @ RODBHBH O@DR@FFH  (M RDBNMCN
luogo, riconosce alla risorsa archeologica un ruolo attivo nella ricomposizione dei valori territoriali e nella
BNMFTQ@YHNMD CH LNCDKKH CH FDRSHNMDDOH@MHB@YHNMDHMSDFQ@S@ (MMD 
HMCHB@KDBNLTMHSCHOQNFDSSNBNLD
RNFFDSSN@SSHUN@HMHCDKQHBNMNRBHmento sociale del patrimonio archeologico, oltre le angustie della tutela
silenziosa e autoreferenziale.
+D MDRSQD BQNMNKNFHBGD @ODQSD C@KKD 4/  NQNMN TM@ NQHFHM@KD
opportunit di rappresentare i pi
RHFMHB@SHUH BHBKH SDQQHSNQH@KH CH KTMFN
periodo che hanno interessato la costa adriatica veneta e il suo immediate entroterra. Il riconoscimento
RO@YH@KDCHPTDRSHBHBKHPT@KHB@K@Qmatura storico-culturale e aiuta ad
HCDMSHB@QDBQHSDQHCHQHBNLONRHYHNMD
paesaggistica.
Negli ambiti paesaggistici riconosciuti dalla prima Variante al Piano Territoriale Regionale di CoordiM@LDMSN  RNMN RS@SH CDMHSH
obiettivi di qualit la cui plausibilit
e sinergia possono essere valutate
con riferimento alla risorsa archeologica. Ad essa verrebbe cos attribuito un inedito valore sistemico di
rilevanza spazio-temporale.
+D MDRSQD BQNMNKNFHBGD BNMSQHATHRBNMN@CDMHQD@MBGDTMPT@CQN
di riferimento utile per la realizzazioMDCHHMC@FHMHB@LOHNM@QHDRSQ@SHB@SD
nella forma di test sulla validit concettuale e operative delle UPA. Maggiore la loro validit semantica e pi
agevole diventa il riconoscimento di
FTQD O@DR@FFHRSHBGD N CH SDQQHSNQHN 
ma anche la costruzione di ipotesi di
ricomposizione paesaggistica.

muzej bodo lahko obiskovalci


NATCNU@KH MDJ@SDQ@ D Q@YHRJ@M@
podroja in nekatere krajinske elemente. Toda e vedno ostaja odprto kompleksno vpraanje dojemanja prostorov pod povrjem. Pri
tem se porajata dve vpraanji: kako
omogoiti obiskovalcem izkunjo, ki
bi se jih dotaknila bolj kot e bi se
samo sprehodili skozi razstavne prostore in po nekaterih mestih izkopavanj, in e, kako posei v arheoloki
prostor tako, da bi bil funkcionalni
in estetski vidik zemeljskih del zdruKIHURJNMSDJRSNLJQ@IHMD
.RQDCMI@ FTQ@ ID S H  yJQ@IHMRJH
animator, ki bi ga lahko zaposlil
muzej. Sedanji muzej je zamiljen
kot struktura za zaposlene ali za obiskovalce, ne pa kot prostor za kulturno izmenjavo. V perspektivi predlaganega kmetijsko-naravoslovnega
parka in razvoja turistinih kapacitet
po vsem ozemlju bi lahko prostore
za dodatne dejavnosti, kot so kulturna animacija, promocija poznavaMI@ JQ@IDU  HYNAQ@DU@MID JLDSHIRJHG
pridelovalcev, pridobili s prenovo
sedanjih skladi, iz katerih se bodo
dejavnosti, ki se zdaj v njih izvajajo,
preselile v novo muzejsko poslopje.
Vendar pa tudi ti prostori, vkljuno z
obstojeimi razstavnimi dvoranami,
M@IAQMDANCNY@CNRSNU@KH ,NQDAHtno reitev predstavlja stara vodna
rpalka pred muzejom, ki pa bi v
primeru spremembe namembnosti
YHMNNRS@K@KNDM@NCLTYDIRJDF@
poslopja.
'RVWRS
Projekt predvideva gradnjo
OQHRS@I@KH@UAKHHMHMNUDF@LTYDja. Z njega bi do poivali in muzejskih poslopij vodila pot iz poroznih
tlakovcev in preparirane zbite zemlje. Na obali lagune pred muzejem
RDY@MDJQNM@ONS JHUNCHLDCJ@nalom in osjo, vzporedno s cardom
maximusom. Pot se nadaljuje po
manjih dekumanih, poudarjenih z
HUNLDINUJNQHSHG
Pot se lahko izdela tudi v prodnikih do dvoria pred starim muzejem, v katerem se bodo odvijale
CNC@SMD CDI@UMNRSH  5 OQHAKHMN 
metrov irokem pasu je mogoe
opraviti morebitne izkope, ki si sledijo do mestnega jedra. Zaporedje
je izdelano v obliki nekakne osi z
areolami razline velikosti, ki povezuje novi muzej s starim in vodi do


LDRSMHGUQ@SHMCNAKHMIHG@QGDNKNkih najdb. Pot prekineta dvorie


pred starim muzejem, ki ga je potrebno ponovno tlakovati, in ozka
dostopna cesta.
Onstran kanala, za sedanjim arheolokim najdiem, vodi do foruma pot, ki tee vzporedno s decumanom maximusom. Za njim se
M@C@KITIDCNJQHH@LDCUHN MMHN
in vio Claudio Augusto. V tem odseku jo lahko uporabimo kot usmerjevalni kanal proti izkopom v srediu
rimskega mesta. S tem se omogoi
dostop do tega predela, ki naj bi postal javnega znaaja. Vstop do njega bi upravljal lastnik v dogovoru z
muzejem. Gre za pomemben kraj, saj
forum predstavlja velikost mesta.
Forum bi lahko obdali z lahko leseno
ograjo, na katero bi pritrdili table z
informacijami o rezultatih raziskovanja, o izkopavanju in o restavratorskih laboratorijih skupnosti.
Ravni nasad dreves ali kletke s
kamenjem lahko oznaujejo mestno
NAYHCIDHMUYMNID M@J@SDQDLRDID
zgradilo rimsko mesto.
V dogovoru z lastniki bi lahko
uporabili tudi sedanji hlev, ki se
nahaja v osrednjem obmoju. V
njem bi bilo skladie, organizirali bi lahko delavnice, laboratorije,
prenoia, ali pa tudi prodajalno
lokalnih kmetijskih izdelkov.
Celotno arheoloko obmoje je
prepredeno s tematskimi potmi s
krajinskim pomenom, doloenimi
v fazi delavnic-charrette, ki lahko
obiskovalce obogatijo z izkunjo
poveane resninosti. Projekt
se lahko uporabi za opredelitev
morebitnih nartov izkopavanj s
pripadajoo doloitvijo lokacije in
pridobivanjem dovoljenj (sl. 18, 19).
6.4 Opazovanje in spremljanje
#DDKMHY@JNMS YCMD
 ONKDF TQDI@MI@ CDDKMHG  ONkrajinskih, obinskih in ustanovnih
pristojnosti na podroju parkov
NOQDCDKITID STCH #DDKMH JQ@IHMRJH
observatorij. S sklepom t. 826 z dne
ID#DDKMHRUDS!DMDHID
usposobil pet lokalnih eksperimenS@KHG NARDQU@SNQHIDU  JH RD OQHCQTTjejo od leta 2011 delujoemu obRDQU@SNQHITColline dellAlta Marca v
pristojnosti obine Pieve di Soligo.
&QDY@NARDQU@SNQHID#NKNLHSHUOQHstojnosti obine Cortina dAmpezzo,
Graticolato Romano (pokrajina

/@CNU@  %RQLFD GHO 9HQHWR 2ULHQtale NAHM@ 3NQQD CH ,NRSN  Pianura Veronese (konzorcij %RQLFD
Veronese), Canale di Brenta (gorska
skupnost Brente). Lokalni znaaj
observatorijev poudarja krajinske
posebnosti dale ez standardne
OQNKD M@ SDL ONCQNIT  QGDNKNka dediina altinat in sosednjih
NALNHIMTCHSDL@SRJNOQHKNMNRSY
visoko eksperimentalno vrednostjo.
Poseben poudarek je na naslednjih
temah:
a) posodabljanje in sistematino
doloanje razlinih tipologij omejitev19 s poudarkom na obmojih, ki
so prepoznana kot obmoja z arheolokim pomenom, ter na povezave
RJQ@IHMRJHLJNMSDJRSNL
b) priprava prvega narta krajinske arhitekture (Ppra za obalno
NALNID
c) spremljanje z zakonom predvidenih upravnih poenostavitev. Na podK@FH Y@JNM@ N SDQHSNQH@KMDL CDDKnega koordinacijskega prostorskega
narta Ptrc, ki ureja tudi krajinski
vidik in nartov na tem podroju, bo
iz postopka pridobivanja krajinskega dovoljenja izvzeto obvezujoe
mnenje zavoda za arheoloko varRSUN SN AN URDJ@JNQ ONDMNRS@UHKN
upravne postopke in uvedlo disciplino nartovanja, ki naj bi usmerjala politike varstva in valorizacije
vrednotenja krajine. Ta olajava pa
sama po sebi e ne pomeni zagotovila za izvedljivost, saj je skupaj
Y NBDMN YCQTKIHUNRSH ONSQDAMN OQDCKNHSHSTCHJQ@IHMRJHOQNIDJS
CTONSDU@SHyJQ@IHMNiJNSLNMNRS
ocenjevanja slehernega posega na
NYDLKIT JHK@GJNROQNHONI@UyNYDLDKIRJHGFTQi@KHONCNAMHGONILNU 
kot kompleksen kriterij (poroilo za
pravilnike Vas, Vinca in posebna
NBDM@@QGDNKNJDF@UOKHU@
e) arheologija lahko zavzame pomembno vlogo pri doloanju vrednosti krajine za obinske urbanistine
narte (Pat/e), za podrobne krajinske
narte20 in za lokalne eksperimentalne observatorije.
*NS RLN ONUDC@KH D TUNCNL@ 
so izkunje lokalnega eksperimentalnega observatorija v Beneiji ele
na samem zaetku. Pripravljajo se
projekti za gorski, grievnati, dolinRJHHMMHHMRJHRUDS URDROQHRSNONL 
JHJQ@IHMRJDUHQDOQDONYM@U@yHY@bje perspektive, ne da bi pri tem
OQHG@I@KUJNMHJSYL@JQN NYDLDKI-

skimi pristopi ali pristopi na ravni


OQNIDJSMDF@ NALNI@  9CQTHSDU
projektnega obmoja z lokalnimi
NARDQU@SNQHIH AH Y@RKTHK@ yONRJTR
projekta, katerega izidi (nekateri od
LNMHGHYHCNUAHK@GJNONL@F@KHOQH
QDNQF@MHY@BHIH CDDKMHG OQHRSNIMNRSH
in pri zagotavljanju bolj strokovne
ponudbe poenotenih lokalnih komisij (zazidalna in prostorska ureditev).
Poleg tega bi lahko primerjalna
ocena izdelkov observatorijev
pomagala pri uveljavljanju tematskega pristopa v primerjavi z njegovo bolj splono obliko. Posebnost tematskih observatorijev je
namre v njihovem prepoznavanju
ONCQNAMNRSH yJQ@IHMRJHG FTQi HM U
projektnih izkunjah, ki lahko spodbudijo celotno skupnost (sl. 20).
=DNOMXNL
5SDJTSHRNKDSIHGRNRHM@ONOK@UMH MHHMH HM U NA@KMDL O@RT 2DUDQnega Jadrana druga za drugo sledile
Q@YKHMD ONJQ@IHMD  JH IHG OQDONYM@LNRJNYHOQDOKDS@M@KHSHMDF@HMQ@Ylagalnega pristopa. Inovativnim tehnologijam opazovanja zemeljskega
ONUQI@ RD OQHCQTTIDIN D OQDHYJTene tehnike iskanja dejstev iz literature poznanega, pregledi na terenu in popisovanje krajev in podob
@MSHMDONKIDCDKRJDONJQ@IHMD 5RHSH
OQHRSNOH NLNFN@IN CH@GQNMN @M@KHzo v velikem merilu, z zbiranjem in
raziskovanjem pomembnih sledi:
pod povrjem skrita mesta in ceste,
ostanki starodavnih polj in gozdov,
NOTDMD QDMD RSQTFD HM J@M@KH U
laguni, izgonski grebeni in priobalni
kordoni, fosilizirane dune.
Raziskovalne ekipe so na doKNDMHG UYNQMHG OQDCDKHG NOQ@UHKD
geoloke in geomorfoloke izmere,
FDNFMNRSHMD UQSHMD HM RSQ@SHFQ@ERJD
OQDQDYD  O@KDNANS@MHMN @M@KHYN HM
Q@CHNLDSQHM@C@SHQ@MI@ #DKTM@SDrenu smo dodali tudijo po ekstenzivni metodi, ki je pokrila relativno
NARDMDRDFLDMSDM@NALNIT
(MSDFQHQ@M@ @M@KHY@ Q@YKHMHG DKDLDMSNU ID NLNFNHK@ CDKHSDU OQNIDJSMDF@NALNI@M@$MNSD@MSHMD
pokrajine (EUP). Te enote sovpadajo
Y Q@YKHMHLH NJNKIH  JH RN M@RS@I@K@ U
CNKNDMHG YFNCNUHMRJHG NACNAIHG
M@ OQHLDQ U DKDYMH CNAH  U NACNbju rimske republike ali cesarstva, v
zgodnjem srednjem veku) kot posleCHB@ FDNLNQENKNJHG OQNBDRNU QDne, lagunske ali morske narave, ter

131

Un risultato con implicazioni


operative immediate il riscatto del
BNRHCCDSSNONSDMYH@KD@QBGDNKNFHBN
nella forma di conoscenza collettiva
e di capacit deliberativa.
Lesperienza altinate, pur limitata
nel tempo e negli interlocutori, eviCDMYH@K@ONRRHAHKHSCHLNCHB@QDKD
regole del gioco arricchendo lagenda urbana e rendendo pi sensibili
le politiche territoriali ai contenuti
sociali e ambientali del patrimonio
archeologico. Levidenza di questi
BNMSDMTSHCHK@S@HKRHFMHB@SNCHO@SQHmonio e lo legittima nei pi generali
processi di governo.

Note

132

1
Vedi NINFO, FONTANA, MOZZI, FER1 1$2$ O ,.99(et al. 2011,
pp. 199-204.
2
Le ricostruzioni da telerilevamento,
oltre a confermare precedenti ipotesi
(SCARFI, TOMBOLANI 1985) consentono
di riconoscere quattro settori urbani: il
primo, a nord dellantico canale disposto
in direzione est-ovest, comprendente
H KTNFGH OTAAKHBH OH RHFMHB@SHUH BNLD
K@MSD@SQN K@A@RHKHB@ HKSD@SQNDKNCDNM 
HKENQNDHPT@QSHDQHQDRHCDMYH@KHHKRDBNMdo, a sud del canale, prevalentemente
QDRHCDMYH@KD HK SDQYN NKSQD HK UDBBGHN B@nale che portava il Siloncello nel canale
CH 2@MS@ ,@QH@ HK PT@QSN OQNA@AHKLDMte caratterizzato da strutture portuali.
Lo sviluppo della citt avvenuto per
DRO@MRHNMD UDQRN RTC DRS D QHPT@KHB@zione/ricostruzione dellesistente anche
in ragione delladattamento del tessuto al tracciato della via Annia nei primi
due settori. Ci sarebbe confermato
dalla compresenza di due principali sistemi a maglia ortogonale con direzioni
26/116 E e 38/128 E. Il primo sistema caratterizza il tessuto del quarto e
del terzo settore oltre allorientamento
CDKK@MSD@SQN D CDK ENQN MDK OQHLN RDSSNQD HK RDBNMCN RHRSDL@ @ L@FKH@ B@Q@Sterizza il primo e il secondo settore per
ancoraggio al tracciato urbano della via
Annia, vedi MOZZI et alii 2011, p. 203.
3
 +@O@QYH@KDDB@BH@CDKUHMBNKN@Qcheologico per la gestione del territorio
evidente nel Prg in vigore nel Comune
CH0T@QSNC KSHMN (OQNAKDLHQHFT@QC@MN
non solo i contenuti del vincolo, ma anche la sua delimitazione territoriale e le
modalit di gestione, come discusso nei
lavori preliminari al Pat.
4
Lapplicazione utilizzata per la gestione della base-dati phpMyAdmin,
mentre lo script per linterfaccia tra il
server Layar ed il database composto
in linguaggio Php. Il controllo e la gestioMDCDKRHRSDL@@C@SN@K2HSN6DA (K
sito garantisce funzionalit basilari per
il progetto. Inserito nel portale www.
itinerariinitalia.com, la sezione della

citt di Altino consente di accedere a


diverse funzionalit. Le pi importanti
sono la registrazione, laccesso alla community, la visualizzazione degli itinerari
e linterazione con essi, la visualizzazione dellelenco dei POI e della mappa.
Dopo essersi connesso con apposita
login, lutente registrato pu aggiungere, per mezzo della mappa, altri punti di
interesse ad integrazione dei punti gi
HMC@S@A@RD (OTMSHOQNONRSHC@KKTSDMSD
sono gestiti dallamministratore che pu
eliminarli, nasconderli, conservarli per
utilizzi successivi, oppure procedere all
integrazione del database.
5
La lettura personale e intima del
processo di conoscenza che sempre
accompagna la pratica di camminare
stata ben espressa in SOLNIT 2002. Vedi
anche SPADOLINI 2007 e PULITO 2007.
Per alcune esperienze italiane vedi CARERI 2006.
6
Sul concetto di deriva di ispiraYHNMD KDSSDQ@QH@ DN ORHBNFDNFQ@B@ 
interessante la recente esperienza fatta
@KKHMSDQMN CH TM VNQJRGNO CH OH@MHB@YHNMD SDQQHSNQH@KD MDK PT@KD RH  CDMHS@
questa pratica come modo di conoscere
il territorio: La deriva, in ambito disciplinare una critica alla forma razionalcomprensiva di analisi del territorio (
!$13(  &( "./$++(   O    0TDRSN
atteggiamento va considerato utile solo
se integra e arricchisce i normali sistemi
di esplorazione e conoscenza dei territori. Non sono rari i casi in cui la deriva
FDMDQ@ HMCHDQDMY@ @K BNMSDRSN  B@ricando il passo della ricerca o dello
svuotamento del s.
7
 +D B@QSD SDL@SHBGD CDK ONSDMYH@KD
archeologico altinate, assieme allarmatura ambientale e ai valori paesaggistici
MNQ@ QHBNMNRBHTSH BNMM@MN HK ONSDMYH@KD DCHB@SNQHN @H CHMSNQMH CDK MTBKDN
OQHMBHO@KDCH0T@QSNC KSHMN
8
 $RHRSNMN HM OQNONRHSN CHUDQRD CDMHYHNMH  /DQ FTQ@ SDQQHSNQH@KD HK /H@MN
paesaggistico territoriale regionale (Pptr)
della Regione Puglia intende una entit territoriale riconoscibile per caratteri
morfotipologici peculiari e persistenti
MDKOQNBDRRNRSNQHBNCHRSQ@SHB@YHNMDCDH
cicli di territorializzazione. La rappresenS@YHNMDB@QSNFQ@B@CHPTDRSHB@Q@SSDQHMD
interpreta sinteticamente lidentit ambientale, territoriale e paesaggistica. Di
NFMH FTQ@ SDQQHSNQH@KD O@DRHRSHB@ HMCHUHduata vengono descritti e rappresentati
i caratteri identitari costituenti (struttura
e funzionamento nella lunga durata, invarianti strutturali che rappresentano il
patrimonio ambientale, rurale, insediativo, infrastrutturale), mentre il paesaggio
CDKK@ FTQ@ SDQQHSNQH@KD O@DRHRSHB@ UHDMD
descritto e rappresentato come sintesi
degli elementi patrimoniali. Lutilit delK@ FTQ@ BNR HMSDR@  KNB@KD HM PT@MSN
richiede una complessa sintesi spaziotemporale del rapporto fra morfologie
D SHOH  LDCH@SN C@ BNMBDSSH CH LDLNQH@
profonda.
9
La visibilit di trame e tessuti paesaggistici pu essere resa con benchL@QJ @QQDCH HMSDQUDMSHCHK@MC@QSREQTS-

tando dossi e argini, ma anche elevazioni


come la torre dellacquedotto (gi candidata a diventare osservatorio ecologico)
N HK B@LO@MHKD CH 0T@QSN OQNFDSS@SN C@
Angelo Scattolin. Segni di fossati, canali,
banchine portuali, cortine edilizie, teorie
funerarie, ville possono far riemergere
paesaggi sepolti.
10
Il periodo di riferimento potrebbe
essere 2011/13-2031/33.
11
Il Ptcp di Venezia non fornisce speBHB@MNQL@SHU@HML@SDQH@CHSTSDK@CDH
beni archeologici, mentre il Palav allart.
34 delle Norme riconosce in Altino ambiti per listituzione delle riserve archeologiche di interesse regionale.
12
 (K SDQLHMD U@KNQHYY@YHNMD  PTH
inteso nellaccezione propria del Codice
e, prioritariamente, in prospettiva culturale.
13
Molteplici sono le porte daccesso
al sito: i territori della regione di appartenenza, laeroporto, il cluster di Torcello
e pi in generale la laguna di Venezia, le
fasce litoranee balneari. Diverse sono
anche le possibilit di movimento nel
sito, come indicato negli spunti progettuali Parsjad e in alcuni progetti gi realizzati o in corso. Una opzione interesR@MSDM@UHF@QDRTHOQ@SH @KKHUDKKNCDKKD
praterie palustri. Gli stressor maggiori
provengono da infrastrutture e cluster
BNMMDRRH@K"NQQHCNHN5 C@KMNCN@DQNportuale, dalle zone contigue agli svincoli autostradali e dalla conurbazione
litoranea.
14
Nella formazione di cluster spaziali
CHADMHHKbasket pu essere pi o meno
specialistico, ma ci che conta il senso
evolutivo e culturale che ad esso riconosce la contemporaneit. I problemi di
BK@RRHB@YHNMDMDKK@@QBGHSDSSTQ@CDH2HSN
CDH#ALRRNMN@QNMS@SHHMLNCNCHUDQso. Nel piano paesaggistico della Puglia
HK#ALRK@UNQ@ODQTMHSSNONFQ@B@ RHSN 
BNMSDRSN SNONFQ@BN RSQ@SHB@SN QHEDQHSN
a periodi storici diversi. Lunit minima
BGDBNMBNQQD@CDMHQDTMRHSNK4MHS
SNONFQ@B@4SBGDQHRODSSN@KRHSNOT
essere un immobile, una tomba, un partiBNK@QDQDODQSN +@BK@RRHB@YHNMDS@MSN
OHDB@BDPT@MSNLDMNK@CDRBQHYHNMD
del bene culturale richiede la distinzioMD HMHYH@KD EQ@ ADMD @QBGDNKNFHBN  @QBGHSDSSNMHBN @QSHRSHBNDBNRUH@ 0TDRSD
connotazioni sono derivate con apposite
semantiche che valorizzano anche il linguaggio ordinario.
15
Uno di questi la centuriazione
romana.
16
In questo disegno rientrano il Parco Archeologico di Jesolo e lo stesso
Museo di Torcello, oltre al ricco tessuto
veneziano.
17
Delle tre ipotesi in discussione
(Marittima - Canale Contorta SantAngelo, Fusina, Lido) la pi interessante per
Altino la terza. Va comunque rilevato
che, in generale, le previsioni si basano
su progetti preliminari, come quello per
la sub-lagunare che la Commissione di
Salvaguardia non ha approvato per carenza valutativa. A questo progetto si af-

@MB@MNKDHONSDRHCHSQ@BBH@SNCDKSTMMDK
ferroviario per larrivo dellalta velocit
in aeroporto, anche se sembra una questione superata per lalto costo dellopera che prevede 5 km di galleria e per lo
spostamento della meta dellalta velocit dalla citt lagunare allaeroporto. Non
chiaro il sostegno economico che la
2@UD  OQHMBHO@KD ADMDBH@QHN CH PTDRSN
intervento, intender mettere in gioco.
prevista anche la realizzazione del people mover che collegher la darsena con
laerostazione e il sistema dei parcheggi
dinterscambio per permettere spostamenti a piedi dei viaggiatori in un raggio
non superiore a 300 metri. Lo studio di
fattibilit per il nodo intermodale dellaDQNONQSN ,@QBN /NKN CH 5DMDYH@  BN
M@MYH@SN C@KK@ "NLLHRRHNMD DTQNOD@
nellambito del Programma TEN T, per lo
sviluppo degli studi sul Corridoio V, oggi
ridenominato Corridoio Mediterraneo.
18
La Fondazione uno strumento
gi sperimentato in contesti analoghi
secondo le norme che prevedono la costituzione di Associazioni e/o Fondazioni
miste pubblico-privato per la conoscenza, tutela e valorizzazione dei beni culturali. Sul modello della Fondazione Parco
Archeologico di Classe, denominata RavennAntica, o della Fondazione Aquileia,
istituto di valorizzazione ai sensi dellart.
15 del D.Lgs 42/2004, si propone listituzione della Fondazione Parco Archeologico di Altino-Torcello. Potenziali
soci fondatori della Fondazione potrebADQNDRRDQD"NLTMDCH0T@QSNC KSHMN
e Comune di Venezia, Amministrazione Provinciale di Venezia e di Treviso,
Sovrintendenze, Universit degli Studi
di Venezia, Iuav Universit di Venezia,
Universit di Padova, Venice International University (Viu), Universit straniere,
Patriarcato di Venezia, Fondazione Cassa
di Risparmio di Venezia, SAVE, proprietari immobiliari privati , H Farm (C Tron) e
altri. La Fondazione pu acquisire il riconoscimento di personalit giuridica con
atto pubblico ai sensi dellart. 1, comma
1 del DPR 10.02.2000 n. 361. Fra gli scopi statutari si potrebbe prevedere listituzione di un Centro di coordinamento
della ricerca archeologica presso il nuoUN ,TRDN CH KSHMN NROHS@SN HM DCHBH
recuperati) sulla base di un progetto elaANQ@SNC@@OONRHSN"NLHS@SN2BHDMSHBN 
La Fondazione potrebbe cos contribuire
alla formazione del Parco Archeologico
che, assieme al Parco agro-naturalistico,
garantirebbe unadeguata conservazione e fruizione pubblica dei beni culturali
conferiti e/o dati in concessione o in uso
sulla base di convenzione fra soggetti
pubblici e privati. Su queste premesse,
la Fondazione pu migliorare la fruizione
pubblica dei beni culturali, garantendone nel contempo ladeguata conservazione. Favorisce, inoltre, la integrazione
delle attivit di gestione e valorizzazione
dei beni culturali con quelle riguardanti
eventuali beni conferiti dai partecipanti,
incrementando nel territorio i servizi offerti al pubblico, migliorandone la qualit e realizzando economie di gestione.
1D@KHYY@  HMMD  ENQLD CH U@KNQHYY@YHNMD

v posebnih paleo-okoljskih kontekstih. Najpomembneji so poplavna


MHHM@  NA@KMH HM OQHNA@KMH O@R  YC@I
HYRTDMD K@FTMD  MDJ@SDQ@ RODBHM@FDNKNJ@ONCQNI@geosites).
Na osnovi znanj in tehnologije
M@ ONCQNIT FDNLNQENKNFHID HM @Qheologije smo razvili modele za preventivno oceno arheolokih virov,
neznanih ali delno znanih, v posaLDYMHG$ /HMM@UYNQMHGRDFLDMtih, ki smo jih izbrali za podrobnejo
obravnavo.
Enemu od njih altinate smo
Y@QS@KHDMJQ@SMNONSJTKSTQMDF@M@QSNU@MI@  M@LDMIDMDF@ yOQNHYUNdnji krajine kot spleta okoljskih in
arheolokih vrednosti ter uveljavitvi
njegovega pomena kot vir skupnosti
in arheoloki vir.
Arheoloki potencial teh ozemelj
(v veliki meri neviden ali e ne interpretiran v celoti) pripada transektu
na prehodu med grondo in laguno,
ki je navdihnil raznovrstne poti in
OQHONUDCH  9 MIHGNUN ONLNIN RLN
poskusili preventivno arheologijo
OQDMDRSHNCHYJKITMDNBDMDSUDF@MI@
v razlago konteksta in priznati majhni, a bojeviti projektni skupnosti
DLOHQHMH ONLDM  3@ OQNRSNUNKIM@
HMOQHKNMNRSM@RJTOMNRSIDHYCDK@K@
projektno mapo, ki poleg predloga,
da je potrebno arheoloko krajino
yCNIDSHiJNSMNUNCQTADMNYM@MID 
vsebuje tudi podatke o lokalnih urA@MHRSHMHGHMTOQ@UMHG@JSHG 
V odgovor na potrebo po razirjeni preventivi smo oblikovali predlog integriranega kmetijsko-natuQ@KHRSHMDF@HM@QGDNKNJDF@O@QJ@ 5
parku se uporabi model upravljanja
s pivotom na arheolokih raziskavah
in na dejavnostih morebitnega eksperimentalnega observatorija.
HQDFKDC@MNHMM@M@@INRDM@
BDKNSMNOQNIDSMNNALNIDRLNHYCDlali razvojne zamisli o arheolokih
virih v smislu trajnostne valorizacije
z ekonomskega in upravnega vidika.
Opredelili smo poglavitne vire, ki
so orodja managementa in kulturni
izdelki trinajstih muzejskih stvarMNRSH CDUDS LDC MIHLH ID HYJKITMN
arheolokih, tirje pa so meanega
tipa, kar pomeni, da poleg arheolokih eksponatov razstavljajo tudi
umetnike ali naravoslovne zbirke.
V glavnem gre za majhne in srednje
velike muzeje, ki stojijo v manjih
RQDCHHG 1NUHFN  "GHNFFH@  /NQSNFQT@QN@KHM@ONCDDKIT MDJ@SDQHM@


licu mesta ali neposredno povezani


RONCQNIH JIDQRN@KHDONSDJ@IN@Qheoloka izkopavanja.
Raziskava je pokazala tri najpomembneje rezultate z jasnimi operativnimi posledicami.
/QUH  NJQDOH @QGDNKNJH ONFKDC
in ga vpne v geomorfoloko analiYN CNKFDF@ @RNUMDF@ NACNAI@ HM
RODBHMDF@ OQNRSNQ@  #QTFH  @Qheolokemu viru priznava aktivno
UKNFN OQH UMNUHMDL UYONRS@UKI@nju ozemeljskih vrednot in izdelavi
modelov integriranega upravljanja
HMM@QSNU@MI@ *NMMNO@ ONSQITID 
da so projektne skupnosti aktivMHRTAIDJSOQHCQTADMDLOQHYM@MIT
@QGDNKNJDCDCHHMD J@QIDFNSNUN
UD J@QK@GJNONMTCHTSDRMIDMHOQHstop tihega in samozadostnega varstva.
Kronoloka okna ki jih odpiQ@IN$ / ONMTI@INHYUHQMNOQHKNMNRS
za predstavitev najpomembnejih
zgodovinskih obdobij, ki so vplivala
na beneki segment jadranske obale in na njeno neposredno zaledje.
Prostorska umestitev teh obdobij
ONSQCH TOQ@UHDMNRS YFNCNUHMRJN-kulturnega ogrodja in pomaga pri
CNKN@MITJQHSDQHIDUY@OQDMNUNJQ@jinske strukture.
-@ NALNIT TQDI@MI@ JQ@IHMD  JH
F@OQDONYM@U@OQU@U@QH@MS@CDDKnega koordinacijskega prostorskega
M@QS@  RN RD NOQDCDKHKH BHKIH
J@JNUNRSH CU@ LDC MIHLH  UDQNCNstojnost in sinergija, se lahko ocenita v smislu arheolokega vira. Temu
bi se tako pripisala nova vrednost s
OQNRSNQRJN @RNUMHLONLDMNL 
y*QNMNKNJ@ NJM@i RN U ONLN
STCHOQHCDMHBHIHTONQ@AMDF@NJUHQI@ Y@ QD@KHY@BHIN UYNQMHG UDRKNIMHG
tudij v obliki preizkusa o veljavi
koncepta in operativne funkcije EAP.
5DIH JNS ID MIHGNU@ RDL@MSHM@ UDKI@U@  K@ID ONRS@MD OQDONYM@U@MID
JQ@IHMRJHG @KH NYDLDKIRJHG yFTQi 
pa tudi oblikovanje predloga za obnovo pokrajine.
Eden od rezultatov s takojnjimi
NODQ@SHUMHLHONRKDCHB@LHIDTMNUDnje tako imenovanega arheolokega potenciala v obliki kolektivnega
YM@MI@HMRONRNAMNRSHNCKN@MI@
(YJTMI@ @KSHM@S ID  DOQ@U NLDIDM@U@RTHMSDUHKTRNFNUNQMHJNU 
ONJ@Y@K@  C@ ID LNFND Y@LDMI@SH
pravila igre, obogatiti mestno agendo in pritegniti pozornost ozemeljRJHGONKHSHJY@CQTADMDHMNJNKIRJD

URDAHMD @QGDNKNJD CDCHHMD  #Nkaz o teh vsebinah postavlja nove,


HQD LDID ONLDMT CDCHHMD HM IN
TUQ@ U M@IANKI ROKNMD OQNBDRD
upravljanja.

Opombe
1
Glej NINFO, FONTANA, MOZZI, FER1 1$2$ O ,.99(et al. 2011,
str. 199-204.
2
Rekonstrukcija na podlagi daljinskih meritev je poleg predhodnih domnev (SCAFRI, TOMBOLANI 1985) omoFNHK@ STCH CNKNHSDU SHQHG OQDCDKNU
mestnega tkiva: prvi se nahaja severno
od starega kanala, ki je potekal v smeri
UYGNC Y@GNC HM UJKITTID M@IONLDLAMDID I@UMD ONUQHMD @LSD@SDQ  A@YHKHJ@ FKDC@KHDHMNCDNM ENQTLHMRS@MNU@MIRJDDSQSHCQTFHKDHITMNNCJ@M@K@ 
UDHMNL@ FQD Y@ RS@MNU@MIRJD DSQSH
tretji se nahaja na drugi strani kanala, ki
je usmerjal Siloncello v kanal Santa MaQH@UDSQSDLOQDCDKTO@RNRDUDQIDSMN
M@G@I@KD UDHMNL@ OQHRS@MHJD RSQTJture. Mesto se je razvijalo s iritvijo v
jugovzhodni smeri ter s spreminjanjem
M@LDLAMNRSH SDQ NAMNUN NARSNIDHG
objektov kot posledico prilagajanja prvih dveh predelov mestnega tkiva cesti
via Annia. Dejstvo potrjuje obstoj dveh
ONFK@UHSMHGRHRSDLNUOQ@UNJNSMDLQDD
z usmeritvijo 26/116 E e 38/128 E.
/QUHRHRSDLIDTQDI@KRSQTJSTQNDSQSDF@HM
SQDSIDF@OQDCDK@SDQTRLDQHSDU@LSD@SQ@
in foruma v prvem predelu. Druga urbaM@LQD@IDTQDI@K@OQUHHMCQTFHOQDCDK
na podlagi mestnega odseka ceste via
Annia, glej MOZZI et alii 2011, str. 203.
3
 #DKM@THMJNUHSNRSY@JNMRJHGNLDIHSDUHMOQDCOHRNUM@ONCQNIT@QGDNKNgije ozemlja je vidna v veljavnem urbaMHRSHMDLM@QSTNAHMD0T@QSNC KSHMN 
3D@UD M@RS@I@IN OQH URDAHMRJH Q@YK@FH
predpisov pa tudi pri njegovi teritorialMHUDKI@UMNRSHHMM@HMTHYU@I@MI@ JNSID
bilo omenjeno v pripravljalni fazi za proRSNQRJHM@QS/@S
4
Za upravljanje banke podatkov se
uporablja program phpMyAdmin, zapisi vmesnika med Layar in banko podatkov pa se izvajajo v programskem jeziku
Php. Funkcije nadzora in upravljanja sistema so na razpolago na spletni strani,
ki zagotavlja osnovno stopnjo funkcij za
projekt. V portal www.itinerariinitalia.
BNL UJKITDM@ RSQ@M LDRSMD NAHMD KSHMNNLNFN@CNRSNOCNQ@YKHMHGETMJcij. Najpomembneje so prijava, vstop
v strani skupnosti, interaktivni prikaz
tematskih poti, prikaz seznama POI in
YDLKIDUHC@  /N ONUDY@UH R OQHO@C@INHL
geslom lahko prijavljeni uporabnik na
YDLKIDUHCT CNC@I@ NRS@KD Y@MHLHUD SNJD @KH CNONKMITID ONC@SJD N SNJ@G  JH
RNDOQHRNSMDUA@MJHONC@SJNU 3NJD 
ki jih predlaga uporabnik, dodatno
pregleda upravljalec, ki jih lahko odstrani, skrije, shrani za kasnejo uporabo ali
doda v banko podatkov.

5
Osebna in zasebna narava braMI@ U ONRSNOJT TDMI@  JH ID NC MDJC@I
spremljala hojo, je dobro ponazorjena v
SOLNIT 2002. Glej tudi SPADOLINI 2007
in PULITO 2007. O nekaterih italijanskih
izkunjah CARERI 2006.
6
O konceptu "obrobja" v literaturi
in/ali geopsihologiji obstaja nedavna
zanimiva izkunja v okviru delavnice teQHSNQH@KMDF@ M@QSNU@MI@  LDC J@SDQN RD
je tovrstna praksa opredelila kot pristop
k poznavanju ozemlja : Obrobje predRS@UKI@ M@ RSQNJNUMDL ONCQNIT JQHSHJN
Q@BHNM@KMN URDNARDF@INH @M@KHYH NYDmlja (BERTI, GIACOPELLI 2010, str. 76).
3@JNCMNRIDTONQ@ADMKD DCNONKMITID
HMANF@SHNAH@IMDRHRSDLDQ@YHRJNU@MI@
in poznavanja ozemelj.. Neredki so primeri, v katerih obrobje pripelje do
ravnodunega odnosa do konteksta in
postane raziskovalni dejavnosti v breme
ali pa osiromai samega sebe.
7
"Tematske karte" arheolokega
ONSDMBH@K@ M@ NALNIT KSHM@ RJTO@I Y
dosedaj odkrito krajinsko strukturo in
njenimi vrednotami "omejujejo" potencial zazidljivosti na obrobje glavnega
LDRSMDF@IDCQ@JQ@I@0T@QSNC KSHMN
8
 2SDLUYUDYHNARS@I@INQ@YKHMDCDMHBHID  #DDKMH OQNRSNQRJH M@QS /OSQ
CDDKD /TFKHD NOQDCDKITID JNS NYDmeljski lik" teritorialni subjekt, katereF@YM@HKMNRSHRNMDM@U@CMDHMSQ@IMDU
RLHRKT YFNCNUHMRJDF@ OQNBDR@ RSQ@SHkacije ciklov ozemeljske porazdelitve.
*@QSNFQ@I@ SDG YM@HKMNRSH OQDCRS@UKI@
kratek povzetek njihove okoljske, ozemeljske in krajinske identitete. Vsakemu
najdenemu ozemeljsko-krajinskem liku
RD OQHOHDIN HM CNKNHIN YM@HKMNRSH  JH
F@HCDMSHBHQ@INRDRS@U@HMCDKNU@MIDU
C@KIDL @RNUMDL NACNAIT  RSQTJSTQMD
nespremenljivke, ki predstavljajo okoljRJN  JLDJN  M@RDKAHMRJN  HMEQ@RSQTJSTQMN CDCHHMN  LDCSDL JN RD JQ@IHMRJ@ YM@HKMNRS KHJ@ NOHD HM OQDCRS@UH
JNS ONUYDSDJ CDCHHMRJHG DKDLDMSNU 
Uporabnost tako opredeljenega lika je
"lokalne" narave, saj je zanjo potrebno
HYCDK@SH JNLOKDJRDM OQNRSNQRJN @RNUMH
povzetek odnosa med morfologijami in
SHOH R ONLNIN JNMBDOSNU FKNANJDF@
spomina".
9
Razvidnost vzorcev in tkiv krajine
lahko ustvarimo tudi z orodji benchmarkinga, opremo, inventarjem krajinske
TLDSMNRSH  Y HYJNQH@MIDL M@RHONU HM
QDMHG AQDFN  O@ STCH R ONLNIN M@C
ravnino dvignjenih objektov, kot je voCMHRSNKOJHIDDAHKOQDCK@F@MJNSDJNloki observatorij) ali cerkveni zvonik v
0T@QST@USNQI@ MFDK@2B@SSNKHM .RS@MJH
jarkov, kanalov, pristanikih pomolov, ziCNU FQNAHHMUHKK@GJNOQH@Q@INRS@QNdavne pokopane pokrajine.
10
Sklicno obdobje bi lahko bilo
2011/13-2031/33.
11
 /QNRSNQRJH HM TQA@MHRSHMH M@QS
Ptcp Benetke ne podaja ustrezne zakoMNC@ID M@ ONCQNIT U@QRSU@ @QGDNKNJD
CDCHHMD LDCSDLJNKNJ@KMHOQNRSNQRJH
M@QS!DMDSJHMADMDJDK@FTMDUK 
pravilnika prepoznava Altino kot ob-

133

del patrimonio musivo anche con interventi di restauro dei beni. La Fondazione
pu operare, per il tramite di convenzioni quadro e/o intese, in accordo con la
Direzione Regionale per i Beni Culturali
della Regione Veneto, la Soprintendenza per i Beni Archeologici della Regione
Veneto, la Soprintendenza per i Beni Architettonici di Venezia, le Universit di
Venezia e Padova. In questo quadro, promuove, secondo gli indirizzi del Progetto
RBHDMSHBN  B@LO@FMD CH RB@UH MDKK@QD@
altinate, corsi di formazione e attivit di
ricerca, progetti di allestimento museale
nei musei di Altino e di Torcello, in appoRHSDSDBGDCDKK DQDNONQSN,@QBN/NKND
cos via.
19
Vedi Documento Ctp Procedure
per la ricognizione ed il recepimento dei
Vincoli Paesaggistici, 2011.
20
 5DCH  @ SHSNKN DRDLOKHB@SHUN  K@
sperimentazione paesaggistica inerente
K@LAHSN  CDK /31" !NMHBGD D +@gune del Veneto Orientale (Caorle), in
particolare REGIONE DEL VENETO 2011.
Il documento stato predisposto da Regione del Veneto, Mibac, Comune di CaQNKD4BHNCHOH@MND/QNSDBN "NMRNQYHNCH!NMHB@/H@MTQ@5DMDS@SQ@+HUDMY@
e Tagliamento, Veneto Agricoltura.

134

LNID  M@ J@SDQDL AH K@GJN NQF@MHYHQ@KH


M@Q@UMD @QGDNKNJD O@QJD Y CDDKMHL
NADKDIDL 
12
Izraz 'vrednotenje' je tukaj miljen
v dobesednem smislu Kodeksa, prvenstveno pa iz kulturnega vidika.
13
 #NM@ICH@UNCHINSDUHKMHCNGNCH
CDDKM@ NYDLKI@  KDS@KHD  NSNID 3NQcella in celotna beneka laguna, obalni
O@R R STQHRSHMHLH RQDCHH  1@YKHMD RN
STCH LNMNRSH OQDLHJ@MI@ ON NALNIT
M@ICH JNSIDM@UDCDMNDUHYGNCHHG
OQNIDJS@ /@QRI@C SDQ U MDJ@SDQHG D Y@JKITDMHG @KH Q@UMNJ@Q ONSDJ@INHG OQNIDJSHG  9@MHLHUN LNMNRS OQDCRS@UKI@
'plovba po travnikih na nivojih travnikih
LNJQH -@IUDIDNUHQDO@OQDCRS@UKI@IN
HMEQ@RSQTJSTQD HM YFNDMD CDI@UMNRSH 
ONUDY@MDR JNQHCNQIDL YKDS@KHDL 
YNALNIHUAKHHMH@USNBDRSSDQYNA@KMHmi primestnimi naselji.
14
 /QHNAKHJNU@MITOQNRSNQRJHGYCQTA
ID K@GJN JN@QHB@ UD @KH L@MI NYJN
usmerjena. Kar v resnici teje, je kulturni
HMQ@YUNIMHNATSDJ JHIHOQHYM@U@RNCNAMNRS  3D@UD OQH JK@RHJ@BHIH @QGHSDJSTQD
programov Sit ali Dbms se reujejo na
Q@YKHMD M@HMD  5 JQ@IHMRJDL M@QST
CDDKD /TFKHD OQNFQ@L #ALR Q@YUQ@
podatke po topografski enoti, lokaciji/
M@ICHT SDQ U OK@RSH Q@YCDKIDMDL SNONFQ@ERJDL JNMSDJRST FKDCD M@ Q@YKHM@
zgodovinska obdobja. Najmanja enota,
JH D CNKN@ KNJ@BHINM@ICHD  SNONFQ@ERJ@ DMNS@ 4MHS SNONFQ@B@ 4S 
ki je lahko v primerjavi z lokacijo zgradA@  FQNA  ONRDAM@ M@ICA@  *K@RHJ@BHI@
IDSNKHJNANKITHMJNUHS@ JNKHJNQL@MIID
OQHY@DSMHNOQDCDKHSUHJTKSTQMDCNAQHMD
ONSQDAMN TONQ@AKI@SH CDMHBHID JNS RN
'arheoloka', 'arhitekturna', 'umetnika
CNAQHM@HSC 3DNADKDADRNM@LQDQDYTKS@SRDL@MSHMHGHYAHQ JHANF@SHINSTCH
pogovorni jezik.
15
Ena teh je rimska centurizacija.
16
 5 SN UHYHIN RD TUQ@IN STCH QGDoloki park Jesolo in Muzej Torcello, ter
ostalo bogata in raznolika beneka deCHHM@
17
Najbolj zanimiva med tremi obravnavanimi zamislimi (Marittima- kanal
Contorta Sant'Angelo, Fusina, Lido) je
za Altino zadnja. Gre pa poudariti, da
se predvidevanja v glavnem opirajo na
predhodne projekte, kot je na primer tiRSHNITMDLCDKTK@FTMD JHF@*NLHRHI@
za spomeniko varstvo ni odobrila zaradi pomanjkljive ocene. Temu projektu
RD OQHCQTTIDIN Y@LHRKH N HYCDK@UH DKDYMHJDF@ STMDK@ Y@ ONUDY@UN KDS@KH@ Y
DKDYMHJN OQNFN UDKHJD GHSQNRSH  DOQ@U
se zdi, da bo projekt propadel zaradi visokih strokov izgradnje 5 km dolgega
tunela, ki bi povezoval Benetke z letaliDL -HONURDLI@RMN JNKHJDMM@MMHOQHRODUDJIDOQHOQ@UKIDM@UKNHSH2@UD 
JH AH HLDK@ NC ONRDF@ M@IUDID JNQHRSH 
Predvidena je tudi realizacija sistema
people mover, ki bi povezala pristaniDY KDS@KHDL YHYLDMIDU@KMHLO@QJHQHDL J@QAHY@FNSNUHKN C@ONSMHJNLU
nobenem primeru ne bi bilo treba hoditi
dlje kot 300 metrov. tudijo izvedljivosti

HMSDQLNC@KMDF@UNYKH@KDS@KH@,@QBN
/NKN U !DMDSJ@G RNM@MBHQ@ $UQNORJ@
komisija v okviru programa TEN T za razvoj tudij 5. koridorja, danes preimenovanega v Sredozemski koridor.
18
 %TMC@BHI@IDDOQDHYJTDMNNQNCje v podobnih kontekstih in v skladu s
predpisi, ki uravnavajo ustanavljanje
9CQTDMI HM@KH %TMC@BHI I@UMDF@ HM Y@RDAMDF@ RDJSNQI@ M@ ONCQNIT ONYM@vanja, varstva in vrednotenja kulturnih
dobrin. Po vzoru "Fundacije arheolokega parka Classe z imenom RavennAntica ali Fundacije Aquileia, ustanove za
U@KNQHY@BHIN U RLHRKT K   Y@JNMRJDF@
odloka D.Lgs 42/2004, se predlaga ustanovitev Fundacije "Arheoloki park AltiMN 3NQBDKKN /NSDMBH@KMHTRS@MNUMHK@MH
ETMC@BHID AH K@GJN AHKH NAHM@ 0T@QSN
C KSHMN HM NAHM@ !DMDSJD  /NJQ@IHMRJ@
uprava Benetke in Treviso, Nadzornitva,
Univerza v benetkah, fakulteta Iuav v
okviru univerze v Benetkah, univerza v
Padovi, Venice International University
(Viu), tuje univerze, Patriarhat v Benetkah, Fundacija banke Cassa di Risparmio
di Venezia, SAVE, zasebni lastniki nepreLHMHM '%@QL"3QNMHMCQTFH %TMdacija lahko pridobi status pravne oseAD Y I@UMHL @JSNL U RLHRKT K    SNJD
1 odloka DPR 10.02.2000 t. 361. Med
cilji fundacije bi lahko bili: ustanovitev
centra za koordinacijo arheolokih raziskav v okviru novega muzeja v Altinu
RRDCDDLUNAMNUKIDMHGOQNRSNQHGM@
podlagi projekta, ki bi ga izdelal poseben znanstveni odbor. Fundacija bi lahJNM@S@JM@HMOQHONLNFK@JTRS@MNUHSUH
arheolokega parka, ki bi skupaj z naravoslovnim parkom zagotavljal ustrezno
NGQ@MI@MID JTKSTQMD CDCHHMD  2KDCMIN
bi lahko parka sprejela v hrambo in/ali
v koncesijsko uporabo ali tudi v uporabo na podlagi dogovora med javnimi in
Y@RDAMHLHRTAIDJSH 9HYGNCHDLM@SDG
predpostavkah lahko fundacija izbolja dostop javnosti do kulturnih dobrin,
hkrati pa zagotovi ustrezno ohranjanje
njihove vrednosti. Poleg tega pomaga
OQH YCQTDU@MIT CDI@UMNRSH TOQ@UKI@MI@
in valorizacije kulturnih dobrin s tistimi,
ki se nanaajo na morebitne podarjene
CNAQHMD R RSQ@MH TCDKDDMBDU  2NCDKTID
pri razvoju storitev za javnost, osredoSN@RDM@HYANKI@MIDMIHGNUDJ@JNUNRSH
in bolj racionalen izkoristek pri upravljanju. Nenazadnje realizira oblike vaKNQHY@BHID LTYDIRJDF@ FQ@CHU@ UJKITMN
z restavratorskimi deli. Fundacija lahko
CDKTIDRONLNINNJUHQMHGCNFNUNQNUHM
ali sporazumov, v sodelovanju z Upravo
RONLDMHJDF@ U@QRSU@ CDDKD !DMDHID 
-@CYNQMHSU@ Y@ @QGDNKNJN CDCHHMN
CDDKD!DMDHIDSDQTMHUDQY@LHU!DMDSkah in Padovi. V zastavljenih okvirih in v
skladu z smernicami znanstvenega proIDJS@RONCATI@HYJNO@U@MI@M@NALNIT
KSHM@  RSQNJNUMD SD@ID HM Q@YHRJNU@KMD
dejavnosti, projekte priprav na razstave
v muzejih Altino in Torcello, razstave v
SDLT M@LDMIDMHG UHSQHM@G M@ KDS@KHT
,@QBN/NKNHMS@JNC@KID 
19
Glej dokument Ctp Postopki za
per la pregled in sprejemanje predpisov

za krajinske omejitve, 2011.


20
Kot primer glej krajinsko eksperiLDMSHQ@MID U NJUHQT NALNI@  /31"
!NMHJD HM K@FTMD UYGNCMD !DMDHID 
"@NQKD  YK@RSH #$$+  !$-$()   
#NJTLDMS RN OQHOQ@UHKH CDDKM@ TOQ@U@
!DMDHID  ,HA@B  NAHM@ "@QNKD NCCDKDJY@M@QSNU@MIDHM/QNSDBN *NMYNQBHI
ANMHJDADMDJDMHHMDLDC+HUDMYNHM
Tilmentom, Veneto Agricoltura.

135

!HAKHNFQ@@

1. Depotenziare il potenziale?
'DOODWXWHODGHOVLWRDOODWXWHOD
GHOSDHVDJJLR1XRYLDSSURFFLQHO
riconoscimento e nellanalisi della
risorsa archeologica territoriale
1. Depotencirati potencial?
2G]DLWHQDMGLDGRYDURYDQMD
RNROMD1RYLSULVWRSLNGRORDQMX
in analizi teritorialne arheoloke
GHGLLQH
CAMMELLI M. 2000, La nuova Disciplina dei Beni Culturali e Ambientali, Bologna.
CARANDINI A. 2012, Il nuovo dellItalia
nel passato, Roma-Bari.
A. CARDARELLI e al. 2001, Valutazione
del rischio archeologico e programmazione degli interventi di trasformi zone
urbana e territoriale: lesperienza di
Modena, in S. GELICHI (a cura di), Dalla
carta di rischio archeologico di Cesena
alla tutela preventiva urbana in Europa,
Firenze, pp. 31-40.
M. CARVER 2003, Archaeological value
and evaluation, Mantova.
R. FOLEY 1981, 2VLWH DUFKDHRORJ\
an alternative approach for the short
site, in I. HODDER - G. YSAAC - N. HAM
MOND (eds), Pattern of the past. Studies
in honour of David Clarke, Cambridge,
pp. 157-183.

tentazioni dellarcheologia italiana alle


soglie del nuovo millennio, in S. GELI
CHI, C. NEGRELLI (a cura di), A piccoli
passi. Archeologia predittiva e preventiva nellesperienza cesenate, Firenze, pp.
57-62.
S. GELICHI, A. ALBERTI, M. LIBRENTI
 Cesena: la memoria del passato.
Archeologia urbana e programmazione
della ricerca, Firenze.
S. GELICHI, C. NEGRELLI (a cura di)
2008a, A misura duomo. Archeologia
del territorio cesenate e valutazione dei
depositi, Firenze.
S. GELICHI, C. NEGRELLI 2008b, Valutazione del potenziale archeologico del
territorio cesenate, in S. GELICHI, C. NE
GRELLI (a cura di) 2008a, pp. 269-275.
G. LOCK, T. HARRIS 2006, Enhancing
Predictive Archaeological Modeling: Integrating Location, Landscape and Culture, in M. W. MEHERER, K.L. WESCOTT
(eds), GIS and Archaeological Site Location Modeling, Boca Raton, pp. 41-62.
L. MALNATI 2011, Archeologia preventiva in Emilia - Romagna, in S. GELICHI, C.
NEGRELLI (a cura di), A piccoli passi. Archeologia predittiva e preventiva nellesperienza cesenate, Firenze, pp. 7-10.
D. MANACORDA 2007, Il sito archeologico: fra ricerca e valorizzazione, Roma.

S. GELICHI 1999, Archeologia urbana


e programmazione della ricerca, in S.
GELICHI, A. ALBERTI, M. LIBRENTI 1999,
pp. 9-21.

C. NEGRELLI 2008, La carta delle potenzialit archeologiche, in S. GELICHI,


C. NEGRELLI (a cura di) 2008a pp. 277286.

S. GELICHI 2008, Solo un Giano bifronWH" 4XDOFKH ULHVVLRQH VXOOXVR GHOOD


fonte archeologica, in S. GELICHI (a
cura di), Missioni Archeologiche e progetti di ricerca e di scavo dellUniversit
Ca Foscari Venezia (VI Giornata di Studio), Venezia, pp. 5-8.

A. RICCI 1996, I mali dellabbondanza.


Considerazioni impolitiche sui beni culturali, Roma.

S. GELICHI 2011, La terra di mezzo e le

[

A. SCHNAPP 1984, Archeologia urbana,


archeologia preventiva, in Archeologia
urbana e centro storico di Napoli (Atti
del Convegno, Napoli 1981), Napoli,
pp. 25-27.

BHAKHNFQ@I@

S. SETTIS 2002, Italia S.p.A. Lassalto al


patrimonio culturale, Torino.

vo 15 maggio 2004, a cura di G. Leonardi e S. Rossi, Padova, pp. 55-86.

S. SETTIS 2013, Azione popolare. Cittadini per il Bene Comune, Torino.

BLAKE H., BONDESAN A., FAVERO V.,


FINZI E., SALVATORI S. 1988, Cittanova Heraclia 1987: risultati preliminari delle
indagini geomorfologiche e paleogeoJUDFKH HM0T@CDQMHCH QBGDNKNFH@CDK
Veneto, IV, pp. 112-135.

L. SCIASCI 1975, La scomparsa di Majorana, Torino.


N. TERRENATO 2000, The visibility of
VLWHV DQG WKH LQWHUSUHWDWLRQ RI HOG
survey results: towards an analysis of
incomplete distribution, in R. FRANCO
VICH, H. PATTERSON (eds), Extracting
Meaning from Ploughsoil Assemblages
(The archaeology of the Mediterranean
Landscape 5), Oxford, pp. 60-71.
P. VERHAGEN 2007, Case studies in Archaeological Predictive Modeling, Leiden.

2. Paesaggi antichi e potenziale


archeologico
2. Starodavne pokrajine in
arheoloki potencial
ARPAV 2005, Carta dei Suoli del Veneto
alla scala 1:250,000, Castelfranco Veneto, 3 vol.
BACCI N., GAMBACURTA G., MARCASSA
P., SCHIAVO A. 2001, 9HULFKHDUFKHRlogiche sul tratto della via Annia in localit Pontinovi a Adria, in Via Annia II,
a cura di F. Veronese, Padova, pp. 173
-192.
BALISTA C. 1986, Lineamenti geosedimentologici e paleoinsediativi in due
localit del deltapolesano: Corte Cavanella e San Basilio, in Prospezioni archeologiche, 10, pp. 105-110.
BALISTA C., 2004. Il territorio camELD LGURJUDD OD URWWD GHOOD &XFFD $UFKHRORJLD H LGURJUDD GHO 9HURQHVH D
FHQWDQQL GDOOD GHYLD]LRQH GHO XPH
Gu (1904-2004), Atti della Giornata
di Studi La necropoli del Fiume Nuo-

BONARDI M., CANAL E., CAVAZZONI S.,


SERANDREI BARBERO R., TOSI L., GAL
GARO A., GIADA M. 1997, Sedimentological, Archaeological and Historical evidences of paleoclimatic changes during
the Holocene in the Lagoon of Venice
(Italy), in World Resource Review, 9 (4),
pp. 435-446.
BONDESAN A., MENEGHEL M. (a cura
di) 2004, Geomorfologia della provincia di Venezia, Padova.
BONDESAN A., CALDERONI G., RIZZET
TO F. 2003a, Geomorphologic evolution
of the lower Piave river coastal plain
during the Holocene, in Risposta dei
processi geomorfologici alle variazioni
ambientali. MURST, Atti del Convegno,
Bologna 10-11/02/2000, a cura di A.
Biancotti A. e M. Motta, Genova, pp.
125-133.
BONDESAN A., LEVORATO C., PRIMON
S. 2003b, La geomorfologia del territorio di Arzergrande, in Arzergrande e
Vallonga, la memoria storica di due comunit, a cura di G. Rosada, Treviso, pp.
13-24.
BONDESAN A., PRIMON S., BASSAN V.,
VITTURI A. (a cura di) 2008, Le unit
geologiche della provincia di Venezia,
Caselle di Sommacampagna (VR).
BONDESAN M. 1990, Larea deltizia paGDQDFDUDWWHULJHRJUDFLHJHRPRUIRORgici, in II Parco del delta del Po: studi e
immagini, a cura di M. Bondesan, Ferrara, v. 1, pp. 9-48.

137

BONDESAN M., CALDERONI G., CATTA


NI L., FERRARI M., FURINI A.L., SERAN
DREI BARBERO R., STEFANI M. 1999,
1XRYL GDWL VWUDWLJUDFL SDOHRDPELHQtali e di cronologia radiometrica sul
ciclo trasgressivo-regressivo olocenico
nellarea deltizia Padana, Dipartimento
di Scienze Geologiche, Universit di
Ferrara, pp. 1-34.
BONOMI S., MALACRINO C. G , Dal
santuario di Altino al santuario di Lova
di Campagna Lupia. Una messa a confronto nel panorama del sacro nel Veneto, Campagna Lupia, studi e ricerche
di storia e archeologia, volume I. Alle
foci del Medoacus Minor, a cura di G.
Gorini, Padova, pp. 71-88.
BONOMI S., PERETTO R., TAMASSIA K.
1993, Adria - appunti preliminari sulla
necropoli tardoetrusca e romana di via
spolverin di Bottrighe, in Padusa, 29,
pp. 91-290.
BONOMI S., BELLINTANI P., TAMASSIA
K.,TRENTIN S. 1995, Aggiornamento
sui rinvenimenti archeologici nellarea
dellazienda ospedaliera, in Padusa, 31,
pp. 41-49.
BORTOLAMI S. 2003, Il brenta medievale nella pianura veneta, in Il Brenta,
a cura di A. Bondesan, D. Gasparini, F.
Vallerani F. e M. Zanetti, Verona, pp.
209-233.
BORTOLETTO M., DAGOSTINO M., LEZ
ZIERO A., MARCHESINI M., MARVELLI S.
, Evidenze archeologiche sommerse altomedievali ai margini dellisola
di Santa Cristina nella laguna nord di
Venezia HM QBGDNKNFH@5DMDS@ 777((( 
pp. 192-239.
BRUNELLO L. 1993, $QWLFD LGURJUDD
della terraferma veneziana, in Centro
Studi Storici Mestre, 2, 61 pp.
BUSANA M. S. 2002, Architetture rurali
nella Venetia romana, Roma.
BUSANA M.S., GHEDINI F. (a cura di),
2004, La via Annia e le sue infrastrutture, Atti delle Giornate di Studio, Ca
Tron, Roncade, 6 7 novembre 2003,
Cornuda (Treviso), 296 pp.
CAGNAZZI D. 1979, 3UROR 6WRULFR in,
San Don di Piave. Storia immagini
costume, a cura di Amministrazione
Comunale, Padova, pp. 15-36.
CALAON D. 2006a, Altino (VE). Strumenti diagnostici (GIS e DTM) per lanalisi delle fasi tardo-antiche ed altomedievali, in Le missioni archeologiche
dellUniversit Ca Foscari di Venezia, a
cura di A. Zaccaria Ruggiu, Venezia, pp.
143-158.

138

CALAON D. 2006b, Cittanova (VE):


analisi GIS, in IV Congresso nazionale

di archeologia medievale, a cura di R.


Francovich R.e M. Valenti, Firenze, pp.
216-224.
CALAON D., FERRI M. 2008, Il monastero dei Dogi. SS. Ilario e Benedetto ai
margini della Laguna veneziana, in Missioni archeologiche e progetti di ricerca
e scavo delluniversit Ca Foscari Venezia - VI Giornata di Studio, a cura di S.
Gelichi, Venezia, pp. 185-197.
CANAL E. 1998, Testimonianze archeologiche nella Laguna di Venezia - Let
antica, Venezia, 91 pp.
CANIATO G:, TURRI E., ZANETTI M. (a
cura di), 1995 - La laguna di Venezia,
Verona, 527 pp.
CASAZZA L. 2001, Il territorio di Adria
tra VI e X secolo, Padova.
CASTIGLIONI G.B., GIRARDI A., RODOLFI
G. 1987, Le tracce degli antichi percorsi
del Brenta per Mont e Arcella nei pressi di Padova: studio geomorfologico, in
Memorie Scienze Geologiche, 39, pp.
29-149.
CASTIGLIONI G.B., FAVERO V. 1987 - Linee di costa antiche ai margini orientali
della Laguna di Venezia e ai lati della
foce attuale del Piave, in Istituto Veneto
di Scienze Lettere ed Arti, Commissione di Studio dei Provvedimenti per la
Conservazione e Difesa della Laguna e
della Citt di Venezia. Rapporti e Studi,
10, pp. 17-30.
CASTIGLIONI G.B., PELLEGRINI G.B.
1981, Geomorfologia dellalveo del
Brenta nella pianura tra Bassano e Padova, in Il territorio della Brenta, a cura
di M. Zunica, Padova, pp. 12-32.
CASTIGLIONI G.B. 1978, Il ramo pi
settentrionale del Po nellantichit, in
Accademia Patavina di Scienze Lettere
ed Arti, 90 (3), pp. 157-164.
CESSI R. 1943 Il problema della, Brenta
dal secolo XII al secolo XV, in La laguna
di Venezia, 2 (1), p. IV, t.VII, 3 ss.
CIBIN U., STEFANI M. (a cura di) 2009,
Note illustrative della carta geologica
dItalia: Foglio 187 : Codigoro ISPRAServizio Geologico dItalia Regione
Emilia Romagna, Firenze, 161 pp.
COMEL A. 1964, I terreni agrari compresi nella Tavoletta I.G.M. Quarto
dAltino, in Nuovi Studi della Stazione
Chimico-Agraria Sperimentale di Udine, Pubbl. N.67, 26 pp.
CONTON L. 1996, Le antichit romane
della Cava Zuccarina (a cura di A. Padovan), Venezia.
CORR E. 2008-2009 La frangia lagunare sud in eta post antica: soluzioni
informatiche per la gestione e la valuta-

zione dei dati e dei depositi archeologici, tesi di laurea in archeologia medievale, Universit degli studi di Venezia,
relatore S. Gelichi.
CROCE DA VILLA P. 2006, Osservazioni
sulle due chiese precedenti la Cattedrale di Santa Maria Assunta di Jesolo (Venezia), utrosaeponerentur. Scritti
di archeologia in ricordo di Giovanna
Luisa Ravagnan, a cura di E. Bianchin
Citton e M. Tirelli, Treviso, pp. 213-225.
CROCE DA VILLA P., DI FILIPPO BALE
STRAZZI E. (a cura di) 2001, Concordia.
Tremila anni di storia, Padova, 248 pp.
CUSCITO G., SARTORI F. 2007, Limpianto paleocristiano di Jesolo e i suoi
mosaici: una rilettura critica del monuPHQWR GRSR JOL VFDYL VWUDWLJUDFL GHO
1985-87 e del 1990, Venezia.
DAVID A., DAVID A. 2009, Il territorio di
&DRUOHQHOOHIRQWLFDUWRJUDFKHGLHSRFD
veneta, dal 1527 al 1789. Presentazione, in 4XDGHUQLGLFDUWRJUDDVWRULFD, El
Bossolo, Caorle (Venezia), 69 pp.
DI FILIPPO BALESTRAZZI E. 2009, Il
foro concordiese: conferme e prospettive dai nuovi dati, in Via Annia Progetto
di recupero e valorizzazione di unantica strada romana, Atti della giornata di
studio, Padova, 19 Giugno 2008, a cura
di F. Veronese, Padova, pp. 189-202.
DORIGO W. 1994, Venezie sepolte nella terra del Piave. Duemila anni fa tra il
dolce e il salso, Roma.

turali, 8, pp. 83-102.


FAVERO V. 1990, La pianura costiera
da Altino al Tagliamento., in Dal Sile al
Tagliamento, a cura di C. Semenzato,
Venezia, pp. 12-43.
FERSUOCH L. 1995, S. Leonardo in fossa mala e altre fondazioni medievali lagunari. Restituzione territoriale, storica
e archeologica, Roma.
FONTANA A. 2004, Tra Tagliamento e
Livenza, in- Geomorfologia della provincia di Venezia, a cura di A. Bondesan
e M. Meneghel, Padova, pp. 195-217.
FONTANA A., 2006, Levoluzione geomorfologica della bassa pianura friulana e le sue relazioni con le dinamiche
insediative antiche, ,NMNFQ@D CDK
Museo Friulano di Storia Naturale, 47,
288 pp., con allegata Carta Geomorfologica della bassa pianura friulana,
scala 1:50.000 Udine.
FONTANA A., BONDESAN A., MENE
GHEL M., TOFFOLETTO F., VITTURI A.,
BASSAN V. (a cura di), 2012, Note illustrative della Carta Geologica dItalia
alla scala 1:50.000. 107 Portogruaro,
Roma.
FONTANA A., MOZZI P., BONDESAN A.
2008, Alluvial megafans in the VenetoFriuli Plain: evidence of aggrading and
erosive phases during Late Pleistocene
and Holocene, (M 0T@SDQM@QX (MSDQM@tional, 189, pp. 71-89.

DORIGO W. 1995, Fra il dolce e il salso:


origini e sviluppi della civilt lagunare,
in La laguna di Venezia, a cura di G. Caniato, E. Turri e M. Zanetti, Verona, pp.
137-192.

FRASSINE M. 2010, La questione Popillia Annia tra Padova ed Adria, in


UH@L MMH@L HMTDMSHATR O@KTRSQHATR
aquis eververatam, a cura di G. Rosada, M. Frassine M. e A.R. Ghiotto, Treviso, pp.107-120.

ELLERO A. 2008, De petra que habemus in Equilo,*XLGDDLUHSHUWLHSLJUDci ed archeologici provenienti dallantica Jesolo, Jesolo (VE).

FURLANETTO P. 2011, Geoarcheologia,


in Atlante Geologico della Provincia di
Venezia. Note illustrative, a cura di A.
Vitturi, Venezia, pp. 137-200.

FAVERO V., PAROLINI R., SCATTOLIN M.


1988, Morfologia storica della laguna
di Venezia., Venezia.

GELICHI S. 2006, Venezia tra Archeologia e storia: la costruzione di unidentit


urbana, in Le citt italiane tra la tarda
antichit e lalto Medioevo, Atti del convegno di Ravenna, a cura di A. Augenti,
Firenze, pp. 151-184.

FAVERO V., SERANDREI BARBERO E.


1978, La sedimentazione olocenica
nella piana costiera tra Brenta ed Adige, in Memorie della Societ Geologica
Italiana, 19, pp. 337-343.
FAVERO V., SERANDREI BARBERO E.
1980, Origine ed evoluzione della laguna di Venezia bacino meridionale,
in Lavori della Societ Veneziana di
Scienze Naturali, 5, pp. 49-71.
FAVERO V., SERANDREI BARBERO R.
1983, Oscillazioni del livello del mare
ed evoluzione paloambientale della Laguna di Venezia nellarea compresa tra
Torcello e il margine lagunare, in Lavori
della Societ Veneziana di Scienze Na-

GELICHI S. 2010, Larcheologia della


laguna veneziana e la nascita di una
nuova citt, in Le trasformazioni dello
spazio urbano nellalto medioevo (secoli V-VIII). Citt mediterranee a confronto, a cura di C.E. Mndez C. E. e S.
&@RO@QQH2 1DSH,DCHDU@KH1HUHRS@ 7( 
2, pp. 1-31.
GELICHI S., MOINE C. (a cura di), con
contributi di CORR E., FERRI M., GA
RAVELLO S., GHEZZO M., SABBIONESI
L., VIDAL D. 2012 Isole fortunate? La
storia della laguna nord di Venezia at-

[

traverso lo scavo di San Lorenzo di Ammiana, HM QBGDNKNFH@,DCHDU@KD 77(7 


pp. 9-56.
GIANDON P., RAGAZZI F., VINCI I., FAN
TINATO L., GARLATO A., MOZZI P., BOZ
ZO G.P. 2001, La carta dei suoli del bacino scolante in laguna di Venezia, in
Bollettino della Societ Italiana della
Scienza del Suolo, 50, pp. 273-280.
GORINI G. 2011 (a cura di), Campagna
Lupia, studi e ricerche di storia e archeologia, volume I. Alle foci del Medoacus
Minor, Padova.
GUIOTTO G. B. 1855, Cenni storici
sullantica citt di Jesolo e sullorigine
della Cava Zuccherina, Venezia.
LEVORATO C. 2001-2002 Studio geomorfologico della pianura sud-orientale
della Provincia di Padova, tesi di laurea
in geomorfologia, Universit degli studi di di Padova, relatore A. Bondesan.
LEVORATO C., SCORTEGAGNA U. 2008,
- Risorgiva di Frattina, in Geositi della
provincia di Venezia, a cura di A. Bondesan A. e C. Levorato, Venezia, pp.
29-32.
MARAGNO E. (a cura di) 1993, La centuriazione dellagro di Adria, Stanghella,
pp. 170-185.
MARCHESINI M., LEZZIERO A., MARVEL
LI S., BIAGIONI S. 2009, Ricostruzione
del paleoambiente. Sondaggi geoarcheologici ed analisi paleobotanich, in Il
Passante autostradale di Mestre, a cura
di A. Lalli A., Campodarsego (PD), pp.
94-109.
MAROCCO R. 1989, Evoluzione quaternaria della Laguna di Marano (FriuliVenezia Giulia) HM(K0T@SDQM@QHN  
pp. 125-137.
MATTEAZZI M. 2011, Una strada tra terra ed acqua, in Campagna Lupia, studi e
ricerche di storia e archeologia, volume
I. Alle foci del Medoacus Minor, a cura
di G. Gorini, Padova, pp. 68-70.
MIOLA A., FAVARETTO S., SOSTIZZO I.
2006, /LQQLWDPHQWHSLFFRORDOVHUYL]LR
dello scienziato:polline fossile per la ricostruzione paleoambientale della bassa pianura del Tagliamento, in Il Tagliamento, a cura di F. Bianco, A. Bondesan,
P. Paronuzzi, M. Zanetti, A. Zanferrari,
Sommacampagna (VR), pp. 162-164.
MIMMO M., Analisi della viabilit
SHU OD ULFRVWUX]LRQH GHOOD WRSRJUDD GL
Adria. Revisione dei dati darchivio, in
/@CTR@ 7+(( OO  
MOTTA BROGGI M. 1989, Adria, in Il
Veneto nel medioevo. Dalla Venetia
alla Marca Veronese, a cura di A. Castagnetti A. e G.M. Varanini, Verona, II, pp.
251-255.

[

MOZZI P. 1995, Evoluzione geomorfologica della pianura veneta centrale, tesi


di dottorato, Universit degli studi di
Padova.
MOZZI P. 1998, Nascita e trasformazione della pianura del Sile, in Il Sile, a cura
di A. Bondesan, G. Caniato, F. Vallerani,
M. Zanetti, Verona, pp. 40-51.
MOZZI P., NINFO A. 2009, /DIRWRJUDD
aerea obliqua per lanalisi geoarcheologica del territorio della via Annia, in
Via Annia Progetto di recupero e valorizzazione di unantica strada romana.
Atti della giornata di studio, Padova,
19 Giugno 2008, a cura di F. Veronese,
Padova, pp. 103-120.
MOZZI P., NINFO A., PIOVAN S. 2010,
Nuove evidenze da telerilevamento a
sud di Padova, in viam Anniam inTDMSHATRO@KTRSQHATR@PTHRDUDQUDQ@tam, a cura di G. Rosada, M. Frassine
M. e A.R. Ghiotto, Treviso, pp. 85-88.
MOZZI P., FONTANA A., NINFO A., FER
RARESE F. 2011, La struttura urbana di
Altino: telerilevamento e contesto geomorfologico, in Atti del VI Convegno di
studi altinati, Altino dal cielo: la citt
telerivelata, lineamenti di foma urbis,
Venezia, 3 dicembre 2009, a cura di M.
Tirelli e G. Cresci Marrone, Roma, pp.
15-38, 5 tavv.
MOZZI P., FERRARESE F., FONTANA A.
2013, Integrating digital elevation
models and stratigraphic data for the
reconstruction of the post-LGM unconformity in the Brenta alluvial megafan
(North-Eastern Italy), in Alpine and MeCHSDQQ@MD@M0T@SDQM@QX  OO   
disponibile online http:/amq.aiqua.it.
NINFO A. 2009, DEM e telerilevamento per lo studio geomorfologico delle
pianure alluvionali, tesi di dottorato,
Universit degli studi di Padova, 190 pp.
NINFO A., FONTANA A., MOZZI P., FERRARESE F. 2009, The Map of Altinum,
Ancestor of Venice,HM2BHDMBD UNK 
p. 577.
NINFO A., FONTANA A., MOZZI P. 2011,
Il contributo del telerilevamento nello
studio della via Annia, in Via Annia II, a
cura di F. Veronese, Padova, pp. 55-69.
PERETTO R. 1993, 6WUDGH H ERQLFKH
nellantico territorio di Adria, in La centuriazione dellagro di Adria, a cura di E.
Maragno, Stanghella, pp. 170-185.
PETTEN E., VIGONI A. 2009, Lungo la
via Annia: nuove ricerche presso il foro
di Julia Concordia, in Via Annia Progetto
di recupero e valorizzazione di unantica
strada romana, Atti della giornata di studio, Padova, 19 Giugno 2008, a cura di
F. Veronese, Padova, pp. 163-187.

PAVANELLO G. 1919, Antichi scrittori di


idraulica veneta, vol.1, Venezia, 112 pp.
PAVANELLO G. 1923, Di una antica laguna scomparsa La laguna eracliana,
Venezia.
PELLEGRINI G.B., PAGANELLI A., PENSO
D. 1984, Aspetti geomorfologici e paliQRORJLFLGLGHSRVLWLXYLDOLQHLSUHVVLGL
Carturo sul Brenta (Padova), in Geogra@ %HRHB@ D #HM@LHB@ 0T@SDQM@QH@   
pp. 36-39.
PESAVENTO MATTIOLI S. 1986, Le prime sette miglia della strada romana da
Padova ad Altino HM0T@CDQMHCH QBGDologia del Veneto, II, pp. 126-134.
PIOVAN S. 2008, Evoluzione paleoidroJUDFDGHOODSLDQXUDYHQHWDPHULGLRQDle e rapporto Uomo-Ambiente nellOlocene, tesi di dottorato, Universit degli
studi di Padova.
PIOVAN S., MOZZI P., STEFANI C. 2010,
Bronze Age palaeohydrography of the
southern Venetian Plain, in Geoarchaeology, 25, pp. 6-35.
PIOVAN, S., MOZZI, P., ZECCHIN, M.
2012, The interplay between adjacent
Adige and Po alluvial systems and
deltas in the late Holocene (Northern
Italy), in Gomorphologie 4/2012, pp.
427-440.
ROBINO M.T.A. 2008, Alcune note sulla
viabilit di Adria, in Edilizia pubblica e
privata nelle citt romane, Atlante teL@SHBN CH 3NONFQ@@ MSHB@  SS@  
Roma, pp. 7-19.
ROSADA G. 1980 - Portus Aedro-Vallonga (Padova), in Archeologia Veneta, III,
pp. 69-96.
ROSADA G. 2001, .Inter Tliamentum
et Liquentiam, et sicut via ungarorum
cernitur et paludes maris piscationes,
venationes, silvas, terras, fruges, in Concordia Sagittaria. Tremila anni di storia,
a cura di P. Croce Da Villa, E. Di Filippo
Balestrazzi, Padova, pp. 29-38.
ROSADA G. 2003, Arzergrande e Vallonga. La memoria storica di due comunit, Treviso, 142 pp.
SEMENZATO P. 1990, La vegetazione e
il paesaggio, in Dal Sile al Tagliamento,
a cura di C. Semenzato, Venezia, pp.
69-95.
STEFANI M., VINCENZI S. 2005, The interplay of eustasy, climate and human
activity in the late Quaternary depositional evolution and sedimentary architecture of the Po Delta system, in Marine Geology, 222223, pp. 1948.

di) 2011, Atti del VI Convegno di studi


altinati, Altino dal cielo: la citt telerivelata, lineamenti di foma urbis, Venezia,
3 dicembre 2009, Roma, 183 pp., 16
tavv.
TIRELLI M., MOZZI P., FONTANA A., NIN
FO A., FERRARESE F., ABB T. 2013, Dal
telerilevamento di Altino al controllo veULWWHUUHQRODSULPDYHULFDLQORFDOLW
Valle Rossa HM0T@CDQMHCH QBGDNKNFH@
CDK5DMDSN UNK 775((( OO  
TOSI L., RIZZETTO F., BONARDI M.,
DONNICI S., SERANDREI BARBERO R.,
TOFFOLETTO F. 2007, Note illustrative
della Carta Geologica dItalia alla scala
1:50.000. 148-149 - Chioggia-Malamocco, Roma, 164 pp., 2 carte.
TOMBOLANI M. Jesolo (VE) Loc.
Le Mure. Saggi di scavo nellarea della basilica di Santa Maria Assunta, in
Aquileia Nostra, LVI, pp. 474-475.
TUZZATO S. 2001, Risultati degli scavi
archeologici a San Basilio, in AAVV, Il
restauro della chiesa di San Basilio, in
0T@CDQMH CH /QNFDSSN 1DRS@TQN    OO 
9-12.
VEGGIANI A. 1972, Il ramo del Po di
Adria nella tarda Et del Bronzo. Padusa, 8(3-4), pp. 123-126.
VEGGIANI A. 1974, Le variazioni climatiche del basso corso del Po negli ultimi
3000 anni, in Padusa, 1-2, 22 pp.
VEGGIANI A. 1985, Il Delta del Po e leYROX]LRQHGHOODUHWHLGURJUDFDSDGDQD
in epoca storica, in Atti della Tavola
Rotonda Il delta del Po, Sezione geologica, Bologna, 24/11/1982, Bologna,
pp. 37-68.
VITALI L. SALZANI D. 2002, Gli scavi
archeologici nel podere Forzello a San
Basilio di Ariano Polesine, in Padusa,
7775((( OO  
VITTURI A. (a cura di) 1983, Studio geopedologico e Agronomico del territorio provinciale di Venezia, parte nordorientale, Venezia, 335 pp.
ZANFERRARI A., AVIGLIANO R., FON
TANA A., MARCHESINI A., PAIERO G.
2008, Carta geologica dItalia alla scala
1:50.000 Foglio 086 S. Vito al Tagliamento, Udine.
ZUNICA M. 1974, /D ERQLFD 'HOWD
Brenta. Un esempio di trasformazione
del paesaggio nella Laguna di Venezia,
HM 1HUHRS@ &DNFQ@B@ (S@KH@M@  MM@S@
+777( %@RB  %HQDMYD OO

STUDI JESOLANI 1985, in Antichit alSN@CQH@SHBGD 75( 4CHMD


TIRELLI M., CRESCI MARRONE G. (a cura

139

SUREOHPDWLFKHHGRSSRUWXQLW
manageriali per la valorizzazione
del patrimonio archeologico

WULPLQLR &XOWXUDOH YHUVR OD GHQL]LRQH


di un modello di governance, Milano,
&HTQ$CHSNQD

SRVORYQHSUREOHPDWLNHLQ
SULORQRVWLSULYUHGQRWHQMX
DUKHRORNHGHGLLQH

IASEVOLI G., 2008, Servizi innovativi


nel contesto museale rivolti al segmento famiglia: una comparazione tra la
realt italiana e quella internazionale,
in Economia e diritto del terziario,
vol. 20.

AA.VV. 2007 Bilancio sociale, 20042007, Montebelluna, Museo di Storia


Naturale e archeologia.
ANDREANI A. 1998, Listituzione per
la gestione dei musei. Spunti problematici, in Aedon. Rivista di arti e diritto
on line, n. 2/1998.
BAGDADLI S. 1995, Cooperazione
o isolamento? Verso una nuova organizzazione dei musei italiani, in
Economia&Management, n.1 /95.
BAROVIER MENTASTI, TIRELLI M., 2010
Altino. Vetri di Laguna, Treviso, Vianello
Libri.
BONETTO J. 2009, Veneto. Archeologia
delle Regioni dItalia, vol. 5, Roma, LiAQDQH@CDKKN2S@SN (RSHSTSN/NKHFQ@BND
Zecca dello Stato.
BRADFORD H., 1994, A new frame work
for museum marketing, in Museum Management, London, Routledge.
BURATTI N. 2008, Nuove tecnologie e
percorsi di innovazione in ambito museale, in Economia e diritto del terziario, vol. 20.
CASARIN F., Moretti A., 2011, An International review of cultural consumption
research, Working Paper Series, Universit Ca Foscari di Venezia.
CELI M., 2004, Guida del museo di
Scienze Naturali e Archeologia di Montebelluna, Montebelluna, Zanetti Editore.
CURTOLO A., Tamma M., 2009, Lo sviluppo strategico delle organizzazioni
di produzione culturale: commitment,
risorse, prodotti, in Brunetti G., Rispoli
M. (a cura di) Economia e management
delle aziende di produzione culturale,
Bologna, Il Mulino.
DE BIASI M, 2003, Murano fra storia e
arte, Venezia, Societ cooperativa muranese mista.
FERRARI S., VELTRI A.R., 2008, LapprocFLR HVSHULHQ]LDOH QHOORHUWD GHL EHQL
culturali. Il caso di Emozioni al Museo, in
Finanza, marketing e produzione: rivista dellUniversit L. Bocconi, vol. 4.
FUNARI S., VASCOLANI B. 1998, Allocazione dinamica delle risorse in un
museo: il problema della gestione della
congestione, in Economia della Cultura, vol. 2.

140

GOLINELLI M.C. 2008, Cultura, impresa


e territorio. La valorizzazione del Pa-

KOTLER P., KOTLER N., 2004, Marketing


dei musei: obiettivi, traguardi, risorse,
Torino, Einaudi.
LORENZETTI G., 1974, Venezia e il suo
estuario. Guida storico artistica, Trieste, Edizioni LINT.
MANENTE M., FURLAN M.C., 2002, Per
un osservatorio sul turismo culturale:
motivazioni e comportamenti nella domanda, CISET, Venezia, Libreria Editrice Cafoscarina.
MERLO A.M.A., 1996, Assetti istituzionali innovativi per la cultura, in Roncaccioli A. (a cura di), Lazienda Museo.
Problemi economici, gestionali e organizzativi, Padova, Cedam.
MONTI A., 2004, Le politiche di privatizzazione dei servizi museali. Il modello
organizzativo dei musei del comune di
Roma, in Studi e Note di Economia,
n. 3.

RUSSO S., 2009, Le partnership pubblico-privato nella produzione culturale, in


Brunetti G., Rispoli M. (a cura di), Economia e management delle aziende di
produzione culturale, Bologna, Il Mulino.
SAHA K., 2009, Mystery Shopping. A
Marketing Research Tool to Measure
Custumer Satisfaction, in Journal of
business and Economic Issues, vol. 1.
SCATTOLIN A., 2010, 5LFRQJXUDUH LO
museo archeologico: casi in Veneto,
Tesi di Laurea magistrale in Economia
e Gestione delle Arti e delle Attivit
Culturali, Universit Ca Foscari, Anno
Accademico 2010/2011.

3URMHNWQDVNXSQRVWDOWLQDW
,]NXQMDNXOWXUQHJDQDUWRYDQMD
z arheolokim pomenom

TAMMA M., 1996, La produzione di servizi, in Volpato G. (a cura di), La gestione dimpresa, Padova, CEDAM.

5LIHULPHQWLDHVSHULHQ]HGLSLDQLFD]LRne culturale e interpretativa

TAMMA M., 1996, Prodotto e forma di


RHUWD GXH FRQFHWWL XWLOL SHU LQWHUSUHtare i sistemi complessi di produzioneerogazione, in Sinergie, n. 40.
TARASCO A. L. 2007, La gestione dei
EHQLFXOWXUDOLGHJOL(QWL/RFDOLSUROLGL
diritto e delleconomia, in Amministrazione in cammino.
TIRELLI M., 1993, Il Museo archeologico nazionale e le aree archeologiche di
Altino, Padova, Editoriale Programma.

NORMANN R., 2002, Ridisegnare limpresa: quando la mappa cambia il paesaggio, Milano, Etas.

TIRELLI M., 2011, (a cura di) Altino antica. Dai Veneti a Venezia, Venezia, Marsilio Editori.

NORMANN R., Ramirez R., 1995, Le


strategie interattive dimpresa: dalla catena alla costellazione del valore, Milano, EtasLibri.

VALENTINO P. A., 2003, I processi di riorganizzazione in atto nei musei: potenzialit e limiti  HM i-NSHYH@QHNy  M  75(((
71-73/ gennaio-dicembre.

PAROLINI C., 1996, Rete del valore e


strategie aziendali, Milano, EGEA.

WILSON A, 2001, Mystery shopping:


Using reception to measure Service Performance, in Psychology Marketing,
vol. 18.

PULINI I., 2009, Mostrare il passato:


turismo archeologico al Parco Archeologico della Terramara di Montale,
in , in Carlini L., Bacchella U., Zan L. (a
cura di), Organizzazione e gestione del
museo. Strategie di miglioramento, Bologna, Editrice Compositori.
RAMIREZ R., 1999, Value Co-production: intellectual origins and implication
for practice and research, in Strategic
Management Journal, vol. 20.
RISPOLI M., TAMMA M., 1996, Le imprese alberghiere nellindustria dei viaggi e
del turismo, Padova, Cedam.

&RPXQLWGLSURJHWWRQHOODOWLQDWH
8QHVSHULHQ]DGLSLDQLFD]LRQH
FXOWXUDOHDYDOHQ]DDUFKHRORJLFD

TAMMA M., 1992, Beni e servizi, cio


prodotti, in Sinergie, 29 settembre
-dicembre.

MORETTI A., 1999, La produzione museale, Torino, Giappelli Editore.

PRONTI S., Boccenti L., 1996, Il museo


tra istituzione e azienda : un modello
gestionale rivolto alla qualit : studio
sulla proposta dintervento per i musei
di Palazzo Farnese a Piacenza, Il Sole
24 Ore Libri, Milano.

www.vallecamonicacultura.it
www.museomontebelluna.it
www.parchivaldicornia.it
www.parcomontale.it
www.museiarcheologici.net
www.museipiceni.it
www.museomav.it
www.sistemamusei.ra.it
www. sistemimuseali.sns.it

WIZEMANN A., ALBERTI F. G., 2005,


Lassetto organizzativo della Fondazione per la gestione dei beni e delle attivit culturali, in Luic Papers, n. 175,
Serie Management ed Economia della
cultura 1, agosto.
ZAN L., 1999, Il management di un museo civico: lArcheologico di Bologna, in
Zan L. (a cura di), Conservazione e innovazione nei musei italiani. Management
e processi di cambiamento, Milano,
EtasLibri.
www.archeoavventura.it
www.arles-antique.cg13.fr
www.axp.lvr.de
www.bresciamusei.com
www.cortonamaec.org

BERRIDGE J. 2006, The Creative City, in


Plan Canada, 46 (1).
BIANCHINI F., PARKINSON M. (eds.)
1993, Cultural Policy and Regeneration:
The West European Experience, Manchester University Press.
BRINGER J. P. 1992, Mthodologie des
plans dinterprtation, Editions Aten
(Atelier technique des espaces naturels), Paris.
CARDINAL D. 1998, Changing Purposes
of Municipal Cultural Policy. Presentation at Cultural Policies and Cultural
Practices: Exploring Links between Culture and Social Change, Ottawa, Canadian Cultural Research Network.
CARTA M. 1999, Larmatura culturale
del territorio. Il patrimonio culturale
come matrice di identit e strumento di
sviluppo, FrancoAngeli, Milano.
CARTER J. (a cura) 1997, A sense of place, an interpretative planning, tourism
and environment initiative, in Scottish
Interpretation Network, Edinburgh.
C.C.C.S. (Communit de Communes de
la Combe de Savoie) 2009, Plan dInterprtation du Chemin des Vignes en
Combe de Savoie Viticole, Savois.
CREATIVECITY.CA 2010, Cultural Planning, Toolkit, British Columbia.
HAWKES J. 2001, The Fourth Pillar of
Sustainability: Cultures Essential Role,
in Public Planning, Melbourne, Cultural
Development Network.
ISTITUTO PANGEA ONLUS (a cura)
2000, Ente Parco Nazionale dei Monti
Sibillini, Piano dInterpretazione Ambientale.
LANDRY G. 2004, Measuring Community Creativity, in Plan Canada, 44 (2).

[

MCNULTY R. 1992, Culture and Communities: The Arts in the Life of American Cities. Washington, Partners for
Livable Cities.
OCIM, 1999, LAtelier technique des
espaces naturels: un pionnier franais
de linterprtation du patrimoine. Rencontre avec Jean-Marie Petit, in La Lettre de lOCIM, n 61.
PARC NATIONAL DE LA GUADELUPE
2006, Programme dAmenagement
2006-2011 du Parc National de la Guadalupe, Guadelupe.
REGION NORD PAS DE CALAIS, 2000,
Cahier technique, Mthodologie du
Plan dInterprtation, in Espace naturel rgional.
SACCO P. L., BLESSI G., TAVANO G. 2006,
European Culture Capitals and Local
Development Strategies: Comparing the
Genoa 2004 and Lille 2004 Cases, in
www.creativecity.ca/cecc/downloads/
Sacco.
STEVENS L. K. 1990, Developing a Strategic Cultural Plan: A Work Kit. Amherst,
MA: The Arts Extension Service, University of Massachusetts.
STEVENSON D. 2004, Civic Gold Rush:
Cultural Planning and the Politics of the
Third Way, in International Journal of
Cultural Policy, 10 (1).
Riferimenti generali
ASHMORE W., KNAPP B. (ed) 2000, Archaeologies of Landscape. Contemporary Perspectives, Malden-Oxford.
BALLETTI F., STOPPA S. 2005, Paesaggio
LQ HYROX]LRQH ,GHQWLFD]LRQH LQWHUSUHtazione, progetto, Milano.
BARRET J. C. 1987, Contextual Archaeology, in Antiquity, n. 61.
BERNARDI M. (a cura) 1991, Archeologia del paesaggio (IV ciclo di lezioni
sulla ricerca applicata in archeologia),
Certosa di Pontignano, Firenze.
BERTI E., GIACOPELLI A. L. 2010, Passaggi per citt. La deriva come forma di
conoscenza della citt: un workshop al
Convegno della Rete Interdottorato, in
Territori di ricerca, ricerche di territorio: atti dellVIII Convegno nazionale
QDSD HMSDQCNSSNQ@SN HM OH@MHB@YHNMD
urbana e territoriale, a cura di BARTOLINI S. et alii, vol. II, Firenze, Alinea,
2010, p. 76.
BIANCHINI F. 1991, Models of Cultural
Policies and Planning, in West European Cities, Presentation at a Cultural
Planning Conference, Victoria (Australia), Engineering Publications.
CAMBI F. TERRENATO N. 2001, Introduzione allarcheologia dei paesaggi, Roma.

[

CAMBI F. 2003, Archeologia dei paesaggi: fonti e diagnostica, Roma.


CAMBI F. (a cura) 2011, Manuale di archeologia dei paesaggi. Metodologie,
fonti, contesti, Carocci Editori, Roma.
CARERI F. 2006, Walkscape. Camminare
come pratica estetica, Torino, Einaudi.
CASSANO F. 2004, Homo civicus. La
ragionevole follia dei beni comuni, Edizioni Dedalo, Bari.
CERVELLATI P.L. 2000, Larte di curare la
citt, Il Mulino, Bologna.
CHEVALLIER R. 2000, Lecture du temps
dans lspace. Topographie archologique et historique, Paris.
FERRARIS G. 2011, Estetica razionale,
1@@DKKN"NQSHM@$CHSNQD ,HK@MN
FLORIO M., Progetti di investimento nel
settore dei beni culturali, in FLORIO M.
2002, La valutazione degli investimenti pubblici, F Angeli, Milano, vol. II, pp.
135-144.
FREY B.S. 1997, Evaluating Cultural
Property: The Economic Approach, in International Journal of Cultural Property 6: 231-246.
GIBSON L., PENDLEBURY J. 2009, Valuing historic environments, Ashgate.

corsi della memoria, in SPADOLINI B.,


GRASSELLI B., ANSINI L. (a cura) 2007,
La funzione educativa del cammino.
Aspetti pedagogici, psicologici e sociologici, Armando, Roma, pp. 149-159.
REGIONE DEL VENETO 2011, Piano
paesaggistico di dettaglio La laguna
di Caorle. Documento preliminare, Venezia.
RENFREW C., BAHN P. 2000, Archaeology: Theories, Merthods and Practice,
London.
RICCI L. 2005, 'LXVLRQH LQVHGLDWLYD
territorio e paesaggio. Un progetto per il
governo delle trasformazioni territoriali
contemporanee, Roma.
SANTAGATA W., SIGNORELLO G., Contingent Valuation of a Cultural Public
Good and Policy Design: The Case of
Napoli Musei Aperti, in Journal of Cultural Economics 24: 181-204, 2000,
Kluwer Academic Publishers.
SCARPELLINI P. 2007, Le concessioni
duso in Sardegna, in MIBAC, Il paesaggio archeologico. Resti e contesti: prospettive di condivisione su tutela e valorizzazione 7!NQR@,DCHSDQQ@MD@CDK
Turismo Archeologico, Paestum 15-18
Novembre 2007, Edizioni MP Mirabilia,
pp. 51-53.

GOODMAN N. 1978, Ways of Worldmaking, Hacket Publishing, IndianapolisCambridge (trad. it. 2008, Vedere e
costruire il mondo &HTR +@SDQY@DFKH 
Bari).

SIRCHIA G. (a cura) 2000, La valutazione economica dei beni culturali, Carocci


Editore, Roma.

HB-DP (Heritage Branch, Department


of Planning) 2009, Guidelines for the
preparation of the Archaeological Management Plans, New South Wales
(Australia).

SPADOLINI B. 2007, La funzione educativa del cammino a piedi, in SPADOLINI B., GRASSELLI B., ANSINI L. (a cura)
2007, La funzione educativa del cammino. Aspetti pedagogici, psicologici e
sociologici, a cura di, Roma, Armando,
pp. 125-136.

HODDER J. 1992, Leggere il passato.


Tendenze attuali dellarcheologia, Torino (ed. or. Cambridge, 1986).
MAGGI M. 1994, Il valore dei beni culturali: unapplicazione empirica, in BROSIO G. (ed.), Economia dei Beni culturali,
La Rosa Editrice, Torino.
MAGNAGHI A. 2000, Il progetto locale,
Einaudi, Torino.
NAVRUD S., READY R.C. (eds) 2002,
Valuing cultural heritage, Applying
environmental techniques to historic
buildings, monuments and artefacts,
Edward Elgar, Cheltenham.
/ 3 22(-( # "TKSTQ@ D OH@MHB@YHNMD 
Beni culturali tra tutela e mercato, in
TAVANO BLESSI G. 2006, Citt satellite?
Le Laives dEuropa: quale sviluppo attraverso la cultura, Meltemi, Roma, pp.
15-22.
/4+(3. ,  +    "@LLHM@QD ODQ-

Third World Archaeological Congress,


New Delhi.
VENTURI R., IZENOUR S. SCOTT BROWN
D. 1972, Learning from Las Vegas,
"@LAQHCFD ,@RR  SQ@C  HS ^ Imparare
da Las Vegas, a cura di ORAZI M. 2010,
0TNCKHADS ,@BDQ@S@
WHITLEY D. S. (ed) 1998, Reader in Archaeological Theory: Post-processual
and Cognitive Approaches, London.
ZAJCZYK F. (a cura) 1994, La valutazione delle politiche culturali, Irer, F Angeli.
Riferimenti al contesto altinate
MOZZI P. et alii 2011, Nuove tecnologie
per la ricostruzione della pianta della citt: il telerilevamento ad Altino, in TIRELLI
M. 2011, Altino antica. Dai Veneti e Venezia, Marsilio, Venezia, pp. 199-204.
NINFO A. et alii 2009, The map of Altinum, ancestor of Venice, in Science,
325, p. 577.
SCARFI B. M., TOMBOLANI M. 1985,
Altino preromana e romana, Musile di
Piave, Venezia.
TIRELLI M. 2011, Altino antica. Dai Veneti e Venezia, Marsilio, Venezia.

SOLNIT R. 2002, Storia del camminare,


Bruno Mondadori, Milano.

3$11$- 3. -  @  UNBD /NRS OQNcessuale, archeologia, in FRANCOVICH


R., MANACORDA D. (a cura), 2000, Dizionario di archeologia. Temi, concetti, metodi, Laterza, Roma-Bari, pp. 220-222.
TERRENATO N. (a cura), 2000b, Archeologia teorica, X Ciclo di lezioni sulla Ricerca applicata in Archeologia, Certosa
di Pontignano, Firenze.
TILDEN F. 1957, Interpreting our heritage, Chapel Hill, University of North
Carolina Press.
TOSCO C. 2007, Il paesaggio come storia, Il Mulino, Bologna.
TOWSE R., KHAKEE A. 1992, Cultural
economics, Springer Verlag, Berlin.
UCKO P. J. LAYTON R.(ed) 1994, The
Archaeology and Anthropology of Landscape. Papers and Proceedings of the

141

Finito di stampare nel mese di novembre 2013


OQDRRNKNRS@AHKHLDMSNSHONFQ@BN
Biblos Srl, Cittadella (PD) - Italia.

Progetto strategico Parco Archeologico dellAlto Adriatico - PArSJAd (CB017)


M@MYH@SNMDKK@LAHSNCDK/QNFQ@LL@ODQK@"NNODQ@YHNMD3Q@MREQNMS@KHDQ@
(S@KH@ 2KNUDMH@  C@K%NMCNDTQNODNCHRUHKTOONQDFHNM@KD
DC@HENMCHM@YHNM@KH
Strateki projekt Arheoloki parki severnega Jadrana - PArSJAd (CB017)
RNM@MBHQ@MUNJUHQT/QNFQ@L@DYLDIMDF@RNCDKNU@MI@2KNUDMHI@ (S@KHI@ 
iz sredstev Evropskega sklada za regionalni razvoj in nacionalnih sredstev

Ministero dellEconomia
e delle Finanze