Documenti di Didattica
Documenti di Professioni
Documenti di Cultura
It is important for a cell and molecular biology student to be familiar with the tools and
equipment in the lab. Knowledge of proper care of the instruments will ensure their
longevity, and knowledge of their proper use will aid in getting positive results when
carrying out experiments. This exercise introduces the student to the cell and molecular
biology laboratory.
Objectives: At the end of this activity the student should be able to:
Methodology
1. Take note of the following equipment and instruments whose usage you need to
be familiar with in the conduct of cell and molecular biology laboratory protocols.
a. Bio Ref
b. UV/Vis Spectrophotometer
c. Photo Documentation System
d. Micropipettors (0.5-10µl, 2-10µl, 20-100µl, 100-1000µl )
e. Thermal Cycler (MyCycler PCR Machine)
f. Gel Electrophoresis System
i. Horizontal gel electrophoresis
ii. Vertical gel electrophoresis
iii. Power supply
iv. Fast Blast Staining Facility
g. Shaker/Agitator
h. Vortex mixer
i. Microcentrifuge
j. Water bath
k. Distilling apparatus
l. Autoclave/Sterilizer
m. Ice shaver
n. Parafilm
2. A battery of exercises will be conducted by your instructor to equip you with basic
skills necessary in conducting research in cell and molecular biology.
a. Proper use of micropipettors
b. Assembly of a gel electrophoresis system
c. Spectrophotometry
Cell and Molecular Biology Laboratory Manual Third Edition
Your Task:
Research on the descriptions and uses of the equipment and instruments in Part 1 of
this exercise. Pay special attention to their function. Submit a 10- to 15-page report to
your teacher.
3. In PCR, what is the relationship between the DNA template’s melting point and
the annealing temperature? Explain your answer briefly.
2
Cell and Molecular Biology Laboratory Manual Third Edition
The polymerase chain reaction (PCR), gel electrophoresis and restriction enzyme
digestion are standard protocols in molecular biology. Data from these often serve as the
basis for quantitative analyses, from which insight on the workings of the natural world
may be gleaned. These tools are applied in a wide variety of fields such as population
genetics, forensics, and the detection of genetically-modified organisms.
Objectives: At the end of this activity the student should be able to:
1. isolate nucleic acids (DNA and RNA) from selected biologically important
sources;
2. apply basic protocols in nucleic acid analysis such as polymerase chain reaction
(PCR), agarose gel electrophoresis (AGE) and DNA fingerprinting;
3. conduct proper documentation and reporting of scientific findings;
4. understand the ethical issues in the applications of nucleic acid analysis; and
5. practice ethical behavior in the conduct of nucleic acid analysis procedures.
Materials Needed
Item/s Quantity Item/s Quantity
cheek cells glass vials 36
lysis buffer A (40ml) 1 silver caps 36
lysis buffer B (40ml) 1 plastic plugs 36
protease (1.3ml) 1 waxed string 36
5M sodium chloride (salt), 5ml 1 super glue gel 2
sterile water, 2.5 ml 1 91% isopropyl alcohol or 95% EtOH 1
5-ml round bottom tubes 50 water bath with thermometer 1
clear micro test tubes 60
colored micro test tubes 60
screwcap tubes (assorted color caps) 40
disposable plastic transfer pipets 50
foam micro test tube holders 10
cytology brushes 80
parafilm laboratory film 1
3
Cell and Molecular Biology Laboratory Manual Third Edition
Methodology
Pre-Lab Preparations
4
Cell and Molecular Biology Laboratory Manual Third Edition
Laboratory Proper
5
Cell and Molecular Biology Laboratory Manual Third Edition
6
Cell and Molecular Biology Laboratory Manual Third Edition
7
Cell and Molecular Biology Laboratory Manual Third Edition
Your Task:
Prepare a 3- to 5-page formal report, explaining the rationale for each step in this
exercise. Explain the results you obtained. Your report should have an Abstract, Title,
Introduction, Methodology, Results and Discussion, and Conclusion. Make sure that the
problem and hypothesis are stated in the Introduction.
1. What is the reason for using 95% ice-cold ethanol in the extraction procedure?
2. What color of the precipitated DNA should you expect? Explain your answer.
Reading assignment:
Steiner JJ, CJ Poklemba, RG Fjellstrom & LF Elliott. 1995. A rapid one-tube genomic
DNA extraction process for PCR and RAPD analyses. Nucl. Acids Res. 23:2569-
2670.
8
Cell and Molecular Biology Laboratory Manual Third Edition
Materials Needed
Item/s Quantity Item/s Quantity
HindIII DNA size standard, 100µl 1 horizontal gel 2
electrophoresis chambers
DNA samples, lyophilized, 60 µg each micropipets
Crime scene sample 1 2-20µl 1-8
Suspect samples 5 20-200µl 1
EcoRI/Pstl restriction enzyme mix 1 100-1000µl 1
Lyophilized, 3000 units pipet tips
sample loading buffer, 5x, 1ml 1 2-20µl 1 box
electrophoresis buffer, 50x TAE, 100 ml 1 20-200µl 1 box
sterile water, 2.5 ml 1 100-1000µl 1 box
agarose powder, 5 g 1 power supply
Fast Blast DNA stain, 500x, 100 ml 1 water bath
colored micro test tubes, 1.5 ml 80 mini centrifuge
foam micro test tube holders 8 gel support film
gel staining trays 4 hot plate
Methodology:
Pre-Lab Preparations
4. Prepare 100X Fast Blast stain from the 500X stock solution. Use distilled water to
dilute the dye in an Erlenmeyer flask. The dye may be stored at room temperature
until it is ready for use.
9
Cell and Molecular Biology Laboratory Manual Third Edition
Laboratory Proper
10
Cell and Molecular Biology Laboratory Manual Third Edition
11
Cell and Molecular Biology Laboratory Manual Third Edition
12
Cell and Molecular Biology Laboratory Manual Third Edition
5. Place the gel in a plastic container with your group identification and store the gel in
the cell biology lab refrigerator.
Your Task:
Prepare a 3- to 5-page formal report, explaining the rationale for each step in this
exercise. Explain the results you obtained. Your report should have an Abstract, Title,
Introduction, Methodology, Results and Discussion, and Conclusion. Make sure that the
problem and hypothesis are stated in the Introduction.
13
Cell and Molecular Biology Laboratory Manual Third Edition
Materials Needed
Item/s Quantity Item/s Quantity
HindIII restriction enzyme 1 horizontal gel electrophoresis 2
apparatus
Pstl restriction enzyme 1 micropipets
EcoRI restriction enzyme 1 2-20µl 4-8
restriction buffer 1 20-200µl 1
λ DNA, uncut 1 pipet tips 1 bag
DNA size standard 1 2-200µl
sample loading buffer, 5x, 1 ml 1 power supply 2
agarose powder, 5 g 1 water bath 1
electrophoresis buffer, 50x 1 rocking platform
TAE, 100 ml
agarose powder, 5 g 1 gel support film
Fast Blast DNA stain, 500x, 1 hot plate
100 ml
micro test tubes 60
foam micro test tube holders 8
gel staining trays
Methodology
Pre-Lab Preparations
1. Aliquot 3 µl of each restriction enzyme into three clear micro test tubes. Label the
tubes HindIII, Pstl and EcoRI respectively. Make sure that the micro test tubes are
maintained on crushed ice.
2. Aliquot 30 µl of restriction buffer into two clear micro test tubes. Label the tube "res".
Keep the tube on ice.
3. Aliquot 25 µl λ DNA into two clear micro test tubes. Label the tube "λ". Maintain the
tubes on ice as well.
4. Aliquot 10 µl sample loading dye into two clear micro test tubes.
5. Store the enzymes, buffer, the λ DNA and sample loading dye in the cell biology
refrigerator.
6. Prepare 1X TAE buffer that will be enough for a 1%(w/v) or 2%(w/v) agarose gel
and electrophoresis chamber if necessary.
7. Prepare the agarose gel for the electrophoresis.
14
Cell and Molecular Biology Laboratory Manual Third Edition
Laboratory Proper
15
Cell and Molecular Biology Laboratory Manual Third Edition
16
Cell and Molecular Biology Laboratory Manual Third Edition
17
Cell and Molecular Biology Laboratory Manual Third Edition
Your Task:
Prepare a 3- to 5-page formal report, explaining the rationale for each step in this
exercise. Explain the results you obtained. Your report should have a Title, Introduction,
Methodology, Results and Discussion, and Conclusion. Make sure that the problem and
hypothesis are stated in the Introduction.
18
Cell and Molecular Biology Laboratory Manual Third Edition
Materials Needed
Item/s Quantity Item/s Quantity
positive Controls micro test tubes 60
homozygous (+/+) 1 PCR tubes 0.2 ml 50
heterozygous (+/-) 1 screwcap tubes 1.5 ml 50
homozygous (-/-) 1 capless PCR tube adaptors 50
1.5 ml
PCR Master Mix 1 agarose powder 5 g 1
PCR Primer Pair 1 electropheresis buffer 1
DNA molecular mass ruler 1 Fast Blast DNA stain 1
InstaGene™ DNA extraction 1 foam micro test tube holders 8
matrix
xylene cyanol DNA loading dye 1 gel staining trays 4
Methodology
Pre-Lab Preparations
1. Pipet 200 µl of Instagene™ matrix into four screwcap tubes. Make sure that the
contents of the bottle have been gently mixed or vortexed prior to pipetting.
2. Prepare 50 ml 0.9% saline solution by adding 4.5g non-iodinated table salt to 500 ml
drinking water. Give 10 ml of this to the class volunteer.
3. Pipet 34.375 µl (x4) of Master Mix to a yellow micro test tube labeled "complete mix".
To this, add 0.6875 µl (x4) of the Primer Mix. The volume of this complete master mix
should total 140.25 µl. Vortex or flick the tube with your fingers.
4. Aliquot 20 µl of the complete master mix to each of four PCR tubes.
5. Prepare 1%(w/v) or 2%(w/v) agarose gel and appropriate volume of 1X TAE buffer.
6. Set the water bath to 100oC.
Laboratory Proper
19
Cell and Molecular Biology Laboratory Manual Third Edition
Your Task:
Prepare a 3- to 5-page formal report, explaining the rationale for each step in this
exercise. Explain the results you obtained. Your report should have an Abstract, Title,
Introduction, Methodology, Results and Discussion, and Conclusion. Make sure that the
problem and hypothesis are stated in the Introduction.
2. Explain briefly why PCR primers (forward and reverse) should be prepared in
equimolar concentrations for a standard PCR technique.
20
Cell and Molecular Biology Laboratory Manual Third Edition
Some microorganisms such as E. coli are invaluable tools in molecular biology. Often,
they serve as vectors in transformation experiments. Knowing how to manage them is
an essential basic skill not only in molecular biology, but in related fields. This exercise
also serves as the student’s first foray into genetic engineering.
Objectives: At the end of this activity the student should be able to:
Materials Needed
Item/s Quantity Item/s Quantity
plasmid (pGLO), lyophilized 1 inoculation loops, sterile 80
E. coli strain HB101 K-12, 1 micro test tubes, 2.0 ml, sterile, 60
lyophilized color coded
LB nutrient broth, sterile 1 foam micro test tube holders 8
LB nutrient agar powder 1 disposable plastic transfer pipets 50
Ampicillin, lyophilized 1
Arabinose, lyophilized 1
sterile transformation solution 1
(CaCl2)
Petri dishes, 60 mm, sterile 40
Methodology
Pre-Laboratory Preparations
1. Prepare the nutrient agar three days before the experiment. This nutrient agar is
autoclave free.
21
Cell and Molecular Biology Laboratory Manual Third Edition
c. Note that the ampicillin and arabinose can be destroyed at temperatures that
exceed 50oC.
4. Pour the LB nutrient agar into the plates. Stack the plates 4 to 8 high. Starting with the
bottom plate, lift the lid straight up and to the side with one hand, and pour the LB
nutrient agar with the other. Fill each plate about one-third to one-half (approx. 12 ml)
with agar.
5. Allow the plates to cure. They should stay at room temperature for two days followed
by refrigeration.
a. After curing, the plates can be stacked twenty high and a plastic sleeve bag
slipped down over them.
b. Invert the stack and secure the bag with tape.
c. Store the plates inverted in the refrigerator.
7. Prepare the plasmid by adding 250 µl transformation solution in the vial containing the
pGLO plasmid followed by refrigeration.
22
Cell and Molecular Biology Laboratory Manual Third Edition
Laboratory Proper
23
Cell and Molecular Biology Laboratory Manual Third Edition
24
Cell and Molecular Biology Laboratory Manual Third Edition
13. Analyze results by comparing the appearance of the bacterial samples under UV
light. Tabulate your observations:
Your Task:
Prepare a 3- to 5-page formal report, explaining the rationale for each step in this
exercise. Explain the results you obtained. Your report should have an Abstract, Title,
Introduction, Methodology, Results and Discussion, and Conclusion. Make sure that the
problem and hypothesis are stated in the Introduction.
3. What are the possible uses of GFP? Why transfer the capability of GFP synthesis
to E. coli O157:H7 strain?
25
Cell and Molecular Biology Laboratory Manual Third Edition
Exercise 3. Proteins
Objectives: At the end of this activity the student should be able to:
Materials Needed
Item/s Quantity
1x Bradford dye reagent (12 ml) 1
microtubes with protein standards 7
test milk samples 2
1x PBS (500 µl) 1
microtubes for making dilutions 4
100–1,000 µl adjustable-volume micropipet 1
100–1,000 µl pipet tips 1 box
2–20 µl pipet tips 1 box
cuvettes (or test tube substitutes) 10
milk carton with nutrition information 1
Parafilm (small pieces to seal cuvettes) 10
26
Cell and Molecular Biology Laboratory Manual Third Edition
Methodology
27
Cell and Molecular Biology Laboratory Manual Third Edition
Your Task:
Prepare a 3- to 5-page formal report, explaining the rationale for each step in this
exercise. Explain the results you obtained. Your report should have an Abstract, Title,
Introduction, Methodology, Results and Discussion, and Conclusion. Make sure that the
problem and hypothesis are stated in the Introduction.
1. What is the principle behind the use of Bradford reagent in this exercise? Why
use a wavelength of 595 nm?
2. Did your findings about the protein content of your samples match with the
product information provided? If no, can you explain why.
28
Cell and Molecular Biology Laboratory Manual Third Edition
Materials Needed
Item/s Quantity Item/s Quantity
pipet tips for gel loading 1 rack Actin and Myosin Standards 1
500 µg
micro test tubes 1.5 ml 120 foam micro test tube holders 8
screwcap micro test tubes 1.5 ml 200 gel staining trays 4
disposable plastic transfer pipets 1 30
ml
Laemli sample buffer 30 ml 1
Kaleidoscope prestained 1
standards 500 µl
electrophoresis buffer 1
10x TRIS/glycine/SDS, 1L
Biosafe Coomasie Stain 1L 1
Methodology
29
Cell and Molecular Biology Laboratory Manual Third Edition
Your Task:
Prepare a 3- to 5-page formal report, explaining the rationale for each step in this
exercise. Explain the results you obtained. Your report should have an Abstract, Title,
Introduction, Methodology, Results and Discussion, and Conclusion. Make sure that the
problem and hypothesis are stated in the Introduction.
30
Cell and Molecular Biology Laboratory Manual Third Edition
Materials Needed
Methodology
Pre-Laboratory Preparations
1. Using a sterile pipette, add 3 ml TE solution directly to the vial containing ampicillin.
2. Using another sterile pipette, add 3 ml TE solution to rehydrate the arabinose.
3. Mix or vortex the vials and swirl to facilitate rehydration.
Laboratory Proper
31
Cell and Molecular Biology Laboratory Manual Third Edition
Your Task:
Prepare a 3- to 5-page formal report, explaining the rationale for each step in this
exercise. Explain the results you obtained. Your report should have an Abstract, Title,
Introduction, Methodology, Results and Discussion, and Conclusion. Make sure that the
problem and hypothesis are stated in the Introduction.
2. Why do you need to purify your protein given that it already exhibits
biological activity even in crude state?
32
Cell and Molecular Biology Laboratory Manual Third Edition
Materials Needed
Methodology
Pre-Lab Preparations
1. Prepare at least 100 ml 1x phosphate buffered saline (PBS) from 10x PBS.
2. Prepare a wash buffer by adding 90 ml 10x PBS to 805 ml distilled water
and add 4.5 ml to 5 ml 10% Tween 20 to make a final volume of 900 ml.
1. Label one 30-ml bottle each for the antigen, primary antibody and secondary antibody.
2. Transfer 7.5 ml 1x PBS to a 30-ml bottle labeled "antigen".
To it add 150 µl of 50x antigen stock solution.
3. Transfer 24.5 ml wash buffer to a 30-ml bottle labeled "primary antibody".
To it add 0.5 ml 50x primary antibody.
4. Repeat the previous procedure for the secondary antibody. Prepare the secondary
antibody less than 24 hours before the experiment.
33
Cell and Molecular Biology Laboratory Manual Third Edition
Laboratory Proper
strip.
34
Cell and Molecular Biology Laboratory Manual Third Edition
35
Cell and Molecular Biology Laboratory Manual Third Edition
36
Cell and Molecular Biology Laboratory Manual Third Edition
Your Task:
Prepare a 3- to 5-page formal report, explaining the rationale for each step in this
exercise. Explain the results you obtained. Your report should have an Abstract, Title,
Introduction, Methodology, Results and Discussion, and Conclusion. Make sure that the
problem and hypothesis are stated in the Introduction.
2. Were false positives or negatives encountered in this activity? How could this
affect the final analysis of results? How can such errors be prevented?
37
Cell and Molecular Biology Laboratory Manual Third Edition
Exercise 4. Bioinformatics
>WHOAMI
STKKKPLTQEQLEDARRLKAIYEKKKNELGLSQESVADKMGMGQSGVGAL
FNGINVLQAYNAALLAKILKVSVEEFSPSIAREIYEMYEAVSMQPSLRSE
YEYPVFSHVQAGMFSPELRTFTKGDAERWVSTTKKASDSAFWLEVEGNSM
TAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDSGQ
VFLQPLNPQYPMIPCNESCSVVGKVIASQWPEETFG
MRFPELEELKNRRTLKWTRFPEDVLPLWVAESDFGTCPQLKEAMADAVER
EVFGYPPDATGLNDALTGFYERRYGFGPNPESVFAIPDVVRGLKLAIEHF
TKPGSAIIVPLPAYPPFIELPKVTGRQAIYIDAHEYDLKEIEKAFADGAG
SLLFCNPHNPLGTVFSEEYIRELTDIAAKYDARIIVDEIHAPLVYEGTHV
VAAGVSENAANTCITITATSKAWNTAGLKCAQIFFSNEADVKAWKNLSDI
TRDGVSILGLIAAETVYNEGEEFLDESIQILKDNRDFAAAELEKLGVKVY
APDSTYLMWLDFAGTKIEEAPSKILREEGKVMLNDGAAFGGFTTCARLNF
ACSRETLEEGLRRIASVL
38
Cell and Molecular Biology Laboratory Manual Third Edition
Copy and paste the retrieved sequences into the multiple-sequence alignment program
CLUSTAL-W at http://www.ebi.ac.uk/clustalw/ and run that program.
3. Exploration of a Database
PubMed is the public and freely available version of Medline, the most
comprehensive database of primary scientific literature in the biomedical area.
Maintained by the U.S. National Library of Medicine (physically located on the campus of
the National Institutes of Health in Bethesda, Maryland), PubMed is the brainchild of the
NCBI (National Center for Biotechnology Information), a world-leading bioinformatics
center. The nucleotide sequence database GenBank and the immensely popular BLAST
software are two other famous productions of NCBI.
Searching PubMed
1. Go to www.pubmed.nl
2. Type in dUTPase in the For window, and click the Go button. Is the database
search case-sensitive?
3. For any entry in the Results list, click the associated author names.
4. Save what you like to your hard drive by choosing your browser’s File Save As
option. Alternatively, you can transform the display into a simpler (printer-friendly)
format by first clicking the Text button on the right of the line with Display, and
then choosing File Save As.
When your search yields many references, the best move is to start scanning a
few pages and select the most promising papers for future use by checking the
corresponding boxes. To move through the Results pages, just use the Select page
button in the top right to select the next page.
1. Choose Abstract from the pull-down menu to the right of the Display button.
2. If you want to print this display as is, choose File Print from your browser
menu.
3. If you want to print this display in a more printer-friendly format, first click the
Text button (on the same menu bar as the Display button) to display this
information in a non-HTML test format and then choose File Print from
your browser menu.
4. If you’d like to save the file in the format of your choice, choose File Save
As from your browser menu, enter a new filename for the file, and then
choose the file format you want to save to.
39
Cell and Molecular Biology Laboratory Manual Third Edition
When you want to quickly find out the basics about a subject you know nothing
about, it’s best not to read any single highly specialized article. A better bet is to stick
with review articles, where one expert summarizes the state-of-the-art for you. Thus, we
want to limit our PubMed search to recent review articles about dUTPase.
1. Point your browser to the PubMed site and type dUTPase in the For window.
2. Click the Limits button. The Limits screen appears. You now have plenty of fields
and attributes you can use for setting limits. You can go back later to this page
and explore these various options.
3. Choose Review as the Type of Article and English as the Language (unless you
40
Cell and Molecular Biology Laboratory Manual Third Edition
41
Cell and Molecular Biology Laboratory Manual Third Edition
To start RasMol under Microsoft Windows, double click on the RasMol icon in the
program manager. Two windows will appear, the main graphics or canvas window with a
black background and a command line or terminal window. At the top of the graphics
window is the RasMol menu bar, on which the 'File', 'Display', 'Colors', 'Export' and
'Options' pull-down menus are found. The Main graphics window also has two scroll
bars, one on the right and one at the bottom, that may be used to rotate the molecule
interactively. The program reads in a molecular coordinate file (such as a PDB file) and
interactively displays the molecule on the screen in a variety of representations and color
schemes.
Mouse Controls
Action Buttons/Controls
Rotate X, Y Left
Translate X, Y Right
Rotate Z Shift-Right
Zoom Shift-Left
Slab Plane Ctrl-Left
Picking
In order to identify a particular atom or bond being displayed, RasMol allows the
user to 'pick' objects on the screen. The mouse is used to position the cursor over the
appropriate item, and then any of the mouse buttons is depressed. Provided that the
pointer is located close enough to a visible object, the program determines the identity of
the nearest atom to the point identified.
The program will display, in the terminal window, the atom's type, serial number,
residue name and residue number. If the atom is a member of a named chain, the chain
identifier is also displayed. Two examples of the output generated by selecting an atom
follow:
The first line describes the alpha carbon of the serine-70 amino acid in a protein.
The unique Protein Data Bank serial number for this atom is 349. The following line
describes the oxygen atom in a water molecule attached to the P chain of the main
42
Cell and Molecular Biology Laboratory Manual Third Edition
Clicking the mouse on an atom can be used not only to identify it, but also to find
the coordinates, the distances between two atoms, the bond angle defined by three
atoms, the torsion angle defined by four atoms, to toggle labels on or off, or to specify
the center of rotation.
For more details on RasMol and other molecular visualization freeware, please visit:
http://www.umass.edu/microbio/rasmol/
43
Cell and Molecular Biology Laboratory Manual Third Edition
DNA microarray analysis is one of the newest tools in the fields of molecular biology and
medicine. Scientists are using DNA microarrays in a host of experiments, including
investigating changes in gene expression levels and identifying single nucleotide
polymorphisms. This exercise is meant to introduce the student to the basics of this new
technology.
Materials needed
Methodology
44
Cell and Molecular Biology Laboratory Manual Third Edition
References
Books
Ausubel FM, R Brent, R Kingston, D Moore, JG Seidman, JA Smith and K Struhl. Short
Protocols in Molecular Biology. Green Publishing Associates and John Wiley and
Sons, New York, 1992
Claverie JM & C Notredame. Bioinformatics for Dummies. Wiley Publishing, Inc., New
York, 2003.
Davis LG, MW Kuehl and JF Battey. Basic Methods in Molecular Biology 2nd Ed.
Appleton and Lange. Norwalk Connecticut. 1994.
Scientific Journals
Steiner et al. 1995. A rapid one-tube genomic DNA extraction process for PCR and
RAPD analyses. Nucl. Acids Res. 23: 2569-2570
Monographs
Bio-Rad Biotechnology ExplorerTM Restriction Digestion and Analysis of Lambda DNA Kit
45
Cell and Molecular Biology Laboratory Manual Third Edition
Online
DNA Microarray Virtual Lab. 24 May 2010. The University of Utah. 25 May 2010.
http://learn.genetics.utah.edu/content/labs/microarray/.
46