Documenti di Didattica
Documenti di Professioni
Documenti di Cultura
September 2015
l Price
15/-
l September
2015
l Price
15/-
INDEX
n
a
a
a
Editor
Acharya Balkrishna
Associate Editor
a
a
a
Office
Patanjali Yogpeeth
Maharishi Dayanand Gram,
Delhi-Haridwar national highway,
near Bahadarabad,
Haridwar-249402, Uttarakhand
Phone (01334) 240008,
244107, 246737
Fax (01334) 244805, 240664
e-mail yogasandesh1@gmail.com
e-mail divyayoga@rediffmail.com
on the web www.divyayoga.com
Subscription Fee
One copy
Annual
Five Years
Eleven Years
Abroad (Annual)
15/150/700/1500/800/-
Publishing
a
a
a
a
a
a
a
a
a
a
a
a
a
a
a
Eternal wisdom
Editorial
Eagle wood is highly fragrant, very useful
Divine formula of life
Tribute and remembering the moments spent at Patanjali
Yog Peeth by respected former President APJ Abdul Kalam
Mothers and sisters should get full dignity
Sleeplessness and its natural-yogic treatment
Your Experience
Mind is full of amazing miraculous capabilities
Cow milk full of omega - 3 and ......
Bharat is front-runner in various fields
Why worry for snoring, epilepsy or cataract?
The truth of English being the global language
Message of Sansthan
30 medicinal plants and 20 `yogasans` useful in diabetes
Naturopathy of Patanjali Yoggram
The world on the way of reconstruction
For the best scale of rural development....
Some domestic methods for protecting agriculture:
Important message for the readers of Yog Sandesh
Song: With the strength of Yoga
Take maximum production of chilli with Patanjali process
Arogya Guru my salute to you
03
04-05
06-09
10
11
12-13
14-16
17
18-20
22-23
24-26
28-29
30-31
34-44
46-48
50-51
52-53
54-56
57
59
61
62-64
67
Read this magazine yourself, inspire five others to read and then place in five new families so that this
agitation, being inspired by seers could spread, reach and benefit every human being. - Editor
Eternal wisdom
. There should be no alternative to the pledge and to fulfill the sacred oath taken by us,
every effort should be made. Physically, mentally, psychologically and spiritually, we are
independent though we depend on others in view of economical, social, family and political
aspects. But this is little trouble, which could be overcome though, it gives little pain. The
completeness of the life is in the manhood. The external manhood effort (purushurth) takes
up to prosperity while internal manhood takes us to the extreme of `Samadhi` (trance).
. When we perform service and meditation, without any selfishness we receive three gifts from
the almighty. First one is the best, refined, positive and complete judicious intelligence, the
second one is the best powerful and completely healthy body and the third one is patronage
of the best and competent parents and most intelligent and efficient teachers. Enjoying
the worldly pleasures will not give us good fortune and more we enjoy the pleasures, more
the blessings of the god for our good work decays. Hence, a complete pious and rational
person has the duty that he starts the public service form 10 per cent and later extend it
to 100 per cent. Thus, service to the mankind is the platonic service. This service has been
named as `brahma karma`, `akam`, `aapt kam`, or divine duty in Vedas, philosophy, Gita
or Upnishads. We shall get rid of our inconsiderate wishes and live life, in accordance to
the `Vedas`, teachers, `Shastras` and the soul. We shall not dis-honour or violate the wish,
order, inspiration or the direction of the almighty in the soul.
. In the life, we shall take some decisions very firmly and live life with authority. Such
tendency gives divinity, greatness, sage ship, divinity and completeness. We could easily
remove macro-defects from the life immediately like non-vegetarianism, intoxication,
anger, revenge, reaction, violence, falsehood or if we say in proper words, any action against
the `yama-niyam`. Dilute the macro defects of the life slowly with firmness and one day,
you will succeed.
Social, economical, practical, family and other mutual relationship should be maintained on
the principle of generosity, co-existence and reciprocity but we should be firm and committed
completely, while following Vedic principles preached by the seers, our conduct, guru and the
organization and there shall be no compromise or wavering attitude. Firmness and generosity
should be two guiding forces or models for us, which we shall follow with commitment, which
are of much importance in the life. If we dont follow these two principles, pain, injustice, nonreligion and disorder are bound to happen. I myself live on the same principle and people, who
have affection to me; I pray all of them to live on this formula. We will have to be firm towards self,
look as god in every individual and should be generous towards the humanity. We all will have to
move towards complete truth with complete divinity.
3 SeptemberU 2015
Editorial
`Kapalbhati Pranayam`
I
n the field of yoga different discussions are being held on the word `Kapal bhati`. Some people
opined that it is an action or `karma` but no Pranayam while in the Patanjali Yogpeeth and the
literature been published from here, it is placed under the category of Pranayam. Thus, some sort
of confusion has been created, so I am presenting some facts here.
First-of-all, we will have to decide as what is the definition of `Pranayam` and whether Kapalbhati
falls under its ambit? As Kapalbhati is identified as `karma` or `kriya` i.e. action in `shatkarma`,
no objection can be raised that Pranayam is a kind of `karma` or `kriya`. Thus, Kapalbhati is
a Pranayam, it has been also placed in the category of `karma` in `shatkarma`. Thus, it is specific
quality or magnificence that `Kapalbhati` is a `Pranayam` and also included in the refining activity
under `Shatkarma`.
Acharya Balkrishna
Otherwise also, Bhrastika, Suryabhedam, Ujjaiyi, Seetakari, Sheetali, Anulom-vilom and Bhramari
and other Pranayams refine impurities and frailty of the body, mind and organs. Thus, if we accept
all Pranayams as refinery process, there should be no objection as every Pranayam is a `karma`.
`Hathpradipika` says that some `acharyas` accept purification of all impurities and frailty with
Pranayam. They do not consider `Shatkarma` process important for it.
Pranayamairaive Sarve Sushyanti Bhala Iti,
Acharyaknantu Keshanchidnayam Karma na Samtam. (Hath 2/38).
Pranayam purifies all impurities and hence, many `yogis` or `acharyas` do not find other refinery
processes important. As in Yoga Darshan, `tapa, `swadhyay` and `ishwar pranidhan` all are `kriya
yog`, rule and `ashtang yoga` too. First-of-all, I try to speak out the explanation of Pranayam in the
`Shastra` tradition and in context of the core Pranayam. The word Pranayam has found reference in
Manu Smriti, Gita, Yoga Darshan, Hathyoga and Purans.
In Sanskrit language, meaning of any word depends on root and suffix. Pranayam is a derivative word,
which has been made by two words `Prana` and `Ayam`. `Ayam` means dimensions, extensions,
control, deficiency, prohibition or perception. The meaning of word `ayam` in context of `Pranayam`
is discontinuance of `prana` i.e. the normal breathing, deficiency, prohibition and control.
Maharshi Patanjali and Vyas Muni have given the same definition.
Tasminsati shwas prashwasyagartiviched Pranayam (Yoga Darshan 2/49)
Satyasanjaye Bahasya Vayorachmanam shvasam, koshthayasya vayodnisaranam prashyas.
Tayogartiviccheda ubhaya Pranayam. (Yoga Darshan- Vyas Bhashya 1/49)
Pranayam Tridhaprokta: Purak kumbhk rechkah. (Hath 2/71)
In this connection, it is written in Yogavashishtha
Trayana paurvaparyene prathmabhumikaya
sadhyanushthanniyamadektva vyawaharoppatte,
Na tu tadrashvakyeshu militanamev pranayamtatva vivkshitam (Yo Va)
Vkshyaman chaturvidh pranayamsyey samanaylakshnam gativicchedam,
Shostrokatritya swabhavikgate pratishedh-ityartha.
4 SeptemberU 2015
5 SeptemberU 2015
Health in Herbs
6 SeptemberU 2015
Acharya Balkrishna
Patanjali Ayurved is conducting a widespread research
to stop the oppression of this body endowed by
almighty. In Indian Ayurveda, a medicine is that which gives a person the
sense of being healthy and make him free from diseases. Since our body
is directly connected with the nature, therefore a disease is also born due
to natural imbalance. In this situation, a medicine has to be made from
natural ingredients. Moreover, if we will use any chemical as a medicine
for treatment of diseases, it will sooner or later definitely show its adverse
impact on our health. For eternally good health, it is necessary to find a
medicine for mental or physical problems from the nature itself.
Patanjali Yogpeeth has conducted intense research on herbs and their
prescribed dose and has come up with this series of "Health in Herbs".
This time here is the description of the properties of eagle wood. These
description can be found in detain in the book named- Jadi Buti Rahasya.
Patanjali
There are many types of Agar plant. In Aryan scriptures and Ayurvedic texts,
following types of this plant have been described.
1. Krishnaguru 2. Kashthaguru 3. Dahaguru 4. Mangalya Guru.
Among them, Krishnaguru is considered as the best and is highly used in
treatment of diseases due to its medicinal values. Woods of this species of the
plant are of high density therefore they sink when kept in water. Assam has
been very famous due to abundance of this plant but the countries which are
world - wide famous for supply of its wood are Bhutan, Myanmar, Malaya,
Malaysia and Philippines. In North India , its trees are found upto 500
metre height in the areas consisting of North-Eastern Himalaya, Meghalya,
Manipur, Nagaland, Tripura's hilly areas, West Bengal, etc.
Chemical composition:
In the fungus infected wood, oil that can be vaporised is found. Aquillochin,
Lignain, a & B - Agairofuron, Agraio, Dihydroagarofuron, Agarospirol,
basic Liriodenine, selinine, besides 48 per cent alcohol dissolvable substances
are found.
Its juice has acrid taste, hot in nature for sperm, light, smooth, cures cough
and gastric problems. It also increases pitta in the body.
By applying its fragrant paste, it gives cooling effect. It is Hridya, interesting,
Shwashar, Sheetprashamak, Shirovirechak, Medshoshak, Varnaprasadak, etc.
It is useful in treatment of the problems like ear problems, Akshirog, leprosy,
Hikka, Chhardi, breathing, jaundice, head problems etc.
Krishnaguru- It is acrid in taste, full of juices, Ushna Virya, a bit cures
Tridosha, especially Pitashamak. Its paste is very cool.
Kashthguru: Its juice is acrid in taste, hot in nature, cures cough and its paste
on being applied gives rough feeling.
Dahaguru: It is also acrid in taste, hot in nature, nourishes hair, has colouring
effect, cures hair problems.
Manglyaguru: It has cool nature, heavy, yogavahi, cures leprosy, etc.
Agarusar: It is acrid, bitter, hot and cures gastric, purifies sores, worms and
leprosy. Its smoke is fragrant and cures gastric.
It sinks in water.
In tube test, it shows impact on human nostrils and its cells.
The extract of Ethyl Acetate shows oxidising nature.
Extract of its leaves has the nature of anti-biotic.
7 SeptemberU 2015
Health in Herbs
Medicinal use, quantity and
method:
Head diseases:
1. Headache: Rub a piece of Agar
wood like sandal wood and
add some camphors into it and
apply on the head. It is very
effective in head related pain.
2. Chest problems:
1. Cough: Take 1-3 gm Agar
power and add some dry ginger
into it and use with honey. It
is effective in cough related
problems.
2. Swelling in respiratory ducts:
Take Agar power and camphors
and crush them together. Apply
it on the chest. It will cure the
problem.
Breath: Take 2 drops of Agar oil
in a betel leaf, and administer it to
the patient. It is effective in breath
related problems.
Stomach diseases:
1. Arbud: Take 10 gm of Agar
wood, make its tea, use it to
make 20-40 ml tea, which is
very effective in this problem.
2. Vomiting: Administering
1-2 gm Agar powder is very
effective.
3. Low appetite: Take 1-3 gm
Agar wood powder and use it
with honey. It is very effective.
Sex diseases:
8 SeptemberU 2015
Its trees are 18-20 metre high, curved at various places, full of
branches. Its bark is thin like a piece of paper, it is soft, a bit flexible,
white with a little bit yellowish appearance. Since its internal
wood is affected by fungus is black in colour and has some special
fragrance. Its leaves are 5-12 cm long, 1.8-5 cm wide, smooth and as
thin as a piece of paper. Its flowers are small in size, greenish white
in colour, in the shape of umbrella, and they are found in bunches.
Its fruits are 2.5 cm long, have wrinkles on being dried, flowers and
fruits are found between May and November. Its wood begins to get
mature after a tree turns 21. Before turning mature, the wood lacks
fragrance, has a very simple yellowish colour. But after maturing, its
branches accumulate juices in its various parts. It makes the plant's
wood useful and heavy in weight. Its pieces are sold in the market.
The quality of wood depends upon the quantity of the juice in the
wood. Higher the juice, better is the quality. In some parts of the
wood, the juice gets accumulated in the form of Ral or wax which
is used as fragrant wax which is sold in the market by the name of
Dhoop. After the wood turns mature, a worm starts rot into it due to
which it becomes even more fragrant and at this stage it is called the
true fragrant Agar. For better fragrant results, its wood is chopped
and stored beneath soil to improve its quality even further. Due to
this, its colour turns black.
Raktarsh: It will be cured when its 1-3 gm powder is added in three times
quantity of sugar candy and administered to the patient.
Kidney diseases:
1. Prameh: Take equal quantities of Patha Panchang, Agar wood, turmeric,
and make its tea. It 10-20 ml quantity is useful in the problem.
1. Diseases of reproduction system:
1. Sutika rog: Administer 10-20 ml tea of Agar wood to a patient after and
before birth of child. It is very effective. If dry ginger or sonth are added
into it, it will be even more effective.
Skin diseases:
Paste of its wood when applied on affected body part is very effective.
Paste of its leaves is also effective in related problems.
Poison treatment:
Jangamvish: If its wood is crushed
and applied on the place of a
snake bite it will cure the effect of
the bite.
Special:
Pryojyang: Fungus infected
internal wood.
Quantity: Oil 1-5 drops, powder
0-5-3 gm, extract 1-2 gm, tea
10-40 ml and it has to be taken
according to the advice of a
doctor.
Special notes: Agar's internal
wood has ascomycetous mold,
phaeoacremonium parasitica ,
etc fungus and for safety of the
wood from them a special resin is
discharged from the plant.
9 SeptemberU 2015
Spirituality
Divine
formula of life
Swami Ramdev
At Patanjali Yogpeeth, respected Swami Ramdev ji , respected Balkrishna ji and his excellency
Abdul Kalam in special thinking
Then President Sri APJ Abdul Kalam wrote in the visiting book of Patanjali Yogpeeth, a
historical moment
Woman dignity
Further from last issue
49. Even vulgarity cries on seeing the way women are shown in advertisements, Dirty thoughts of a human, is feeling shrunken,
This kind of nudity needs garments I
50. Lustful traders of knowledge, who are always in search of
material pleasure, Such dirty people have written destructive
literature, Their shops must shut down immediately.
51. Some people call her their slave, others called her the doorway
of hell, Such people must be beaten and punished
It is required to have Dayanand like great souls who can fight
with the system.
52. A woman some or other way feels joy
But she is mostly seen crying, she is the origin of all pleasure of
men, she now needs rest.
53. It seems exploiters are enjoying all pleasures,
Tears of her eyes narrate her oreals,
It is really strange, this has to be realised by all.
54. She suffers due to mal-nutrition, has weak body, even then she
is loved by all, she has small forehead, very less blood in her
body, her tears tell the story, a woman's heartbeats are heavy,
she needs dedication.
55. She has great capability of creativity, her power is enormous,
Make Supatra independent and safe, hand over the responsibility to build,
If the world gives her respect, such an ambience is required.
56. She always prefers penance, bears insult,
To make her mind normal she often silently cries,
No such a story is required.
57. All the ties are cause of all pains, but bonding of love is amazing, While remaining hungry, she is contented, repents on
eating, Such a deprived women need love and respect.
58. She mighty look alive, but her heart is dead, she has no sense
of personality, the fire of her identity is extinguished,
Is it right that to work in self-interest should not be allowed.
59. There is a person, which needs a personality
It is also needed to enhance her inherent qualities,
The one who helps her to forget her pain, such a favour is
required.
60. You got fame both in house and also in the battle field,
You are forerunner in all the fields,
The voice should be silenced which shouted at her.
61. Vedic hymns sung by Lopamudra and Apala,
Mother Anusuya took care of Trivedas as a mother takes care
of a child, Savitir fought for her husband, returned her life.
62. In the court of Janak of Videh, scholar Yagyavaalak came,
But on listening Gargy's arguments, he was stunned ,
Some day a man's arrogance must end.
12 SeptemberU 2015
Mothers and
sisters should
Dr Suman,
73. Neither did ever yoga in life, nor achieved knowledge in life,
Accumulated wealth but was defeated at the end,
Now have got a golden chance, it has to be noted.
74. Provide her best education, she will get voice with blessings of
god, she will become wise,
The world could sing the song that is required.
75. Give them big responsibilities and watch with patience and
sunn all your prejudices , it is needed that doer is silent and
others are praising her.
76. Never torture a woman, make them free from problems,
If you want high results, then enhance their qualities,
if you want sons like Ram, Krishna and Bharat
77. She needs affection in the childhood, needs respect in young
age, she needs help when her body becomes weak due to old
age, such an edge is required which could make it shining.
78. A Nari means one who doesn't have an enemy but the whole
world is her enemy, but the things which could not be done
by men was done by the women, her problems need to be
sorted out.
79. She is abused in the name of less dowry, less beauty after marriage, she is scolded if she does not give birth to a male child, a
woman is suppressed by a women, needs wisdom.
80. It is said a woman is daughter of goddess mother Jagdamba,
don't know why is she unhappy, she has faced many problems,
now needs blessings.
81. She has incurred troubles since beginning, a woman has faced
bore many troubles, now she needs to be empowered.
82. She will agree to live without food but don't keep her hungry
of love, if a woman is unhappy, it will invite great destruction,
she needs to be free from insult, deprivation.
83. Don't consider her inferior, consider her able, show respect to
her, leave no stone unturned to improve her condition, do not
Research
Dr. Shirley Telles and Shivangi Pathak, Patanjali Research Department, Patanjali Yogpeeth, Haridwar
Sleep
is very important for life long good health. According to National Sleep Institute, sleep is necessary for proper
function of a person's body.
c.
l
l
14 SeptemberU 2015
a.
b.
d.
e.
Yoga is a solution
If you are suffering from the problem of sleeplessness
or insomnia, yoga can be a best solution. Yoga
Light sleep, feeling very
drowsy
STAGE 1
90 - 120 mins.
Transition
between light and
deep sleep, slow
high amplitude delta
waves
STAGES
3&4
STAGE 2
Research
Your experience
Got rid of problems of heart and memory loss
Yoga gave me a new lease of life, otherwise I won't have survived after 1994 fatal heart attack. I had to
visit Delhi after that, there my angiography was done and it was found that many arteries are blocked ,
I was treated for a year and I was advised to go for bypass surgery. I saw Baba ji on TV doing yoga, who
descried every form of yoga and its benefits, Baba ji is of the view that yoga can cure all the problems, I
started doing yoga every day and my problem was over.
One year back I had memory loss problem. I was not able to recognise my wife, children and other
relatives. I stopped taking meal and all my activities came to a standstill. There was no chance of my
survival, the medicines suggest by my son who is a doctor , I am still taking them, but it was yoga which
helped me in a great way to recover. I am getting rid of depression and other problems. It is advised to
every individual to take yoga at least half an hour to keep healthy. Kapalbhati and Anulom-Vilom are
specially advised to be practised.
I regularly do yoga even at the age of 89, yoga makes us to change our view towards life and ambience
around us which help reduce our stress in a big way. This keeps all our body parts active.
At this time, yoga is being spread all round the world and Baba Ramdev ji played a vital role in it for
which I offer him many many thanks.
From
PL Gupta,
79, D-5, Vibhav Appartments, New Agra, Agra-5
17 SeptemberU 2015
Spiritualism
Acharya Pradyumna ji
Tendencies of mind:
Kaam-Chikitsa-Vichikitsa-Shraddha-Ashraddha-
Spiritualism
Mind is ready to
learn
Whatever is told to mind
it learns them quickly. It was
proved in a news story
published in Navbharat
Times' August 1989 issue. It
was said in the story that a person
by changing his way of thinking and
shunning negativity and relying on selfconfidence, can accomplish everything which
has been impossible in the eyes of people. This was
proved when a Dutch national Emil Stilband walked
on amber. With the help of mental strength , he
successfully enthused all the 104 viewers thronged there
to do the same what he had done. All of those who were
present there were full of great enthusiasm.
US' Robin's Research Institute's European region
director Mister Stilband first delivered his speech on
Mind's Enormous Power and inspired people to rely on
it and then suddenly started walking on the amber by
calling it cold grass.
During this a five years old girl Surabhi too walk on
them with great joy, Mr Kulkarni of Birla Planetarium,
and his kids besides others also enjoyed walking on the
ambers. In his speech, Mr Kulkarni described that
human mind has infinite strength and stressed on the
need to protect it.
In this practical example , we have known about
enormous strength of mind. Many a times, while
sleeping, it is felt that someone is touching us, it is like
20 SeptemberU 2015
Amidst the expressions of nation building, Pujya Swami Ramdevji Maharaj and the Andhra Pradesh Chief Minister
Chandrababu Naidu and in the below picture Pujya Swami Ramdevji Maharah is seen performing `jalabhishek` to
`Maa` in Nashik Mahakumbh.
21 SeptemberU 2015
21 day colustrum
Cow
Cow's anatomy
There are four chambers in a cow's
22 SeptemberU 2015
rays of atom bombs. All nutrients for mental and physical vitality are found
in Desi cow milk. Similarly, we can preserve our natural resources by using
cow dung for making biogas.
The smoke produced from burning of cow dung cake destroys harmful
germs and insects in the ambiance. Cow dung is effective in destroying radiation from atomic reactors.
Laborious animal:
bodyFirst chamber is called rumen, second one is called reticulum, third one
is called omasum, fourth one is called
abomasum.
Chewing the cud makes her products
like milk, dung, urine, etc. pure.
Source of Omega- 3
Importance of Omega- 3 is now being recognised since 2000 due to its
effect on a person's mind and mental abilities. Today people are so conscious
about using unsaturated fats in their meal that Omega- 3 has started to be
sold in the market as a cure to all major diseases and its trade is of billions
of rupees. Though this vital nutrient is available in abundance in cow milk.
In fact, the cows which are kept at one place and not allowed to wander in
search of food, have saturated fats in their milk which cause obesity and
bad for our health. On the contrary, wandering cows' milk contains unsaturated fats in abundance like Omega - 3 and Omega -6 and they are called
EFA necessary fats. It is this fat which is vital for human body. If cows are
fed with Khalli, Binaula and dana, their milk will contain saturated and
unhealthy fats while green food for her will increase the level of healthy
unsaturated fats and consumption of this kind of milk will keep us healthy.
Modern science too is also of the view that presence of omega - 3 increases
the quantity of DHA (Dehydrogenated Acid) and with this element human brain and eye power develop well and presence of the two is vital for
mental growth. Hence cow milk is deemed as nectar.
23 SeptemberU 2015
National pride
is still front runner in different aspects. The former Congress Government was atheist and materialistic and had vex
with the tradition of knowledge and education, which was but natural for a political outfit like his. Albeit, they tried
to keep people and the nation attentive only on economical issue but they miserably failed on that front too. It is not a secret that till
a few years back, the Congress and its associates were making hue and cry, saying that the main issue is to remove poverty from the
country. They also claimed that the people are deprived of their rights and solving these problems is their basic motto of politics. None
of their leader had the farsightedness that Bharat itself is a super power, which will emerge as a strong nation in the years to come. They
always talked of the depravity. But despite all such adverse circumstances, the people of the country remained active in such adverse
and negative circumstances and now, it is being discussed as the future super economical power at the global scenario. Though, none,
who were the part of the ruling system, could predict this to happen. Thus, the Government, which was striving hard in the field of
economics, could not predict that Bharat will be future global power. Thus, the icons of the previous Government were exposed as
they could not predict what is going to happen, in the field in which they claimed to be the master leave apart, other aspects of the
governance. And despite what has been said and stated, Bharat is on the driving seat in many of the fields. Here is the article.
Bharat
Bharat is front-runner
in various fields
n Professor Kusumlata Kedia
1.
2.
3.
4.
25 SeptemberU 2015
National pride
ahead in evolving the best procedure of trade and
commerce and to distribute the profit among different
cross-sections of the society. Due to transformation
of power, some people made efforts to publicise some
groups of leaders and officers as the trade expert but
failed miserably in the efforts. They tried to push
public sector as a trade, which is completely false and
misleading. And finally, their efforts proved nonprofitable and failure. They continued the rules of trade,
framed by the British people. It is a point of common
sense that a society, which has rich experience of trade of
millions of years, is being governed by the rules and laws
framed by another society, which sparkled for a while
and then extinguished. It is ridiculous and laughable.
Despite all the adverse circumstances, our traders have
shown that Bharat is moving ahead on the route of
becoming economical global world power. This, again
proves that how intelligent, talented and efficient are
the people of India in the field of trade and commerce.
14. Bravery and Army area: In the area of bravery and
gallantry, Bharat is way ahead since decades. The people
of Bharat have been a brave tribe, who were always rated
as great warriors. In villages, the tradition of bravery
and courage is a part of their life. Indian army has been
one of the oldest forces of the world. Documents are
available describing their courage since Mahabharata
era to this century. In the first and second world war,
only Indian forces saved British and French forces
or else Germany would have dismantled their entire
generation. It is a fact widely admitted by the historians
that it was because of Indian warriors that British
could win against Germany. Even the women were
great fighters since decades and history is a testimony
to it. From Maharani Kaikai to Maharani Laxmi Bai,
our history has seen many such great woman stalwarts.
Indian women have been experts in operating arms with
courage. The people, who ruled due to the transference
of power made every possible effort to keep women
away from arms training and to disarm them but did not
succeed. In the field of bravery and efficient manpower
we are far ahead, though efforts were made to hide the
truth and propagate the falsehood but all such attempts
bit the dust. If our tradition of bravery is kept intact, no
one can challenge us.
26 SeptemberU 2015
2015 27
Principles of health
epilepsy or cataract?
U
Everybody
Epilepsy disease
Yoga exercises like `anulom-vilom`, `bhramri`,
`pranayam` and concentrating on breaths gives
immense benefit. It stops dizziness. Medhavati
cures epilepsy comely. You can also go for natural
treatment and use linseed and `Medhavati`,
which cure epilepsy.
For platelets
Use wheat grass, aloevera and giloy, which are
immensely useful in this purpose. Even the
leaves of papaya are also useful. They can be
taken collectively. When platelets decrease in
Dengue, the four items mentioned above are
useful. Take their juice at the interval of 2-2
hours, which increase platelets. Pranayam,
anulom-vilom, kapal bhati also help increasing
platelets. For increasing platelets, pranayam is
the best treatment.
28 SeptemberU 2015
Special
Take A i.e. aola (myrobalan) 100 grams, B i.e.
beetroot (chukandar) 75 grams, C means carrot
250-300 grams, T i.e. turmeric means tender
turmeric 20 grams, and G means ginger 4 grams
when all the products are mixed in juicy form
and drunk, it gives miraculous effects.
Cataract
If the cataract is in the initial state, only pranayam
could cure it, which normalize the pressure on
glaucoma. For the better vision mix almonds
and fennel in powder form and take with water
in morning and evening, twice a day.
Snoring
Kapalbhati and Ujjaini pranayam when
performed 7 to 11 and 21 times it relaxes trachea
and larynx. But mind that `kapha` should not
be increased. Obesity, kapha, larynx and trachea
should be relaxed to get rid of snoring. Hence
control obesity. Warm water is beneficial,
reduce use of cold water. Take `trikuta` powder
with honey, half grams, which is helpful in the
treatment of snoring.
Sputum
Banana, ground nut, milk, ghee, oil, curd and
Fever
The best medicine available for fever in the
clinical world is giloy. Better to have giloy, basil
and aloe-vera in earthen pots at home.
29 SeptemberU 2015
Language-culture
the British came to India, they were totally unaware of Hindi language but anyhow, they made contact
with the people and moved ahead in trade and business. Later, to rule the country properly and in the final
phase of their influence, they made every effort to demoralize Indians and hence, made English an important language.
Resultantly, our regional languages, including Hindi grew weak gradually. To establish the English language, falsehood
was spread to establish the glory of English. British left the country but left their mentality here in the people left in the
country. Ved Prakash Lamba made serious analysis of the facts to take the facts from the public to the Government.
When
ue to the scientific pronunciation and spontaneity, Hindi language has its own place in the global
languages. But it is a fact that the extent of damage
done to Hindi language has been immense and not a small
fraction of damage has been done by others. Observing Hindi
week or Hindi fortnight once in a year is an insult to the language, same as Mothers day is observed once a year. Old people remember one weekly news based magazine Dinman and
its cover page carried a picture of a demonstration held by Jansangh (the old avatar of Bhartiya Janata Party) in which two
women, belonging to rural background were trying to save
themselves from the scorching sun, with the help of a placard,
on which it was written `We want Hindi`.
The so-called English supporters propagate English in
such a manner that if English will not be there, the country
will be nowhere. We should remember that Swami Ramdevji
Maharaj, who has popularity at the global level, has visited
the country on many occasions but he always addresses the
people in Hindi. Even, when he visited foreign nations, he did
not need interpreters.
The present TV channels are damaging Hindi and think
that it is their birth right. The news is basically sent in English,
which is then translated in Hindi language and what blunders are made in the translation, is another long and sorrowful story. Whenever the history of Hindi will be written, the
present Hindi newspapers will be underlined as the biggest
enemies of the language. Just go on reading from front page
to the last page and every day you will find experiments of
some new English word, encroaching in Hindi vocabulary. In
the language of general discussion, the regularly used words
30 SeptemberU 2015
cation in English language. The shameful and ironical situation is that even the names of the hockey, cricket and football
teams are placed in English like Rider, Blaster or Fighter. The
logic given is that it will give new energy and fastness to the
players. In fact, if such people are given all decision making
powers, they will say all asses as donkeys and dogs as doggies.
Today even the protagonists of Hindi sign in English language. The name plate appearing before their house will be in
English language. On any auspicious occasion at home, the
invitation will be in English language. The hoardings, banners of their shops, offices, ancillaries or industries remain in
English although, they know it very well that their customers
will be Indians, who have adequate knowledge of Devnagari
script.
I am not an opponent of English but it is a common sense
that the people living in this county should also think of our
national language. But the fact is that when a person has mentality of English language, expecting service to Hindi by such
group is searching needle in the haystack. Just think how a
few words of English could become a phrase? Is it not mental
slavery of English and its culture?
After independence, such scene has been created, where
people speak of Hindi but practice English. Furthermore, in
the mutual discussion, they support essentiality of English
and its qualities. It is my advice that if you want to do something for Hindi, remove the binding of English at the centre
and in all the BJP-ruling states for Government jobs. Whatever information, the Government of India wants to share with
public, advertise it in Hindi. Stop giving advertisements to
English newspapers and mediums. The Government should
ask the official broadcaster Doordarshan to start news, giving
priority to not only English but all the prominent languages
of the world.
I firmly believe that such step is sufficient and Hindi will
re-gain its position. The Government will not have to spend
additional budget on it and the biggest point that none will
oppose such move.
Thus, I hope that the present Government will take the
suggestions seriously and take firm steps. Mind it, it is associated with the self-respect and dignity of millions of Indians
and our nation i.e. Bharat. So, I hope the Prime Minister, who
is taking many steps to restore the lost glory of the nation will
take the issue very seriously.
31 SeptemberU 2015
Inspirational satire
(GLEOH3URGXFWV
<RJDDQGSXUHIRRGZLWKRXWDGXOWHUDWLRQDUHWKHEDVHRIVHUHQHLGHDVSXUHFKDUDFWHU
DQGEHKDYLRUDQGKHDOWK\OLIH+HQFHGR<RJDGDLO\DQGHDWJXDUDQWHHGFHQWSHUFHQW
SXUHC6DWYLNCIRRG
C*KHHC2LO)ORXU*UDP)ORXU)DVW)RRGDQG&ROG'ULQNV6SLFHV3XOVHVDQG5LFH
KDYH DGXOWHUDWLRQ GXH WR ZKLFK WKH ERG\ DEVRUEV SRLVRQ VORZO\ ZKLFK JHWV
GHSRVLWHGWKXVZHVXIIHU&DQFHU2EHVLW\6XJDU%ORRG3UHVVXUH/LYHU.LGQH\DQG
+HDUWSUREOHPV
+HQFHIROORZ3HU&HQW3DWDQMDOLSURGXFWVZKLFKDUHJXDUDQWHHGSXUHDQG
VDYH\RXUFKLOGUHQDQGEHORYHGRQHVIURPWKHSRLVRQRIDGXOWHUDWLRQ
2XUSOHGJH:RUOG&ODVV4XDOLW\/RZ&RVWDQG&KDULW\IURP3URWV
6XFK3ODWRQLFZRUNZLWKJUHDWGLYLQLW\FDQEHGRQHRQO\DQGRQO\E\DWUXH
<RJL
6DQ\DVL
Message
of
Sansthan
34 SeptemberU 2015
35 SeptemberU 2015
Message
of
Sansthan
36 SeptemberU 2015
37 SeptemberU 2015
Message
of
Sansthan
the efforts of Swami ji and Acharya ji as the two have touched the hearts of the people directly. And they were
naturally drawn towards them. He has towards these patients a view of considering them an amalgamation of
sensitivity. He said that there is a huge concept working behind the concept of Patanjali, a network, a teamwork, a resolution of success works into it.
Awadheshanand ji also said that as the army of Lord Ram comprising of monkeys was not a simple army
against Ravan but a force inspired by resolution, discipline, and a pledge for victory , the same way a force
is there working at Patanjali Ashram and it it just a beginning. And in future, the dreams of great sages like
Acharya Sri Ram Sharma who wished to establish Indian culture and traditions at its zenith, will be fulfilled
through Patanjali.
By again pointing at Swami ji and Acharya ji , he said that the sages have not only to ensure revolution but
they will ensure complete transformation in the world and they will destroy evasive and devil forces, they will
make the whole world happy and permanent solution to the country's problems will be found out.
He compared Patanjali Ashram with the ancient centres of education like Taxila and Nalanda that when
there will be no successor, Patanjali will provide them. He said he is seeing new India's future being born here.
Those students read Mahabhashya here are amazing kids, When the world will not have scholars to lead the
humanity, they will be produced at Patanjali. It is producing the leaders for all walks of life like trade, politics,
national security, etc. The two great sages are producing leaders to build a new world. Here one can see both
- Charak and Patanjali working together in the form of Acharya ji and Swami ji. One of them is a thinking
power, another is a vocal power. One is visible power, second is hidden power. One is Vyavahar satta, second
one is yoga power. They are resolute and working together. Both aspects are complementary towards each
other.
He said that all of us are involved in teachings and imparting knowledge, but whenever anyone will ask
me that where is our ideological movement, our answer will be that it lies in Acharya ji and Swami ji. It
lies in the experiments of Patanjali Yogpeeth. Their joint voice is the voice of India. He added that a time
will come when sages will conduct research on the works and achievements of the two. Here is the future
of India.
38 SeptemberU 2015
39 SeptemberU 2015
Message
of
Sansthan
peared a gap and people forgot about yoga but it was Swami ji who as a great sage introduced yoga among people.
He said that it was for the first time that UN had a few days ago officially mourned the death of our former
President Dr APJ Abdul Kalam and his birth anniversary is celebrated as World Student day.
He added that when energetic Prime Minister Narendra Modi addressed UN General Assembly, the world
accepted his call and began to do yoga. Speaking on the specialities of the book- Ayurved Siddhant Rahasya he
said that the book has been published in 12 languages and with this it is hoped that in future the herbs day will
be celebrated as World Herbs Day or World Ayurved Day. I have no doubt in it, he concluded. He further said
that there are two main forces in the country- Rishi Shakti and Krishi Shakti. Krishi Shakti produced grains to
feed our people while Rishi Shakti uncovered the vast secrets. The tribals have preserved the vast treasures of our
culture in the form of herbs.
He also said that today infrastructure is build and broken but intra-structure is never destroyed. This country
need vast intra-structure. This country has not developed itself through internet but through inner-net. Both the
great souls are able to establish a connection between the two.
He also said that this way the nation needs the herbal medicine of patriotism. More over the nation also needs
the realisation of self-pride as it strengthens patriotism. With self-pride, a person does not only live for himself
but the whole nation becomes his own. By indicating towards Swami ji and Acharya ji, Muni ji said that Patanjali
is strengthening the roots of the nation. The two have lived for the nation and the world. They are simply great.
They are working for the sake of their motherland.
40 SeptemberU 2015
Herbs day
On August 4, 2015, herbs day was celebrated and on that day Acharya Balkrishna ji Maharaj's book Ayurved
Siddhant Rahasya was released in 12 languages in the presence of sages and honourable Union Minister for
Tribal Affairs Jual Oram.
Children of Acharya Kulam are displaying Ayurved Siddhant Rahasya in various languages in the guise of the
people of different countries of the world.
42 SeptemberU 2015
Respected Mata ji
Dedicated sisters
Dedicated Brothers
43 SeptemberU 2015
Herbs day
The birthday of Acharya Shri being celebrated as `Jadi-buti Diwas` and the best wishes related to welfare of the
world communicated from `matra satta` and `guru satta`.
44 SeptemberU 2015
.HVK.DQWL
8QGHUWKHDEOHJXLGDQFHDQG/HDGHUVKLSRI
$\XUYHGD6KLURPDQL
6KUHGK\H\$FKDU\D%DONULVKQD-LZKRKDVGRQH
UHVHDUFKDQGGLVTXLVLWLRQRQRYHUPHGLFLQDOSODQWVDQGKHUEDOVDQG<RJDULVKL6ZDPL5DPGHY-L0DKDUDM
WKHODUJHVW$\XUYHGLF,QVWLWXWLRQ3DWDQMDOLKDVIRU\RXUEHWWHUKHDOWKSUHSDUHGDQGLQWURGXFHGRYHUSXUH
KHDOWK\HGLEOHDQGEHDXW\SURGXFWVDQGRQHRIWKHVHSURGXFWLVC.HVK.DQWLC
)RUWKHQDWXUDOVDIHW\DQGSURWHFWLRQRIKDLUVXVH.HVK.DQWLRLO.HVK.DQWL6KDPSRRDQG.HVK.DQWLKDLU
FRQGLWLRQHUZKLFKKDYHDQWLGDQGUXIISURSHUW\ZKLFKVWRSKDLUORVVDQGJUD\LQJRIKDLU,QIDFWWKLVSURGXFWLV
RQHVROXWLRQVWRSIRUHYHU\KDLUSUREOHP,WLVSUHSDUHGRIQDWXUDOKHUEDOVDQGPHGLFLQDOSODQWVZLWKRXW
3DUDIQ6RXVHLW\RXUVHOIDQGWHOO\RXUQHDUDQGGHDURQHV
2XUSOHGJH:RUOG&ODVV4XDOLW\/RZ&RVWDQG&KDULW\IURP3URWV
6XFK3ODWRQLFZRUNZLWKJUHDWGLYLQLW\FDQEHGRQHRQO\DQGRQO\E\DWUXH
<RJL
6DQ\DVL
2015 45
Disease Special
useful in diabetes
n
iabetes disease is caused by lack of insulin hormone in the body. This hormone is being released
by the `Agnashaya` gland, which is located just
below the stomach and above the duodenum. Its beta cells
produce insulin, which controls glucose in the blood. According to the World Health Organization (WHO) an
estimate of 18 crore people in the world are affected due
to diabetes. Diabetes disease exist since decades and its
description is found in `prahmeh` and Ayurvedic doctors
were aware of the disease around 3000 years ago.
Diabetes Mellitus word has been derived from the Greek
word diabetes, which means siphoning i.e.flowing and mellitus means sweet.
Types of diabetes
Type one is Insulin dependent diabetes mellitus: This category of diabetes attacks mostly children and tender-aged
children. In this category, the percentage of insulin in the
blood is negligible and hence, the sugar percentage increases
in the blood, to control which insulin injections are needed
or the patient falls unconscious and later slip into coma.
This condition is said to be diabetic coma. Its original reason is still not known.
Type two is non-Insulin dependent diabetes mellitus:
This disease is less serious as compared to Insulin dependent diabetes mellitus. It is mostly found in adults. Among all
diabetes patients, non-Insulin dependent diabetes mellitus
is found in 2/3rd of the total patients. The chief reason is
insufficient insulin hormone availability in the body or despite its adequate presence cells are unable to use it.
46 SeptemberU 2015
Reasons of diabetes
1. Obesity and lavish life style
2. Hereditary problem descending to children from the
parents
3. Excessive mental tension
4. Excessive use of anti-pregnancy tablets, steroids and
other such medicines.
Symptoms of diabetes
Repeated urination, excessive thirst, more hunger, decrease in weight, laxity and tiredness, dryness of the mouth,
time taking healing of the injuries, blurred vision, increase
in the lens power, itching around private parts, numbness
in hands, legs and sometimes feeling the movement of ants,
problem in skin and jaws, collection of ants near urine, sexual weakness and impotency, unconsciousness and gangrene
trouble.
9.
Aonla
Botanical name Phyllanthus emblica l
Family Phyllanthaceae
Useful Fruit
10. Neem
Botanical name Azadirachta Indica A Juss
Family Meliaceae
Useful Leaves and Seeds
3. Onion
Botanical name Allium Cepa L
Family Amaryllidaceae
Useful Juice of the bulb
11. Vat
Botanical name Ficus benghalensis
Family Moraceae
Useful Bark
4. Garlic
Botanical name Allium sativum
Family Amaryllidaceae
Useful bulb
12. Pipal
Botanical name - Ficus religiosa
Family Moraceae
Useful Root
5. Aloevera
Botanical name Aloevera (L) Burm
Family Xanthorrhoeaceae
Useful Exudates of leaves
13. Ramtil
Botanical name - Guazuma ulmifolia lam
Family Sterculiaceae
Useful - Fruit and leaves
6.
Sharifa
Botanical name Annona squamosa L
Family Annonaceae
Useful Leaves
14. Gurhal
Botanical name - Hibiscus rosa-sinensis
Family - Malvaceae
Useful - Roots and buds
7.
Lajalu
Botanical name Biophytum sensitivum (l) Dc
Family Oxalidaceae
Useful Whole plant
8.
Sadabahar
Botanical name Catharanthus roseus (l.) G.Don
Family Apocynaceae
Useful Whole plant
47 SeptemberU 2015
Disease Special
17. Sandan, Tinsa
Botanical name - Desmodium oojeinense (Roxb.) H.ohashi
Family Fabaceae
Useful - Fruit and leaves.
25. Harada
Botanical name - Terminalia chebura Retz.
Family - Combretaceae
Useful Seed powder
18. Pachi
Botanical name - Phyllanthus reticulatus Poir
Family Phyllanthaceae
Useful - Fruit and leaves
26. Methi
Botanical name - Trigonella foenum-graecum l
Family Combretaceae
Useful - Seed Power
19. Amrood
Botanical name - Psidium guajava l
Family Myrtaceae
Use - Fruit and leaves
27. Bhindi
Botanical name - Abelmoschus esculentus (l.) moench
Family Malvaceae
Useful - Seed and aerial Part
20. Kuina
Botanical name - Cinchona officinalis l
Family Rubiaceae
Useful Bark
28. Khair
Botanical name - Acacia catechu (L.f.) willd
Family Fabaceae
Useful Bark.
21.Turmeric
Botanical name - Curcuma longa l
Family Zingiberaceae
Useful Rhizome
30. Chirayita
Botanical name - Swertia chirayita (Roxb.) buch.-Ham.
ex C.b. Clarke
Family Gentianaceae
Useful Whole plant.
23.Jamun
Botanical name - Syzygium cumini (l.) Skeels
Family Myrtaceae
Useful - Seed and bark
24. Bahera
Botanical name - Terminalia bellirica (Gaertn.) Roxb
Family Combretaceae
Useful - Whole Plant
48 SeptemberU 2015
6SHFLDO&K\DZDQSUDVK
)RUWKHWKRXVDQGVRI\HDUVRXUROGVDLQWVVHHUVGLGUHVHDUFKRQKHUEDOVDQGIRURXUEHWWHUOLIH
DQG KHDOWK\ IXWXUHJLIWHG
WKHLQYDOXDEOH NQRZOHGJH RI$\XUYHGD ,QWKHVFDUHG GLYLQH WUDGLWLRQ RI
IXWXUHJLIWHGWKHLQYDOXDEOH
VDLQWV$\XUYHGD6KLURPDQL$FKDU\D%DONULVKQD-L0DKDUDMLVLQYROYHGLQGHHSDQGLQWHQVHUHVHDUFKRI
RYHU VFDUFH KHUEDOV )URP WKH ORQJ OLVW RI OLIHVDYLQJ KHUEDOV KDYH EHHQ SLFNHGXS WR
SURGXFHWKHJOREH
VEHVW3DWDQMDOL6SHFLDO&KD\DZDQSUDVKZLWKDGGHGC.DVKPLUL.HVDUC
1RZMXVWTXLWWKHVXEVWDQGDUGDGXOWHUDWHGFK\DZDQSUDVKDYDLODEOHLQWKHPDUNHWDQGDGRSW
RULJLQDO3DWDQMDOL&KD\DZDQSUDVKDQGJDLQLPPHQVHSRZHUDQGLPPXQLW\WRJKWRXWVHULRXV
DLOPHQWVDQGGLVHDVHVDQGHQMR\ORQJKHDOWK\OLIH
2XUSOHGJH:RUOG&ODVV4XDOLW\/RZ&RVWDQG&KDULW\IURP3URWV
6XFK3ODWRQLFZRUNZLWKJUHDWGLYLQLW\FDQEHGRQHRQO\DQGRQO\E\DWUXH
<RJL
6DQ\DVL
2015 49
Principles of health
Naturopathy of
Patanjali Yoggram
`Panchkarma experiment`
In `panchkarma`, it is lubrication, diaphoresis, purgation and emesis. These
50 SeptemberU 2015
ing uses `prana` properly, there is no need to eat medicines or for the strength of `prana`, medicines, herbals
are useful. The yog-gram cell of Patanjali works on the
same principle.
51 SeptemberU 2015
World Building
The world on
the way of
reconstruction
n
or Radha - Krishna? It is so because this was the greatness of Indian culture. People of India don't call their
country as their fatherland but they prefer to call it their
motherland. In Vedas, earth has been termed as mother.
Mata Bhumih, Putroaham Prithivyah I Among teachers
of a child, mother is counted before his or her Guru and
father. "Matriman, Pitriman, Acharyavan Purusho Ved".
Why did we put our mothers on back burner like that of
western culture.
When every citizen of India will start writing the
names of their mother, it will mark the beginning of a
new revolution. I will try to move a petition in the Supreme Court seeking to make it necessary for every citizen to use the name of his mother instead of his father.
relationship. It is most likely that with recent accord between the two sides, the era of 40-year old tension will
be over. Another major development is that Iran has
agreed international monitoring on its nuclear installations hence it won't be able to develop nuclear weapons
henceforth. The kind of pressure Iran incurred in the recent years due to sanctions by the six nations, the other
countries of the world will learn a lesson and they will
desist from nuclear adventure. It is a great development
in the direction of nuclear disarmament. Fourth, with
normalisation of relation between the US and Iran, now
it will be possible that the whole south Asia, Iran, India and the US will work together. They will share joint
strategy, joint trade tax, etc. With normalisation of Iran
and the US, now India will have even wider opportunities for its own development in all sectors. India is developing Iran's Chahbahar port, from where there will be a
direct route to Central Asia, and hence the US will now
help India even more to enhance its influence.
Sixth, now India, Iran, the US, and other countries of
the world can even more effectively deal with Taliban,
they can build a stronger Afghanistan. Seventh, India
has now a much better relation with Saudi Arabia, Israel
and Iran, now India is required to develop a new threepronged strategy. The duty which is to be executed by
the US is now to be done by India itself. Eighth, now Iranian oil will help reduce the price of oil in international
market. India imports 80 percent of the oil of its needs.
Now it will have benefit of billions of rupees. Moreover,
Village Matters
Majority ment of the villages. But the problem is that we want to adopt Western culture for the
development of the villages. We should not forget that the civilization of the Western period is just
200-300 years old. The society and the culture are still experimenting. They could not develop any
model system or arrangement, which can be followed for the benefit of the society. Their system and
arrangements are proving detrimental for themselves. From socialism to capitalism, they have been
proved to be miserable failure and passed through the phase of confusion thus finding some proper
solution for them itself. In fact all the philosophers of the world are finding solution of their problem
in Indian culture, tradition and ideology. Thus for the all-round development and self dependency of
the villages, we will have to rely on the decades-tested `swadeshi` formula and traditions, which have
to be mould in accordance with the modern era so that our own model could be developed.
54 SeptemberU 2015
Indigenous fertilizer:
If we use fertilizer prepared of cow dung and vegetable
waste, the country could save lakhs, crores of rupees, which
is being used in chemical fertilizers. Experiments in many
countries, including India have proved that such domestic
fertilizer increases productivity and not decreases.
Supply of fuel:
Methane gas, which is prepared of cow dung could easily
fulfill the need of fuel of more than half of the population.
In world, at many places, the gas production plants in plastic
tubes are running successfully, which could easily save lakhs,
crores of rupees, spent on fuel. The domestic plant could be
installed for just Rs 5-10,000 and is not unsuccessful like cow
dung gas plant of cement. At little large scale, with small generators, power could be generated, which is being used at some
places in our country. 8-10 cows are sufficient for the purpose.
Village Matters
could be set-up with proper training to the village men. The
poor effects of GM seeds have already been observed and
almost all the countries have rejected them. Only India is an
exception. But of late, we will have to rely on domestic seeds
as impotence seeds are making our youths impotent, is what
many people presume. Thus, without protecting domestic
seeds, village and national growth is not possible.
Water management:
India had been the best in water management including
collection and conservation. A book on this subject `Abhi
bhi khare hai talab` and discussion with Ravidra Guru give
adequate guidelines in this connection. If we properly implement such technologies with intelligence at village level,
for sure good results will come.
`Panchgavya` products:
A two-day workshop on Panchgavya, arranged under
the aegis of AYUSH department i.e. Central Ayurveda and
Research Council of Government of India, held in New
Delhi, recently. On the occasion, a research tract of 500
pages, titled `Panchgavya chikitsa` was released. According to medical experts, complete treatment with the help of
`Panchgavya` is possible. The medicines could be prepared
at village level. In fact, a farmer could produce medicines at
the corner of his house for his family thus, saving his beloved ones with the ill-effects of medicines besides unnecessary
spending money, efforts and time.
The use of cow dung incense sticks is also gaining popularity and anybody could easily learn the technique and prepare incense sticks. Apart from the domestic use, it could be
sold in the urban areas. The demand of cow urine infusion,
`ghanvati` is also on rise. Cow dung, cow urine and cows
ghee safeguard a person from the risk of cancer and researches have certified it. America and other countries have
patent some of the `Panchgavya` products. Thus, till license
permission and selling system, they could experiment it at
their home so that the health of their beloved ones is saved.
A-2 protein means the product is highly healthy. Thus, essentially we should shelter and protect domestic cows and
its rearing should be promoted. The Ayurveda Research
Council and Karnal located NBAGRK scientists have the
same opinion.
Agnihotra:
Peru, Chile, Poland, Germany, France and many other
countries of the world are relying on `agnihotra` to improve
production and treatment of incurable diseases of crops. On
December 16, 2012, an MD doctor, who had come from
Peru gave presentation on agnihotra in Patanjali Yogpeeth
and said that in his farms, he is taking production of 84 tons
of mangoes per acre, due to the use of agnihotra, which was
just 10 tons previously. We have, using chemical fertilizers
taken 15 tones of mangoes, per acre of land. Most of the
people from different countries cant pronounce agnihotra
properly and hence, they re-named it as homa.
This process of 5-10 minutes time can be easily taught to
the farmers. The process is much easy and result-oriented.
It treats the pollution of water, soil, air and increase the
productivity manifolds.
In Maharashtra, farmers started production of grapes.
The germination of seeds was taking place in 6-9 months
but with agnihotra, seeds germinated in just 21-28 days. In
Maharashtra, many farmers are still utilizing the technique.
Many experiments, held world-wide proved that agnihotra generates positive energy. Drug addicts leave the
habit and become peaceful and good character person.
So, the need is to train groups of good values. Following
the above said principles, we could develop some of the
villages as model villages, so that other people could also
be motivated and inspired and the country starts growing
faster on agriculture based economy. I am hopeful that the
common man will understand the facts and move ahead
in this direction to contribute in the growth of the nation.
Natural fertiliser
1955, only 2000 mt pesticides were used in India, now 8300 mt is used in the country. They
adversely impact the environment. Various fruits, vegetables,
cattle food, etc are mediums which carry harmful chemicals
inside the human and animal body and drastically hit their
health. Given these realities, it is important to use more
and more domestic stuffs to control pests and Patanjali has
launched an intense research drive in this direction. Other
institutes too have started moving in this direction, but it is
equally important to spread awareness among farmers. The
aim is to promote the use of herbal fertilisers so that they
could be prepared at domestic levels and with this the whole
agricultural world would benefited.
Till
Use of Neem
l
Before planting the crops of tomato, soak it in water mixed with Neem khali. It use will prevent the
danger caused by many worms.
Take 5 litres of water and add 1 kg Neem Khali
and leave them together for a week and keep shaking them on and off. Later filter it and add 10 litre
of water and sprinkle it on your crops. It will protect the crops from many pest and insects.
Mix one kg Nimbauli powder in per 100 kg of
each of the grains of Moong, gram, peanuts and
other pulses to protect them from damage from
insects for 6-12 months.
Keep Nimbauli in an earthen pot and fill it with
water and cover the pot for a month's time. Sprinkling this preparation on crops by adding water
into it will protect from pests and insects.
Butter milk:
Take 10-15 days old butter milk made of the Desi cow
milk. Sprinkle it after adding 15 litre of water. It will
control pests and diseases in pulses. Moreover, store 10
litre butter milk in an earthen pot for a month, later add
13, 01
UUmUU- U 25
U 2015
, , ,S SU
U
15/-
U S U UUU U
U (USU) UUmU mUU
5.
6.
7.
8.
U U L
S U UcU U
1.
2.
3.
4.
6DYHWKHFRXQWU\IURPHFRQRPLFVODYHU\DQGSRYHUW\
%ULQJWKHEHVWCVZDGHVKLCSURGXFWVRI3DWDQMDOLDWKRPH
:KHQZHXVHIRUHLJQFRPSDQ\SURGXFWVRXUPRQH\LVRZQWRIRUHLJQFRXQWULHVRXU
QDWLRQDQGWKHVRFLHW\VORZO\JURZZHDNHUHFRQRPLFDOO\:KHQWKHFRXQWU\ZHDNHQVLW
XOWLPDWHO\EHFRPHVVODYHRIIRUHLJQQDWLRQ
7KXVWRPDNHWKHFRXQWU\VXSHUSRZHUHFRQRPLFDOO\DQGVSLULWXDOO\DGRSWDQGIROORZ
3DWDQMDOL<RJDDQGC6ZDGHVKLC
7KHSURWHDUQHGE\WKH3URGXFWVLVFHQWSHUFHQWXWLOL]HGIRUWKHSURPRWLRQRI<RJD
$\XUYHGD(GXFDWLRQ+HDOWK&RZVHUYLFHC*XUXNXOCDQGVHUYLFHWRWKHQDWLRQ7KH
3DWDQMDOLFDPSDLJQLVQRWIRUWKHSURVSHULW\DQGSOHDVXUHRIDQ\LQGLYLGXDOEXWLWLVIRUWKH
FROOHFWLYHSURVSHULW\DQGKDSSLQHVVRIWKHFRXQWU\DQGWKHVRFLHW\
2XUSOHGJH:RUOG&ODVV4XDOLW\/RZ&RVWDQG&KDULW\IURP3URWV
6XFK3ODWRQLFZRUNZLWKJUHDWGLYLQLW\FDQEHGRQHRQO\DQGRQO\E\DWUXH
<RJL
6DQ\DVL
2015 59
60 SeptemberU 2015
With the
strength of
Yoga
By waking up at dawn,
lets focus in the feet of almighty I
With the strength of yoga,
Lets make our lives sacred I
With the endowments of dawn,
Let us make our life complete I
By getting benefitted from divine
yoga,
Lets get healthy body and mind I
By doing Surya Pranama every
morning,
Lets enhance our inner energy I
With Asana, Pranayam and Niyam,
Lets make ourselves fresh and active I
To deprived and troubled people,
lets hug them with love and
affection I
To every individual of this world,
lets inspire to do yoga I
Auspicious and best method,
Let us make a prosperous and happy
society I
Laziness, frustration and
hopelessness,
lets get rid of all these things I
With the strength of Yoga
LET US MAKE OUR LIVES
SACRED I
Ram Kishore Shukla
The souls
which became
decayed in five
fundamental
elements
Sacrificed all their comforts for the world,
They are now remembered and revered as deities I
By sacrificing their own blood for the world,
Fought on the frontiers our brave soldiers,
The life which becomes prosperous due to their sacrifices,
Never were they envious, even a bit,
The sacred thoughts, they did not ever show arrogance.
They became eternally famous, by sacrificing their lives,
They smeared the motherland with their own blood,
Their only dream was to see the motherland prosperous,
They went for heavenly abode,
by praying the motherland,
O I Nationalists ,
lets come to remember their contribution,
Those who after sacrificing lives, are proud,
To ensure no politician could loot the nation,
People of the nation should not be
harmed because of them,
Rein in atrocious, terrorist elements,
Promote brave and courageous forces,
could take charge of the nation,
No more bleeding due to terror elements,
Send the message to enemies of humanity,
Disturbing elements have been spotted,
The brave sons of this country by sacrificing their lives,
Their sacrifice should never go waste,
O nationalists , lets pray in their respect,
Those who have sacrificed their life, shown bravery
61 SeptemberU 2015
Rajesh Jain
is an old saying that when any problem assumes serious dimensions, return to the basics. Many farmers are committing suicide in India and the incidents are sufficient to say return to
the basics. When chemical and toxic fertilizers were not available, still
farming was done and the produce was better. The farmer was happy.
Azadirachta indica or neem, insecticides made-up of cow urine were
playing efficient role in controlling the diseases. But as the use of chemical, poisonous fertilizers increased, the problems of the farmers too increased in the same proportion. In such adverse circumstances, the drive
for toxin-free farming being launched by Patanjali Yogpeeth will definitely show the light.
IT
62 SeptemberU 2015
semi-warm areas but for its production warm and humid climate is the
best. Area having around 700 mm of
annual rainfall is the best region for
its production.
could be saved from excessive water and moisture. Put 200 liters of Sanjeevak fertilizer of biogas slurry one week before sowing. For one acre of land,
100 square meters of area and 450 grams of chilli seeds are sufficient for
sowing chilli seeds. But before sowing the seeds in the nursery, its purification is necessary. Now for the purification, take 2 liters bitter butter-milk
and mix 10 grams of asafetida in 5 liters of water to prepare a solution. Dip
chilli seeds in the solution for 30 minutes and then take it out and dry in
shadow. Following this process, sow the seeds.
During sowing, make lines at the distance of 5-6 cms. After sowing, cover
the lines with thin layer of rotten cow manure and put light layer of straw.
When the plats germinate, remove straw layer.
Transplantation of plants
The plants of chilli prepare
in 25-28 days in summer and
50-55 days in winter. The plants
should be sown at distance of
45x30 cms.
Prominent species
of chilli
1.
2.
3.
4.
5.
6.
7.
8.
LG 1 (Pusa Sadabahar)
Bhagya Laxmi
Jawahar chilli 128
X-235
K-5452
Pusa Jwala
Pant-C 1
Punjab Gucchedar
63 SeptemberU 2015
&KLNLWVDOD\DDQG$URJ\D.HQGUD
0DKDUVKL &KDUDN 6XVKUXW 'KDQYDQWDUL DQG 3DWDQMDOL HWF PDQ\
ODLGWKHIRXQGDWLRQRI0HGLFDO6FLHQFHWKRXVDQGVODNKVRI
EDFN )ROORZLQJ WKH VDPH WUDGLWLRQ $\XUYHGD 6KLURPDL
$FKDU\D%DONULVKQD-LLVGRLQJGHHSUHVHDUFKRQRYHU
6KUHGK\H\$FKDU\D%DONULVKQD-LLVGRLQJGHHSUHVHDUFKRQRYHU
KHUEDOV DQG PHGLFLQDO SODQWV <RJDULVKL 6ZDPL 5DPGHYML
DQG6KUHGK\H\$FKDU\D%DONULVKQD-LKDYHVDYHGQRWRQO\
0DKDUDMDQG6KUHGK\H\$FKDU\D%DONULVKQD-LKDYHVDYHGQRWRQO\
EXWPLOOLRQVRIOLIHWKURXJK<RJDDQG$\XUYHGD
:HVKRXOGQRWIDOOLOODWWKHUVWSODFHDQGHYHQLIZHIDOOLOOZKDWPHGLFLQHVZHVKRXOGWDNH:HKDYH
VXUHVKRWVFLHQWLFDOWHUQDWLYHRIGLVHDVHVWREHFXUHGSHUPDQHQWO\WKURXJK<RJDDQG$\XUYHGD7KH
WUHDWPHQWRI$\XUYHGDLVEHQHFLDOLQ2EHVLW\'LDEHWHV+LJK%ORRGSUHVVXUH+HDUWDLOPHQWV6NLQ
WURXEOHV$VWKDPDZDLVWDQGMRLQWSDLQVOLYHUDQGNLGQH\UHODWHGGLVHDVHVDXWRLPPXQHGLVHDVHVDQG
HYHQ&DQFHU
0DQ\3DWDQMDOLKRVSLWDOVDQG&XUHFHQWUHVDUHEHLQJUXQZKHUHDOOSRZGHUVC9DWLCC$YDOHKCRLO
C3DNCDVKHVC*XJJDOCC$ULVKWDCDQGRWKHUVDQGSDWHQWPHGLFLQHVOLNHC0XNWDYDWLCC0DGKXQDVKLQLC
DQGC+LUG\DPULWCZKLFKKDYHEHHQSUHSDUHGDIWHUDJJUHVVLYHDQGORQJUHVHDUFKDUHDYDLODEOH
7DNHIUHHPHGLFDODGYLFHIURPWKH3DWDQMDOL<RJSHHWK+DULGZDURUWKHKRVSLWDOORFDWHGLQ\RXUGLVWULFW
,QFOXGH<RJDDQG$\XUYHGDLQ\RXUOLIHVW\OH
$QGHQMR\GLVHDVHWHQVLRQIUHHKHDOWK\SHDFHIXODQGKDSS\OLIH
2XUSOHGJH:RUOG&ODVV4XDOLW\/RZ&RVWDQG&KDULW\IURP3URWV
6XFK3ODWRQLFZRUNZLWKJUHDWGLYLQLW\FDQEHGRQHRQO\DQGRQO\E\DWUXH
<RJL
6DQ\DVL
2015 65
Poem
3
Become a member of
12 Languages
+LQGL(QJOLVK*XMDUDWL0DUDWKL%DQJOD3XQMDEL2UL\D
$VVDPHVH7HOXJX.DQQDGD1HSDOL7DPLO
Sir,
I hereby pay Rs. ................ as the annual /
YH \HDUV (OHYHQ <HDUV VXEVFULSWLRQ IHH IRU
Yog
Sandesh
.......................
by
dated
cash/M.D./D.D./Payslip
....................
Therefore
every
month
at
the
address
given
below.
Name .............................................................
Father/Husband name .......................................
Address ...........................................................
........................................................................
........................................................................
........................................................................
3RVW2IFH
District ....................... State .............................
Pin Code...................... Phone ..........................
email ...............................................................
(Special rules)
1. Subscriprion fee-1 year-150/- 5 years-700/- 11 years1500/2. D.D. should be in favour of Yog Sandesh payable in
Haridwar.
3. The D.D. payable on other places than Haridwar send
Rs. 70 extra.
3OHDVHOO\RXUQDPHDQGDGGUHVVLQQHDW FOHDQKDQGwriting
5. The subscription in abroad initially for one year. The
subscription fee for such members Rs. 800/- or USD
20/- or GBP 10/6. Subscription fee may be deposited in the A/c no.
30721914467 (SBI Patanjali Yogpeeth, Shantarshah,
Bahadarabad, Haridwar).
0HPEHUVKLSIRUPPXVWEHOOLQ+LQGLRU(QJOLVKRQO\
&RZ
V3XUH*KHH
:H KDYH HVWDEOLVKHG D PDVVLYH ELJ DQG RUJDQL]HG FKDLQ IURP 0DKDUDVKWUD WR
.DUQDWDNDLQHQWLUH6RXWK,QGLDSUHFLRXVO\IRUWKHFROOHFWLRQRIPLONIURPZKHUHWKHFRZ
V
PLON LV FRQYHUWHG LQ EXWWHU ZLWK FHQW SHUFHQW JXDUDQWHHG SXULW\ DQG FHUWLFDWLRQ DQG
WUDQVSRUWHG WR +DULGZDU +HUH SXUH CGHVLC JKHHFODULHG EXWWHU LV SUHSDUHG ZKLFK
UHDFKHVWR\RX
(DWSXUHCGHVLJKHHCRIFRZDQGVDYH\RXULQQRFHQWFKLOGUHQDQGIDPLO\IURPDGXOWHUDWLRQ
PO
PO
OW
OW
OW
C6KDVWDP'KLVPULWLPDLQGKJQLEDODX6KXNUDFKDNVKXQDP
%DOYULGKDSUDMDNDQWLVDXNXPDU\DVWKLUDUWKLQDPD'KDQYDQWDUL1LJKDXQWX,,,,
&RZ
VPLONLPSURYHV,QWHOOHFWPHPRU\YLJRUHQKDQFHVSRZHUDJHDQG\RXWKIXOQHVVLPSURYHVH\HYLVLRQEHQHFLDO
IRUFKLOGUHQDQGROGHUDOLNHKHOSVLQIHUWLOLW\LPSURYHVIDFLDOJORZDQGVDYHVWKHERG\IURPWKHROGDJHHIIHFWV
6FLHQWLFIDFW 7KHFRZ
VPLONKDV JJ.HURWLQHHOHPHQWZKLFKLVQRWDYDLODEOHLQEXIIDORHV
CJKHHC7KLVHOHPHQWKDVPDJLFDOWHQGHQF\WRNHHSH\HVKHDOWK\,QWHUQDWLRQDO-RXUQDORI'DLU\7HFKQRORJ\SDJH
CJKHHC7KLVHOHPHQWKDVPDJLFDOWHQGHQF\WRNHHSH\HVKHDOWK\,QWHUQDWLRQDO-RXUQDORI'DLU\7HFKQRORJ\SDJH
2XUSOHGJH:RUOG&ODVV4XDOLW\/RZ&RVWDQG&KDULW\IURP3URWV
6XFK3ODWRQLFZRUNZLWKJUHDWGLYLQLW\FDQEHGRQHRQO\DQGRQO\E\DWUXH
<RJL
6DQ\DVL
2015 67
YOG SANDESH ()
3DWDQMDOL
$QLPDOIHHG%LRIRRG
DQGDQLPDOSURWHFWRU
)RU WKH SHUIHFW KHDOWK DQG PD[LPXP PLON SURGXFWLRQ IURP WKH PLOFK DQLPDOV XVH C3DWDQMDOL
'XJGKDPULWCDEDODQFHGDQLPDOGLHWJHWRQHFDOIHYHU\\HDUDQGIRUGD\VHQMR\VWUHDPRIPLON
C3DWDQMDOL'XJGKDPULWCULFKLQE\SDVVSURWHLQSURELRWLFYLWDPLQPLQHUDOVDQGKHUEDOVZLWKRXW
XUHD$SURSHUDQLPDOIHHGZKLFKJLYHVKHDOWKWRWKHFDWWOHDQGSURVSHULW\WRWKHIDUPHU
$IWHUGHOLYHU\IRUWKHSURWHFWLRQDQGFXOWXUHRIXWHUXVRIWKHDQLPDO C3DWDQMDOL*DUEKDQMDOLC )RU
PXOFKLQJDQLPDOSUHJQDQWDQGIRUWKHJURZLQJFDWWOHC3DWDQMDOL6DPYULGKLCDQGC3DWDQMDOL6DPYULGKL
%ROXVC7RLPSURYHDQGVWUHQJWKHQGLJHVWLYHV\VWHP C3DWDQMDOL%DWWLVD3URC )RULPSURYHPHQWLQ
XGGHUDQGPLONFHOOV
3DWDQMDOL0XOWLYLWDPLQV
ZKLFKDOVREHWWHUVLPPXQHV\VWHPRIWKHFDWWOH)RU
KXQJHU GLJHVWLYH SRZHU DQG FRPSOHWH OLYHU DFWLYDWLRQ
3DWDQMDOL <DNULWDPULW
)RU EHWWHU PLON
SURGXFWLRQFXUELQJRINHWRVLVDQGDFWLYDWLRQRIWKHFDWWOHC3DWDQMDOL6KDNWLGKDUDC
7KURXJK3%5,XVHIRUWR[LQIUHHDJULFXOWXUHC3DWDQMDOL*UDQXODUIHUWLOL]HUCC3DWDQMDOL%LRIHUWLOL]HUC
DQG C3DWDQMDOL6XUDNVKDCDQG C3DWDQMDOL1HHPCZKLFKUHVWULFWVXVHRIWR[LQFKHPLFDOFRQWDLQLQJ
IHUWLOL]HUVLQVHFWLFLGHVDQGVDYHSHRSOHIURPEHFRPLQJFDQFHURXV
)RUWKHVDOHRI3DWDQMDOL$QLPDOIHHG)HHGVXSSOHPHQW%LRIHUWLOL]HUDQGDQLPDOSURWHFWRUC.LVDQ6HZD.HQGUDC
KDYHEHHQHVWDEOLVKHGDFURVVWKHFRXQWU\)RURSHQLQJQHZFHQWHUVDWYDFDQWSODFHV3HDVHFRQWDFW
3KRQH1XPEHUV
(PDLOLQIR#SDWDQMDOLJUDPRGK\RJQ\DVFRP:HEVLWHZZZSDWDQMDOLJUDPRGK\RJQ\DVFRP
68 U 2015