Sei sulla pagina 1di 123

180874_CAT BOLZAN 2015fotolito.

indd 1

27/04/15 17:01

LETTI

006 - 183

BEDS

PARAVENTI

20, 21 | 84 - 91

WINDSCREENS

COMPLEMENTI, PLAID, CUSCINI E SCALDOTTI

184 - 223

COMPLEMENTARY ITEMS, CAR RUGS, CUSHIONS AND WARMERS

RIVESTIMENTI E FILATI PER CUCITURE


UPHOLSTERY AND SEAM THREAD

224 - 242

fair

pag. 06-09 | 22-33

sheen

pag. 52-55

lovely pag. 72-75

lovely light

pag. 92-101

fair big

pag. 14-19 | 32-43

sheen big

lovely chic

pag. 56-63

pag. 76-81

fair light

beautiful big

pag. 44-51

sheen light

lovely big

pag. 64-71

chic

pag. 82-89

pretty chic

nice chic

chic

pag. 102-109

pag. 110-115

pag. 134-137

handsome

pag. 156-161

pretty big chic

nice big

pag. 118-123

pag. 128-133

nice light

pag. 140-147

handsome big

nice

pag. 162-175

pag. 148-155

handsome light

pag. 176-183

fair
)DLUFRQIRUWHYROHHGDOODOLQHDVREULDLQXQULWUDWWRVRVWLFDWRDFRORULFKLDUL
,O ULYHVWLPHQWR GHO OHWWR D VFHOWD WUD WHVVXWR SHOOH HFRSHOOH UHQGH SRVVLELOH DQFKH OD
SHUVRQDOL]]D]LRQHGHLFRPSOHPHQWLSROWURQDSRXIHSHUVLQRORVSHFFKLR

)DLUFRPIRUWDEOHVREHUVW\OLQJZLWKDVRSKLVWLFDWHGORRNIHDWXULQJOLJKWFRORXUV
7KHEHGLVXSKROVWHUHGLQ\RXUFKRLFHRIIDEULFOHDWKHURUHFROHDWKHUDQGWKH
FRPSOHPHQWDU\LWHPVFDQEHFXVWRPL]HGWRPDWFKHDV\FKDLUSRXIDQGHYHQWKH
PLUURU

specchiera

poltrona

ilary

greta

Dalle forme semplici ed essenziali, la specchiera Ilary non conosce tempo. Grazie alla
possibilit di personalizzare il rivestimento, a scelta in tessuto o pelle, si adatta facilmente
ad ogni tipo di ambiente da quello pi tradizionale a quello pi contemporaneo.
Its simple uncluttered shape makes the Ilary mirror timeless. It can be covered in your
choice of fabric or leather and so adapt easily to any type of dcor, from the most
traditional to the most modern.

Con la poltrona Greta, Bolzan Letti dimostra ancora una volta la sua estrema eleganza,
risultato di uno stile senza tempo, perfetto nella ricerca di equilibri. Una poltrona classica,
capace di unire le tipiche forme della bergere a un bracciolo pi moderno e minimal e
a una seduta pi alta.
The Greta armchair demonstrates once again the elegance of Letti by Bolzans production,
provided by timeless styling that successfully seeks perfect balance. This Is a classical
armchair that unites the typical shape of a bergre with a more modern minimal armrest
and higher seat

11

pouf

12

pandora

Labbinamento con il pouf Pandora crea una zona adatta a chi cerca nel passato e nellispirazione
naturale non un contrasto, ma una nuova armonia.
Coordinated with the Pandora pouf it creates an area to please those who seek new harmony in
things of the past and natural inspiration.

13

fair big
Fair Big si veste di gold per impreziosire, in aperto contrasto alla semplicit formale,
anche gli ambienti pi minimal.
Fair Big is decked in gold to enhance even minimal decor, in contrast with the uncluttered
shapes.

15

fair

big

Il linguaggio universale della bellezza: linee 7KHXQLYHUVDOODQJXDJHRIEHDXW\RZLQJOLQHV


XLGH UHVWLWXLVFRQR DO SUROR XQHYDQHVFHQ]D JLYHWKHSUROHDQHWKHUHDOTXDOLW\WKDWDEVRUEV
PDWHULFD FKH DVVRUEH H GLIIRQGH XQD OXFH DQGGLIIXVHVSUHFLRXVOLJKWWKURXJKRXWWKHGD\
SUH]LRQDDGRJQLRUDGHOJLRUQR

16

17

paravento

sightly

Un elemento darredo di altri tempi si propone in una veste attualizzata e moderna per creare
XQDWPRVIHUDXQLFDQHOODFDPHUDGDOHWWR,OSUH]LRVRWHVVXWR6LQJSRUWDODUPDGL'RPLQLTXH
Kieffer by Rubelli.
Lelegante geometria ad esagono legati fra loro ricorda le nuances tipiche della ceramica
islamica.
Il tessuto Tulban invece caratterizzato dalla rigatura di colore deciso che sfuma nel colore
bianco e rimanda alle suggestioni dellarte Ottomana.

$ GpFRU HOHPHQW IURP GD\V JRQH E\ UHDSSHDUV LQ D PRGHUQ JXLVH WR FUHDWH D XQLTXH
atmoVSKHUHLQWKHEHGURRP7KHYDOXDEOH6LQJIDEULFLVGHVLJQHGE\'RPLQLTXH.LHIIHUIRU
Rubelli.
The elegant geometry of linked hexagon is reminiscent of the typical nuances of Islamic
pottery, whereas the Tulban fabric features strongly coloured stripes that shade into white
and recall Ottoman art.

20

fair
Linserto colorato e le cuciture in tinta della testiera di Fair, caratterizzano un semplice
pannello leggermente imbottito e interamente sfoderabile.
The coloured insert and tone on tone seams featured on the Fair headboard lend
character to a simple slightly padded panel with removable covers.

23

fair

8QR VSD]LR FKH YLDJJLD QHO WHPSR H GL RJQL HSRFD VD ULSRUWDUH XQLQHGLWD FLWD]LRQH FRQ DFFRVWDPHQWL VRVWLFDWL PDWHULDOL
sorprendenti e forme dimenticate. Un recupero della tradizione che sa sempre essere contemporaneo, seducente, sorprendente.
Fair ben si adatta allaccostamento con la poltrona Greta che, grazie alle sue proporzioni armoniose e le dimensioni contenute
qIDFLOHGDLQVHULUHQHOODUUHGDPHQWRGLFDVDGDOOLYLQJDOORVWXGLRQRDOODFDPHUDGDOHWWR
Disponibile in diversi colori, Greta pu essere rivestita in pelle (non sfoderabile) o in tessuto (sfoderabile) a scelta.
A decor that journeys through time and the ages brings unusual references with sophisticated coordination, amazing materials
and the shapes of long ago. Such recovery of tradition is always contemporary, beguiling and wonderful. Fair matches well
ZLWKWKH*UHWDDUPFKDLUZKRVHEDODQFHGSURSRUWLRQVDQGFRPSDFWQHVVWHDVLO\LQWRWKHGpFRUIURPWKHOLYLQJURRPWRWKH
study, including the bedroom.
Available in several colours, Greta can be upholstered in your choice of leather (not removable) or fabric (removable).

24

25

fair

c/copritestiera Well

Fair c/copritestiera Well un letto eclettico capace di vestirsi di molte personalit a


seconda dellabito che ha indosso. Punto dattrazione della zona notte, che si colora di
GHOLFDWDHUDIQDWDHOHJDQ]D
)DLUZLWKWKH:HOOKHDGERDUGFRYHULVDYHUVDWLOHEHGWKDWRR]HVSHUVRQDOLW\DFFRUGLQJWR
ZKDWLWZHDUVLWLVDIRFDOSRLQWLQWKHEHGURRPZKLFKWDNHVRQGHOLFDWHUHQHGHOHJDQFH

26

fair

28

Per chi ama avere una visione


dinsieme
sempre
nuova
e
inaspettata, Fair c/copritestiera
Well accompagnato, nella stessa
veste, dal pouf Circus.

29

For those who like a new and


surprising general view, Fair
with the Well headboard cover
goes perfectly with the Circus
pouf upholstered in the same
fabric.

fair

big

c/copritestiera Well

8QD SLDFHYROH VHQVD]LRQH GL PRUELGH]]D VRIFH H DYYROJHQWH SDUWLFRODUPHQWH


ULFHUFDWDQHOODPELHQWHQRWWH
,O OHWWR WHVVLOH PDWULPRQLDOH )DLU %LJ FFRSULWHVWLHUD :HOO q XQ FDOGR ULFKLDPR DOOD
WUDGL]LRQHLQFKLDYHPRGHUQD
$ SOHDVDQW VHQVDWLRQ RI DOOHPEUDFLQJ VRIWQHVV LV SDUWLFXODUO\ DSSUHFLDWHG LQ WKH
EHGURRP7KH)DLU%LJGRXEOHXSKROVWHUHGEHGZLWKWKH:HOOKHDGERDUGFRYHUJLYHVD
ZDUPLPSUHVVLRQRIWUDGLWLRQLQDPRGHUQNH\

33

fair

36

Alla rigidit formale, leggermente


smorzata dalla grande testiera
LPERWWLWDVLDIDQFDODIXQ]LRQDOLWj
GHOODPSLR YDQR FRQWHQLWRUH 7XWWR
DO VXR SRVWR WXWWR LQ RUGLQH OLQHH
VHPSOLFL H DVVHQ]D GL RUSHOOL SHU
JRGHUVLDSSLHQRLOPRPHQWRUHOD[

big

37

7KH ULJLG VKDSH VOLJKWO\


VRIWHQHG E\ WKH ODUJH SDGGHG
KHDGERDUG JRHV KDQG LQ
KDQG ZLWK WKH IXQFWLRQDOLW\
RI WKH FDSDFLRXV VWRUDJH
FRPSDUWPHQW D SODFH IRU
HYHU\WKLQJ DQG HYHU\WKLQJ LQ
LWV SODFH  6LPSOH XQFOXWWHUHG
OLQHV DOORZ \RX WR HQMR\
UHOD[LQJPRPHQWV

pouf

circus

Ormai un must nellarredamento di una casa moderna e aperta alla convivialit i pouf consentono di
de-strutturare lo spazio della conversazione e della zona notte rimanendo libero da schemi prestabiliti.
Dimensioni, forme, tessuti e colori possono essere combinati fra loro secondo i nostri gusti. Adatti al
living, alla zona notte, alla camera dei ragazzi
Now a must in the decor of a modern home that welcomes guests, poufs are used to de-structure the
living room and bedroom areas with freedom from established layouts. Dimensions, shapes, fabrics and
colours can be mixed and matched to your own taste. Suitable for living rooms, bedrooms, childrens
bedrooms

39

fair
40

big

c/copritestiera Well

Lidea progettuale semplice:


avvolgere la testiera imbottita con
un morbido mantello e trasformarla
in qualcosaltro.
Il rivestimento diventa abito e il
fruitore lo stilista.

The idea is simple: to wrap


the padded headboard in a
soft cloak and transform it into
something else.
The
upholstery
becomes
a garment and the user a
fashion designer.

fair / fair big / fair chic / fair big chic


Letto completamente sfoderabile, disponibile con o senza box
e c/box easy up.
Disponibile anche nella versione chic c/gonnellina. (vedi l.p.)
Disponibile con piede plastica, vasetto, cipolla o system anche
laccati scala Ral (vedi pag. 184)
The bed cover is completely removable, available with or
without storage box and with box easy up.
Available also in the chic version with skirt. (see p.l.)
Available with feet plastica, vasetto, cipolla or system which
can be lacquered in any colour ref. Ral scale (see pag. 184)
Cuciture: nervetto, ricamo,
cucitura lineare su gonnellina

applicazione

passamaneria,

Seams: contrasting seam, embroidery, with strip of fabric,


linear seam on the skirt

technical details

Colori passamaneria
Colours for strip

vedi / see pag. 242

Colori cuc.ricamo
Colours for embroidery

vedi / see pag. 240

Colori cuc.lineare
Colours for linear seam

vedi / see pag. 240-241

Accessori testiera: copritestiera Well


Accessories for the headboard: well headboard cover

Predisposto per materassi: l 90-100-120-140-160-170-180 x p 200

90-100-120-140-160-170-180

For mattresses: w 35 39 3/8 47 2/8 55 1/8 63 67


70 x d 78

200
99
29
111-121-141-161-181-191-201

33

Queen size: predisposto per materassi l 153 x p 203 for mattresses


w 60x d 80

231

VERSIONE BASE

King size: predisposto per materassi l 193-198 x p 203 for


mattresses w 76x d 80

90-100-120-140-160-170-180

200

119

29
111-121-141-161-181-191-201

33
231

VERSIONE BIG

43

fair light
La vasta scelta nei colori e nelle fantasie dei tessuti di Fair ne faciliter la personalizzazione,
trasformandolo in un vero e proprio oggetto darredo, opera di un artista a volte eccentrico e
a volte romantico.
The wide choice of colours and patterns for the fabrics used for Fair facilitate customization,
making the bed a veritable interior decor item, the work of an artist whos both eccentric and
romantic.

44

fair light

48

Luso sapiente dei diversi materiali rende Fair


Light un modello adatto a qualsiasi esigenza.
La morbidezza del tessuto e la sinuosit delle
sue forme ben si sposa con lessenzialit della
struttura in metallo che lo sostiene.

49

Clever use of different materials makes Fair


/LJKWDPRGHOWKDWWVDOOQHHGV,WVVRIWIDEULF
and sinuous shape go well with the uncluttered
metal frame.

fair light
Letto completamente sfoderabile.
Disponibile con piede vasetto, tubetto, inox, plaza, bridge, slitt
QLQR[HFURPRQHURDQFKHODFFDWLVFDOD5DO YHGLSDJ
7KHEHGFRYHULVFRPSOHWHO\UHPRYDEOH
$YDLODEOHZLWKIHHWYDVHWWRWXEHWWRLQR[SOD]DEULGJHVOLWWQ
LQR[DQGEODFNFKURPHGZKLFKFDQEHODFTXHUHGLQDQ\FRORXU
UHI5DOVFDOH VHHSDJ

Cuciture: nervetto, ricamo, applicazione passamaneria


6HDPVFRQWUDVWLQJVHDPHPEURLGHU\ZLWKVWULSRIIDEULF
Colori passamaneria
Colours for strip

vedi / see pag. 242

Colori cuc.ricamo
&RORXUVIRUHPEURLGHU\

vedi / see pag. 240

Accessori testiera: copri testiera Well


$FFHVVRULHVIRUWKHKHDGERDUGZHOOKHDGERDUGFRYHU

technical details

3UHGLVSRVWRSHUPDWHUDVVLO[S

90-100-120-140-160-170-180

)RUPDWWUHVVHVZ
[G
200

117

124-134-154-174-194-204-214

VERSIONE LIGHT

30
231

Queen size:SUHGLVSRVWRSHUPDWHUDVVLO[SIRUPDWWUHVVHV
Z[G
King size: SUHGLVSRVWR SHU PDWHUDVVL O  [ S  IRU
PDWWUHVVHVZ[G

51

sheen
Il calore e lintimit della memoria per un effetto trapuntato dove i materiali sono
protagonisti in un continuo gioco di riferimenti culturali. Sheen rivestito in cotone bianco
della collezione di Dominique Kieffer.

Warm intimate memories are recalled for a quilted effect in which materials play the
main role by juggling cultural references. Sheen upholstered in white cotton from the
Dominique Kieffer collection.

53

sheen

big

Letto funzionale dalle linee essenziali ed eleganti, un classico contemporaneo in grado


di adattarsi a qualsiasi ambiente.
Functional bed with essential elegant lines, a contemporary classic that will adapt to
any environment.

57

sheen big

60

Rigore ed eleganza si trovano unite


in questo letto con testata ad effetto
quadrettato che ben si accosta
alla linearit spezzata del tavolino
Teorema, dalle forme rigide e
pungenti in aperto contrasto con un
tono cromatico fuori dagli schemi.

61

Rigour and elegance come


together in this bed with a
squared effect headboard
that matches well with the
broken linearity of the Teorema
occasional table featuring a
crisp rigid shape in contrast
with the extraordinary colour
scheme.

sheen / sheen big


Letto completamente sfoderabile, disponibile con o senza box e
c/box easy up.
Realizzabile unicamente in tessuto.
Disponibile con piede vasetto, cipolla o system anche laccati scala
Ral (vedi pag. 184)

The bed cover is completely removable, available with or without


storage box and with box easy up.
The bed cover is available only in fabric.
Available with feet vasetto, cipolla or system,
which can be lacquered in any colour ref. Ral scale (see pag. 184)

Accessori testiera: copri testiera Well


Accessories for the headboard: well headboard cover
Predisposto per materassi: l 90-100-120-140-160-170-180 x p 200
For mattresses: w 35 39 3/8 47 2/8 55 1/8 63 67
70 x d 78

technical details

Queen size: predisposto per materassi l 153 x p 203 for mattresses


w 60x d 80
King size: predisposto per materassi l 193-198 x p 203 for
mattresses w 76x d 80
90-100-120-140-160-170-180

200
99
29
111-121-141-161-181-191-201

33
231

VERSIONE BASE

90-100-120-140-160-170-180

200

119

29
111-121-141-161-181-191-201

33
231

VERSIONE BIG

63

sheen

light

Il modello Sheen esprime nella testiera tutto lamore e la cura per i dettagli e per le
lavorazioni artigianali, fatte per impreziosire e rendere unico lambiente pi intimo della
casa
The headboard on the Sheen model expresses love and care for details and
craftsmanship, used to enhance the most intimate room in the house and make it unique.

64

sheen light

68

Materiali diversi tra loro si fondono in un


unicum progettuale: alla lucentezza della
struttura metallica, cos apparentemente esile
QHOODVXDVHPSOLFLWjVLDIDQFDODQDWXUDOLWjGHO
tessuto che sembra rimanere sospeso pronto
ad accoglierci in magici sogni.

69

Different materials blend in a unique design


concept: the brightness of the metal structure,
which appears slim in its simplicity, is offset by
the natural fabric that seems to be suspended,
ready to take us into the land of dreams.

sheen light
Letto completamente sfoderabile.
Realizzabile unicamente in tessuto.
Disponibile con piede vasetto, tubetto, inox, plaza, bridge, slitt
QLQR[HFURPRQHURDQFKHODFFDWLVFDOD5DO YHGLSDJ

7KHEHGFRYHULVFRPSOHWHO\UHPRYDEOH
DQGLVDYDLODEOHRQO\LQIDEULF
$YDLODEOHZLWKIHHWYDVHWWRWXEHWWRLQR[SOD]DEULGJHVOLWWQ
LQR[DQGEODFNFKURPHGZKLFKFDQEHODFTXHUHGLQDQ\FRORXU
ref. Ral scale VHHSDJ

Accessori testiera: copri testiera Well


$FFHVVRULHVIRUWKHKHDGERDUGZHOOKHDGERDUGFRYHU

3UHGLVSRVWR SHU PDWHUDVVL O  [


S
)RUPDWWUHVVHVZ
[G
Queen size: SUHGLVSRVWR SHU PDWHUDVVL O  [ S  IRU
PDWWUHVVHVZ[G

technical details

King size: SUHGLVSRVWR SHU PDWHUDVVL O  [ S  IRU


PDWWUHVVHVZ[G

90-100-120-140-160-170-180

200

117

124-134-154-174-194-204-214

30
231

VERSIONE LIGHT

71

lovely
Linee essenziali e pure fanno risplendere una testata dal sapore antico, per un letto che
si fa preziosa ma contemporanea alcova. Un lusso discreto, quasi sussurrato.
(VVHQWLDOSXUHOLQHVJLYHDQDQWLTXHDYRXUWRWKHKHDGERDUGRQDEHGZKLFKEHFRPHV
DGHFRUDWLYHEXWFRQWHPSRUDU\DOFRYH'LVFUHHWDOPRVWZKLVSHUHGOX[XU\

72

lovely chic
Un ambiente ispirato da contrasti inediti e dal design pi ricercato. Un luogo dove
DQWLFLSDUHOHQXRYHWHQGHQ]HHLQGDJDUHLQXRYLFRQQLGHOOLIHVW\OH
/RYHO\&KLFqSHQVDWRSHUFKLFHUFDDWPRVIHUHHOHJDQWLHVRVWLFDWHHYXROHHVSULPHUH
la propria visione glamour in ogni momento della giornata.

'pFRULQVSLUHGE\XQXVXDOFRQWUDVWVDQGUHQHGVW\OLQJFUHDWHDSODFHZKHUHQHZWUHQGV
DUHDQWLFLSDWHGDQGWKHODWHVWIURQWLHUVRIOLIHVW\OHDUHH[SORUHG
/RYHO\ &KLF LV GHVLJQHG IRU WKRVH ZKR VHHN HOHJDQW VRSKLVWLFDWHG DWPRVSKHUHV DQG
ZLVKWRH[SUHVVWKHLUORYHRIJODPRXUWKURXJKRXWWKHGD\

77

lovely

chic

Perfetto connubio di estetica e funzione, si integra negli ambienti valorizzandone latmosfera.


Il letto contenitore rappresenta una soluzione ormai diffusa ed ampiamente collaudata. Infatti,
oggi pi che mai importante poter usufruire di spazio in pi, per riporre ordinatamente e al
riparo dalla polvere biancheria ed oggetti.
A perfect combination of good looks and functionality blends into the environment to enhance
the atmosphere. The storage bed has now become a popular solution widely experimented
because these days it is increasingly important to make more space available for storing bedding
and other things tidily and away from dust.

lovely big chic


Lovely Big Chic interpreta unestetica allinsegna della leggerezza, in cui la molteplicit
dei rivestimenti garantisce unampia variet stilistica.
Lovely Big Chic interprets aesthetics on a light note, with a host of upholstery options
that provide a variety of styles.

83

lovely big chic

86

Lunico ornamento in questo modello nella


testiera, ritmata dalle particolari balze bicolore,
che in queste tenui nuance ne sottolineano le
grazie ed il design.

The only ornament on this model enhances the


headboard, which has special two-coloured
frills, the soft shades of which underline the
charm and design of the bed.

Il pouf Ares, in abbinamento, con la pratica


ed elegante dock station con diffusori per
iPod e iPhone, la proposta pi tecnologica
by Bolzan, che conferisce un carattere
decisamente moderno, originale e versatile
alla zona del relax per eccellenza.

The Ares pouf coordinates with a smart


practical dock station with iPod and iPhone
diffusers, a high tech proposition by Bolzan
that adds a modern, original and versatile
feature to the ideal relaxation area.

87

lovely / lovely big / lovely chic / lovely big chic


Letto completamente sfoderabile, disponibile con o senza box
e c/box easy up.
Realizzabile unicamente in tessuto.
Disponibile anche nella versione chic c/gonnellina. (vedi l.p.)
Disponibile con piede plastica, vasetto, cipolla o system anche
laccati scala Ral (vedi pag. 184)
The bed cover is completely removable, available with or
without storage box and with box easy up.
The bed cover is available only in fabric.
Available also in the chic version with skirt. (see p.l.)
Available with feet plastica, vasetto, cipolla or system which
can be lacquered in any colour ref. Ral scale (see pag. 184)
Cuciture: nervetto, cucitura lineare su gonnellina
Seams: contrasting seam, linear seam on the skirt
Colori cuc.lineare
Colours for linear seam

vedi / see pag. 240-241

Accessori testiera: copritestiera Well


Accessories for the headboard: well headboard cover

technical details

90-100-120-140-160-170-180

Predisposto per materassi: l 90-100-120-140-160-170-180 x p 200


200

For mattresses: w 35 39 3/8 47 2/8 55 1/8 63 67


70 x d 78

99
29
110-120-140-160-180-190-200

33

Queen size: predisposto per materassi l 153 x p 203 for mattresses


w 60x d 80

231

VERSIONE BASE

King size: predisposto per materassi l 193-198 x p 203 for


mattresses w 76x d 80

90-100-120-140-160-170-180

200

119

29
110-120-140-160-180-190-200

33
231

VERSIONE BIG

89

paravento

sightly

Il paravento Sightly, complemento funzionale per separare gli ambienti, quale originale alternativa ad
interventi invasivi, diventa vero e proprio protagonista della casa grazie ai colori sgargianti o caldi e a
fantasie inaspettate.
Ogni modulo composto da un telaio in legno massiccio rivestito nel tessuto prescelto. possibile
realizzare paraventi con 3, 4 o 5 moduli.
The Sightly windscreen is a functional complementary item used to divide areas as an original alternative
to invasive masonry work. It becomes a true star, with its bright or warm colours and amazing patterns.
Each module comprises a solid wood frame covered with your chosen fabric. Windscreens can be made
up of 3, 4 or 5 modules.

lovely

light

Un moderno effetto plissettato caratterizza questo letto tessile rivestito in foto da un


ricercato tessuto di Dominique Kieffer.
A modern pleated effect distinguishes this fabric upholstered bed, shown in the photo in
DUHQHG'RPLQLTXH.LHIIHUIDEULF

93

Con le cuciture artigianali e


lopzione di gambe in metallo che
passano da un lato allaltro, Lovely
nella versione Light un letto
moderno per una casa moderna.

lovely light

With its crafted seams and


option for metal legs going from
one side to the other, the Light
version of Lovely is a modern
bed for a contemporary home.

94

95

99

lovely light
Letto completamente sfoderabile.
Realizzabile unicamente in tessuto.
Disponibile con piede vasetto, tubetto, inox, plaza, bridge, slitt
QLQR[HFURPRQHURDQFKHODFFDWLVFDOD5DO YHGLSDJ
7KHEHGFRYHULVFRPSOHWHO\UHPRYDEOH
DQGLVDYDLODEOHRQO\LQIDEULF
$YDLODEOHZLWKIHHWYDVHWWRWXEHWWRLQR[SOD]DEULGJHVOLWWQ
LQR[DQGEODFNFKURPHGZKLFKFDQEHODFTXHUHGLQDQ\FRORXU
UHI5DOVFDOH VHHSDJ

Cuciture: nervetto
Seams: contrasting seam

Accessori testiera: copritestiera Well


$FFHVVRULHVIRUWKHKHDGERDUGZHOOKHDGERDUGFRYHU

technical details

90-100-120-140-160-170-180

3UHGLVSRVWRSHUPDWHUDVVLO[S
)RUPDWWUHVVHVZ
[G

200

117

123-133-153-173-193-203-213

VERSIONE LIGHT

30
231

Queen size:SUHGLVSRVWRSHUPDWHUDVVLO[SIRUPDWWUHVVHV
Z[G
King size: SUHGLVSRVWR SHU PDWHUDVVL O  [ S  IRU
PDWWUHVVHVZ[G

101

beautiful big chic


La materia di cui sono fatti i sogni? Per Beautiful non ci sono dubbi: qualcosa da
toccare con mano. Rivestito in tessuto, Beautiful il letto di chi non vuole mai rinunciare
DGXQRVWLOHHVFOXVLYRHURPDQWLFRJUD]LHDOOLQVHUWRRUHDOHVXOODWHVWLHUD

The stuff dreams are made of? For Beautiful there is no doubt: its something to caress.
Fabric upholstered, Beautiful is the bed for those who love exclusive romantic styling,
SURYLGHGE\WKHRUDOLQVHUWRQWKHKHDGERDUG

102

beautiful big chic

106

Il letto Beautiful, disponibile nella versione con


o senza contenitore, pu essere rivestito a
scelta in tessuto Shabby, Doublebuk o Wool.

107

The Beautiful bed, available with or without


storage space, can be upholstered in your
choice of Shabby, Doublebuk or Wool fabric.

beautiful big chic


Letto completamente sfoderabile, disponibile con o senza box
e c/box easy up.
Realizzabile unicamente in tessuto Shabby, Doublebuk Pure
wool e Wool.
Disponibile con piede plastica, vasetto, cipolla o system anche
laccati scala Ral (vedi pag. 184)
The bed cover is completely removable,
available with or without storage box and with box easy up.
The bed cover is available only in fabric Shabby, Doublebuk
Pure wool and Wool.
Available with feet plastica, vasetto, cipolla or system which
can be lacquered in any colour ref. Ral scale (see pag. 184)

Cuciture: cucitura lineare


Seams: linear seam
Colori cuc.lineare
Colours for linear seam

vedi / see pag. 240-241

Accessori testiera: copritestiera Well


Accessories for the headboard: well headboard cover

technical details

Predisposto per materassi: l 90-100-120-140-160-170-180 x p 200


90-100-120-140-160-170-180

For mattresses: w 35 39 3/8 47 2/8 55 1/8 63 67


70 x d 78
200

117

29
112-122-142-162-182-192-202

Queen size: predisposto per materassi l 153 x p 203 for mattresses


w 60x d 80
33

231

King size: predisposto per materassi l 193-198 x p 203 for


mattresses w 76x d 80

VERSIONE BIG

109

pretty chic
Pretty Chic lemblema della semplicit rigorosa, essenziale, priva di qualsiasi elemento
VXSHUXRIDWWDHFFH]LRQHSHULOWRFFRGLFRORUHFKHLPSUH]LRVLVFHLOERUGRGHOODPRUELGD
testiera imbottita e il rivestimento del ring.

3UHWW\&KLFLVDQHPEOHPRIXQFOXWWHUHGVLPSOLFLW\WKDWVHVVHQWLDOZLWKQRVXSHUXRXV
HOHPHQWVH[FHSWIRUWKHWRXFKRIFRORXUWKDWHQKDQFHVWKHHGJHRIWKHVRIWTXLOWHG
headboard and upholstered ring.

111

pretty

114

chic

Pretty Chic, minimal ed essenziale, si pu personalizzare in numerose combinazioni fra rivestimento e


biancheria. Per chi vuole essere chic anche nella pi assoluta semplicit.
Pretty Chic, minimal and essential, can be customised with numerous combinations of upholstery and bed
linen. For those who seek to be in vogue even with an absolutely simple style.

115

poltrona

brigitte

La poltrona Brigitte rappresenta lamore per le linee classiche: la sontuosit della sua veste dorata
e leleganza della gonna, rendono Brigitte una poltrona adatta ad arredare le stanze signorili delle
suite pi importanti.
The Brigitte armchair represents a love for classical lines: its opulent golden covers and elegant
RXQFH PDNH %ULJLWWH DQ DUPFKDLU MXVW ULJKW IRU WKH GHFRU RI GLVWLQJXLVKHG URRPV LQ LPSRUWDQW
suites.

116

117

pretty big chic


Un letto personalizzabile, grazie al rivestimento in tessuto minimal, per soddisfare i gusti
di ognuno. Dedicato a chi vuole essere primo attore del proprio ambiente, attraverso il
proprio tocco personale.
A bed that can be customised with minimal patterned fabric upholstery that meets all
tastes. Dedicated to those who wish to put their imprint on their surroundings by adding
a personal touch.

119

pretty chic / pretty big chic


Letto completamente sfoderabile, disponibile con o senza box
e c/box easy up.
Realizzabile unicamente in tessuto.
Disponibile con piede plastica, vasetto, cipolla o system anche
laccati scala Ral (vedi pag. 184)
The bed cover is completely removable,
available with or without storage box and with box easy up.
The bed cover is available only in fabric.
Available with feet plastica, vasetto, cipolla or system which
can be lacquered in any colour ref. Ral scale (see pag. 184)

Cuciture: cucitura lineare


Seams: linear seam
Colori cuc.lineare
Colours for linear seam

vedi / see pag. 240-241

Accessori testiera: copritestiera Well


Accessories for the headboard: well headboard cover

technical details

90-100-120-140-160-170-180

Predisposto per materassi: l 90-100-120-140-160-170-180 x p 200


For mattresses: w 35 39 3/8 47 2/8 55 1/8 63 67
70 x d 78

200
105
29
112-122-142-162-182-192-202

33

Queen size: predisposto per materassi l 153 x p 203 for mattresses


w 60x d 80

231

VERSIONE BASE

King size: predisposto per materassi l 193-198 x p 203 for


mattresses w 76x d 80

90-100-120-140-160-170-180

200

125

29
112-122-142-162-182-192-202

33
231

VERSIONE BIG

123

com

jubil

/HGLYHUVHYDULDQWLVLDQHOOHIRUPHFKHQHOOHQLWXUHGRQDQRHVWUHPDYHUVDWLOLWjDOJUXSSRFRPz-XELOq
,O FRQQXELR WUD JXUH JHRPHWULFKH H WUDGL]LRQDOL HOHPHQWL GL VWLOH GDQQR YLWD DG XQD FRPSRVL]LRQH
HFOHWWLFDHGLFDUDWWHUH
-XELOqqXQPL[GLFODVVLFLWjPLQLPDOLVPRHVHPSOLFLWjIRUPDOHLQQRYD]LRQHHIXQ]LRQDOLWjWXWWRLQXQR
&RVDYROHUHGLSL"
7KHGLIIHUHQWYDULDQWVLQERWKVKDSHDQGQLVKHVPDNHWKH-XELOqGUHVVLQJWDEOHVHWH[WUHPHO\YHUVDWLOH
&RRUGLQDWLQJJHRPHWULFDOJXUHVDQGWUDGLWLRQDOVW\OLQJHOHPHQWVSURGXFHDQHFOHFWLFFRPSRVLWLRQIXOO
RIFKDUDFWHU
-XELOqLVDPL[RIFODVVLFDOPLQLPDODQGVLPSOHIRUPVLQQRYDWLRQDQGIXQFWLRQDOLW\DOOLQRQH:KDW
PRUHFRXOGRQHZLVKIRU"

124

125

nice
8Q OHWWR HVVXRVR FDUDWWHUL]]DWR GDOOH OLQHH RQGXODWH GHOOD WHVWDWD 8Q FRPSOHPHQWR
GDUUHGRPRGHUQRFKHUHJDODDOODPELHQWHTXHOWRFFRGHOLFDWRUHWUz
$OLWKHEHGIHDWXULQJWKHXQGXODWLQJOLQHVRIWKHKHDGERDUG$PRGHUQGpFRULWHPWKDW
OHQGVWKHURRPDGHOLFDWHYLQWDJHWRXFK

128

Un design aggraziato e gentile per


un letto protagonista garbato della
zona notte.
Il delicato motivo della testata
ricorda ali di farfalla, onde marine
si chiudono gli occhi e i sogni ci
portano lontano..

nice

Gentle graceful design for a


bed that brings charm into the
bedroom.
The delicate motif on the
KHDGERDUG UHFDOOV EXWWHU\
wings, ocean waves close
\RXU H\HV DQG OHW GUHDPV
FDUU\\RXDZD\

130

131

nice

chic

7HVVXWL GL VSHVVRUH WRQL QDWXUDOL H VRIW XQ XQLFR SURJHWWR VDUWRULDOH GHQLVFH H
LGHQWLFDLOOHWWR1LFH&KLF/HOHJDQ]DQRQVFRQWDWDFXFLWXUHFRQFRORUHDFRQWUDVWRSHU
VRWWROLQHDUHDOPDVVLPROHIIHWWRVWURSLFFLDWRGHOODWHVWDWD
:HLJKW\ IDEULFV QDWXUDO VRIW VKDGHV D XQLTXH VDUWRULDO SURMHFW GHQHV DQG LGHQWLHV
WKH 1LFH &KLF EHG  2ULJLQDO HOHJDQFH VHDPV LQ FRQWUDVWLQJ FRORXUV WR XQGHUOLQH WKH
FUXPSOHGHIIHFWRIWKHKHDGERDUG

134

pouf

circus

/D IRUPD FLUFRODUH GLQDPLFD H JLRLRVD H OH VYDULDWH QLWXUH OR UHQGRQR YHUVDWLOH H
adattabile. In modalit seriale arreda e completa ogni ambiente. Un prodotto semplice
PDFRPSLXWR
7KH FLUFXODU VKDSH G\QDPLF DQG MR\IXO DQG YDULRV QLVKHV PDNH LW YHUVDWLOH DQG
DGDSWDEOHWRIXUQLVKDQGFRPSOHWHDQ\URRP

139

nice

big

La particolarit di Nice tutta nella testata con effetto stropicciato.


La maestria dellartigianato tessile f di questo letto un elemento adatto ad un ambiente
caldo e intimo che ritrova nella matericit del tessuto il suo modo di essere: forte e di
carattere ma al tempo stesso romantico e sognatore.
The special feature of Nice is in the crumpled effect of the headboard.
Skilled textile craftsmanship has produced a fabric that makes this bed suitable for a
warm cosy environment: it has strong personality but at the same time is romantic and
dreamy.

141

nice

142

big

Osare la parola dordine: unesplosione di


colore ed energia che sceglie bellissimi toni
intensi color prugna, mescolati ai pi classici
blu scuro e verde militare.

143

To dare is the password: an explosion of colour


and energy featuring a bright intense plum
colour mixed with the more classical dark blue
and olive green.

nice / nice big / nice chic / nice big chic


Letto completamente sfoderabile,
disponibile con o senza box e c/box easy up.
Realizzabile unicamente in tessuto.
Disponibile anche nella versione chic c/gonnellina. (vedi l.p.)
Disponibile con piede plastica, vasetto, cipolla o system anche
laccati scala Ral (vedi pag. 184)
The bed cover is completely removable, available with or
without storage box and with box easy up.
The bed cover is available only in fabric.
Available also in the chic version with skirt. (see p.l.)
Available with feet plastica, vasetto, cipolla or system which
can be lacquered in any colour ref. Ral scale (see pag. 184)
Cuciture: nervetto, applicazione passamaneria, cucitura
lineare su gonnellina
Seams: contrasting seam, with strip of fabric, linear seam on
the skirt

technical details

Colori passamaneria
Colours for strip

vedi / see pag. 242

Colori cuc.lineare
Colours for linear seam

vedi / see pag. 240-241

Accessori testiera: copritestiera Well


Accessories for the headboard: well headboard cover

90-100-120-140-160-170-180

200
99
29
113-123-143-163-183-193-203

33
231

VERSIONE BASE

Predisposto per materassi: l 90-100-120-140-160-170-180 x p 200


For mattresses: w 35 39 3/8 47 2/8 55 1/8 63 67
70 x d 78

90-100-120-140-160-170-180

Queen size: predisposto per materassi l 153 x p 203 for mattresses


w 60x d 80
200

119

29
113-123-143-163-183-193-203

33

King size: predisposto per materassi l 193-198 x p 203 for


mattresses w 76x d 80

231

VERSIONE BIG

147

nice

light

Le texture morbide e loriginale motivo stropicciato sulla testiera creano un letto che
reinventa latmosfera della zona notte emozionandoci.
Soft textures and an original crumpled effect on the headboard create a bed that
invents a new exciting atmosphere in the bedroom.

148

nice

150

light

In Nice Light gli elementi compositivi


mantengono indipendenti il proprio carattere,
per funzione e presenza scultorea, per
fondersi insieme in un connubio perfetto di
grazia, morbidezza, leggerezza, minimalismo,
essenzialit e verticalismo.

151

The units making up Nice Light compositions


maintain their own individual independence
regarding functions and sculptural effect, to
blend and perfectly combine grace, softness,
airiness and minimalism developed vertically.

nice light
Letto completamente sfoderabile, realizzabile unicamente in
tessuto.
Disponibile con piede vasetto, tubetto, inox, plaza, bridge, slitt
QLQR[HFURPRQHURDQFKHODFFDWLVFDOD5DO YHGLSDJ

7KH EHG FRYHU PDGH LV FRPSOHWHO\ UHPRYDEOH DQG DYDLODEOH


RQO\LQIDEULF
$YDLODEOHZLWKIHHWYDVHWWRWXEHWWRLQR[SOD]DEULGJHVOLWWQ
LQR[DQGEODFNFKURPHGZKLFKFDQEHODFTXHUHGLQDQ\FRORXU
UHI5DOVFDOH VHHSDJ

Cuciture: nervetto, applicazione passamaneria


6HDPVFRQWUDVWLQJVHDPZLWKVWULSRIIDEULF
Colori passamaneria
Colours for strip

vedi / see pag. 242

Accessori testiera: copri testiera Well


$FFHVVRULHVIRUWKHKHDGERDUGZHOOKHDGERDUGFRYHU

technical details

90-100-120-140-160-170-180

3UHGLVSRVWRSHUPDWHUDVVLO[S
200

117

126-136-156-176-196-206-216

VERSIONE LIGHT

)RUPDWWUHVVHVZ
[G
30

231

Queen size:SUHGLVSRVWRSHUPDWHUDVVLO[SIRUPDWWUHVVHV
Z[G
King size: SUHGLVSRVWR SHU PDWHUDVVL O  [ S  IRU
PDWWUHVVHVZ[G

155

handsome
8Q OHWWR LQ WHVVXWR GDO FRQFHSW LQIRUPDOH H LQVLHPH VRVWLFDWR ,O GHVLJQ DOOHJUR H OD
FUHDWLYjGHJOLDEELQDPHQWLORUHQGRQRDGDWWRDXQSXEEOLFRGLQDPLFRHJLRYDQHFKHYLYH
LQVSD]LYHUVDWLOLHVHPSUHPXWHYROL
$ IDEULF EHG EDVHG RQ D FRQFHSW WKDW LV ERWK LQIRUPDO DQG VRSKLVWLFDWHG7KH MR\RXV
GHVLJQDQGFUHDWLYHFRRUGLQDWLRQVPDNHLWVXLWDEOHIRUD\RXQJG\QDPLFWDUJHWWKDWOLYHV
LQYHUVDWLOHHYHUFKDQJLQJHQYLURQPHQWV

156

handsome

160

Elementi colorati che diventano icone di


design, assoluti protagonisti di uno spazio
GLQDPLFR H VRVWLFDWR 8QDWPRVIHUD LURQLFD
FKHIDHPHUJHUHLOODWRSLOHJJHURGHOGHVLJQH
ULYHODXQPRGRGLDELWDUHSLIULHQGO\
+DQGVRPH q SHU FKL FHUFD QHOOHOHJDQ]D GHL
FRORULXQQXRYRPRGRGLDFFRJOLHUHODQRWWH

161

Coloured
elements
become
design
LFRQV DEVROXWH SURWDJRQLVWV LQ D G\QDPLF
VRSKLVWLFDWHGDPELHQFH$QLURQLFDWPRVSKHUH
H[DOWV WKH PRUH IULYRORXV VLGH RI GHVLJQ DQG
UHYHDOVDIULHQGOLHUZD\RIOLYLQJ
+DQGVRPH LV MXVW ULJKW IRU WKRVH ZKR VHHN D
QHZ DSSURDFK WR QLJKW WLPH WKURXJK HOHJDQW
FRORXUV

handsome big
Caratteristica del modello Handsome Big loriginale rivestimento sdoppiato della
testiera, reso ancora pi evidente dalla sua altezza maggiorata e dai bordi over-size
lasciati liberi.
In linea con questo stile progettuale il gruppo Jubil qui a seguire, nelle versioni com
4 cassetti e comodino. Dai volumi rigorosi e compatti sono gli oggetti darredo ideali per
riporre tutto in ordine. Come non ripensare con nostalgia al vecchio cassettone della
nonna?
On of the features of the Handsome Big model is the original split upholstery on the
headboard, highlighted even more by its increased height and freely arranged oversize
borders.
In line with this style is the Jubil set shown below as a 4-drawer dressing table and
bedside table. With their rigorous compact dimensions they are ideal items for keeping
everything in its place. How can we not think back with nostalgia to grannys old linen
chest?

163

164

165

handsome big
In Handsome, texture, fantasie e tessuti sono i protagonisti di una collezione darredo
attenta alle tendenze della moda.
Lo stile autunnale, proiettato in un ambiente giovane, dinamico e fashion, parla
scozzese. Molto diffuso come disegno per coperte e plaid, questo mood a scacchi e
quadri lo ritroviamo anche nella biancheria per la casa e persino nei letti per una camera
da letto dallinconfondibile sapore british tradizionale.
In Handsome, texture, patterns and fabrics are the stars of a furniture collection that has
an eye for the latest fashion trends.
The autumn style, projected into a young dynamic fashionable environment, speaks
Scottish. Very popular for blankets and car rugs, this typical plaid pattern is also found
in the household linen and even on beds that give the bedroom an unmistakable British
air.

166

168

169

handsome

big

Le grandi proporzioni della testiera e le geometrie pied de poule, evidenziate mediante giochi di
chiaroscuri e insoliti accostamenti di trama, diventano lelemento caratterizzante principale di una
proposta che interpreta la camera da letto come spazio sempre pi personale e glamour.
The large proportions of the headboard, together with the geometry of tartan, highlighted by
juggling light and dark and unusual weaves, are the main features of furniture that interprets the
bedroom as an increasingly personal and glamorous space.

172

173

handsome / handsome big


Letto completamente sfoderabile, disponibile con o senza box
e c/box easy up.
Disponibile con piede plastica, vasetto, cipolla o system anche
laccati scala Ral (vedi pag. 184)
The bed cover is completely removable, available with or
without storage box and with box easy up.
Available with feet plastica, vasetto, cipolla or system which
can be lacquered in any colour ref. Ral scale (see pag. 184)

Accessori testiera: copritestiera Well


Accessories for the headboard: well headboard cover

technical details

Predisposto per materassi: l 90-100-120-140-160-170-180 x p 200

90-100-120-140-160-170-180

For mattresses: w 35 39 3/8 47 2/8 55 1/8 63 67


70 x d 78

200
103
29
117-127-147-167-187-197-207

33
231

VERSIONE BASE

Queen size: predisposto per materassi l 153 x p 203 for mattresses


w 60x d 80
King size: predisposto per materassi l 193-198 x p 203 for
mattresses w 76x d 80

90-100-120-140-160-170-180

200

123

29
117-127-147-167-187-197-207

33
231

VERSIONE BIG

175

handsome

light

Geometrie rigorose per una proposta che esprime un stile di vita libero, informale, in cui
lattualit e la ricercatezza di nuovi materiali e tendenze, convivono con la spontaneit
e la naturalezza.
6WULFWJHRPHWULHVWRH[SUHVVDIUHHLQIRUPDOOLIHVW\OHZKHUHUHQHGQHZPDWHULDOVDQG
trends go hand in hand with spontaneity and naturalness.

177

handsome

178

light

Handsome Light dalle linee sottili e rigorose


fa parlare di s per la testata in tessuto
sfoderabile con cerniera che corre per tutto
LO SUROR GHO OHWWR FDUDWWHUL]]DQGRQH OR VWLOH H
LO GHVLJQ DOOLQVHJQD GHOOD OHJJHUH]]D H GHOOD
IXQ]LRQDOLWj

179

Handsome Light with its slim severe lines is


distinguished by its headboard with removable
IDEULF FRYHU DQG D ]LS WKDW UXQV URXQG WKH
HQWLUHEHGSUROHWREHFRPHDGHVLJQIHDWXUH
for a style under the banner of airiness and
IXQFWLRQDOLW\

handsome light
Letto completamente sfoderabile.
Disponibile con piede vasetto, tubetto, inox, plaza, bridge, slitt
QLQR[HFURPRQHURDQFKHODFFDWLVFDOD5DO YHGLSDJ
7KHEHGFRYHULVFRPSOHWHO\UHPRYDEOH
$YDLODEOHZLWKIHHWYDVHWWRWXEHWWRLQR[SOD]DEULGJHVOLWWQ
LQR[DQGEODFNFKURPHGZKLFKFDQEHODFTXHUHGLQDQ\FRORXU
UHI5DOVFDOH VHHSDJ

Accessori testiera: copri testiera Well


$FFHVVRULHVIRUWKHKHDGERDUGZHOOKHDGERDUGFRYHU

technical details

90-100-120-140-160-170-180

3UHGLVSRVWRSHUPDWHUDVVLO[S
200

121

130-140-160-180-200-210-220

VERSIONE LIGHT

)RUPDWWUHVVHVZ
[G
30

231

Queen size: SUHGLVSRVWRSHUPDWHUDVVLO[SIRUPDWWUHVVHV


Z[G
King size: SUHGLVSRVWR SHU PDWHUDVVL O  [ S  IRU
PDWWUHVVHVZ[G

183

technical details

piedi

piedi

versione base e big

La personalizzazione dei Letti by Bolzan arriva ai massimi livelli : i piedini


in legno, nelle versioni Base, Big e Light, sono disponibili anche laccati
scala Ral
Customization of beds by Bolzan reaches its apex: the wooden feet for the
Base, Big and Light versions are also available lacquered in RAL colours.

Cipolla

System

Bridge

Inox

Tubetto

Vasetto

Plaza

Slitt Cromo Nero

Plastica

Vasetto

Slitt Inox

versione light

co p e e t
complementi

TECHNICAL INFORMATIONS, DIMENSIONS,FINISHINGS

pouf ARES con DOCK STATION


Applicazione per I-phone.
Disponibile nei pouf con cassetto a scomparsa.

Device for iPhone.


Available on poufs with push-down drawer

Caratteristiche tecniche:

Technical features:

- Lettore audio iPhone/iPod


- Bluetooth
- Porta USB
- Porta AUX IN per lettori MP3, iPhone/iPod, PC,
PSP
- Lettore SD card
- Carica batterie iPhone/iPod e USB

- iPhone/iPod player
- Bluetooth
- USB port
- AUX port for MP3 players/iPod, PC, PSP
- SD card player
- Battery charger for iPhone, iPod and USB

pouf TONDO
Pouf sfoderabile in tessuto e non sfoderabile in
pelle ed ecopelle.

pouf ARES

pagg. 84, 86, 87

pagg. 35-37, 142, 145

Pouf con cassetto a scomparsa, non sfoderabile.


Disponibile con top nel rivestimento scelto, con
vetro argentato o laccato colori scala Ral.
Disponibile con dock station.
Pouf with push-down drawer, cover not removable.
Available with top in same cover of pouf in silver
glass or lacquered in any colour of Ral scale.
Available with docking station.

pouf CUBE

pouf SUN

pagg. 94, 96, 98, 99, 167-173, 178-181

Pouf c/interno in polistirolo, sfoderabile in tessuto


e non sfoderabile in pelle ed ecopelle.

Pouf c/interno in polistirolo, sfoderabile.


Non realizzabile in pelle ed ecopelle.

3RXIOOHGZLWKSRO\VW\UHQHUHPRYDEOHFRYHULQ
IDEULFQRQUHPRYDEOHLQOHDWKHURUHFROHDWKHU

3RXIOOHGZLWKSRO\VW\UHQHUHPRYDEOHFRYHUQRW
DYDLODEOHLQOHDWKHURUHFROHDWKHU

'LPOSK
'LPZGK

'LPK
'LPK

Dim. l 45 p 45 h 46
Dim. w 17 11/16 d 17 11/16 x h 18 1/8

pouf HAWAII

pagg. 16, 18, 52, 55, 74, 95, 97-99


105-107, 150

Pouf with removable cover in fabric and


non-removable in leather or eco-leather.

pag. 91

pouf ROUND

Pouf sfoderabile in tessuto e non sfoderabile in


pelle ed ecopelle.

Pouf c/interno in polistirolo, sfoderabile in tessuto


e non sfoderabile in pelle ed ecopelle.

Pouf with removable cover in fabric, non-removable in leather or eco-leather.

3RXIOOHGZLWKSRO\VW\UHQHUHPRYDEOHFRYHULQ
IDEULFQRQUHPRYDEOHLQOHDWKHURUHFROHDWKHU

Dim. l 100 p 100 h 38


Dim. w 39 3/8 d 39 3/8 h 14 15/16

'LPK
'LPK

tavolino TEOREMA small

pagg. 16-19, 48, 58-61, 65-69, 140-144

6WUXWWXUDLQDFFLDLRYHUQLFLDWRDSROYHULFRQSLDQR
LQ0')VDJRPDWR
Finitura laccato scala Ral .

pouf CIRCUS

pagg. 96, 140-144

Pouf sfoderabile in tessuto e non sfoderabile in


pelle ed ecopelle.

Pouf non sfoderabile.


Pouf with non removable cover.

Pouf with removable cover in fabric and


non-removable in leather or eco-leather.

Dim. l 100 p 100 h 38


Dim. w 39 3/8 d 39 3/8 h 14 15/16

Dim. 110 h 39
Dim. 43 5/16 h 15 3/8

188

pagg. 29, 31, 38, 39, 137-139

tavolino TEOREMA medium

pagg. 46-49, 58-61, 66, 68, 75


79-81, 136, 149-153

3RZGHUFRDWHGVWHHOVWUXFWXUHZLWK0')WRSWKDW
FDQEHODFTXHUHGLQDQ\FRORXU5DOVFDOHUHI
'LPVPDOO[K
'LPVPDOO[K

Dim. 45 h 46
Dim. 17 11/16 h 18 1/8

pouf TRAPUNTATO

pag. 32, 85, 90

tavolino TEOREMA large

pag. 75

6WUXWWXUDLQDFFLDLRYHUQLFLDWRDSROYHULFRQSLDQR
LQ0')VDJRPDWR
Finitura laccato scala Ral .

6WUXWWXUDLQDFFLDLRYHUQLFLDWRDSROYHULFRQSLDQR
LQ0')VDJRPDWR
Finitura laccato scala Ral .

3RZGHUFRDWHGVWHHOVWUXFWXUHZLWK0')WRSWKDW
FDQEHODFTXHUHGLQDQ\FRORXU5DOVFDOHUHI

3RZGHUFRDWHGVWHHOVWUXFWXUHZLWK0')WRSWKDW
FDQEHODFTXHUHGLQDQ\FRORXU5DOVFDOHUHI

'LP[K
'LP[K

'LPODUJH[K
'LPODUJH[K

189

pag. 75

TECHNICAL INFORMATIONS, DIMENSIONS,FINISHINGS

71

71

185

140
50

50

specchiera ILARY

poltrona GRETA

pagg. 10, 11, 121

pagg. 10, 11, 25

Poltrona sfoderabile in tessuto e non sfoderabile


in pelle.

Specchiera non sfoderabile, posizionabile in


verticale od orizzontale, disponibile in qualsiasi
misura.

Armchair with removable cover in fabric,


non-removable in leather.

Mirror with non removable cover, can be placed


horizontally or vertically.
Available in all sizes.

Dim. l 55 p 63 h 77
Dim. w 21 5/8d 24 13/16 h 30 5/16

com JUBIL 3 + 3 cassetti

com JUBIL 3 + 3 cassetti piccoli

pag. 120

Com non sfoderabile, realizzabile unicamente


nel tessuto Spring.
Maniglie e zoccolo laccato opaco scala Ral

Com non sfoderabile, realizzabile unicamente


nel tessuto Spring.
Maniglie e zoccolo laccato opaco scala Ral.

Non removable chest of drawers cover, avaible


only in the following fabric Spring
Handle and socle lacquered in matt colour
specify Ral scale ref.

Non removable chest of drawers cover, avaible


only in the following fabric Spring.
Handle and socle lacquered in matt colour
specify Ral scale ref.

Dim. l 185 p 50 h 71
Dim. w 72 7/8 d 19 11/16 h 28

Dim. l 140 p 50 h 71
Dim. w 55 3/16 d 19 11/16 h 28

38

38
35

pagg. 124, 125

182
172
162

90

182
172
162

139

35

60

60

182
172
162

50

50

90

poltrona BRIGITTE

pouf PANDORA

pagg. 116, 117

Poltrona sfoderabile, non realizzabile in pelle ed


ecopelle.

60

pagg. 12, 13, 54

Pouf con contenitore, sfoderabile.


Pouf with storage box, the cover pouf is
removable.

Armchair with removable cover, not available in


leather or eco-leather.

Dim. 89/99x32xh.38
Dim. W 35/39x12 5/8 h 16

Dim. l 88 p 90 h 103
Dim. w 34 5/8 d 35 7/16 h 40 9/16

SETTIMINO

paravento SIGHTLY

pag. 126

Settimino
non
sfoderabile,
realizzabile
unicamente nel tessuto Spring.
Maniglie e zoccolo laccato opaco scala Ral.

Paravento non sfoderabile.

Non removable seven drawers cover, avaible


only in the following fabric Spring.
Handle and socle lacquered in matt colour
specify Ral scale ref.

Dim. 60xh.162 / 172 / 182


Dim. w 23 5/8 h. 63 3/4 / 67 11/16 / 71 5/8

Non removable screen

Dim. l 50 p 50 h 139
Dim. w 19 11/16 d 19 11/16 h 54 3/4

88

54

95

50

comodino JUBIL

50

50

com JUBIL 4 cassetti

pagg. 162, 164

Comodino non sfoderabile, realizzabile


unicamente nel tessuto Spring.
Maniglie e zoccolo laccato opaco scala Ral

Com non sfoderabile, realizzabile unicamente


nel tessuto Spring.
Maniglie e zoccolo laccato opaco scala Ral

Non removable bedside table cover, avaible


only in the following fabric Spring.
Handle and socle lacquered in matt colour
specify Ral scale ref.

Non removable chest of drawers cover, available


only in the following fabric Spring.
Handle and socle lacquered in matt colour
specify Ral scale ref.

Dim. l 50 p 50 h 54
Dim. w 19 11/16 d 19 11/16 h 21 2/8

pagg. 164, 165

Dim. l 95 p 50 h.88
Dim w 37 6/16 d 19 11/16 h. 34 5/8

190

191

pagg. 14, 16, 19-21, 85, 87, 90, 91, 159

pad
plaid

TECHNICAL INFORMATIONS, DIMENSIONS,FINISHINGS

picasso

Nero cod. PS - 1

Celeste cod. PS - 16

Ottanio cod. PS - 2

Terra cod. PS - 17

Fucsia/Beige cod. PS - 12

Rosa/Fucsia cod. PS - 9

Amaranto cod. PS - 18

&RPSRVL]LRQH  PRKDLU   ODQD   EUD


poliammidica
Dimensioni: 130 x 180 cm
Peso: 335 gr/m2

Composition: 26% mohair + 66% wool + 8% polyamide


Dimensions: 130 x 180 cm
Weight: 335 gr/m2

194

195

TECHNICAL INFORMATIONS, DIMENSIONS,FINISHINGS

australia

Nero cod. E - 6

Ocra cod. E - 23

Celeste cod. E - 24

Rosa cod. E - 18

Azzurro cod. E - 32

Grigio cod. E - 33

&RPSRVL]LRQHODQDDXVWUDOLDQDH[WUDQD
Dimensioni: 130 x 200 cm
Peso: 380 gr/m2

&RPSRVLWLRQH[WUDQHDXVWUDOLDQZRRO
Dimensions: 130 x 200 cm
Weight: 380 gr/m2

196

197

TECHNICAL INFORMATIONS, DIMENSIONS,FINISHINGS

cashlan

Ocra cod. CL - 449

Composizione: 60% cashmere + 40% lana


Dimensioni: 130 x 180 cm
Peso: 280 gr/m2

Composition: 60% cashmere + 40% wool


Dimensions: 130 x 180 cm
Weight: 280 gr/m2

198

199

TECHNICAL INFORMATIONS, DIMENSIONS,FINISHINGS

stitching

Grigio/Celeste cod. ST - 7

Grigio cod. ST - 8

Beige cod. ST - 9

Oro/Fucsia cod. ST - 10

Oro cod. ST - 11

Composizione: 73% mohair + 27% lana


Dimensioni: 130 x 200 cm
Peso: 450 gr/m2

Composition: 73% mohair + 27% wool


Dimensions: 130 x 200 cm
Weight: 450 gr/m2

200

201

TECHNICAL INFORMATIONS, DIMENSIONS,FINISHINGS

galles

Grigio cod. 3665 B - 2

Beige cod. 3665 F - 6

Salvia cod. 3665 E - 5

Celeste cod. 3665 G - 7

Giallo cod. 3300 L - 11


Composizione: 100% lambswool
Dimensioni: 147 x 179 cm
Peso: 1,2 kg

Composition: 100% lambswool


Dimensions: 147 x 179 cm
Weight: 1,2 kg

202

203

TECHNICAL INFORMATIONS, DIMENSIONS,FINISHINGS

quadri

Grigio cod. 3389 D - 4

Beige cod. 3512 D - 4

Salvia cod. 3389 K - 10

Celeste cod. 3512 H - 8

Composizione: 100% lambswool

Giallo cod. 3512 S - 17

Dimensioni: 147 x 179 cm


Peso: 0,8 Kg

Composition: 100% lambswool


Dimensions: 147 x 179 cm
Weight: 0,8 Kg

204

205

TECHNICAL INFORMATIONS, DIMENSIONS,FINISHINGS

onda

Beige cod. 3620 P - 14

Grigio cod. 3620 H - 8

Composizione: 100% lambswool


Dimensioni: 147 x 179 cm
Peso: 1,2 kg

Composition: 100% lambswool


Dimensions: 147 x 179 cm
Weight: 1,2 kg

206

207

TECHNICAL INFORMATIONS, DIMENSIONS,FINISHINGS

pois

Salvia cod. 3371 S - 16

Grigio cod. 33479 U - 18

Beige cod. 3479 P - 14

Celeste cod. 3479 X - 19

Composizione: 100% lambswool

Giallo cod. 3479 L - 11

Dimensioni: 147 x 205 cm


Peso: 1,2 kg

Composition: 100% lambswool


Dimensions: 147 x 205 cm
Weight: 1,2 kg

208

209

TECHNICAL INFORMATIONS, DIMENSIONS,FINISHINGS

mia

Celeste cod. MI - 7

Celeste cod. MR - 7

relieve

Rosa cod. MI - 8

Composizione: 60% lana + 40% mohair

Composizione: 82% lana + 18% mohair

Dimensioni: 130 x 190 cm

Dimensioni: 130 x 190 cm

Peso: 360 gr/m2

Peso: 345 gr/m2


Composition: 82% wool + 18% mohair

Composition: 60% wool + 40% mohair


Dimensions: 130 x 190 cm
Dimensions: 130 x 190
Weight: 345 gr/m2
Weight: 360 gr/m

210

211

TECHNICAL INFORMATIONS, DIMENSIONS,FINISHINGS

naga

Navy cod. 1306939000

Anis cod. 1306947000

Oltremare cod. 1306941000

Cedro cod. 1306949000

Topazio cod. 1306943000

Mimosa cod. 1306951000

Composizione: 100% cotone


Dimensioni: 140 x 200 cm
Peso: 1,235 Kg

Composition: 100% coton


Dimensions: 140 x 200 cm
Weight: 1,235 Kg

212

213

TECHNICAL INFORMATIONS, DIMENSIONS,FINISHINGS

naga

Geranio cod. 1306955000

Gesso cod. 1306963000

Tortora cod. 1306959000

Grigio verde cod. 1306965000

Lino cod. 1306961000

Acciaio cod. 1306967000

Composizione: 100% cotone


Dimensioni: 140 x 200 cm
Peso: 1,235 Kg

Composition: 100% coton


Dimensions: 140 x 200 cm
Weight: 1,235 Kg

214

215

TECHNICAL INFORMATIONS, DIMENSIONS,FINISHINGS

leto

Gesso cod. 1305612000

Pavone cod. 1306083000

Rubino cod. 1306081000

Prato cod. 1306084000

Zucca cod. 1306082000

Amaranto cod. 1306085000

Composizione: 100% lana vergine


Dimensioni: 130 x 200 cm
Peso: 0,630 Kg

Composition: 100% virgin wool


Dimensions: 130 x 200 cm
Weight: 0,630 Kg

216

217

TECHNICAL INFORMATIONS, DIMENSIONS,FINISHINGS

leto

Ardesia cod. 1306086000

Mimosa cod. 1306198000

Geranio cod. 1306196000

Talpa cod. 1306594000

Oltremare cod. 1306197000


Composizione: 100% lana vergine
Dimensioni: 130 x 200 cm
Peso: 0,630 Kg

Composition: 100% virgin wool


Dimensions: 130 x 200 cm
Weight: 0,630 Kg

218

219

scaldotti e cuscini

TECHNICAL INFORMATIONS, DIMENSIONS,FINISHINGS

Composizione: imbottitura 100% poliestere


Dimensioni: 140 x 230 cm
Peso: imbottitura 100 gr/m2

Composition: padding 100% polyester


Dimensions: 140 x 230 cm
Weight: padding 100 gr/m2

222

223

tessuti

cotone

pesba

Composizione: 100 % cotone

Composizione: 46% vi - 35% pl - 19% li

100% MADE IN ITALY

100% MADE IN ITALY

CAT-D

CAT-C

cod. 46

cod. 47

cod. 01

cod. 01

cod. 24

cod. 02

cod. 26

cod. 04

cod. 09

cod. 25

cod. 18

cod. 06

cod. 19

cod. 31

cod. 38

cod. 35

cod. 12

cod. 24

cod. 03

cod. 23

cod. 07

cod. 19

cod. 39

cod. 36

cod. 13

cod. 20

cod. 05

cod. 21

cod. 22

cod. 28

cod. 42

cod. 26

cod. 21

cod. 29

226

227

shabby

aston new

Composizione: 100% li

Composizione: 100% pl

100% MADE IN ITALY

100% MADE IN ITALY

CAT-A

CAT-A

cod. 101

cod. 144

cod. 102

cod. 129

cod. 04

cod. 16

cod. 104

cod. 124

cod. 22

cod. 21

cod. 132

cod. 120

cod. 01

cod. 06

cod. 118

cod. 113

cod. 05

cod. 08

cod. 110

cod. 127

cod. 12

cod. 09

cod. 109

cod. 115

cod. 108

cod. 126

cod. 131

cod. 138

cod. 105

cod. 135

cod. 24

cod. 10

cod. 13

cod. 17

228

229

wool

pure wool

Composizione: 70% wo - 25% pa - 5% af

Composizione: 100% vw

100% MADE IN ITALY

100% MADE IN ITALY

CAT-A

CAT-LUX

cod. OV100

PDP600

PDP400

PDG600

PDG400

cod. 302

cod. 404

cod. 003

cod. 401

cod. 001

PDP200

PDP404

cod. OV003

PPG200

PDG404

cod. 402

cod. 405

cod. OV703
cod. 101

cod. 801

cod. OV702

cod. 802

cod. 701

cod. 600

cod. 200

cod. 100

cod. 702

cod. 502

cod. 201

cod. 303

230

231

cod. 402

cod. 403

panama

texas - lalique
Composizione: 100% co

100% MADE IN ITALY

100% MADE IN ITALY

100% MADE IN ITALY

CAT-C

CAT-LUX

cod. T29

cod. T31

cod. L29

cod. L31

cod. T36

cod. T4

cod. L36

cod. L4

cod. T28

cod. T12

cod. L28

cod. L12

cod. T35

cod. T30

cod. L35

cod. L30

cod. T17

cod. T8

cod. L17

cod. L8

cod. T18

cod. T7

cod. L18

cod. L7

cod. T33

cod. T10

cod. L33

cod. L10

232

cod. 9000
Bianco

cod. 9001
Latte

cod. 9002
Ecru

cod. 9005
Deserto

cod.9047
Cammello

cod. 9040
Beige

cod. 9007
Pietra

cod. 9034
Creta

cod. 9008
Topo

cod. 9013
Fango

cod. 9009
Grigio

cod. 9023
*UDWH

cod. 9029
Marrone

cod. 9014
Castagna

cod. 9046
Mogano

cod.9030
cod. 9015
Cioccolato Testa di Moro

cod. 9032
Ardesia

cod. 9039
cod. 9028 cod. 9027
Champagne Cappuccino
Miele

cod. 9010
Avana

cod. 9012
Nocciola

cod. 9011
Corteccia

cod. 9006
Pergamena

cod. 9038
Ananas

cod. 9037
Arancio

cod. 9016
Rosso

cod. 9017
Bord

cod.9026
Granata

cod. 9003
Ghiaccio

cod. 9004
Sabbia

cod. 9041
Cipria

cod. 9043
Nude

cod. 9042
Petunia

cod.9025
Viola

cod. 9033
Cenere

cod. 9022
Acciaio

cod. 9045
Muschio

cod. 9018
Verdone

cod. 9035
Bosco

cod.9036
Lime

cod. 9019
Acqua

cod. 9020
Piombo

cod. 9044
Denim

cod. 9021
Oceano

cod. 9031
Blunotte

cod.9024
Nero

233

novabuk

doublebuk

Composizione: 55% pol - 35% pu - 10% co

Composizione: 100% pol

100% MADE IN ITALY

100% MADE IN ITALY

CAT-C

CAT-C

cod. 45

cod. 60

cod. 49

cod. 11

cod. 26

cod. 14

cod. 66

cod. 53

cod. 48

cod. 16

cod. 74

cod. 61

cod. 12

cod. 15

cod. 59

cod. 75

cod. 29

cod. 30
234

cod. 08

cod. 02

cod. 06

cod. 03

cod. 20

cod. 12

cod. 14

cod. 01

cod. 10

cod. 19

cod. 05

cod. 21

cod. 47

cod. 19

cod. 50
235

collezione care
100% MADE IN ITALY

Le lin ivory
205-09 cat. a

Le lin sunset
205-31 cat. a

Lin leger chartreuse


206-14 cat. plus

Duo S smoke laguna


213-22 cat.luxury

Duo S blanc madreperla


213-24 cat.luxury

Lin leger sunset


206-25 cat. plus

Le lin chartreuse
205-15 cat. a

Lin leger laguna


206-15 cat. plus

Duo M blanc madreperla


212-14 cat.luxury

Lin leger pompei


206-24 cat. plus

Diso acido
104-04 cat. pelle

Duo L smoke laguna


211-02 cat.luxury

Clogue de coton craie


140-01 cat.luxury

Le lin pompei
205-30 cat. a

Sing mango
060-11 cat. luxury

Le lin laguna
205-16 cat. a

Lin leger ivory


206-08 cat. plus

Sing tiglio
060-06 cat. luxury

Tulban oro
063-08 cat. luxury

Le lin caraibi
205-19 cat. a

Tulban avorio
063-01 cat. luxury

Tulban tabacco
063-06 cat. luxury

Clogue de coton anis


140-11 cat. luxury

Lin leger caraibi


206-16 cat. plus

Sing avorio
060-01 cat. luxury

Diso moro
104-15 cat. pelle

Clogue de coton taupe


140-05 cat.luxury

Tulban ebano
063-13 cat. luxury

Le lin olive
205-14 cat. a

Sing iris
060-18 cat. luxury

Tulban argento
063-05 cat. luxury

Sing argilla
060-04 cat. luxury

Lin leger pino


206-10 cat. plus

Lin leger denim


206-18 cat. plus

Clogue de coton
terre glaise
140-14 cat.luxury

Diso deserto
104-03 cat. pelle

Sing lago
060-20 cat. luxury

Lin leger ortensia


206-21 cat. plus

Le lin smoke
205-02 cat. a

Diso naturale scuro


104-01 cat. pelle

Le lin denim
205-21 cat. a

Lin leger olive


206-13 cat. plus

Clogue de coton lie de vin


140-18 cat. luxury

Duo S purple mahogany


213-21 cat.luxury
Le lin purple
205-25 cat. a

Tulban acqua
063-12 cat. luxury

Lin leger smoke


206-02 cat. plus

Sing legno di rosa


060-16 cat. luxury

Lin leger argent


206-05 cat. plus

Diso tortora
104-14 cat. pelle

Diso fragola
104-11 cat. pelle

Duo S acier argent


213-23 cat.luxury

Lin leger anthracite


206-01 cat. plus

Clogue de coton fuchsia


140-13 cat. luxury

Lin leger purple


206-22 cat. plus

Duo M acier argent


212-13 cat.luxury

Le lin anthracite
205-01 cat. a

Diso porpora
104-12 cat. pelle

Clogue de coton bleu violet


140-12 cat. luxury

236

Duo M purple mahogany


212-11 cat.luxury

237

filati

TECHNICAL INFORMATIONS

CUCITURA RICAMO

CUCITURA LINEARE

CUCITURA LINEARE

CUCITURA LINEARE

CUCITURA LINEARE

cod. 100 bianco

cod. 401 bianco

cod. 220 uva

cod. 434 rosa

cod. 8803 acqua

cod. 712 beige

cod. 507 latte

cod. 343 petunia

cod. 712 beige scuro

cod. 960 beige

FRGYLROD

cod. 258 fenicottero

FRGRUGDOLVR

cod. 355 provenza


FRGERXJDQYLOOH

cod. 722 tortora


cod.819 testa di moro

cod. A22 creta


cod. 451 canarino
cod. 492 fucsia
cod. 120 deserto

FRGJLDOOR

cod. 1448 rosa


cod. 106 ananas

cod. 472 turchese

cod. 536 acquamarina

cod. 5105 mare

cod. 548 niagara

cod. 44 cina

cod. 274 arancione

cod. 401 fucsia


cod. 806 champagne
cod. 1260 zucca

cod. 923 verde mela

cod. 480 genziana


cod. 932 verde scuro

cod. 535 ruta

cod. 730 cappuccino


cod. 537 minio

cod. 323 arancio

cod. 498 giada

cod. 5652 avio

FRGVDOPRQH

FRGPDODFKLWH

cod. 460 acciaio

cod. 424 geranio

FRGVDOYLD

cod. 306 rosso

cod. 471 bosco

cod. 881 miele


cod. 406 rosso
cod. 614 blu elettrico

cod. 217 nocciola

cod. 617 blu


cod. 501 grigio perla

cod. 698 cioccolato

cod. 828 grigio antracite

cod. 865 antracite

cod. 229 ardesia


cod. 012 nero

cod. 426 testa di moro

cod. 11 bordeaux

FRGSHWUROLR
cod. 40 nero

TECHNICAL INFORMATIONS

INSERTO PASSAMANERIA
cod. 07

cod. 20

cod. 02

cod. 21

cod. 03

cod. 22

cod. 08

cod. 23

cod. 10

cod. 24

cod. 12

cod. 26

cod. 13

cod. 27

cod. 14

cod. 28

cod. 15

cod. 29

cod. 16

cod. 30

cod. 17

cod. 34

cod. 18

cod. 805

cod. 19

cod. 806

100% Cotone
100% MADE IN ITALY

progetto

Andrea Bassanello
Monica Ledda

copy

Monica Ledda

IRWJUDD

Gabriotti

stylist

Carla Bernardis

stampa

*UDFKH$QWLJD

printed

2015

%RO]DQOHWWLVUODOQHGLPLJOLRUDUHOHFDUDWWHULVWLFKHWHFQLFKHHTXDOLWDWLYHGHOODVXDSURGX]LRQHVLULVHUYDGLDSSRUWDUHDQFKHVHQ]DSUHDYYLVRWXWWHOHPRGLFKH
FKHVLUHQGHVVHURQHFHVVDULH
%RO]DQ/HWWLVUOUHVHUYHVWKHULJKWWRPDNHDOOWKHFKDQJHVGHHPHGQHFHVVDU\WRWKHSURGXFWVLQRUGHUWRLPSURYHWHFKQLFDODQGTXDOLW\IHDWXUHVHYHQZLWKRXW
DGYDQFHGQRWLFH