Amazon Riches Manual

1
WARNING!
REPRODUCTI ON OF THESE COPYRI GHTED VI DEO DVD'S AND
PRI NTED M ATERI ALS I S PROHI BI TED BY LAW
ALSO: THESE VIDEO DVD'S ARE DUPLICATED IN OUR
OWNMANUFACTURING FACILITY AND TREATED WITH THE
PATENTED AUDIO-TECHNIK PROCESS WHICH USUALLY
DISTORTS SOUND QUALITY IF COPIES ARE MADE AND WHICH
ALLOWS OUR TECHNICIANS TO DETERMINE WHETHER OR NOT
COPYING HAS BEEN ATTEMPTED IN THE EVENT OF RETURN OR
5()81'&23<,1*7+(6(&'692,'6$//*8$5$17((6$1'
WARRANTIES.
FORTUNATELY, 98% OF OUR CUSTOMERS ARE THRILLED WITH
THE QUALITY AND VALUE THE INFORMATION THAT WE
PROVIDE, KEEP AND USE THEIR MATERIALS AND MAKE
SUBSEQUENT PURCHASES FROM US. HOWEVER, OF THE 2%
WHO OPT FOR OR ATTEMPTED COPYING THE MATERIALS AND
THEN RETURNED THEM FOR REFUNDS, IT IS FOR THIS REASON
THAT WE CONVERTED TO THE AUDIO-TECHNIK PROCESS FOR
ALL OUR VIDEO DVD'S BEGINNING IN LATE 2002. IT IS NOW OUR
POLICY TO EXPOSE ALL RETURNED '9'6727+(9,'(2TECHNIK ANALYSIS METER AND TO REFUSE REFUNDS IN
INSTANCES WHERE COPYING OF THE DVD6,6(9,'(17
OUR CHIEF TECHNICIAN HAS OVER 15 YEARS EXPERIENCE IN
DVD MANUFCTURING AND DUPLICATION AND HAS BEEN
CERTIFIED BY THE VIDEO-TECHNIK CORPORATION AS AN
ANALYST.
94 Reservoir Park Dr, Rockland, MA 02370
www.InsiderOnlineSecrets.com 1800-554-8495
www.Biznulled.com
Disclaimer
This information is designed to provide accurate and authoritative
information in regard to the subject matter covered. It is offered with the
understanding that the presenters are not engaged in rendering legal,
accounting, or other professional services. If legal advice or other expert
advice is required, the services of a competent professional should be
sought.
Adapted from a Declaration of Principles jointly adopted by a

Committee of the American Bar Association and a Committee of
Publishers and Associations
Reproduction or translation of any part of this work without
permission of the copyright owner is unlawful and will be prosecuted
to the full extent of the law.
Insider Online Secrets, Inc

94 Reservoir Park Dr
Rockland, MA 02370
1-800-554-8495


www.Biznulled.com

Amazon
Riches



www.Biznulled.com
4

Table of Contents
Introduction ................................................................................ 6
Lesson 1-How to Start Your Own Amazon Store .............................. 9
Assignment ............................................................................... 34
Quiz.......................................................................................... 30
Lesson 2-Make Money as an Amazon Affiliate ................................. 31
Assignment ............................................................................... 68
Quiz.......................................................................................... 69
Lesson 3-Make Money with the Fulfillment by Amazon Program ........ 60
Assignment ............................................................................... 91
Quiz.......................................................................................... 92
Lesson 4-Promote and Sell Your Products using Advantage .............. 93
Assignment ............................................................................. 115
Quiz........................................................................................ 116
Lesson 5-Build Your Own Amazon Webstore Easily and Quickly ...... 118
Assignment ............................................................................. 140
Quiz........................................................................................ 141


www.Biznulled.com
5

Lesson 6-How to Get Millions of People to Buy from Your Website .. 143
Assignment ............................................................................. 165
Quiz........................................................................................ 166
Lesson 7-How to Use Amazon Product Ads to Make Money ............ 168
Assignment ............................................................................. 193
Quiz........................................................................................ 194
Lesson 8-How to Make a Ton of Money as an Independent Publisher
.............................................................................................. 196
Assignment ............................................................................. 231
Quiz........................................................................................ 232
Final Test ................................................................................ 201
Glossary A ............................................................................... 245
Glossary B ............................................................................... 259



www.Biznulled.com
Introduction
Are you making the kind of money you want? Do you have a thriving
business online that is giving you six figures or more a year? It would
be great if you knew that you had money coming in, especially from
multiple streams of income each month. Did you know there is a way
IRU\RXWRPDNHDORWRIVWHDG\LQFRPHDQGLWUHDOO\LVQWWKDWKDUGWR
get started?
7KHUHDUHPDQ\SHRSOHWKDWZRUNDGD\MREDQGFDQWVtand it. They
are grossly underpaid, or are tired of working for someone else. If you
are one of these people that want to start your own business, and do it
online, you are among many that also had the same dream. Getting
online is not hard to do, you just need an Internet connection. But
what kind of business would you start?
Do you know there are many business people, entrepreneurs, and
marketers, that wanted to make more money, and went online to get
it. They were able to make more money by going after one type of
business. They chose to use Amazon as the means to make money.
You may be surprised to read this. Perhaps you spend a number of
years buying products from Amazon, but never thought about using
the system to make money. Many people actually thought like you as
well, until they investigated and found that they could make money
online with Amazon. You can make money with Amazon as well.


www.Biznulled.com
7

Just how can you make money with Amazon? Amazon has many
different programs available that you can sign up and work. By taking
advantage of these different programs, you can actually make a ton of
cash, if you work the programs properly. There are five programs that
Amazon provides. These programs have been known to provide those
that joined them a ton of money. In some cases this money was made
within a short time.
If you want to be a part of the thousands of people that made money
with Amazon, it is time to get involved with a guaranteed system.
Almost everyone knows Amazon and its reputation. People know how
Amazon makes money every day. Those that have accounts with
Amazon, also make a lot of money with them.
If you ever go to Amazon and look up a product, you just may notice
you can get the same product from other vendors. These vendors are
business people, stores, entrepreneurs, or other people, that have the
same product and are trying to sell theirs on Amazon as well. Most of
the time the price of the products these vendors sell are cheaper than
what Amazon sells the same products for.
The five programs that you can join to make you a ton of money are:
x
Starting Your Own Store
Become an Amazon Affiliate
Joining Fulfillment by Amazon
Promoting and Selling Your Products using Advantage
Building Your Own Amazon Webstore

www.Biznulled.com
8

Each one of these programs has its advantages and disadvantages.
The bottom line is that if you sign up with each program and work the
programs properly, you can make a ton of money.
Okay but how do I learn about these programs? That is the easy part.
Over the course of several pages, you will learn what you have to do in
order to get into each program. There will be five lessons in all. Each
lesson will cover a different program. Along with the discussion of the
program, you will be presented with activities to perform, as well as a
test to confirm what you retained.
With each lesson, you will be taken through the entire process from
beginning to end. Each program will be explained to you fully. There
will be screenshots in certain locations. Also, questions will be asked
along the way. These questions will be more rhetorical in nature. They
will be referred to as Points to Ponder. Each question may be a
question, comment, or scenario. The main purpose is to test to see
how you would think of the answer.
'RQWZDVWHWLPHWU\LQJWRPDNHPRQH\RQOLQHZKHQ,DPSUHVHQWLQJ
to you a way for you to do so. Everything will be explained so you
donWKDYHWRWRXJKLWRXW
Get started with your first lesson now and do the assignments that
follow. After that take time to do the test. The tests are for your own
good. Try to do them without going back to check for the answer. The
more you absorb the better you will make money.

www.Biznulled.com
9

* All test answers in each lesson and the final test are located in
Glossary A and Glossary B.



www.Biznulled.com
10

Lesson 1-How to Start Your Own Amazon Store

Learn how to create your own store on Amazon. This lesson will provide step-by-step
how to get started with your store, how to set it up, and how to get paid. By the time
you complete this lesson, you will have created your own Amazon store.

What is Amazon?
Up till now you may have thought of Amazon as strictly a site that sells
books. In most part, this is what Amazon was when it got started.
However, as time went by, they began adding other items like
appliances, computers, and items used around the home.
$PD]RQGLGQWGRZHOODWILUVWEXWHYHQWXDOO\WKH\EHJDQPDNLQJ
money. They even went public and sold stock. It took a few years, but
Amazon finally began making profits. One day, Jeff Bezos, the owner,
decided that he could make even more money if he had people help
him sell stuff.
He created an affiliate program that really took off. ,OOJHWLQWRWKDW
and how to get involved in a later lesson. Soon after implementing the
affiliate program, Jeff realized that he could also make money letting
vendors sell their products on his system. So he set up a system
where people could sell their products on Amazon.
In time, many people took advantage of this method of selling their
products, and before long, there were many people selling on Amazon.
It was at that point that Jeff opened the door to allow people to sign


www.Biznulled.com
11

up for a seller program. The standard seller program worked well, but
KHZDVQWPDNLQJPXFKPRQH\ZLWKLW6RKHFUHDWHGWKHSURIHVVLRQDO
version where he would charge $39.99 to sign up. Now he had
something going.
As time went on, he soon established other methods of helping others
make money on Amazon. These methods helped Jeff as well, because
for every item vendors sold on amazon, he would get a certain
percentage of the sell price. So it was a win-win situation for him.

Points to Ponder
In your opinion, why did Jeff Bezos decide to
offer vendors so many programs that helped
them make money from his system?

The First Program

The first program that Amazon created was to allow vendors to sell
WKHLURZQLWHPV7KH\VLPSO\UHIHUUHGWRLWDV6HOO<RXU2ZQ6WXII,I
you only had up to 40 items to sell, you could list your items on
Amazon. You were only responsible for paying Amazon $.99 per sale
and other selling fees.


www.Biznulled.com
12

The way it works is simple. First you have to sign up as an individual
seller, unless you already have an account with Amazon. In that case,
all you would have to do is link your main account with your seller
account.
Once you have your account established, just list the item you have
for sale. There is a form to fill out. After you provide the title of the
item, description, whether it is old or new, and the price you want,
simply submit the info to Amazon. They will send you a reply back to
your email, letting you know your item has been listed on their site,
under the category you selected for your item. When a customer
FRPHVDORQJDQGILQGVWKHLWHPWKH\ZDQWWKH\ZLOOVHH$PD]RQV
price and your price as well.
)RUH[DPSOHOHWVVD\\RXZHUHORRNLQJIRUDQ03SOD\HU)RUWKLV
H[DPSOHOHWVVD\\RXSLFND&RE\SOD\HU+HUHLVZKDWWKHOLVWLQJ
would look like:


www.Biznulled.com
13

If you look in the image, you can see the price Amazon has it, and
EHORZWKHZRUGV,Q6WRFN\RXZLOOVHHWKHZRUGVQHZDQG
XVHGIURP
7KHVHWZROLVWLQJVEHORZWKHZRUGV,Q6WRFNDUHYHQGRUVWKDWVLJQHG
up for the program and are selling their MP3 player on Amazon as
well. All you would have to do is click the link to both the new or used
links and you would be taken to a page that shows you the vendors
that are selling that item.
If you are a new member of Amazon, they will treat you special by
providing you with a free trial to use their seller program.
When you do sign up and use Amazon to sell your products, you will
have to establish a billing account, so Amazon will know where to send
the money to when you sell your items. Once you get the confirmation


www.Biznulled.com
14

by email that your item sold, you will have three business days to ship
the item and notify the buyer your item was shipped. Amazon believes
three days is enough time for you to pack up the item, take it to the
post office, or call FedEx or UPS, depending how you ship it.
By the way, Amazon does credit your account the shipping so you
GRQWKDYHWRSD\WRVKLSWKHLWHP
Amazon has two ways you can sell your product. You can sign up to be
just a seller if you are going to sell 40 items or less. If you are going to
sell more than 40 items, Amazon gives you the option to sign up to be
a professional seller.

Points to Ponder
Why do you think Amazon allows a seller up to
three business days to ship products that
customers purchased?

Sell Your Stuff

$VDVWDQGDUGVHOOHU$PD]RQGRHVQWFKDUJH\RXIRUVHOOLQJ\RXULWHP
until your item has been officially purchased. The fees Amazon takes
out are deducted from the total before they send the amount to your
bank.


www.Biznulled.com
15

If you have up to 40 items to sell, you caQMRLQ$PD]RQVVHOOHU
program for free. You just need to register. To register, you just need
to start by listing your first item. As you go through the listing process,
Amazon will request that you register to establish your seller account.
Once you have completed your listing, it will go live in a matter of a
few seconds.
To get started as a seller, you need to list your items for sale. There
are four ZD\VWROLVW\RXULWHPV,I$PD]RQGRHVQWFDUU\LW\RXFDQW
sell it.
1. Go to the main page at www.amazon.com and type in a keyword in
the Search field to get started. This is how you can find items
corresponding to what you are selling.
28VHWKLVIRUPWRVHDUFKIRUWKHLWHP\RXGOLNHWRVHOO

In the form, you FDQVHDUFKE\WKHERRNVWLWOHRU\RXFDQXVHD
keyword that describes the book. If you know the ISBN, UPC, or ASIN
number, you can use one of these to find the book as well.
This form can be located at or near the top of this page:
http://www.amazon.com/gp/seller/sell-your-stuff.html/

www.Biznulled.com
16

3. You can click a button on the detail page (this is the page where
you can see the item for sale) to sell the item listed.

This is an example of a detail page.
On this page, if you look to your far right, you will see a button where
you can click to sell the same item you see on the detail page. Here is
the button for the MP3 player in the image above:


www.Biznulled.com
17

Take a look at the blue bordered rectangle box and you will see the
button I am speaking about.
4*RWRWKH6HOO<RXU6WXII 3DVW3XUFKDVHVSDJHDQGFOLFNWKH6HOO
<RXUV+HUHEXWWRQ
Every time you purchase from Amazon, they keep a record of it. Go to
https://www.amazon.com/gp/seller/sys-exp/sell-your-stuff.html and
you will see all the items you purchased when you first signed up with
Amazon.


www.Biznulled.com
18

I blacked out the products for privacy. If you look to the far right, you
ZLOOVHH\HOORZEXWWRQV,QWKRVHEXWWRQVDUHWKHZRUGV6HOO\RXUV
KHUH
If there are any items listed on this page that you have to sell, click
the yellow button and fill out the information.
When your item sells, Amazon will send you an email with the subject
OLQH6ROG6KLS1RZ" This way you will know your item has sold and it
is time to ship it. In the email, Amazon will usually provide a link to a
page where you can download a receipt for the sale, or a printing label
to place on the package. At that point, you just need to contact your
delivery people and have it shipped out.
Points to Ponder
Why does Amazon provide different methods
for you to list and sell your item on their
system, instead of simply providing a listing
page to go to from your profile page?

www.Biznulled.com
19

Listing Your Item

It is time to learn how to list your item. For this section, the easiest
way to list your item is to take the easy route to the form.
/HWVgo to the main page: www.amazon.com. It will make it easier
and faster to show how to list your item.
Just enter in thHVHDUFKILHOGWKHNH\ZRUG,I\RXUDWKHUJRWR
http://www.amazon.com/gp/seller/sell-your-stuff.html/ and use the
form on this page that is your choice.
Start by entering a keyword into the search field. For this example,
OHWVXVH. Enter 2012 LQWKH6HDUFKE\WLWOHRUNH\ZRUGV:
ILHOGWKHQFOLFN6WDUWVHOOLQJ
A bunch of books will probably show up. You can look through the list
to find one book that you have. For instance, if you bought a certain
book at a bookstore, and you no longer want it, you can sell it on
Amazon.
Pick the book you have presently and match it with one of the books
RQWKHOLVW:KHQ\RXIRXQGWKHRQH\RXDUHORRNLQJIRUMXVWFOLFN6HOO
\RXUVKHUH
If you know the ISBN number, you can also look up the book this way
as well.


www.Biznulled.com
20

:KDWLI\RXGRQWKDYHDbook? What if you have some other kind of
item, like maybe a table lamp? In that case, take a look at the form
DQGFOLFNWKHGRZQDUURZXQGHUWKH6HOHFWSURGXFWFDWHJRU\
You have a lot of categories to choose from. Since your item is a table
lamp, you may want to click Kitchen & Housewares. If you get any
results, compare what is shown on the screen to what you have and
are selling. If they look alike, you can list it. If there are no items
listed at all, go back and try another category.
+HUHVDWLSIRU\RX,I\RXGLGQRWJHWDQ\UHVXOWVORRNDWWKHIDUULJKW
side of the web page, you will see this appear:

<RXGRQWKDYHWRJREDFNWRWKHSUHYLRXVZHESDJHMXVWXVH the
search form on this page. As you can see, when I looked up table lamp
in the Kitchen & Housewares section, I came up with nothing. I just
tried Electronics and still found nothing.
+RZHYHUZKHQ,SXWLQWKHNH\ZRUGWDEOHODPS,UDQWKHVHDUFK
again in the Kitchen & Housewares category and 915 results came up.
Try this yourself. See if your table lamp shows up. If you see a close


www.Biznulled.com
21

OLNHQHVVWR\RXUWDEOHODPSFOLFNWKH6HOO\RXUVKHUHEXWWRQQH[WWR
it.
For the sake of this example, and to demonstrate how to list an item,
OHWVgo with the book section on 2012.
There were a ton of results. I am going to go with the second listing as
shown here:

,ZLOOFOLFN6HOO\RXUV KHUHQH[WWRWKHERRNE\(ULF-*DWHV
When the selling page comes up, you will see there are six steps to
complete. Before you begin filling in anything, look at the boxes to
your right. You will find the product pricing details. These are the
going prices for Amazon and other vendors. By placing these prices
here, Amazon provides you a guide to follow when you are pricing
your item.
Points to Ponder
Considering the way you can search for an item
to list, do you think that Amazon makes it easy

www.Biznulled.com
22

for you to list your item, or do they make it

hard to do so?
Listing with an Account

If you have an account, listing your item will be easier. However, for
the sake of this lesson, I will provide for you instructions on how to list
your item with and without an account.
This section will be about listing with an account. The first thing you do
is sign in to Amazon. Once signed in, you are now ready to list your
item.
Here are the steps you have to follow in order:
1. Verify that the item shown on the page is the exact one you have to
sell. You can verify the book listed by the picture or cover image, the
ISBN number, the ASIN number, or the EAN number.
After looking at your book, you can confirm that they are both the
same, go on to the next step.
2. Describe the condition of your item. You have to provide Amazon
the condition of the book. You have the following choices: New, Used
Like New, Used Very Good, Used Good, Used, and Acceptable.


www.Biznulled.com
23

Although the next field is not required, you may want to provide a
short description of what is wrong with the book. For example, if the
book is used, does it have marks on it, or bent pages?
3. Review your price. Here is where you can review the lowest price
acceptable on Amazon. Sometimes there will be no low price listed. If
your book is new, a low price plus shipping is shown. You can either
accept that price, or choose your own.
/HWVVD\IRUWKLVH[DPSOHZHZLOOJRZLWK8VHG Very Good. There is
no low price to review. So you can skip this part and go on to number
four.
4. Enter the price you want for your product. It is in this step you are
granted to price your book the way you see fit. Careful though. Keep
in mind the list price and the prices your competitors show. If
VRPHRQHVHHV\RXUSULFHLVORZHUWKDQ$PD]RQVEXWKLJKHUWKDQ\RXU
competitors, they may select the other vendors instead of yours. So
keep your price lower than your competition, if possible.
For this example, I will list the price of my book at $11.50. When I
looked at the Product Pricing Details block, I noticed the list price was
$13.99. My competitRUVSULFHVZHUHHDFK6RE\SODFLQJP\
book at $11.50, I stand a better chance of making a sale.
$OVRGRQWIRUJHW\RXUOLVWLQJZLOOVKRZ\RXUSULFHSOXVVKLSSLQJ
charges, which to Amazon is $3.99.


www.Biznulled.com
24

5. Enter the number of this item you plan to sell. What you will do
here is provide the number of this item you are selling. Is it a one-time
purchase, or do you have many of them in stock. In the quantity field,
list the number of your item.
6. Select your shipping method. Once you get to this point, you will
have a number of options to ship your item. You can choose a
standard shipping method. You have a choice of 4-14 business days or
3-5 business days.
If you want, you can choose expedited shipping. If you choose
expedited shipping, Amazon gives you a credit of $6.99. You can
choose 2-6 business days, or 1-3 business days. Other shipping
options include two-day shipping, one-day shipping, international
shipping, and expedited international shipping.
After you have decided on the speed of delivery, click Continue. On the
next page, you will be presented with an overview of your selections.
You can verify what you wrote. If you are satisfied with your
VHOHFWLRQV\RXFDQFOLFN6XEPLW\RXUOLVWLQJDQGZLWKLQVHFRQGV\RXU
item will be listed RQ$PD]RQVVLWHIRUVDOH<Ru will get a confirmation
email letting you know your item was listed successfully.

Points to Ponder
Looking at the steps toward listing your item,

www.Biznulled.com
25

do you think that Amazon provides enough

thorough steps to get your item listed, or do
they request too much info?

Listing without an Account

Creating a listing without an account is almost the same as with an
account. To list your item, go to www.amazon.com and type in search
field a keyword that you want, based on the item you are looking for.
/HWVXVHWKHVDPHH[DPSOHDVIRUWKHOLVWLQJZLWKDQDFFRXQW
(QWHULQWKHVHDUFKILHOGRQWKHPDLQSDJH%HIRUHWKHVHDUFK
field, there will be a down arrow ZLWKWKHZRUG$OOQH[WWRLW&OLFN
the down arrow and choose "Books. 7KHQW\SHLQWKHVHDUFK
field.
A list of books will come up. Again, I will select 2012 by Eric J. Gates.
When that item comes up on the detail page, look to your far right and
FOLFNWKH6HOORQ$PD]RQEXWWRQ
To start with you will need to take the same steps as you did if you
had an account. Those steps are repeated below:
1. Verify that the item shown on the page is the exact one you have to
sell. You can verify the book listed by the picture or cover image, the
ISBN number, the ASIN number, or the EAN number.

www.Biznulled.com
26

After looking at your book, you can confirm that they are both the
same, go on to the next step.
2. Describe the condition of your item. You have to provide Amazon
the condition of the book. You have the following choices: New, Used
Like New, Used Very Good, Used Good, Used, and Acceptable.
Although the next field is not required, you may want to provide a
short description of what is wrong with the book. For example, if the
book is used, does it have marks on it, or bent pages?
3. Review your price. Here is where you can review the lowest price
acceptable on Amazon. Sometimes there will be no low price listed. If
your book is new, a low price plus shipping is shown. You can either
accept that price, or choose your own.
/HWVVD\IRUWKLVH[DPSOHZHZLOOJRZLWK8VHG Very Good. There is
no low price to review. So you can skip this part and go on to number
four.
4. Enter the price you want for your product. It is in this step you are
granted to price your book the way you see fit. Careful though. Keep
in mind the list price and the prices your competitors show. If
VRPHRQHVHHV\RXUSULFHLVORZHUWKDQ$PD]RQVEXWKLJKHUWKDQ\RXU
competitors, they may select the other vendors instead of yours. So
keep your price lower than your competition, if possible.
For this example, I will list the price of my book at $11.50. When I
looked at the Product Pricing Details block, I noticed the list price was

www.Biznulled.com
27

$13.99. My FRPSHWLWRUVSULFHVZHUHHDFK6RE\SODFLQJP\
book at $11.50, I stand a better chance of making a sale.
$OVRGRQWIRUJHW\RXUOLVWLQJZLOOVKRZ\RXUSULFHSOXVVKLSSLQJ
charges, which to Amazon is $3.99.
5. Enter the number of this item you plan to sell. What you will do
here is provide the number of this item you are selling. Is it a one-time
purchase, or do you have many of them in stock. In the quantity field,
list the number of your item.
6. Select your shipping method. Once you get to this point, you will
have a number of options to ship your item. You can choose a
standard shipping method. You have a choice of 4-14 business days or
3-5 business days.
If you want, you can choose expedited shipping. If you choose
expedited shipping, Amazon gives you a credit of $6.99. You can
choose 2-6 business days, or 1-3 business days. Other shipping
options include two-day shipping, one-day shipping, International
shipping, and expedited International shipping.
After you have decided on the speed of delivery, click "Continue." So
far everything appears the same. However, the next step is not. After
you click "Continue", when the next web page comes up, you will be
forced to sign in. $WWKLVWLPHLI\RXGRQWKDYHDQDFFRXQW\RXZLOO
only enter your email address.


www.Biznulled.com
28

6LQFH\RXGRQWKDYHDQDFFRXQW\HWMXVWHQWHU\RXUHPDLODGGUHVV
&KHFN,GRQRWKDYHDQ$PD]RQFRPSDVVZRUGWKHQFOLFN
"Continue."
When the next page comes up, you will have to register your account
if you want to list your item. In order to register, you will need to
supply your first and last name. Next, you will need to retype your
email address you used in the previous screen. After that, select a
password and re-enter it. Once you have done that, click "Continue"
and you will be directed to a page where you will need to supply your
credit card information. Amazon will use your credit card to bill you for
all listing fees.
The next page you will be taken to will be to verify your identity. This
is where you will confirm your name, email, address, and credit card
information. If everything looks good, Amazon will process this
information quickly and take you to a page where you can verify your
listed item. Once you confirm your listing, Amazon will submit your

www.Biznulled.com
29

listing and place it in their system. You will get two emails. One email
will be to confirm your registration. The other email will be to confirm
your listing.
At this point you have completed your listing on Amazon. You just
have to wait for someone to come along and buy it. Depending on how
popular your item may be and the price you established for it, the time
involved in selling your item may be a day, week, or a few days.
Amazon keeps your listing for a month. After that time, if your listing
VWLOOKDVQWVROG

Points to Ponder
Looking at the steps toward listing your item,
do you think that Amazon provides enough
thorough steps to get your item listed, or do
they request too much info?

Selling as a Professional
If you have 40 items or less, you can be a standard seller, but if you
are planning to sell way more than 40 items, you must register as a
professional.


www.Biznulled.com
30

To register as a professional, you need to include your email address,
password, and legal name of business. The fee to sign up for a
professional selling account is $39.99 per month plus selling fees.
As I stated a few times in this lesson, if you already have an account
with Amazon, just use your existing email address and password.
However, if you rather use a different email address to keep your
professional communication separate from your personal, there is a
link right above the sign up form. Take a look at this image. It will
provide you with the details you need.

To establish your professional account, you will need your business
name, address, and contact information. You will need to have a valid
credit card Amazon can use to charge your fees to each month. You
also need to have a verifiable phone number, so you can be reached
during the registration process. This is so Amazon can confirm that
you are engaging in this business for you and no one else.
After you complete the entry screen, click "Continue" and you will be
taken to a web page where you will enter your credit card information.

www.Biznulled.com
31

The next page after that is where you will enter your phone number.
After Amazon calls you, your registration will be complete.
What is the difference between a professional and standard account?
With a standard account, you are only allowed to post up to 40 items.
The cost for each item is only $.99 plus other selling fees. However,
with a professional account, you will need to pay $39.99 per month,
plus selling fees. But at least you can sell more than 40 items.
If you have a boat load of goods to sell each month, or you have a
conventional store and want to sell your items on Amazon, you can go
for the professional account. But if you have only a few items to sell,
and only sell once in a while, you should just go with the standard
account. It cost you no monthly fees. You just pay a small fee when
you have sold the item.

Points to Ponder
By looking at both the standard and
professional seller accounts, why do you think
Amazon charges so much to provide you with
their professional account?



www.Biznulled.com
32

Having a seller account is a great way to make extra money on a daily,
weekly, or monthly basis. All you need is the inventory and Amazon.



www.Biznulled.com
33

Summary
In this lesson, you learned about Amazon and their seller program.
You were taken through the steps of each program and what you
needed to do to list your item.
As you went through this lesson, you were made aware of the steps
required to list your item on Amazon. By now you should have a pretty
good idea of what you need to do it create a seller account and how to
list your items.
If you are unsure of a step, go back over the lesson. The best part of
the process is getting involved with selling your item or items. As you
VHOOPRUHLWHPV\RXZLOOPDNHPRUHPRQH\,WVWKDWVLPSOH



www.Biznulled.com
34

Assignment
For this assignment, go to Amazon.com. If you signed up to use
$PD]RQDVDEX\HU\RXGRQWKDYHWRVLJQXS+RZHYHULI\RXGRQW
have an account with Amazon, be prepared to go through the
registration process.
What you will do is go through your home or apartment and find
something; it can be anything, and make a note of what the item is.
Now go to Amazon.com and do a search, as I showed you in this
lesson. See if you can find the item you want to sell.
If you do find the item on Amazon, perform the steps to have your
LWHPOLVWHG,I\RXFDQWILQGWKHLWHP\RXZRQWEHDEOHWRVHOOWKDW
item. In that case, look for another item that is listed. By working this
assignment, it will help you get better acquainted with Amazon and
their seller program.



www.Biznulled.com
35

Quiz
1. Amazon has only one seller program and that is the
professional? True or False
a. True
b. False
2. There are five programs you can join to make money with
Amazon. Of the following, which is not one of them?
a. Starting Your Own Store
b. Become an Amazon Affiliate
c. Joining Fulfillment by Amazon
d. Hiring Amazon to Create Your Website
e. Building Your Own Amazon Webstore
3. When you confirm your listing, how long does it take to show the
system?
a. A few minutes
b. A day
c. A week
d. A month
4. When providing shipping, you must provide standard shipping?
True or false
a. True
b. False
5. What is the cost Amazon pays for standard shipping?
a. $2.00
b. $3.00

www.Biznulled.com
36

c. $3.99
d. $4.50

Lesson 2-Make Money as an Amazon Affiliate

Learn how to make money as an Amazon affiliate. You will be shown step-by-step
what you need to do in order to be a successful affiliate and make good money
selling products for Amazon.

In lesson one you were introduced to one way to make money with
Amazon. In this lesson you will learn how to make money as an
Amazon Affiliate.
Those that signed up under the affiliate program made a lot of money.
Some marketers were actually able to make millions of dollars in a
year as an affiliate.
The way the Amazon Affiliate program works is that you select from
over a million products that you believe customers will want. These are
LWHPVWKDWDUHPRVWLQGHPDQG<RXGRQWZDQWWRMXVWSLFNDQ\
product. If you were to pick a product that Amazon had trouble selling,
\RXZRQWEHDEOHWRVHOOWKHSURGXFW\RXUVHOI
As an Amazon affiliate, you will be given plenty of help to make
PRQH\<RXOOKDYHDFFHVVWROLQNLQJWRROVWRKHOSPRQHWL]H\RXU
website for best results. As an affiliate, you can earn as much as 15%
in advertising fees. What this means is that you can earn money by

www.Biznulled.com
37

advertising products. You can double the money you make by
advertising and selling products as well.
-RLQLQJ$PD]RQVDIILOLDWHSURJUDPLVHDV\DQGWDNHVRQO\DIHZ
PLQXWHV<RXGRQWKDYHWRZDLWORQJ$IWHU\RXVLJQXS$PD]RQZLOO
send you specials by email to let you know what is really hot so you
can consider selling them as an affiliate.
Points to Ponder
Why do you think Amazon provides an affiliate
program to begin with? What do they have to
gain to offer it?

Six Ways to Make Money as an Affiliate

When you first start working as an affiliate with Amazon, you may see
saleVWULFNOHLQ7KLVGRHVQWKDYHWREHWKDWZD\7KHUHDUHVix key tips
you can follow that will help boost your income so you can make more
money as an affiliate.
The six tips include the following:
1. Use More Than One Tracking ID
When you sign up with Amazon, they provide you with tracking IDs.
8VXDOO\WKRVHWKDWVLJQXSIRU$PD]RQVDIILOLDWHSURJUDPZRUNZLWK

www.Biznulled.com
38

one tracking ID. This is the wrong way to go. If you really want to
make a lot of money as an affiliate, you should consider using more
than one tracking ID on your site. This way you can keep track of what
LVZRUNLQJDQGZKDWLVQW
When you know what is working, you continue to use that method.
Such a method, when repeated, will provide you with continuous
streams of money.
To obtain the tracking IDs, just go here: https://affiliate-
program.amazon.com/gp/associates/network/your-account/manage-
tracking-ids.html/.
2. Go for Bestsellers
As an Amazon affiliate, you want to sell the best and hottest items that
Amazon has to offer. When you sell items that go well for Amazon,
imagine what those items can do for you. This is why Amazon helps
you make money. They provide an email covering in detail the hottest
and most often purchased products on Amazon.
When you set up your system to sell these hot and most in demand
products, you will make great money to. So if you really want to make
good money with Amazon, make sure to highlight and sell those items
that are in demand and that can offer you the highest in return.
3. Use Affiliate Links


www.Biznulled.com
39

If you place an image of a product sold on Amazon and provide an
affiliate link to the product, and someone clicks the link, you make
money, whether the person buys the product or not. Placing affiliate
links on your website is a great way to make a lot of money, even
when the person clickiQJWKHOLQNGRHVQWEX\%XWLIWKHSHUVRQGRHV
buy, you get a commission for that sale.
4. Make Sure Images are Clickable
When you place images on your website, make sure those images
have an active link attached to them. This will help get you more
sales. When someone gets to your site and sees an image of
something they want, and they click the image, you get paid for that
click. You also get paid when the customer buys that product.
5. "Buy Now" Buttons Work Wonders
One great way to make sure your visitors take action, so you make
money, is by placing "Buy Now" buttons on your site. If you place an
image on your web page, why not place a "Buy Now" button so the
customer can buy the product right then.
You can describe the product with an image and text. When customers
see the image and read the text describing, all they have to do is click
the Buy Now button and you have made your commission on that
product.
6. Focus on Busy Periods


www.Biznulled.com
40

If you really want to make a ton of money, the best time to do it is
when shopping is higher. Times like November and December are
good, as well as a month before and during Easter. Keep looking at
your calendar for upcoming holidays. This is when people shop the
most.
Also, you may want to check for special deals. Amazon will announce
special deals on occasion. When you see these deals, get involved and
get your affiliate link to sell them. You will make money this way.
Points to Ponder
Of all the tips you read in this section of the
lesson, why do you think Amazon provides such
resources to help you as an affiliate?

Getting Started
Becoming an Amazon Affiliate is one of the best ways to make money.
Those that are affiliates claim to make hundreds of thousands of
dollars a month selling Amazon products
If you really want to make money as an Amazon affiliate, you first
KDYHWRPDNHVXUH\RXKDYHDZHEVLWH<RXFDQWSURPRWHRUVHOODQ\
Amazon products unless you have a website.


www.Biznulled.com
41

,PQRWJRLQJLQWRWKHVWHSVWRFUHDWHDZHEVLWH,f you need
instructions on how to register a domain, install WordPress, and set up
your site, you can search it online. There are plenty of sources
available to teach you how to do that.
What I will do is provide you with the necessary steps to get started as
an affiliate for Amazon.
7KHILUVWWKLQJWRGRLVMRLQ$PD]RQVSURJUDP<RXFDQGRWKLVE\
going to https://affiliate-program.amazon.com/join?ld=AZAssocMakeM
and clicking the yellow button to the right of the page.


www.Biznulled.com
42

You can see the join button in the above image circled by an orange
box.
Once you click that, you will be taken to a web page where you have
the choice of merging the affiliate account with your Amazon account,
or signing up for an affiliate account as a new customer.

As you can see from the above image, you can sign up either way.
/HWVVD\\RXDUHDQHZFXVWRPHU<RXQHYHUVLJQHGXSWRXVH$PD]RQ
before. Therefore, you can go for a new account. Make sure to select
,DPDQHZFXVWRPHUWKHQFOLFNWKH\HOORZ6LJQLQXVLQJRXUVHFXUH
VHUYHUEXWWRQ
$VDQHZFXVWRPHURI$PD]RQVDIILOLDWHSURJUDP\RXFDQQRZ
register. Just fill in the following fields.


www.Biznulled.com
43

Just provide your name, email address, and mobile phone number, if
you wish to use it. Make sure to provide a good password and confirm
LW2QFH\RXYHILOOHGLQHYHU\WKLQJMXVWFOLFN&UHDWHDFFRXQWDQG\RX
will have created your affiliate account.
If you do have an account with Amazon, you can use your email
DGGUHVV-XVWVHOHFW,DPDUHWXUQLQJFXVWRPHUDQGP\SDVVZRUGLV
Then click the yellow button. Once you do this, your affiliate account
will be associated with your main account and then you can sign in to
either account with the same email and password.



www.Biznulled.com
44

Points to Ponder
Why do you think that Amazon allows for you
to merge your affiliate account with any other
account you have with Amazon, if you do have
one? Why not just force you to create a new
account?

Whether you have associated your account with your present account
or created a new account, you will need to go through a three-step
process to officially get started.
Step One Your Account Information
The first step requires that you verify where your payments will be
sent. You also need to verify who the payments will be made out to.
Here is what this step looks like:


www.Biznulled.com
45

$IWHU\RXKDYHFRQILUPHGHYHU\WKLQJMXVWFOLFNWKH\HOORZ1H[W<RXU
:HEVLWH3URILOHEXWWRQ
By the way, if you are using a different name than the one you used
IRU\RXUDFFRXQW\RXZLOOQHHGWRFOLFN6RPHRQHHOVH I need to
HQWHUWKHLULQIRUPDWLRQ:KHQ\RXFOLFNWKLVEXWWRQWRKLJKOLJKWLWD
section under this field will open, allowing you to enter the name and
phone number of the payee, so they can contact the person to make
verification.
Here is how that section looks on the web page:


www.Biznulled.com
46

1RUPDOO\\RXZRQWGRWKLVLI\RXDUHWKHPDLQXVHURIWKHDFFRXQW,W
is just provided here as an option, just in case.
Once you have completed verifying everything on the page, click the
yellow button and proceed.
Step Two Your Website Profile
On this page, you will fill out all the details of your web page. This will
EHWKHZHEVLWH\RXZLOOXVHWRVHOORUSURPRWH$PD]RQVSURGXcts. As
such, Amazon wants to know about your site to see if it fits with
$PD]RQVDIILOLDWHSURJUDP
You have to provide the name of your site, the actual URL of it, and
what your site is about. When stating what your site is about, you
have to provide what users can do on your site. What will they do
when they get there? Will they read content, order products, or just

www.Biznulled.com
47

sign up for a subscription? You also need to tell them what kind of
products you intend to sell or promote on your site.
Here is a peek into what this site is about:


www.Biznulled.com
48



www.Biznulled.com
49


www.Biznulled.com
50

:KHQ\RXILOODOOWKLVLQDQGFOLFN)LQLVK\RXZLOOEHWDNHQWRDQRWKHU
page where you will be able to complete step three.
Step Three Start Making Money
Once you complete step two, you will be given an associate ID that will
be unique to you. Your application will be looked at and Amazon will
provide you with an answer within three business days. If Amazon
finds a problem or issue, they will contact you. In the meantime, you
now have access to the Associates Central 24 hours a day.
At this time, you will need to provide Amazon a way to get paid. You
can provide Amazon with this information now or later. If you rather
JLYHWKHPWKHLQIRQRZMXVWFOLFNWKH\HOORZ6SHFLI\3D\PHQW0HWKRG
1RZEXWWRQDVVKRZQLQWKHimage on the next page.

If you decide to give Amazon your payment information now, you will
need to enter the name you plan on using for tax purposes. You will
need to enter your tax ID number. If you have a business, you can use
your tax number. If you GRQWKDYHDEXVLQHVV,'QXPEHU\RXFDQXVH
your social security number.
Make sure to let them know what type of business you operate. Is it a
sole-proprietorship, partnership, corporation, or foreign agency? The

www.Biznulled.com
51

last second is your payment information. Here you can choose to get a
gift card, direct deposit, or check. Checks require a $15 processing
fee.
Once you have selected the choice of payment, click "Continue" at the
bottom of the page.
Once you click the button, you will be taken straight to the Associates
Central location where you can read the latest information about
Amazon, and decide what products to promote, and so on.
You can be looking around and deciding what you wish to place on
your website while you wait for that email to come declaring you are
approved as an Amazon affiliate.

Points to Ponder
Looking at each step in the process, do you
think it is fair that Amazon requires so much
information from you regarding your website?

What to Expect
When you are officially approved as an affiliate you will be given
access to many tools. Many of the tools available will help you get to

www.Biznulled.com
52

the level where you can be the best affiliate possible. And what is
JUHDWDERXWWKHVHWRROVLVWKDW\RXGRQWQHHGWREe an expert in web
design to use them. Many of what is offered is cut-and-paste or direct
links to the products you want to promote.
The great part about Amazon is that they will do everything they can
to help you succeed as an affiliate. They know that when you are
selling, they make money too.
There are currently thousands of affiliates scattered across the world
selling for Amazon. One such affiliate claimed earnings of up to half a
million dollars in one year. You can be a part of that to.
But what does Amazon hold in store for customers and their affiliates,
especially for 2012 and onward. It is hard to say. Well, based on some
projections, it appears that Amazon is on its way to making more
money than in previous years.
Their publishing side the Kindle will see much more in publishing.
In fact, Amazon has already sold more than five million Kindle Fire
tablets in the last quarter of 2011. So far in 2012, the numbers are
staggering, although not officially released yet. Amazon is actually
creating a Kindle Fire with a bigger screen.
7KHRQO\GRZQVLGHWR$PD]RQVIXWXUHLVWKDWWKH\ZLOOEHUHTXLUHGWR
collect sales tax from customers from many states. There are a
QXPEHURIVWDWHVQRZWKDWGRQWUHTXLUH$PD]RQWRFROOHFWVDOHVWD[


www.Biznulled.com
53

from tKHLUFLWL]HQVDV$PD]RQGRHVQWKDYHDQDFWXDOVWRUHLQWKDW
state. But that is likely to change in the foreseeable future.

Points to Ponder
:K\GR\RXWKLQNPDQ\VWDWHVGRQWFROOHFW
sales tax, whereas many states do?

Site Stripe as a Sales Tool

2QFH\RXDUHDQDIILOLDWH\RXZLOOEHDEOHWRVHH$PD]RQVWRROV2QH
of such is a Site Stripe. This Site Stripe is actually a toolbar that you
can use to do many things including adding links and reviewing what
you have made.
Here is what a typical Site Stripe looks like:

The Site Strip is the grey area at the top of the image.
Most affiliates will use the Site Stripe to navigate to any Amazon
product page and capture the links from the page. Affiliates have also
used the toolbar to create a slideshow E\DGGLQJSURGXFWVWR$PD]RQV

www.Biznulled.com
54

widget. There are many widgets available, including Carousel, My
Favorites, Slideshow, and MP3 Clips.
As an affiliate, you can also use the Site Stripe to promote a product
directly on Twitter or Facebook and include a link directly to the
Amazon product page.

Points to Ponder
Why do you think the Site Stripe was made
available for affiliates, instead of just offering
banner ads and links from a central location?

Product Links
As an affiliate, you will have access to product links. If you are
considering placing certain product advertisements on your web page,
having a product link will help a great deal as it will get the visitor to
$PD]RQVSURGXFWSDJHVRWKHSURGXFWFDQEHSXUFKDVHG
You can build your own product links. You can customize your links to
include text links, text and images together or images only. The choice
is yours to make.


www.Biznulled.com
55

You can also enhance your product links with reviews, or if you rather,
you can use Easy Links. Amazon also provides you with promotional
material that has been proven to create high conversions. If you
rather, you can use announcement banners and place them on your
web page.
Amazon does provide you with various ways to sell their products from
your web page.
Here is a sample of using an image, text and images, and straight
links to advertise a product on your web page.

You can use one or more than one of these customized product links to
advertise a product on your web page. The main thing is to get people
interested enough so they will click on the link or image, and go to the
product page on Amazon.



www.Biznulled.com
56

Points to Ponder
Look at the above image and think about the
following questions before you answer: When
working with product links, why does Amazon
product an image without any text to it?
:RXOGQWVRPHWH[WLQWKHLPDJHZRUNEHWWHUWR
promote the product?

Banners
Do you like graphics? Are you into using graphics to promote stuff?
Well, do you know that as an affiliate of Amazon, you can have access
to banner ads? You can place banner ads featuring certain products on
your web page. These graphic banner ads are very stylish. They have
been known to attract a lot of attention. In fact, those affiliates that
have used them in the past did very well.
The ads come in different sizes and shapes. You can even get them for
holidays, seasonal promotions, special events, and other days. The
banner will come wiWK$PD]RQVQDPHDQGORJRRQLWVRSHRSOHZLOO
recognize it easily.


www.Biznulled.com
57

Take a look at the above image. This is an example of a banner ad.
Notice the images on it. This will attract anyone interested in videos,
VRQJVDQGVRPHWKLQJIRU0RWKHUV'D\
:KHQ\RXVLJQXSIRU$PD]RQVDIILOLDWHSURJUDPDQGJHWDSSURYHG
you will have access to such like banners. You can even create your
own if you have a banner creation software.
Although you can create banners of your own, remember that each
banner will have a special code attached so Amazon will know the
customer came from your link.
Points to Ponder
Looking at the image on the opposite page, do
you think it is a good idea to create banners
with such images and text? Are they going


www.Biznulled.com
58

overboard with creating such banner ads?
Widgets
As an Amazon affiliate, you can create widgets that can be placed on
your website. Some of the widgets you have the ability to create can
include interactive applications. These widgets can even add a lot of
functionality to your website, and make it more appealing.
The types of widgets that can be created include the following:
x
Deals Widgets: With these widgets, you can showcase the

hottest products on your website. You can actually show
Goldbox deals that will really capture the eyes of your visitors.
You can even select a specific category to show discounted
items that Amazon has available.
Carousel Widgets: These widgets allow you to do exactly like

the deals widgets do, but using a carousel function.
My Favorites Widgets: You can even create widgets that display

your own recommendation and comments on products.
Search Widgets: With the search widget, you can help your
visitors find the products that matter to them the most, by
providing a method of searching Amazon.com on your own
website.
www.Biznulled.com
59

Deals Widget
Here is what the deals widget looks like:

You can control the way the widget looks by making adjustments to
the following:


www.Biznulled.com
60

As you change the settings, as shown in the image above, your widget
will also change. You can actually see the changes live by looking at
the Preview to your right, as shown by the image on the previous
page.
Carousel Widget
The carousel widget allows yoXWRGLVSOD\$PD]RQVSURGXFWVLQD'
way. You can display the carousel as a 3D display or as a Ferris Wheel
display. The choice is yours. Here is what you need to create this
widget:


www.Biznulled.com
61

You can pick and choose from a variety of options as shown in the
image. When you have made your selection and completed your
choices, Amazon will provide you with the code necessary to put on
your web page.
My Favorites Widget
My Favorites widget is by far the simplest one to create. Instead of
having many categories to look under, you just have two. You have
the "Search ad Add Products" and the "Search Listmania!" category.
Here is what you will need to create your My Favorites Widget.

Search Widget
Just like with the Deals Widget, you can preview the widget as you
adjust the settings.


www.Biznulled.com
62

Here are the settings I am referring to:

As you make the changes to your settings, you will see the changes
taking place as you will see in the Preview window, just like the image
below:


www.Biznulled.com
63

These are the most common used widgets. There are many more you
FDQXVHRUFUHDWH2QFH\RXEHFRPHDPHPEHURI$PD]RQV$IILOLDWH
SURJUDP\RXOOEHDEOHWRVHOHFWWKHZLGJHW\RXZDQWRUOLNHWKHPRVW
Points to Ponder
Seeing all the widgets that you can make, why
do you think Amazon has such flexibility in
allowing you to make these widgets? Why not
just provide one type of widget no matter
what?

aStore
Another way to make money as an affiliate is to create a professional
ZHEVLWHWKDWKDVWKHORRNDQGIHHORIDQ$PD]RQZHEVLWH<RXGRQW
need any programming skills. Amazon has an aStore setup tool that
will guide you step-by-step through the process. Amazon will provide a
URL that you will be able to link from your site, or have it embedded
on your web page.
Your aStore will provide featured Amazon products and a shopping
cart so that people can view products on your web page, but arrive at
$PD]RQVFKHFNout point when paying for the products.


www.Biznulled.com
64

When you become an Amazon affiliate, you will be given access to the
page where you can start building your aStore. Here is what the first
step looks like. This is where you will select what your category page
looks like:

There are actually four steps you will need to take to build your
aStore. The first step is creating your category pages. The second step
is choosing your color and design. The third step is setting up your
sidebar widgets, and the final step is getting the link to your aStore.
Once you get the link, you are done.
7KHUHLVDOLQNDWWKHERWWRPRIHYHU\SDJHFDOOHG3UHYLHZ6WRUH
With this link, you can always see what your aStore looks like at a


www.Biznulled.com
65

JODQFHWKLVZD\LI\RXPHVVXSRUGRQWOLNHZKDt you see, you can go
back and change it.

Points to Ponder
Looking at the aStore and how it is to be set
up, do you think that is a good idea to use your
affiliate status and make money with Amazon?

7KDWVDERXWLW,KDYHUHIHUHQFHGHYHU\PHWKRGRIXsing your affiliate
VWDWXVWRPDNHPRQH\XQGHU$PD]RQV$IILOLDWHSURJUDP,WLVQRZXS
to you to take advantage of what Amazon has to offer.
Amazon makes good money every day. It does this with the help of it's
thousands, upon thousands of affiliates. It can do the same for you.


www.Biznulled.com
66

Summary
In this lesson, you learned about Amazon and their affiliate program.
You were provided information about the various programs offered as
an affiliate.
<RXZHUHSURYLGHGZLWKYDULRXVPHWKRGVWRSURPRWH$PD]RQV
products including using widgets, the aStore, banners, ads, and
product links.
As you read each page of this lesson, you were shown step-by-step
the method to sign up and get involved with AmazonV$IILOLDWH
Program. When you sign up, you will have the opportunity of earning
PRQH\MXVWOLNH$PD]RQVRWKHUDIILOLDWHVGR


www.Biznulled.com
67

If you take the steps as outlined in this lesson and apply it, you will
not only have set up an Amazon Affiliate account, but will be on your
way to making money as an affiliate.



www.Biznulled.com
68

Assignment
It is time for you to get your feet wet. You will go to https://affiliate-
program.amazon.com/.
<RXZLOOFOLFNWKH\HOORZ-RLQ1RZIRU)UHHEXWWRQQHDUWKHWRSRIWKH
screen. Once you click that button, you will be taken to a series of
steps that will lead you to being an affiliate.
Remember, even after you have completed all steps, you still must
wait till you receive your confirmation email before you are officially an
affiliate.
* If you already have an Amazon account from the previous lesson, or
from buying from Amazon in the past, simply sign in using that email
and password.



www.Biznulled.com
69

Quiz
1. Amazon decides on what products affiliates promote?
a. True
b. False
2. There are six ways to make money as an affiliate. One way is to
use more than one tracking ID. What is one other way?
a. Provide your name on each product you sell.
b. Tell the customer the name of the product to buy.
c. Go for Bestsellers that Amazon promotes.
d. Make sure images are not clickable to mess up numbers.
3. :K\LVWKH%X\1RZ%XWWRQLPSRUWDQWWRXVH"
a. It makes sure your visitors take action.
b. It makes your site look better.
c. It tells visitors you are a salesperson.
d. None of the above.
4. When signing in for the first time, why is providing so much
information about your website important?
a. Amazon wants to know about your site to see if it fits with
their affiliate program.
b. Amazon wants to make sure you are for real and not a
robot.
c. Amazon wants to know if your web page has enough space
to fit their widgets.
d. None of the above.
5. aStore is another great way to make money as an affiliate.

www.Biznulled.com
70

a. True
b. False

Lesson 3-Make Money with the Fulfillment by

AmazonProgram
In this lesson you will learn how to use Amazon to sell your product. Instead of
selling the product from your location, Amazon will store your product in one of their
fulfillment centers. This lesson will take you through the steps to set up this system.

Are you ready to make some money with Amazon? So far you have
gone over two lessons that provided details on how to make money
with Amazon. In lessons 3, you are going to learn how to use Amazon
to sell your products for you.
Basically, what you do is instead of putting up your items for sale like
you did in lesson one, with Fulfillment by Amazon you send your items
to Amazon. Amazon stores those items in their warehouse. You sell
your item. When someone buys your product, Amazon will take care of
the packing, shipping, and providing customer service. All you do is
rake in the cash.



www.Biznulled.com
71

Points to Ponder
Why do you think Fulfillment by Amazon a
great way to make money with Amazon? Would
you risk sending your products to Amazon,
thinking that maybe when you sell items, they
will pocket all the money?

The Benefits
As a seller of Amazon products, by getting involved with Fulfillment by
Amazon, you will gain so many benefits. Here is a list of the benefits
you will gain by being under the program:
x
Free shipping: Amazon has a program called Amazon Prime.

Those who sign up and use this get free shipping for their
products. When someone buys a product, they will get their
product shipped free. This is a great incentive for customers, as
they will be more willing to purchase goods.
Competitive pricing: Amazon will not price any product out of the
market. They will keep tabs on the average price for a particular
product and will price your item or items the same way. For
instance, if you had a table that normally sold for $150 in the
store, Amazon would sell that table for about the same price or


www.Biznulled.com
72

less. By doing this, you will have an advantage over regular
consumers.
x
Fulfillment by Amazon logo: Any product you sell on Amazon and

that is under their fulfillment program will have displayed next to
\RXUSURGXFWWKHORJR)XOILOOPHQWE\$PD]RQ7KLVJLYHV\RXDQ
edge because customers will know that when they purchase your
product, the product will be packed and delivered by Amazon.
Amazon will also take care of any customer service issues or
returns.
Many channels: You can sell any item that may belong under
any channel. Just ship it to Amazon and list it for sale. You can
manage your own inventory by means of an online user
interface.
:LWKVXFKEHQHILWVLQSODFHZK\ZRXOGQW\RXZDQWWRWDNHDGYDQWDJH
of working with Fulfillment by Amazon?
Points to Ponder
Looking at the benefits that are listed on the
previous page, do you think, based on your
experience with Amazon so far, that they are
thorough and deep enough? In other words,
are the benefits they supply good enough for
you to get involved in the fulfillment program?


www.Biznulled.com
73

Pricing
Although joining Fulfillment by Amazon is free, there are fees involved.
The actual fees will depend on what the item is that was purchased,
and the amount of the item. For example, if you have a standard-size
media or non-media item that is priced at $300 or higher, order
handling, picking and packing, and weight handling is free. But storing
\RXULWHPDW$PD]RQVZDUHKRXVHZLOOFRVW\RXSHUFXELFIRRWSHU
month.
If you are unsure of what you have, you can find out what fees you
will need to pay by going to
http://www.amazonservices.com/content/fulfillment-by-
amazon.htm/ref=az_mm_fba?ld=AZMakeM#!pricing.
Here is what kind of pricing you will be facing when taking part in
Fulfillment by Amazon:


www.Biznulled.com
74

When you click the link on the previous page, you will see the web
page as shown in the image. Just click on each part of the menu you
VHHXQGHU6HOHFW\RXUUDWHVFKHGXOH7KHFKRLFHV\RXKDYHDUH
media, non-media, oversize, and zero fee fulfillment.
If you are unsure about the item you have, just click one of the icons
XQGHU9LHZD0HGLDSURGXFWH[DPSOHDQG\RXZLOOILQGZKDWNLQGRI
fees you will face.

Points to Ponder
7DNLQJDORRNDW$PD]RQVIHHVWUXFWXUHIRU
involvement in Fulfillment by Amazon, do you


www.Biznulled.com
75

think the fees are fair? Make sure to look at all

fees before thinking about it.
How Does It All Work?

$PD]RQVIXOILOOPHQWV\VWHPZRUNVE\IROORZLQJILYHVWHSV(Dch step
requires certain actions to be taken. If you want to make a lot of
money on Amazon and wish to use the fulfillment system, you need to
follow each step in turn.
These steps are as follows:
Step 1: Send your products to Amazon
If you want to be a part of this program, you have to ship your
products to Amazon first. If these products consist of media, you can
upload them. If they are physical products, you will have to ship them.
Amazon will provide the means and location where your products will
be shipped to.
Once you have sent your products to Amazon, they will handle your
inventory, unless you specify otherwise. Amazon will also print labels
when they ship your products.
The only rules you have to follow are with the products you can sell.
There are some products that Amazon will not permit to be sold on

www.Biznulled.com
76

their system. When you request for Amazon to sell your products, they
will ask you what the category your product or products fit in. If the
SURGXFWLVFRQVLGHUHGXQVDIHIRUFRQVXPHUVWKH\ZRQWFDUU\LW,IWKH
product quality is also considered poor (they base this on consumer
reports), they will reject it. Also, if there should contain any import or
export restrictions on the product, this will also cause Amazon to reject
the product.
Basically, if the product is considered hazardous or has been
improperly packaged, Amazon will reject it.
To see a list of products that Amazon will refuse to sell, go to
http://www.amazon.com/gp/help/customer/display.html?pf_rd_m=A2
CA1KKALKCX2O&nodeId=200277040&pf_rd_s=top-
1&pf_rd_r=1AY3JE5GP59X7HVHDZ36&pf_rd_p=1363322302&pf_rd_t
=101&pf_rd_i=fba-how-it-works&ld=AZMakeMAS.
As for uploading your product, Amazon provides three methods. You
FDQOLVW\RXULWHPE\PHDQVRI$PD]RQV catalog, and then once your
listing goes live, you can make arrangements with Amazon to have the
item sent to them. This applies to uploaded items only.
Amazon also allows you to upload more than one file at a time. What
you do is list your items by means of a spreadsheet, so this way
Amazon will know what you are selling. Then after they get the
spreadsheet, Amazon will instruct you as to how to upload the files.
They have an Upload tool that you can use to get your files to their
system.

www.Biznulled.com
77

If you have a large amount of items to sell, you can place your items
RQ\RXURZQZHEVLWHXVLQJ$PD]RQV0:6$3,7KLVDSSOLFDWLRQDOORZV
\RXWRLQWHJUDWH\RXUZHEVLWHZLWK$PD]RQVLQYHQWRU\PDQDJHPHQW
software. Then you just make sure to get your product to Amazon so
they can take care of shipping it for you.
By the way, when under the fulfillment system, when someone buys
your product, Amazon will let you know about the purchase, and will
work to help you ship your product. They will provide you with options
for shipment.
Step 2: Amazon stores your products
When all your items arrive at Amazon, they will store your items in
their warehouse and list them in their catalogs and in their ready-to-
ship inventory.
Amazon has an organized system for storing your items. When they
receive your items, they will scan them in. They will place a bar code
on the item they will use as a means to scan the item. They will record
the item by dimensions and any other method required for their
listing. At that point you will be notified when your product has gone
OLYH<RXFDQWKHQORJLQWR$PD]RQVLQWHJUDWHGWUDFNLQJV\VWHP2QFH
there, you can monitor your inventory. If you are selling more than
one of the same item, you can simply notify Amazon of the item you
wish to add to their inventory, and then you will ship the new item to
them.


www.Biznulled.com
78

2QFHWKHLWHPKDVEHHQUHFHLYHGDW$PD]RQVZDUHKRXVHWKH\ZLOO
scan the item into their system. The time it takes to scan the item and
make it available to sell in their system is about three business days.
<RXFDQDOZD\VWUDFN\RXULWHPVLQ$PD]RQV6KLSSLQJ4XHXH,WOHW's
you know when the item has been received. You will either get In
Transit, Delivered, Checked-In, Receiving, and finally Closed.
It is during the receiving process when your items are barcoded and
scanned into their tracking system. After they scan the items in, they
will measure and weigh the item. These measurements and weights
will be listed with the item.
By the way, if at any time the item or items you send to Amazon are
damaged, Amazon will compensate you for the cost of the item.
When Amazon places your items into their system, the storage fee
begins. You will be responsible for paying a storage fee to Amazon.
This is necessary to recoup the space they use for your items. If you
have more than one item, they will only charge you a fee for the total
volume of storage space all your items fill. If your item is sold, it will
no longer be counted as part of the storage space, and therefore, you
ZRQWEHFKDUJHGIRUWKHVSDFH
Step 3: Customer orders your product
Once the customer orders your product, Amazon goes into action to
fulfill that order. Your listing will be ranked by price. This price will not
include shipping, since the shipping will be separate.


www.Biznulled.com
79

'RQWIRUJHWVLQFH\RXDUHXVLQJ$PD]RQV)XOILOOPHQW6\VWHPDQ\
item that is sold will be placed under the FREE Super Saver Shipping
and will receive an Amazon Prime shipping discount. The customer can
also request your item be gift wrapped. Plus, Amazon provides
customer service to the buyer of your product.
$VIRUIHHVDQ\WLPH\RXVHOO\RXUSURGXFWXVLQJ$PD]RQV)XOILOOPHQW
System, you will be paying a fee for them doing so. What Amazon
does is when your item is sold, Amazon will collect the price of the
item, along with the shipping costs from the buyer. At that time, they
will deduct their fees. These fees will include a referral fee of 6 to 25
percent of the sale price, a closing fee that is changeable, and a per-
tem fee of about $.99.
7ROHDUQPRUHDERXW$PD]RQVpricing structure, go to
http://www.amazon.com/gp/help/customer/display.html?pf_rd_m=A2
CA1KKALKCX2O&nodeId=1161240&pf_rd_s=top-
1&pf_rd_r=1AY3JE5GP59X7HVHDZ36&pf_rd_p=1363322302&ie=UTF8
&pf_rd_t=101&pf_rd_i=fba-how-it-works&ld=AZMakeMAS.
Step 4: Amazon retrieves and packs your products
At this stage, once Amazon receives the order, they will process it, and
then they will retrieve the item and pack it. To do this, they use an
advanced web-to-warehouse, high-speed picking and sorting system.
It captures the barcode of the item, and quickly tells the worker the
location of the item in the warehouse, the exact shelf and spot where
the item sits.

www.Biznulled.com
80

If the customer purchases more than one item at a time, the computer
provides the location of each item individually. The worker prints out
the list and goes to retrieve them. The worker than places the item in
a box that has the Amazon brand name on them. Even the invoice has
$PD]RQVQDPHRQLWDORQJZLWKWKHQDPHRIWKHPHUFKDQW
As with storage, Amazon charges a fee for picking and packing your
SURGXFW7KHIHHZLOOEHGHSHQGHQWRQWKHSURGXFWVGLPHQVLRQDQG
weight, product category (is it media or non-media?), and selling
price. If the product sells for more than $300, there is no cost
involved.
Step 5: Amazon ships the product to the customer
After the product has been packaged, Amazon contacts the shipper
and sends it out from their fulfillment center, wherever that may be.
The product gets delivered based on what you decide.
Once the shipper picks up the box, Amazon will keep track of it, and
provide the merchant, you, with all tracking information by email.
These are the steps you will need to go through when you are in
$PD]RQV)XOILOOPHQW6\VWHP,WLVDSDUWRIGRLQJEXVLQHVV7R
Amazon, you are a business. You have items you wish to sell. Amazon
has to make a certain amount of money off of you as well, since you
are using their system. The amount of fees is not that large, but has to
be SDLG7KHRQO\WLPH\RXGRQWSD\DIHHLVZKHQ\RXDUHVHOOLQJ
something that is over $300.


www.Biznulled.com
81

Points to Ponder
Considering all the steps that Amazon requires
you to take, do you think that any step is not
necessary, or are steps required for a secured
transaction sell?

Are You Ready?

$UH\RXUHDG\WRVLJQXSWREHFRPHDPHPEHURI$PD]RQV)XOILOOPHQW
System? If so you are, there are procedures you need to follow. The
first consideration is whether you have an account with Amazon now
or not.
The reason to ask this is because you have two methods of signing up
ZLWKDQDFFRXQWZLWK$PD]RQV)XOILOOPHQW6Hrvices.


www.Biznulled.com
82

Look at the image above. As you can see from looking at the image,
there are two choices you can make regarding signing in. If you have
been following this course so far, you should already have an account
ZLWK$PD]RQ,I\RXKDYHQWHQJDJHGLQany of the lessons yet, but
you do have an account from purchasing from Amazon, use that as
your sign in.
,I\RXGRQWKDYHDQ\NLQGRIDFFRXQWULJKWQRZWKHQ\RXZLOOQHHGWR
register.
/HWVVD\\RXGRKDYHDQDFFRXQWZLWK$PD]RQ:KHQ\RXFOLFNWKHWRp
yellow button, you will be taken to a web page that looks like this:


www.Biznulled.com
83

All you have to do is use your present email address and password.
Then log in and your account will automatically be synced with
$PD]RQV)XOILOOPHQW6\VWHP
%XWZKDWLI\RXGRQWKave an account with Amazon at all? In this case,
you will have to go with the second yellow button. When you click this
button, you will be presented with a page like this:


www.Biznulled.com
84

If you look at the image above carefully, you may notice it is the same
form as was shown in lesson one. This is because Amazon uses a
central form when you are signing up to set up to sell. However, after
you provide your email, password, and legal name of your business,
then when you click the yellow Continue button, you will see this web
page appear:


www.Biznulled.com
85

Just click the yellow button at the bottom, as seen in the image, and
you will be signed up to use it. You will be sent to a web page where
you will receive further instructions on the next steps to take to make
sure you take every advantage of the program you signed up for.
To ensure that you perform the right steps as you start working with
the program, you will be provided a check list:
x
Make sure your products are approved by Amazon
List your products that you are selling with Amazon
*HW\RXUSURGXFWVWR$PD]RQV)XOILOOPHQWFHQWHUV
Select the type of labeling options you wish
Create your shipment
$VORQJDV\RXIROORZWKLVFKHFNOLVW\RXOOEHILQHSOXVWKHUH are
tutorials that will explain every step to you from a visual point-of-view.

www.Biznulled.com
86

If you go to
https://sellercentral.amazon.com/gp/seller/pipe/manager.html, on the
left side of the page will be a list of videos. These videos will help you
with your Fulfillment by Amazon account by showing you how to get
started and use the system.
Here are the videos you will find when you go to the URL provided
above.


www.Biznulled.com
87

Amazon will do whatever is necessary to make sure you succeed and
make money. They will send you and email every so often to guide
you along the way. The main thing is that as you work the system and
JHWVWXFNDORQJWKHZD\GRQWEHDIUDLGWRVHHNKHOS7KDWLVZK\
those tutorials were made. Amazon also provides a customer service
number to call if you have any problems or questions when you begin
to sell using Fulfillment by Amazon.

Points to Ponder
Do you think that having those video tutorials
handy makes it easier and better for you to
work with Fulfillment by Amazon, or does it
detract from what you have to do?



www.Biznulled.com
88



www.Biznulled.com
89

Summary
In this lesson, you learned about Fulfillment by Amazon. In lesson one
you learned about how to sell products on Amazon by listing them on
the product page. In that lesson, you were presented with a seller
account. In this lesson, you were presented with Fulfillment by
Amazon.
Fulfillment by Amazon is nearly the same as the seller account, except
Amazon charges you more fees, plus, you ship or upload your products
to Amazon. They then store your items in their fulfillment centers.
So, in this lesson, you were introduced to that program and were
shown what the program presented, and how you could get involved
with it.
Keep in mind that when you are in the Fulfillment by Amazon program,
you are doing exactly what you would do if you were a seller. The only
difference is that with the fulfillment program, you have to pay fees for
each process that is completed for you, and you have to ship the
products to Amazon before they can ship them to the customer,
whereas with the seller program, you are responsible for shipping the
items yourself.
,WLVDJUHDWZD\WRPDNHPRQH\DQG\RXGRQWKDYHWRZRUU\DERXW
packing, shipping, tracking, and customer service, as Amazon takes
care of that for you.


www.Biznulled.com
90



www.Biznulled.com
91

Assignment
For this assignment, I would like for you to go to
http://www.amazonservices.com/content/fulfillment-by-
amazon.htm/ref=as_hn_fba?id=hm2&ld=AZFSSOAAS#!features-and-
benefits and sign up. If you already have an account with Amazon, use
the second button and register.
Here are the buttons again:

The choice of button will depend on whether you have an account with
$PD]RQFXUUHQWO\RUQRW,I\RXGRQWKDYHDQDFFRXQW\RXZill need
to go with the button at the bottom. However, if you go with the top
EXWWRQ\RXOOEHVLJQHGLQULJKWDZD\
If you follow all the steps in this lesson, you will be signed up to use
Fulfillment by Amazon.

www.Biznulled.com
92

Quiz
1. Of all the benefits Fulfillment by Amazon provides, what is NOT
one of them:
a. Free shipping
b. Competitive pricing
c. Many channels
d. $100 for referrals to the program
2. When joining Fulfillment by Amazon, you have to pay a fee.
a. True
b. False
3. Fulfillment by Amazon works by following five steps. Of the
following steps, which is NOT a step?
a. Send your products to Amazon
b. Amazon will store your products
c. The customer orders your product
d. You are responsible for logging in and selling your product
when it is sold.
4. Signing up for Fulfillment by Amazon is really easy?
a. True
b. False
5. Under the "Select your rate schedule" you have a few selections
you can make. Choose the best answer from the following:
a. media, non-media
b. oversize, and zero fee fulfillment
c. a + b

www.Biznulled.com
93

d. b + c
e. None of the above

Lesson 4-Promote and Sell Your Products using

Advantage
Learn how to apply for the Advantage system and increase your sales. You will be
shown step-by-step how to sign up and get started making money from your media
products.

If you want to make money with Amazon, why not take advantage of
WKHP1R,PQRWWDONLQJDERXWXVLQJWKHPIRU\RXURZQJDLQ,P
talking about signing up to work with their Advantage program.
Advantage is considered a self -service consignment program. With
this program, you can promote and sell media products directly on
Amazon.com. Remember, this is only media products. The type of
SHRSOHWKDWXVH$PD]RQV$GYDQWDJHSURJUDPDUHSXEOLVKHUVPXVLF
labels, studios, authors, and content owners that use media for their
content.
Advantage allows you to market your products on Amazon to millions
of customers. You get to distribute your products and have Amazon
fulfill your order for you. If you are a publisher of used books or are a
ERRNVWRUH\RXFDQWXVHWKHAdvantage program.


www.Biznulled.com
94

Points to Ponder
Why do you think the Advantage program is
not suited for bookstore owners and those
selling used books?

How It Works
If you have media to sell to consumers, why not sign up and start
making money today. But before you do, you should learn how the
program works.
The Advantage program works by you, the seller, adding items you are
going to source to Amazon. In order to list your items with Amazon,
you must have a valid legal right to them and to distribute them .
Once you get your titles listed with Amazon, They will start ordering a
number of them to have plenty in inventory. Amazon will tally the
inventory and order more inventory to make sure plenty of that item is
on hand. When you send the item initially, Amazon hopes you will
send enough items to take care of the possibility of many customers
buying the item, plus enough of a supply to handle orders for a few
weeks.


www.Biznulled.com
95

Once you list your items, just notify Amazon when they are to expect
delivery of your items. This way they will know when to list your item
for sale.
The Advantage program works really well for those that have some
kind of media they would like to provide to others.
Every media item you provide to Amazon will be based on
consignment. Amazon will reduce the cost up to 55 percent. When
Amazon sells your book or other media item, they will pay you. This
SURJUDPLVGLIIHUHQWIURPRWKHURI$PD]RQV)XOILOOPHQW3URJUDP
because when you send item to Amazon, they will take care to make
sure there is plenty of inventory for your item. They do this because
they want to make sure there is plenty of the item in stock so
customers can purchase the item.
Points to Ponder
Considering the way the Advantage program
works, why do you think Amazon offers such a
program to sellers?

Getting Started

www.Biznulled.com
96

If you are ready to get started, you will need to sign up to use
Advantage. There are three different ways to sign up:
1. By way of the Membership Agreement
In order to read and respond to the Membership Agreement, you will
have to go here: https://www.amazon.com/gp/seller-account/mm-
product-page.html?topic=200339190. Here is what the page will look
like:



www.Biznulled.com
97

When you go over the agreement, there will be 25 terms and
conditions you have to read over and agree to. Once you do this just
click the Apply Now button.
2. The Instructions and Rules page
Also, read over the instructions and rules regarding participation in the
Advantage program. You can access this by going to:
https://www.amazon.com/gp/seller-account/mm-product-
page.html?topic=200339300.
Here is what the page looks like:


www.Biznulled.com
98

This page contains all the info you will need regarding the application
SURFHVV$PD]RQVSDFNDJLQJDQGODEHOLQJSURFHGXUHVDSSOLFDWLRQ
approval steps, and many other things you will need as you sell under
the Advantage program.
After you have read over the entire document, just click Apply Now
and your application process will begin.
3. The actual application page
You can also sign up directly by going here:
https://advantage.amazon.com/gp/vendor/setup-sign-in/create-
account?ie=UTF8&successUrl=%2Fgp%2Fvendor%2Fregistration.
This is what the page looks like:
Points to Ponder
After considering the three ways to sign up for


www.Biznulled.com
99

an Advantage membership, why do you think

Amazon allows you to sign up three different
ways?

Signing Up for Advantage

Once you fill in your name, email, and password, you will then be
taken to a web page where you will provide your business name:

After you have entered your business name in the field as shown in
WKHLPDJHDERYHMXVWFOLFNWKH\HOORZ&UHDWHDFFRXQWEXWWRQ
You will be sent to a page where you will need to set up your security
questions. These questions were put in place to prevent just anyone
from using your Advantage account.


www.Biznulled.com
100

$IWHU\RXILOOLQWKHVHFXULW\TXHVWLRQVMXVWFOLFN6XEPLW
Before you are actually giving the account to work with, Amazon will
require some additional information from you. This is typically what
you will see at this point, if you chose option 3, which is applying at
the application page directly.

If this page does show up, you will need to click the words under the
ZRUG0RGXOHLQRUGHUWRIXOILOO\RXUUHVSRQVLELOLW\ZLWK$PD]RQ
The best way to access each web page is to right click on it the word,
DQGVHOHFW2SHQ/LQNLQ1HZ:LQGRZ
The first word to click on is Agreements. When you click this link, here
is what will show up:


www.Biznulled.com
101

You have to review everything on this page and make sure it is
accurate. Then click the button at the top of the page. The button you
need to check is that shown in the image surrounded by a small box
with an orange border.
After you check that box, look at the area under "Purchasing Terms."
You will see a Accept button on the far right side. Click that button
first. Once you have clicked it, the word Accepted will appear in green.
Next, go below to the Terms and Conditions and right click the Terms
and Conditions link as show here:


www.Biznulled.com
102

You will have a chance to download a copy of it to your computer for
future reading. After you have downloaded the terms and conditions, it
is now time to proceed further. So go on and click the "Accept button."
Again, you will see the word "Accepted" come up in green. You will
also notice one other change on the web page. Right at the top, even
above the check box, you will see a "Continue Setup" button. Click this
button.
You will now be taken back to the page where you had to click the
various links to complete your vendor setup. Here is that page, but
now with the Agreements changed to completed.

Now, you need to go to the next link, which is "Bank Information." On
this page, you will have to fill in your address, your company tax ID

www.Biznulled.com
103

number, the way you want to be paid, and the account you wish to
use for payment. As soon as you fill out this page, just click "Submit"
and you will be half way to completing your vendor setup.
Here is what this page looks like:

After you fill out everything on this page and click Submit, you will see
D\HOORZ&RQWLQXH6HWXSEXWWRQDWRUQHDUWKHWRSRIWKHVFUHHQ
right above the Remit to Address.
Again, you will be taken back to the info request screen as shown
here:

www.Biznulled.com
104

The next step is to click the "Contacts" link. On this page you will enter
the contact information of each person that works for you. If you have
more than one department that will be responsible for your Advantage
account, you have to list that person.


www.Biznulled.com
105

You only need to provide the contact information for the person that is
connected with your account. Whoever it may be, just click the arrow
GRZQEXWWRQDQGVHOHFW$GGDQHZFRQWDFW
This is what will appear:


www.Biznulled.com
106

You have the option of filling out the "Contact Roles" section. If you
GRQWZDQWWREHERWKHUHGZLWKWKLVDWWKLVWLPHFOLFNWKH+LGHOLQNWR
the right side and that area of the page will disappear.
However, it is recommended that you at least provide the primary
contact information. This contact information will also be shown under
the Contact Individuals section below the Contact Roles section.
Once you have completed filling in your contact information, just click
WKH6DYH&KDQJHVEXWWRQ
* By the way Amazon does require you to fill in the Products Returns
role, Remittance role, Advantage Buying role, and Accounts Payable
UROH,WLVWKHLUUXOHV<RXFDQWVNLSLWLI\RXGHFLGHWRZRUNZLWKWKLV
section. If you already added a primary name, you can just select that


www.Biznulled.com
107

name, if that person fulfills every role. Otherwise, you will have to add
each name separately.
2QFH\RXKDYHIXOILOOHG$PD]RQVUHTXHVWDQGVDYHGDOOFRQWDFW
LQIRUPDWLRQFOLFN&RQWLQXH6HWXSWRJRRQ
You have arrived back at the vendor set up process again. But this
time, look to see what has been completed:

You only have the Return Addresses left. So click on that link so we
can finish up.
On this page, you will simply provide an address for returns, if you
should have any. This way, if someone were to purchase something
from you, and they need send it back, they can send it to your
address that you provide here.


www.Biznulled.com
108

If you are at the screen right now, go ahead and fill out the return
address, if you know it at this time. Amazon actually makes it simple
for you. If you already have an address in the system, you can click
6HOHFWDQGDGGUHVVDQGLWZLOOVKRZXSWKHUH+RZHYHULI\RXGRQW
KDYHDQDGGUHVVWKHUH\RXZLOOQHHGWRFOLFN$GGDQHZDGGUHVV
/HWVVD\\RXGRQWKDYHa new address. Click the button and you will
be presented with this popup:

Fill out everything and click Submit. The address will now appear in
WKHSURSHUILHOG&OLFN6DYH$OO&KDQJHVILUVW:KHQ\RXVHHDEOXH


www.Biznulled.com
109

,PSRUWDQW0HVVDJHDWWKHWRSRIWKHVFreen, your settings were
VDYHG1RZFOLFN&RQWLQXH6HWXS
Guess what. You have completed all stages. Here is what you will see
now for the vendor setup process:

$OOWKDWLVOHIWDWWKLVSRLQWLVWRFOLFNWKH6XEPLWIRU)LQDO$SSURYDO
button. Once you do that, you will be taken to the Advantage page
where you can read all about the program. This will be your
dashboard, if your account is approved.
Amazon will send you an e-mail, letting you know when your
application to Advantage has been accepted. This email usually takes
up to 24 hours.
Please note in order to participate in the Advantage program you will
need the following:


www.Biznulled.com
110

x
North American distribution rights for any titles you enroll
Access to e-mail
Access to the Internet
A U.S. Bank Account (for Electronic Funds Transfers; you do not

need a U.S. bank account to receive paper checks)
A valid ISBN, UPC, or EAN for each of your items
A scannable barcode on each of your items which maps to the

valid ISBN, UPC, or EAN
When you have been approved, you can start selling under the
Advantage program. What you can do at that point is to send your
inventory to Amazon, and they will store it at one of their fulfillment
centers. They will then place the words "In-stock" on its Amazon.com
product page.
When you item or items have sold and shipped, Amazon will pay you
for it, by sending the money to the bank account you specified in your
application. Amazon pays every 30 days for transactions that occurred
during that time span. For example, if your item sold in January, you
will get paid for that item at the end of February.
.HHSLQPLQGWKDW$PD]RQVVWDQGDUGWHUPVDUH3XUFKDVH
Discount off the list price, which you set, you pay for shipping the item
to Amazon, and you pay a $29.95 Annual program membership fee.


www.Biznulled.com
111

Points to Ponder
You just went through the entire process of
signing up with Advantage. Do you think it was
worth doing all that work of filling out forms
and entering so much information just to get
the account?

Optimize Listing
If you really want to do well with your Advantage account, what better
way to do it than to have your listing optimized fully. How can you
have a fully optimized listing? There are steps you can take:
x
Ask each satisfied customer to write a review of your product.

The more good reviews you have the better your chances of
selling more books.
Before you provide Amazon with your media item, check out
$PD]RQV"Look Inside" program. Amazon uses that program to
give customers a chance to review some of the material before
ordering. This is a personal choice. Do you want people to see
your work before purchasing? What if someone was to read
PDQ\SDJHVEXWGLGQWEX\WKHERRN'R\RXUHDOO\ZDQWSHRSOH
to have a free ride through your material?


www.Biznulled.com
112

x
When listing your book, make sure to provide a good description

and table of contents. By doing so, it will entice consumers to
purchase your book.
Amazon allows you to use 20-word editorial quotes. Take

advantage of this.
Ranking is important. If your book is not ranking well, change

your description and the way your book is listed. Get more good
feedback. You want your ranking to be as low as possible.
/RRNDWWKHERWWRPRI\RXUOLVWLQJ<RXZLOOVHHD)DYRULWHV
section. Go through this and add your own book to it.
Amazon has a "Make a Recommendation" tool. This tool can help

drive your sales upward if you use it properly. The way it works
is to review the top 100 bestselling books. As you review those
books check to see which book or books comes closest to your
book, based on theme and genre. Then suggest that your
customers recommend your book on their books' pages. It is
VLPSO\DPDWWHURIFRS\LQJWKHERRNVISBN number and pasting
it in the "Make a Recommendation" box, then hit "Submit". Many
people that have used this featured saw a dramatic upswing in
sales and great ranking.
Make sure to use the "Rate This Item" function that is found on
the left-hand side of the screen. When a customer buys your
book, request the customer to give your book a five-star rating
as well.


www.Biznulled.com
113

When you get started with Amazon Advantage, you will see just how
much money you can make with the program. It really depends on the
amount of media you have and are willing to sell.
Amazon is and probably will be the most often accessed online
PDUNHWSODFHIRUERRNVDQGRWKHUPHGLD<RXOOEHQHILWKXJHO\E\
having your listing on the service. Many different people go to Amazon
for their book and other media purchases. These customers include
bookstores and libraries.

Points to Ponder
Do you think that optimizing your listing as this
section suggested will help your listing do
better, in turn help you make more money?



www.Biznulled.com
114

Summary
If you truly want to make money with Amazon and you have media
that you can sell on the system, why not take advantage of using
them. Amazon provides you a solid platform that can guarantee you
money. You just have to use it.
The Advantage program is geared mainly for books and other media. If
you have these types of items to sell, you can use Advantage. It is
very useful for providing those with much media to sell, and way to
make a good amount of money.
The sign up process can be extensive and time-consuming, but the
result is that you will benefit a great deal by entering into the
program.



www.Biznulled.com
115

Assignment
For this assignment, you need at least 10 to 15 minutes of your time
to perform. I want you to go to this web page:
https://www.amazon.com/gp/seller-account/mm-product-
page.html?topic=200329780&ld=AZAdvanMakeM
Take time to read the fine-print as it were. When you are ready, click
the Apply Now button and start the process of applying. Again, the
time involved will be at least 10 minutes, but the end result is that you
will be involved in a program that can make you a ton of money.



www.Biznulled.com
116

Quiz
1. Advantage is considered a self-service consignment program.
a. True
b. False
2. Advantage allows you to do what?
a. Market your products on Amazon
b. Market your products on your own website
c. Market your products on Barnes & Noble website
d. Market your products on Borders website
3. How does the Advantage program work?
a. The Seller adds items that he/she is going to send to
Amazon for sale
b. The seller takes items and returns them for a refund
c. The buyer contacts the seller directly with an offer to buy a
certain book outside of Amazon
d. The buyer gets to return any item to the seller regardless
of condition of book
4. To get started you have to sign up. Amazon gives you three
ways to sign up. You can sign up by way of the Membership
Agreement. What is one other way?
a. The Instructions and Rules Page
b. The application page
c. A + B
d. B + C
5. Signing up for Advantage is a fast process.

www.Biznulled.com
117

a. True
b. False


www.Biznulled.com
118

Lesson 5-Build Your Own Amazon Webstore

Easily and Quickly
In this lesson, you will learn how to create a stand-alone, fully-branded online store
from scratch that is secure, reliable, and that uses Amazon technology.

So far you have been introduced to many way of making money on
Amazon. Having your own webstore is just another way to go about it.
The type of webstore you may wish to get involved with will depend on
how many items you plan to sell.
Here are the types of Webstores you can set up:
x
Individual Seller: This involves only you. You have control. You
can build your store by selling Amazon products that are based
on your choices. The number of items will be small, as you are
an individual.
Small/Medium Business: For this type of store, you would need

to sell at least one million dollars gross annually. This means you
can sell quite a number of items.
Large Business: if you are going to sell more than one million
dollars worth of products in a year, this will be the best type of
website to start and work with.
When thinking about setting up your webstore, you first have to look
at your inventory, and make a determination whether you have


www.Biznulled.com
119

enough items to sell on a regular basis. Setting up a webstore is not a
one-time event.
Points to Ponder
Why do you think setting up a Amazon
webstore is a practical idea? Do you think it has
any merit?

Why Start a Webstore

Why not start one. It is a great way to make money. Having an
Amazon webstore is safe, secure, and reliable. This is a great way of
doing business and running an eCommerce store.
Every day someone out there wants to go online and make money.
:KRZRXOGQWZDQWWRGRWKDW" Amazon has made it easier for you to
create a business online. Think about this fact for a moment. By
creating an Amazon webstore, you are using a brand that is very
popular and known throughout the world.
You will be using features that are only common to Amazon that will
make your site as a reliable place for consumers to purchase goods of
any type. For those that have already engaged in this type of
eCommerce solution, they are doing very well.


www.Biznulled.com
120

Just what do you get when you create your webstore? Here are just
some benefits of having a webstore set up:
x
Make more money: You can generate more sales from your
website than you may be doing from any other web business
\RXPLJKWKDYHVHWXSQRZ,I\RXGRQWKDYHDQ\ZHEVLWH
established, you can really start making money online by having
a webstore.
Generate more traffic: By having a website, you can attract a

ton of people to your site. If you have another website you are
promoting, and you provide a link on your webstore, the
amount of traffic you will get to your webstore will cause a lot of
traffic to go to your other website as well.
Reach more people: With a webstore, you can take advantage

of a number of other services that Amazon offers. These
services will allow you to reach more customers. By reaching
more customers, you can get your products into their hands and
make more money as well.
Partner with a leader of eCommerce: There is no one larger and

more popular than Amazon. Amazon has saturated the market
as the go to company for selling practically anything. By setting
up an Amazon webstore, you can assure people you are running
a legitimate site. This is important since there is so much fraud
and identity theft taking place online today. People have
resorted to taking the careful approach. By having a webstore,
people will know you can be trusted.


www.Biznulled.com
121

x
Have security and scalability: By having a webstore, you can

have security and scalability. What does this mean for you? As
Amazon grows, your webstore will automatically grow as well.
/HWVORRNDWHDFKRQHRIWKHDERYHSRLQWVPRUHFDUHIXOO\WRVHHKRZ
they show that having a webstore is the most practical way to make
money online.
Make More Money
As the owner of a webstore, you have the opportunity to make untold
amounts of money. Amazon will help you make lots of money by
providing you with features to help you with your webstore and grow
your sales. Amazon has promotions they use on a regular basis. They
also have products they recommend since they are hot sellers.
Amazon constantly provides featured items that people enjoy the
most. These methods of exposing products are enough to get people
interested in purchasing the product.
When you set up a webstore, you can use up to 28 different
promotions and at the same time. If you use more than one of these
promotions, you will attract more customers, which will result in more
sales for you.
When you use these promotions, you are in control. You can dictate
the rules behind the promotion. You could offer a free product to
entice the consumer to purchase a certain product from you. You could
also offer free shipping on any purchase made by a certain day. If you


www.Biznulled.com
122

want to, you can even offer your customer a discount on his/her
purchase.
$VDZHEVWRUHRZQHU\RXFDQWDNHDGYDQWDJHRI$PD]RQVFURVV-sell
DQGXSVHOOZLGJHWV7KHVHZLGJHWVZLOODGYHUWLVH$PD]RQVODWHVW
recommendations. The widgets also help consumers find their featured
products faster.
Generate More Traffic
Another feature of having a webstore is that you can generate a lot of
traffic to your site. Amazon has many tools that you can use that will
generate that traffic. Not only that, but by driving plenty of traffic to
your webstore, your website will also be indexed by the search
engines. This is to your advantage, as it will enable your page to come
up in the search results page.
How can your website attract traffic? Amazon provides plenty of SEO
tools that will help you get your site optimized so search engines can
pick it up. Amazon also has tools available that will help automate
submissions to shopping engines so as to keep all listings updated.
Also, Amazon uses an extremely effective email marketing campaign
that keeps consumers informed about the latest updates and new
products, based on their buying habits.
When you sign up for an Amazon webstore, you not only getting a
website where every page is optimized, the store runs on an
eCommerce template. This template is one that you customize to your


www.Biznulled.com
123

liking. All you have to do is update your content. This can easily be
done by uploading and modifying items and changing product
descriptions when necessary. You can also be provided images that
really catch the eye of those looking at them. Widgets are available
that you can set up on your website to offer related products that
Amazon has on sale or is promoting heavily.
There is also one important factor to take into consideration when you
want to start a webstore<RXGRQWZDQWMXVWWUDIILFWR\RXUZHEVLWH
You also want to close as many sales as possible. Amazon helps out in
this situation, by providing Checkout by Amazon. This makes
purchasing so much easier. The process is smooth, fast, and easy.
It works on the principle that when consumers shop on Amazon, their
shipping and payment information gets stored. So when they arrive at
your webstore and order from you, they can use their stored
information to make a purchase.
Reach More People
By using many of Ama]RQVIHDWXUHVDQGRWKHUVHUYLFHV\RXFDQUHDOO\
make your webstore sing. There are a number of opportunities
available to help you be successful with your webstore. Once you have
your webstore set up, you can add the services Amazon provides
whenever you want them.


www.Biznulled.com
124

Just what are some of these services? One such service Amazon
provides is the ability of you to sell your items on Amazon.com as well
as on your own webstore.
Amazon also has many sales channels you can take advantage of.
These channels allow you to reach out and connect with more
customers, thereby increasing your revenue. You can list your
products in over 25 categories.
Another way to leverage Amazon to help you grow your business is by
using features like A to Z Guarantee, 1-Click purchasing, and above all
else, being tied to a brand that is trusted by most customers around
the world.
Partner with a Leader of eCommerce
By getting involved with Amazon, even by setting up a webstore, you
are getting connected with a company that is so well known in the
industry that people look at them as the number one eCommerce
website on the Internet.
Amazon is trusted by everyone that stops by and shops at their
storefront. Amazon has locations around the world and has done so
well that have affiliates and many other people working with them.
Consumers are constantly purchasing from them on a daily basis.
When you start your webstore, people will notice it and will come to
your site and buy from you. They will recognize it as a brand of
Amazon and will take delight in ordering from you.

www.Biznulled.com
125

Have Security and Scalability
:KHQ\RXVLJQXSZLWK$PD]RQ:HEVWRUH\RXZRQWKDYHWRZRUU\
about fraud, because everything is protected. Your webstore will have
security in place to prevent you from having to face fraud. By having
such security in place, you can also protect consumers as they stop to
shop at your store.
7KHJUHDWSDUWDERXW$PD]RQV:HEVWRUHLVWKDWWKHVRIWZDUHLV
constantly updated, so that the newest advances in technology are
utilized.
As for scalability, your webstore will be able to grow as Amazon grows.
Amazon will see to it that your It and overhead costs are down to a
minimum. The great part about your Amazon Webstore is that it is
KRVWHGE\$PD]RQVR\RXGRQWKDYHWRSD\IRUDQ\HTXLSPHQWWo
VWRUHWKHVLWH<RXGRQWHYHQKDYHWRZRUU\DERXWLQVWDOOLQJVRIWZDUH
that needs updating.
The bottom line is that your online store is built on a solid foundation
that is secure and flexible as well.
Points to Ponder
Based on what was related above, what are
your thoughts regarding starting your own
webstore? Is it really practical?


www.Biznulled.com
126

Webstore Features
One great reason for starting an Amazon Webstore is the many
features that go with owning one. First of all they have many tools to
help you design and market your store.
Some of the tools that are provided you include web design, a
shopping cart, credit card processing, eCommerce hosting, inventory
management, and Prime on Your Site.
:KHQ\RXVLJQXSIRU$PD]RQV:HEVWRUH\RXDUHLQFRQWURORIKRZLW
looks and feels. You will be provided powerful looking layouts and
merchandising tools to help you design your site the way you want it.
Your web design will consist of:
x
Template designs
Custom navigation
Product categories
Widgets
Customer reviews
Page Masters (a method of creating pages that you have control

over)
Built-in hosting for images and products
Website updates without IT helping


www.Biznulled.com
127

7KHVWRUHVVKRSSLQJFDUWLVcompletely integrated. ,WVGHVLJQHGWKLV
way to make the order process as simple and easy as possible. It uses
SSL encryption, this enables secure transactions.
As for payment processing, you will be able to select all major credit
cards. There is no need for a payment gateway or merchant account.
All transactions are handled by Amazon.
As for hosting, that is taken care of by Amazon. There is no need on
your part to purchase any computer equipment or software. Regarding
LQYHQWRU\PDQDJHPHQWZHOOOHWVMXVWVD\$PD]RQVXSSOLHVWKHWRROV
necessary to make running your business easier than you might think.
Your store will also be more efficient. You will be able to control your
inventory without any hassles.
Lastly, you can add Amazon Prime on your site. This is a system that
allows consumers to get their shipping overnight or second day. In
most cases, the shipping is free. The worst case scenario is that
consumers would have to pay $3.99 to cover overnight shipping.

Points to Ponder
Amazon provides a lot of features for those that
sign up for a webstore. Do you think they have
provided enough features, or maybe they could


www.Biznulled.com
128

have included more?
Signing Up
Are you ready to get started? Amazon gives you the opportunity to
decide which option you want to go with. The option you choose will
determine the fees you will have to pay Amazon. Remember, Amazon
is taking care of your hosting, upgrades, and offers you plenty of tools.
But that does come at a price.
You can choose to sign up for Amazon Webstore only where you will
build your eCommerce website, or you can sign up with Amazon
Webstore and also have access to Selling on Amazon (we covered this
in a previous lesson).
Here is what Amazon offers:


www.Biznulled.com
129

The great part about going for the second option is that is provides the
best value as you not only have a webstore, but you can also place
those same items on Amazon, and have them sell the item for you on
their products detail page. The difference between the two options is
the price. If you look at the price well enough, you just might be
surprised to see that the second option is cheaper per month.
:KHQ\RXKDYHGHFLGHGRQWKHSODQ\RXZDQWMXVWFOLFNWKH*Ht
6WDUWHGSODQ<RXFDQDFFHVVWKLVSDJHE\JRLQJWR
http://webstore.amazon.com/pricing-Products/b/2980642011.
/HWVVD\\RXZLVKWRJRIRUWKHVHFRQGSODQ$PD]RQ:HEVWRUHZLWK
Selling on Amazon). Click the Get Started button. Here the page you
will be presented with.


www.Biznulled.com
130

By now you should have an account with Amazon. If you do, use your
existing Amazon account by clicking the lower button and click
&RQWLQXH+RZHYHULI\RXGRQWKDYHan account yet, click the top
button.
If you choose the lower screen, this is what will appear:


www.Biznulled.com
131

If this is your situation, just provide your email address and password
and then click the yellow button below it. Once you do that, you will be
taken to a web page where you can begin the set up process.
* Side Note: If you already have a sellers account set up from a
SUHYLRXVOHVVRQ\RXFDQWXVHWKHVDPHDFFRXQW<RXZLOOQHHGWRVHW
up a new account to use Webstore.
)RUWKRVHWKDWGRQWKDYHDQDFFRXQWZLWK$PD]RQ,OOWDNH\RX
through the sign up process from this angle instead.
On the getting started page like you were just at, unless you are still
there, you will have to select the top button. Provide an email address
that is not associated with or used by Amazon for any other accounts.
When you click the Continue button, you will be presented with a page
where you have to confirm your name and password, to access
Amazon and your website.
Once you do this, you will have four steps to go through. These four
steps include entering your business information, entering your
payment details, verifying your phone number, and reviewing and
confirming everything entered. Once you have gone through each of
these steps, you will then be sent to a control panel where you will
have access to your webstore.
Here is step one:


www.Biznulled.com
132

The image may be hard to see, but basically, you will enter your legal
name (either your full name or business name), company website,
address, phone, the name for your store, customer service phone
number, the industry you are in, and how many sales do you think you
will make per year.
,I\RXGRQWKDYHDZHEVLWHRI\RXURZQGRQWZRUU\DERXWLW7KLVLV
not mandatory to have a webstore.
Here is step two:


www.Biznulled.com
133

With step two, you need to provide your credit card number, the name
on the card, etc.
Here is step three:

With this step, all you have to do is verify your business phone
QXPEHU7KHQFOLFN&DOOPHQRZVR$PD]RQFDQYHULI\LWDVDYDOLG
numbeU,I\RXGRQWZDQWWKHPWRXVHWKHQXPEHU\RXJDYHWKHPLQ


www.Biznulled.com
134

step one, enter in the field below it, a number you do want them to
call.
Here is what will show up on your screen:


www.Biznulled.com
135

After you enter into your phone the four digit pin number, you will
then be sent to this screen, where you just have to review and confirm
everything is correct.

When you scroll down, you will find the terms for your webstore. It will
list what you have to pay each month, what you owe now, and
everything else you entered. If everything looks good, click the
&omplete registration button and you are done.
Amazon will review all your entries and when verified, they will provide
you a video to watch so you can learn more about the webstore. You
can watch the video if you wantRUMXVWFOLFN&RQWLQXH
On the next web page, you will select the type of checkout system you
want.


www.Biznulled.com
136

The type of checkout function you choose will show on your webstore
when people are ready to purchase their item or items. If you go with
your Webstore check out, your customers will have to create an
account with you like they did when they first signed up with Amazon.
Not many people will like doing that. If you go with this option, there
will be no Amazon logo on any page on your webstore. But you can
DGG&KHFNRXWE\$PD]RQE\VHOHFWLQJWKHVTXDUHER[EHORZ<RXU
:HEVWRUH&KHFNRXW
With Checkout by Amazon, you are signing up for an Amazon
Payments account, which means your customers will have the option
of choosing Amazon to process their payments, or your own website.


www.Biznulled.com
137

Here is what the Checkout by Amazon would look on the item page of
your webstore:

Courtesy Amazon.com
If you go with $PD]RQFRP&KHFNRXW\RXUFXVWRPHUVFDQXVHWKHLU
Amazon accounts when checking out. Also, the Amazon logo, as well
as your logo, appears on your checkout pages.
Most people that sign up for the Amazon Webstore use the second
option. However, that is entirely up to you. The reason many people
prefer the second option is because of the name and brand. People

www.Biznulled.com
138

WUXVW$PD]RQDQGWKHUHIRUHZKHQWKH\VHH$PD]RQVORJRWKH\ZLOO
know your webstore is legit.
$IWHU\RXKDYHPDGH\RXUFKRLFH\RXFDQWKHQFOLFN&UHDWH\RXU
VWRUHWRFRQWLQXH
That is pretty much it. It takes about three minutes for Amazon to
create your store. Amazon will send you a link to the Control Panel so
you can update your site or whatever you wish to do with your
webstore.

Points to Ponder
After going over and through the set up
process, do you think that setting up a store
using Amazon is a wise choice? Why or why
not.



www.Biznulled.com
139

Summary

If you truly want to make money with Amazon, the best way is with an
online store. Amazon has the best type of store available. They call it
the Amazon Webstore.
Amazon encourages people to sign up for their Webstore and you can
sell Amazon products from your store. Amazon provides you many
features, benefits, and tools that will help you be successful with your
webstore. This is one of the many reasons people like signing up for
the webstore.
The process is time-consuming, but when you are done with it, and
your webstore becomes live, you can then promote it and start making
money right out of the gate.
With all the features that are provided, along with the benefits, why do
you think that many business people get on Amazon and sign up for
WKHLURZQZHEVWRUH,WGRHVSD\RIILQWKHORQJUXQ<RXGRQWKDYHWR
pay that much to belong or have an account, and the rewards are
great.


www.Biznulled.com
140

Assignment
This assignment will require that you go directly to the Amazon
Webstore page and begin the sign up process. To do this, you will
need to go to http://webstore.amazon.com/pricing-
Products/b/2980642011.
Once you are at the site above, just read all the instructions as you go
through the process and the web pages as they come up. If you take
all the steps as required, you will end up with a webstore.



www.Biznulled.com
141

Quiz
1. The type of webstore you may wish to get involved with will
depend on how many items you plan to sell.
a. True
b. False
2. There are many types of webstores. One of them is an individual
seller account. What are the other two?
a. Small/Medium Business
b. Large Business
c. A + B
d. B + C
3. There are many reasons for starting a webstore. One reason is
to make more money. What is one other reason?
a. Generate more traffic
b. Help others make money
c. Help spread Amazon's reputation
d. Develop your web design skills
4. There were eight different features that were mentioned in the
lesson. Name two of them?
a. Template Designs
b. Widgets
c. A + B
d. A + C

www.Biznulled.com
142

5. Signing up for a webstore account is very complicated and takes
at least 20 to 30 minutes to complete.
a. True
b. False
6. With Checkout by Amazon, you are signing up for an Amazon
_____account.
a. Checking
b. Savings
c. Payment
d. Receipts



www.Biznulled.com
143

Lesson 6-How to Get Millions of People to Buy

from Your Website
In this lesson, you will learn a trick where you can get millions of people going to
your website where they can order any item they want from Amazon, without leaving
your site. You get the commission.

Do you know there is a way for you to get millions of people to buy
from your website? Instead of consumers coming to your website and
leaving right away, why not have those consumers stick around, buy
from you, and actually complete their transactions on your website? It
can happen.
Amazon has developed tools that when utilized, will help to not only
drive people to your site, but will keep them there and have them buy
from you, this way you make the money.
How does Amazon help you in this regard? The tools they have include
Checkout by Amazon, and Amazon Simple Pay. The Checkout by
Amazon was briefly mentioned in the previous lesson. It will be
covered more extensively in this lesson.
Checkout by Amazon
What is Checkout by Amazon? This is a checkout and payments service
for e-commerce retailers.


www.Biznulled.com
144

Think about this for a second. You have a website. You want to make
money with it. You decide to show products from Amazon, thinking
that by showing such products, it may entice people to purchase those
products. The problem can occur when consumers get to your site, see
the products, but have trouble ordering the product.
:LWK&KHFNRXWE\$PD]RQ\RXGRQWKDYHWKLVSUREOHP:K\QRW"%\
using Checkout by Amazon, you will be giving consumers the ability to
use their account information that is stored on AmD]RQVVHUYHUVWR
help them complete the transaction. This helps consumers because
WKH\GRQWKDYHWRILOOLQWKHLUDFFRXQWLQIRUPDWLRQDJDLQ
By using Checkout by Amazon, you help consumers with their ordering
process. You make it easier and faster for consumers to complete their
order without having to leave your website.

Points to Ponder
Making money from a website is the main
purpose for placing it online. Do you think that
by using Checkout by Amazon, you will be able
WRLPSURYH\RXUZHEVLWHVDELOLty to make more
money than you could have without it?



www.Biznulled.com
145

Why Use It?
That is a good question. Why should you take the steps to use
&KHFNRXWE\$PD]RQ"&RXOGQW\RXXVHDQRWKHUVKRSSLQJFDUWV\VWHP
to help process orders? You could use any number of shopping cart
systems, but how would affect the consumer?
The important part about having a website is to make money. At least
this is the reason for many webmasters. If you have a product to sell
on your site, you need to have consumers come to your site and
purchase from you. This is how you make money. But the problem
that occurs many times for webmasters and anyone that has a website
set up online to make money, is in converting visitors to buyers. More
visitors mean more buyers.
By having a system in place that allows consumers to have an easier
way to pay for your products will entice them to come back to your
VLWH,WZRQWEHMXVWDRQH-time purchase.
Your website will become a traffic magnet. People will begin flocking to
your site and ordering whatever you have there, because they will
know that you have the way for them to order easily and quickly,
without any hassles at all.
By having a tool like Checkout by Amazon, you not only keep buyers
on your site, you also gain new customers, as more and more people
learn about what you have and will tell their friends to buy from you.
More new customers mean more money in your bank account.


www.Biznulled.com
146

A great incentive for using Checkout by Amazon is the full protection
you can get. The number of fraud-related transactions is non-existent.
This means no chargebacks for you.
Another great part about Checkout by Amazon is that the tool is fully
integrated with your own checkout SURFHVV,WGRHVQWPDWWHUZKDW
manner you have your customers checking out, you can have
Checkout by Amazon work seamlessly to guide the transaction and
purchase without going through any configuration or updates. You are
the one in control. You can customize the tool to work the way you
want it to.
Every aspect of your checkout process is handled. You can safely and
easily handle shipping, sales tax, promotions, and such post-sale
activities like refunds, cancellations, and chargebacks (if they occur).
The great benefit of using the Checkout by Amazon tool is that
FRQVXPHUVGRQWKDYHWROHDYH\RXUVLWHWRRUGHUZKDW\RXKDYHOLVWHG
Everything can be done on you website. This keeps you from losing a
FXVWRPHU:KHQ\RXUFXVWRPHUVFKHFNRXWWKH\GRQWQeed to enter
their financial information or address. They just simply use what is
stored at Amazon to complete the transaction.
Points to Ponder
Based on what you have read so far, in your
opinion why do you think it important to use


www.Biznulled.com
147

Checkout by Amazon?

How it Works
Just how does Checkout by Amazon work? In order to really
understand how the entire process works, see the image on the
opposite page:

Courtesy of Amazon


www.Biznulled.com
148

As you can see from the image above, you can see the way that
Checkout by Amazon works. It basically works by five phases.
The first step involves you setting up your account. When you go to
$PD]RQV&KHFNRXWE\$PD]RQSDJH\RXZLOOQRWLFHWKHUHDUHSOHQW\
of instructions on what to do. You will need to go through a somewhat
lengthy process, but when you do, you will have an account.
Keep in mind that Checkout by Amazon provides many bells and
whistles. So when you set up your account, make sure to take
advantage of them. For instance, you are entitled to shipping and tax
rates. Use them.
After you have filled out all web pages as required, you will get an
email confirming your account has been established. Once you get
that, you can go into your control panel and get the code for the
widget that you will have placed on your web page. With this code,
you can have the payments option integrated into your web page.
After you have your website set up, you just have to promote the site
and let your customers know that you are accepting Amazon Payments
on your site. This will encourage them to come to your site. Amazon
provides the marketing tools you need to help promote your site.
When customers find that they can order right from your website
without leaving it, they will be more encouraged by it. They will be
even more encouraged when they realize that they can use their
financial and shipping information, as it is stored with Amazon, to


www.Biznulled.com
149

complete their transactions, without having to reenter everything
again.
The biggest thrill is when customers come to your site, see the item,
click the Checkout by Amazon button, and know their order is being
SURFHVVHGXVLQJ$PD]RQVV\VWHP:KHQWKH\QRWLFH$PD]RQV
checkout button, they will begin to trust you, as they will know you
EHORQJWR$PD]RQVJUHDWQHWZRUN
When the order has been received, you will receive an email that an
order was placed. At that time, you just pack and ship the item to the
customer. If you have Fulfillment by Amazon in place, Amazon will
take care of the shipping.
After the product has been shipped out, Amazon Payments will then
transfer the money owed to you to your bank account. They will then
send you an email, letting you know your payment has been sent.
Make sure before you start working with Checkout by Amazon that you
read the user guide. You can get that here:
http://amazonpayments.s3.amazonaws.com/documents/Getting_Start
ed_Guide.pdf.

Points to Ponder
Now that you understand more fully how


www.Biznulled.com
150

Checkout by Amazon works, is this something

that you would like to place on your web page?
Sign Up Process
If you are ready to sign up with Checkout by Amazon, you will need to
go to https://sellercentral.amazon.com/gp/on-
board/workflow/Registration/login.html/902-0586098-
4611057?pf_rd_m=A2CA1KKALKCX2O&passthrough/account=cba&pf_
rd_s=top-
1&pf_rd_r=0GYB9QD2H4GACW8PX2DH&pf_rd_p=1326237502&passth
rough/marketplaceID=AZ4B0ZS3LGLX&pf_rd_t=101&passthrough/ld=
AZFSSOAAS&passthrough/superSource=OAR&passthrough/source=Am
azonCheckout&pf_rd_i=cba-features.
Here is what the page looks like for your convenience:


www.Biznulled.com
151

,I\RXKDYHQWVLJQHGXSZLWKDQ\RWKHU$PD]RQSURJUDPRUGRQWEX\
from Amazon, you will need to create a new account. Just provide your
business name, email address, and password to get started. However,
if you do have an account with Amazon, click the second option so you
can use an existing account.
After you fill out this form and click Continue, you will see this web
page:


www.Biznulled.com
152

Take a good look at this form. Does it look familiar? It should. It is the
same form you used when you signed up for your Webstore and
Amazon Advantage. The difference with this form and the form for the
Webstore is that the Webstore form included setting up the website.
The bottom line here is to go through each step until you get to step
four. Just before you get to step four, you will need to verify your
credentials. In step three, you will need to supply your phone number
so Amazon can call you. When that step is done, you just need to
confirm all the information entered is correct. If it is, you are done.


www.Biznulled.com
153

Points to Ponder
If you noticed the sign up process is the same
with other Amazon Services, why did Amazon
make it so redundant when signing up for all
different services?

Amazon Simple Pay

Amazon Simple Pay is another type of checkout function. With Amazon
Simple Pay, your customers will be able to use their payment
information when ordering from your website. It works like the
Checkout by Amazon, except that Checkout by Amazon provides more
capabilities that allow for real-time shipping and tax calculation, along
with keeping track of promotions.
Amazon Simple Pay does not include all the capabilities that Checkout
by Amazon has. ,I\RXGRQWZDQWWRJLYH\RXUFXVWRPHUVPRUH
checkout options like:
x
Real-time shipping
Tax calculation
Promotions
Order management (cancellations, reports, and shipment

tracking)


www.Biznulled.com
154

Then Amazon Simple Pay will be okay for you. Although Amazon
Simple Pay is not that sophisticated, it does provide some good
features like:
x
Hassle-free ordering: Customers can use their information when

checking out, without any hassles, thereby allowing them to
order without leaving your website.
Purchase protection: Your customers will have confidence in

knowing that when they place an order on your website, they
can trust the order will go through, since you will be using
$PD]RQVFKHFNRXWRSWLRQ
Simple integration: Adding Amazon Simple Pay is easy. You just

need to place some HTML code on your web page. This will allow
the checkout option to be fully integrated into your website.
Automatic post-payment: You will have access to such programs

as Instant Payment Notifications (IPN) and refunds.
Get instant payment for digital goods.
If you only want a simple method of receiving payments, this choice

may be for you. As I said earlier in this section, your customers will
still have access to their financial and shipping information, but no
other bells and whistles.



www.Biznulled.com
155

Points to Ponder
Compared to Checkout by Amazon, do you
think that Amazon Simple Pay is better for a
website? Why or why not?

How it Works
Just how does Amazon Simple Pay work? In order to really understand
how the entire process works, see the image on the opposite page:

Courtesy Amazon.com


www.Biznulled.com
156

The first step is to create your account. There will be some instructions
to follow, they are quick to read and easy to understand. The process
is quicker than would have been with Checkout by Amazon. After you
have filled out all necessary information, you will be sent an email to
confirm everything has been set up.
When you confirm everything by your email, you will then be taken to
a web page where you can complete the registration process and
access the control panel. It is here you can access the code you will
need to place on your web page.
If you happen to know some HTML, you can place the code on your
website yourself. You just need to know where to place the code on
the page. If you have no clue about HTML, you will have to hire
someone, or find someone to help you do it.
Once you have the button in place, it is time for you to contact your
customers and let them know you are selling items on your website for
Amazon, and that you are using Amazon Payments to take orders and
have them processed.
When customers come to your website and find the product they want,
all they have to do is by clicking "Pay Now" buttons on your site and
select the payment method they want to use.
Just as with Checkout by Amazon, you will get a notification by email
of a sale. At that time, you will need to pack and ship the item to the


www.Biznulled.com
157

customer. After shipping has been completed, Amazon will then
transfer the money to your bank account.
In case you are wondering, when I spoke about Checkout by Amazon,
I stated you would ship the item, or if you had Fulfillment by Amazon,
they would take care of your shipping. %XW,GLGQWVWDWHLWKHUH7KDWLV
EHFDXVHXQGHU$PD]RQ6LPSOH3D\\RXGRQWKDYHWKDWOuxury. It is a
simple payment solution. You are in charge of shipping, if you choose
this checkout function.

Points to Ponder
Now that you understand more fully how
Amazon Simple Pay works, is this something
that you would like to place on your web page?

Signing Up
To get started with Amazon Simply Pay go here:
https://payments.amazon.com/sdui/sdui/premiumaccount.
Signing up for Amazon Simple Pay is just like signing up for any of
AmazRQVSD\PHQWVV\VWHPV<RXKDYHWKHFKRLFHRIVLJQLQJLQXVLQJ
your existing account, or you will need to let Amazon know you are a
new customer.

www.Biznulled.com
158

After you sign in, you will be taken to this web page:
https://payments.amazon.com/sdui/sdui/start?referringcaller=NotAvai
lable&upgrade=true&wa=premiumaccountcontactinfo&wreply=https%
3A%2F%2Fpayments.amazon.com%3A443%2Fsdui%2Fsdui%2Fpremi
umaccountcompleted&wtrealm=urn%3Aaws%3AawsAccessKeyId%3A
12727SZQHQP0PBHR5J02&awssig=%2FAY1XzMBmJwvt7qV1uF5%2BU
jruIw%3D.
The actual page looks like this:


www.Biznulled.com
159

After you fill out this entire page, and click Continue, you will then be
taken to a page where you will be given the code to place on your web
page. That will be the end of your registration. All you have to do at
that point is place the code on your website and begin selling Amazon
products.

Points to Ponder
Now that you have looked at Amazon Simple
Pay, which to you seems easier and simpler to
work with: Amazon Simple Pay or Checkout by

www.Biznulled.com
160

Amazon?
Optimizing your Business

Do you know you can optimize your business so you make even more
money than you may be making now? To do this, you need to optimize
your website for the best results possible.
In order to optimize your site to give your customers the best in
shopping experience, you have to provide flexible implantation
options. This means providing more than one way for consumers to
check out. If you work with Checkout by Amazon, the tool uses two
options: Standard Checkout and Inline Checkout.
Standard Checkout
With Standard Checkout, customers are able to review the order to
make sure the price is correct, and they got the right product. In
reviewing the order, they can tell if any promotions have been
included. They can also check for shipping costs and taxes.


www.Biznulled.com
161

Once the order has been confirmed, a click of the mouse will process
the order quickly.
Inline Checkout
With Inline Checkout, the checkout process is integrated. When a
customer checks out and chooses Checkout by Amazon, they just have
to log into the system with their username and password they use to
access their account with Amazon. Once they enter this information,
they will be able to use their address and financial information to make
the purchase.
The important point to remember here is that the customer never
leaves you website, no matter what checkout option he chooses.


www.Biznulled.com
162

If you look closely at the above image and the one under Standard
Checking, you can see that with Inline Checking, the customer is able
to see more info as he orders. This is important to consumers, as they
want to see what they are ordering, to make sure that the order is
correct.
Multiple Addresses
Another way to optimize your checkout feature is by providing
customers a way to do more than just checking out with one purchase.
With Checkout by Amazon, consumers can ship to more than one
address when they order an item. This is an awesome feature, as it
lets customers pick the places where they may want the item to go.
Mobile Access

www.Biznulled.com
163

For those that use their cell phone to order, with Checkout by Amazon,
your customers can order by using their cell phone. All they have to
do is install a mobile app or access your website by means of their
mobile phones. In many cases, when websites are built, many web
building programs allow the website to be set up as a mobile site.
WordPress is great for this.
Imagine your customer logging into your mobile website, see the
product they want, and use the 1-Click function to place the order. By
having this feature available, it will provide convenience for
consumers. This will give them the incentive to go back to your site
more often.

Points to Ponder
By looking at the different checkout methods in
this section, which one do you think would work
better on your website?



www.Biznulled.com
164

Summary
Amazon provides a way for you to get millions of people to your site
and to stay there by providing a way for your customer to order
Amazon products from your site without even leaving it.
Amazon provides two different checkout methods that you can use for
your customers. One is the Checkout by Amazon. The other is Amazon
Simple Pay. The difference between the two is that Amazon Simply
3D\GRHVQWKDYHDOOWKHEHOOVDQGZKLVWOHVWKDW&KHFNRXWE\$PD]RQ
has. Amazon Simple Pay still allows your customers to use their
financial information and shipping account that is stored on Amazon.
,WGRHVQW matter which method you use for your website, you still give
your customers the best order processing system around as it is based
RQ$PD]RQVFKHFNRXW
Once you sign up and use the checkout system, you will find just how
it will help speed up your custoPHUVRUGHULQJSURFHVVZKLFKLVZKDW
you want. This will encourage them to come back to order more
products from you.



www.Biznulled.com
165

Assignment
For this assignment, you will go to
https://payments.amazon.com/sdui/sdui/business/overview. To
perform this assignment, you will choose one of the checkout
methods.
If you choose the Checkout by Amazon method, follow what is stated
on the forms. Register, and then place whatever code is given you on
your site. Amazon will send you an email about it.
If you go for Amazon Simple Pay, sign up and when you get the code,
place it on the web page you plan to use as your ordering page.



www.Biznulled.com
166

Quiz
1. What two tools did Amazon develop to help those selling Amazon
products on their website to make checkout easier? One is
Checkout by Amazon. What is the other one?
a. Amazon Simple Payment
b. Amazon Direct Plus
c. Amazon Webstore
d. Amazon Fulfillment
2. Checkout by Amazon is a payments service for e-commerce
retailers.
a. True
b. False
3. Checkout by Amazon makes the ordering process hard for
consumers.
a. True
b. False
4. With Standard Checkout, customers are able to do what?
a. Call you to complain
b. Email you with a big thank you
c. Review the order to make sure the order is correct
d. Look at order to make sure it comes from Amazon
5. With Inline Checkout, the checkout process is ____?
a. Built-in
b. Manual

www.Biznulled.com
167

c. Integrated
d. Automatic


www.Biznulled.com
168

Lesson 7-How to Use Amazon Product Ads to

Make Money
In this lesson, you will learn how to create product ads that will drive traffic to your
website where you can sell your items.

Would you like to see millions of people hit your website every day,
ZHHNRUPRQWK"2XWRIWKHVHPLOOLRQVZRXOGQW\RXORYHWRVHHDW
least 30% of these people buying your products? You may think it is a
SLSHGUHDPEXWLWLVQW,OOtell you why.
<RXFDQGULYHWUDIILFWR\RXUZHEVLWHE\VLPSO\XVLQJ$PD]RQV3URGXFW
Ads. 7KDWVUHDOO\ZKDWLWLVDOODERXW0DQ\SHRSOHXVH$PD]RQ
Product Ads to drive traffic to their website. By so doing, many of the
visitors end up making a purchase.
I stated you can make money by driving visitors to your website by
means of Amazon Product Ads.
Just what are these ads? Amazon Product Ads are a pay-per-click
advertising program that puts your product in front of millions of eyes
each day. When shoppers come on Amazon, they will see your ad and
if it entices them to click, they will do so, causing them to land on your
page.
All you do is upload your product catalog (not your actual products),
and set your daily budget. Once you do that, your ads will go live.


www.Biznulled.com
169

Amazon Product Ads are likH*RRJOHV$G:RUGV,WQHDUO\ZRUNVRIIWKH
same concept.

Points to Ponder
Do you think it is possible to use ads on
Amazon to drive traffic to your website?

Displaying the Ads
When Amazon displays your ads, the ads will always appear in highly
targeted areas of Amazon.com, based on your product type. These
places will be like product detail pages, search results, and browse
results. Here is a list of the places where the ad will show (all images
are courtesy of Amazon.com):
x
Detail Page
Search and Browse


www.Biznulled.com
170

x
Buy Box
Tower Ad

Here is a visual representation of where your ads will be shown (the
following images are a courtesy of Amazon.com):


www.Biznulled.com
171

Details Page

Search and Browse


www.Biznulled.com
172

Buy Box



www.Biznulled.com
173

Tower Ad
When someone searches for a product and they see your ad and click
it, they will be sent right to your web page where the product is and
pay for it. Those that wish to sell their products quickly have found
using Amazon Product Ads to be worth the cost of using it.
As long as you have a website where you sell products under secured
conditions, Amazon Products Ads will work. The only restriction is that
every product you sell must have its own web page (product detail
page), along with a shopping cart.

www.Biznulled.com
174

(YHU\SURGXFW\RXVHOOPXVWDGKHUHWR$PD]RQVUHTXLUHPHQWV,Q
other words, each product you sell on your website must fall into
either of the following categories: open and restricted.
The open categories consist of the following:
x
Baby stuff
Computer equipment and accessories
Electronic equipment and accessories
Health and beauty aids
Anything for the home
Home improvement supplies
Musical instruments
Office supplies
Pet supplies
Sports equipment
Toys
The restricted categories consist of the following:

x
Groceries
Jewelry
Shoes
Watches
The difference between the open and restricted categories is that you
must get permission from Amazon to show products in the restricted
category in your ads.


www.Biznulled.com
175

Points to Ponder
Do you think it is possible to use ads on
Amazon to drive traffic to your website?

How it Works
Once you register for an account, you will be given a seller central
account. You will receive an email letting you know your account is
active. Once you do that, you will then have a chance to go to your
seller account and begin the process of creating your ad.
The first step in the process is to upload your product catalog and set
your budget. You are not uploading the actual product; you are just
providing Amazon the product list for them to review. If Amazon
agrees to your products, they will create your ads based on that
catalog.
The biggest concern is to make sure to set a budget you can afford to
VSHQG<RXZRXOGQWZDQWWRset your budget too low and end up not
JHWWLQJ\RXUDGVKRZQEXWDWWKHVDPHWLPH\RXGRQWZDQW\RXU
budget too high, unless you can afford it.


www.Biznulled.com
176

It is just like working with AdWords, if you know anything about the
system. The amount you set for your budget will determine the
number of times your ad will show on Amazon.
Once your ad shows and people see it, if the product is what people
are looking for and you present it as a reasonable price, they will click
the ad and head over to your website where they will arrive at your
product sales page to make a purchase.
When Amazon shows your ads, they will make sure to focus your ad to
targeted shoppers that have a history of buying such products. The ad
will also show to shoppers in search results, when the product being
searched for is the same as your ad.
At the moment when a buyer clicks your ad, you are charged for that
click. The amount you will pay depends on your bid. Your bids are set
to a minimum for the category shown. If you really want your ad to be
shown more often, it is best to set your bids as high as you can go or
are willing to pay per click.

Points to Ponder
Now that you know how it works, do you think
that using Amazon Product Ads is the right way
to go for your business?


www.Biznulled.com
177

Signing Up
At this time you will need to sign up before you can upload any catalog
file. To do this, go to
http://www.amazonservices.com/content/amazon-product-
ads/signup.htm/ref=as_pads_top_gs_cta1?ld=AZPADSMakeMAS. You
will be given a choice between selling products or services:

If you already know something about Product Ads, just click the yellow
6LJQ8S1RZEXWWRQ+RZHYHUVLQFH\RXDUHUHDGLQJWKLVOHVVRQ,
will assume you are a beginner. So the first step is to decide if you are
selling a product or a serYLFH/HWVVD\IRUWKLVOHVVRQ\RXDUHVHOOLQJ
a product.
Click the top button to highlight it. Another question will appear below
it:


www.Biznulled.com
178

Look over the second question carefully to determine which way to go
from there. The question pertains to your own website. In this case,
OHWVVD\\RXDUH6R\RXZLOOVHOHFWWKHILUVWEXWWRQ


www.Biznulled.com
179

Now you have three questions in front of you. Take a look at the third
question. You will have to give Amazon a choice as to what category
your products belong in. For the sDNHRIWKLVOHVVRQOHWVVD\\RXU
product belongs to the list of categories in the first answer. So
highlight that button and click it. These are the open categories.
Right below this question, a box appears letting you know you can now
proceed to sign up. In order to sign up, you will need to provide your
credit card, phone number, business name, an business contact
information.


www.Biznulled.com
180

$WWKLVSRLQW\RXMXVWKDYHWRFOLFNWKH\HOORZ6LJQ8S1RZEXWWRQ
This is what you will see:


www.Biznulled.com
181

,WVWKHVDPHROGPHWKRGWKDW$PD]RQXVHVIRUHYHU\VLQJOHSURJUDP
you want to apply for. You have to give them your business name, full
name, valid email, and password. Once you have done that, you will
be taken to a web page that begins the process. Take a look at the
image below to see if you notice any similarities.


www.Biznulled.com
182

The form looks the same as other forms that you filled out to join the
Advantage program, Webstore, Fulfillment program, and other
programs you applied for while taking this course. It appears that
Amazon is using one standard form for most sign ups, except one
page may be different.
After you go through the next page, you will be called to verify your
identity as you did for a previous lesson. Then you will be taken to a
page where all you have to do is verify all information. Once you do
that, you now have an account.



www.Biznulled.com
183

Points to Ponder
After going through the sign up process, does it
seem tedious to you to use the same form for
VLJQXS":K\GRHVQW$PD]RQXVHDGLIIHUHQW
method of signing you up to use the Ads
program?

Getting Started
In order to get started with Amazon Products Ads, there are steps you
have to take in order for everything to run smoothly.
The steps that are required are arranged in order below.
1. Upload your product info
The first step in the process is to upload the product catalog. You will
QHHGWRXVH$PD]RQVSURGXFWILOHThe file can be obtained from your
seller account. This location will be available to you when you
complete your registration. An email will be sent to you, giving you full
details once registration has been completed.
The template contains many items you have to fill in including the
category your product fits into, the title of the product, the link to


www.Biznulled.com
184

where the product will be accessible, the SKU number (if available),
and the price.
Once you have entered all the necessary data, you will be required to
save the document as a .txt file. By the way, make sure you are on
the Feed Template tab when you save your file as Text.
After you have completed your text file, and saved it, at that time you
can go to your Sellers Account and upload your text. You will need to
select your Products tab. Once there, you just need to upload your
Amazon Products Ads file and you will be done.
If you know FTP and have FTP software, you can upload it this way as
well. To use the FTP function, you will need to log into your seller
DFFRXQWJRWRWKH3URGXFWV7DEDQGFOLFN8VH)73<RXFDQWKHQ
VHOHFWWKH$FWLYDWHEXWWRQ Your username and password will be
displayed, along with the host URL to use when connecting to
$PD]RQVVHUYHU7KHVHUYHUORFDWLRQZLOOEHWKLVproductads.amazon-
digital-ftp.com.
Keep this in mind. The username and password you are provided will
QRWEHWKHVDPHDV\RXUORJLQIRU\RXUVHOOHUDFFRXQW6RGRQWWU\WR
XVH\RXUVHOOHUDFFRXQWORJLQLQIRUPDWLRQWRXVH)73EHFDXVHLWZRQW
work.
In case you are not aware, you can use Yahoo! Store to upload your
catalog file. You can create the file and save it as catalog.xml. Just go
to your seller account as you did when uploading your text file. But


www.Biznulled.com
185

LQVWHDGRIXSORDGLQJWKHWH[WILOH\RXZLOOVHOHFW8SORDG<DKRR6WRUH
&DWDORJ[PO
Here is what you will find when you select your Product tab:

Just locate the XML file and upload it. Amazon can work off the XML
file as well.
2. Set your budget
This was talked about earlier in this lesson. The main point to
remember here is that you need to set your budget. The amount of
money you set for your budget will determine how much exposure
your ad will get on Amazon. The best way to determine your budget is
to divide the amount you want to spend each month, by the number of
days in the month.
When you have determined exactly how much you know you are
FRPIRUWDEOHZLWKMXVWFOLFNWKH$GYHUWLVLQJWDEDQGFOLFN'DLO\
%XGJHWIn the sub-navigation bar under the tab, the Daily Budget
box will show.

www.Biznulled.com
186

3. Set your shipping rates
You will have to set up how much the shipping rate will be. This will be
calculated in the price of the ad as well as the click. You can find the
shipping settings function to help you determine shipping under the
Settings tab.
<RXOOKDYHWKUHHFKRLFHVIRUVKLSSLQJ
1. Flat fee per shipment: This option will let you set a fixed price for
shipping. The amount you want to charge for shipping needs to
EHHQWHUHGLQWKH3HUVKLSPHQWIHHER[
2. Different fees per shipment: If you need to set different shipping
rates per product you have, use the different fees per shipment
option. You will have a price range to work from.
3. Additional cost per pound: If your products are being sold based
on weight, use the additional cost per pound option. To use this
option, you will first need to use one of the two options above to
set the per-shipment amount, and then in the additional cost-
per-pound field enter the amount it would cost on a per-pound
rate. Make sure to include the actual product weight in the
6KLSSLQJ:HLJKWFROXPQ

Points to Ponder
After reviewing the three steps you need to

www.Biznulled.com
187

take to use the Products Ads program, does it

seem easy to use, or too difficult to mess with?
+RZ%HVWWR8VH$PD]RQV3URGXFWV$GV3URJUDP
:KHQ\RXILUVWVWDUWXVLQJ$PD]RQV3URGXFWV$GVSURJUDPWKHUHDUH
a few points to keep in mind.
Bidding
Your bid will be set to a default value. If you decide to change that
default value, the actual value you enter must be equal to or greater
than the GHIDXOWYDOXH,ILWLVQW\RXUDGZLOOQRWEHGLVSOD\HGRQ
Amazon at all.
You have to always remember that your bid is what you have agreed
to spend for Amazon to show your ad. If you find the default value is
too high, you will need to contact Amazon, and let them know, or you
will have to quit the program, and wait till you have the funds to pay
for it. The bottom line: You can always go higher, just not lower.
Performance monitoring
Amazon will provide reports to let you see how your ad is working and
how much you are spending at any given time. The reports will allow
you to see which category is doing compared to another one (if you

www.Biznulled.com
188

are using more than one category). You will have three methods o
review your report. These three methods will be:
1. Over time: You can download a report in .txt format that shows
how your ad did over a time frame. While in your Seller Central
account, go over to the Performance Over Time report page.
&OLFN'RZQORDGWKLVGDWD

This is what the report looks like:

2. By category: To download this report, do exactly the same thing
DV\RXGLGZLWK2YHUWLPHH[FHSWJRWRWKH3HUIRUPDQFHE\
&DWHJRU\SDJH
3. Using Performance by SKU report: Obtaining this report is more
extensive than getting the other reports. In order to get this kind
of report go to
https://sellercentral.amazon.com/gp/help/external/200437700


www.Biznulled.com
189

and you will get the instructions on what you need to do to
obtain a copy of this kind of report.
Set Preferences
To get the best use out of Amazon Products Ads, you should consider
setting certain notifications. By setting the right notifications, you will
be kept informed about your Products Ads account, as well as any
other important information that is related to your account. To make
sure to set your notification preferences, go to your Seller Central
account and click the Settings tab. Click Notification Preferences.
Click Edit and make whatever changes are required.

Points to Ponder
After looking over the best way to use
$PD]RQV3URGXFWV$GVVHFWLRQGR\RXEHOLHYH
that you can really make money with this
system, if you take the advice found here?

Ensure Your Success

,I\RXUHDOO\ZDQWWRHQVXUH\RXUVXFFHVVZLWK$PD]RQV3URGXFWV Ads
program, consider a few tips that will help you do this:


www.Biznulled.com
190

1. Always keep your product information current. If you change
something on your product page of your website, make sure to
let Amazon know and alter the catalog file so Amazon will be
able to adjust your budget, and anything else that needs
adjusting.
2. Go over the Products Ads Content Guidelines as found here:
https://sellercentral.amazon.com/gp/help/external/200137680.
If something should happen to you or you get notified about a
YLRODWLRQIRUVRPHUHDVRQGRQWVLWRQLWVR\RXUDFFRXQWZRQW
be suspended.
3. When working with your product feed, it is always good to add
attributes to the products you are listing. By doing this, you will
be providing a good amount of detail on your product pages.
This will help customers by giving them the information they will
need to make an informed decision about whether to buy from
you or not.
4. If you have any problems or need help, contact Seller Support
for help. You can contact them by phone or email. Everything is
provided for you when you log into your Sellers Account. In fact,
when you log into your Seller Central page, you will see the link
at the bottom of the page.
5. It is always good to review the blogs and webinars that Amazon
provides. You can get the blog by this website:
http://www.amazonsellersupportblog.com/amazon-product-ads/.
Also, stay updated on current events and happening by


www.Biznulled.com
191

VXEVFULELQJWR$PD]RQVQHZVOHWWHU<RXFDQILQGWKDWKHUH
https://sellercentral.amazon.com/gp/help/external/200388860.

Points to Ponder
Are you ready to ensure your success and
make a lot of money using Amazon?



www.Biznulled.com
192

Summary
Do you want to make a lot of money from your website? If you do, you
may find it hard to do on your own. But if you use Amazon, they can
almost ensure your success. How is this possible? All it takes is by
XVLQJ$PD]RQV3URGXFWV$GVSDJH
The Amazon Products Ads system works very easily. You provide
Amazon a list of the products you are selling. They take the list and
set up ads on their system. When a customer visits Amazon and sees
those ads, they will click the ad and head over to your product page
where they will purchase that product.
How good can it get? What you need to do to ensure you get the sales
is by registering for the program and then give them a budget you can
pay for. This will set up the default bid and then your ad will go live.
This is basically what the Amazon Products Ads program will do for
you. It is a matter of just applying and setting it up. All you have to do
is sell your product when the customer comes to your web product
page.



www.Biznulled.com
193

Assignment
For this assignment, go to
http://www.amazonservices.com/content/amazon-product-
ads/signup.htm/ref=as_pads_top_gs_cta1?ld=AZPADSMakeMAS and
VLJQXS'RQWIRUJHWWRSURvide a budget you can afford. Remember
the formula that was provided in this lesson. Just take a look at your
income and expenses and determine how much you can spend per
month. Once you know this, provide this when registering and setting
up your account. Then download the template and get started filling it
out.
If you perform everything as was stated in this lesson, you will be on
your way to having an account with Amazon Products Ads.



www.Biznulled.com
194

Quiz
1. You can drive traffic to your website by using Amazon's Product
Ads program.
a. True
b. False
2. When Amazon displays your ads they will focus on four main
areas. One such area is the detail page. Of the following, which
is a valid response?
a. Buy box
b. Email box
c. Forms box
d. Results box
3. Amazon allows for two categories. One is the open category,
what is the other?
a. Office Supplies
b. Electronics
c. Restricted categories
d. Pet supplies
e. Sports equipment
4. The first step in the process after registering is to set up a
budget.
a. True
b. False
5. When you upload your catalog file, Amazon will except file types
like ____ or ____?

www.Biznulled.com
195

a. PDF, DOC
b. TEXT, XML
c. PDF, XML
d. TEXT, PDF
e. DOC, XML
6. When you set your budget, you always go lower than the default
setting.
a. True
b. False


www.Biznulled.com
196

Lesson 8-How to Make a Ton of Money as an

Independent Publisher
In this lesson, you will learn how to set up your independent publishing, using
$PD]RQVSODWIRUPDQGPDNHDWRQRIPRQH\GRLQJLW

Do you know you can make a lot of money with Amazon as an
independent publisher? It is true. Amazon has many publishing
programs available. The many programs include:
1. Kindle
2. CreateSpace
3. Search Inside!
Kindle
Nowadays, many people know about Kindle. Kindle is a way to get
your book published in electronic form. When you want to engage with
Kindle, you will find the sign up process is free and easy to do. When
you publish your book by means of Kindle, you will receive up to 70%
royalties.
When you publish by way of Kindle, your work will be available on
various devices including iPad, iPhone, iPod touch, PC, Mac,
BlackBerry, and Android-based devices.


www.Biznulled.com
197

When you publish your work by means of Kindle, you can do so in
many languages including English, German, French, Spanish,
Portuguese, and Italian.
Just how does Kindle provide the ability for people to publish e-books
through them? The secret is in the technology. Amazon uses the
Audiobook Creation Exchange (ACX) system. Plus, Amazon also uses
Whispersync to work with voice and immersion reading. Amazon uses
these technologies to help with making sure every book that is
published has all functionality to it. If a book is an audiobook, Amazon
makes sure the technology publishes the book as such, so that no
audio is distorted, and so that when they skip ahead in the book, they
never lose their place within the audio.
Amazon even has a special deal going for those that publish their
audiobook by way of Kindle. The authors that provide audiobooks will
receive royalties of up to 90%, if the audiobook is created and
distributed using ACX technology.

Points to Ponder
Do you think that Amazon has a great deal with
the Kindle and with publishing using the
system?


www.Biznulled.com
198

Creating Your Account

If you already have an account with Amazon, you can simply sign in
ZLWK\RXUHPDLODGGUHVVDQGVHOHFW,DPDUHWXUQLQJFXVWRPHUDQG
m\SDVVZRUGLVDQGHQWHU\RXUSDVVZRUG
,I\RXGRQWKDYHDQDFFRXQWMXVWIROORZWKHVHVWHSVWRFUHDWHRQH
1. From the KDP homepage (http://kdp.amazon.com) click "Sign
up."
2. Enter your email address, and select "I am a new customer."
3. Enter your name and a password to protect your account.
4. Once logged in, notice the alert message in the upper right hand
corner of your screen, "Your account information is incomplete.
To publish a book you'll need to complete this." Click "Update
Now."
When your account is active, you will be directed to your account page
where you will need to fill in your company and publisher information
as shown in the image below:
Company/Publisher Information


www.Biznulled.com
199

Once you have filled in your company and publisher information, it is

time to fill in your tax information.
To fill in your tax information, you will need to provide your legal name
that you used with the IRS, your Social Security Number, or Tax ID
Number. You also have to let Amazon know if you are an individual,
have a partnership, or own a corporation.
Tax Information


www.Biznulled.com
200

After you have completed the tax information, your next step is to
select the bank you deal with. This is the bank your royalties will be
sent to.
Your Royalty Payments
When you are ready, add a bank account in order to receive your
payments electronically. Once you enter your bank account
information, if you have to change something, just click the "+" next
to each location. If you do not set up a bank account, your royalties
will be paid by check.


www.Biznulled.com
201

Take a look at the image above and you will see how to set up your
bank account information for your royalty payments.
Points to Ponder
When you create your account with Kindle, you
will see how simple it is to set up. If you have
an account already, do you see the simplicity of
setting up a Kindle account?

Set Up New Account

,I\RXGRQWKDYHDQDFFRXQWDV\HWMXVWJRWR
https://kdp.amazon.com/self-publishing/signin. On the right hand side
\RXZLOOVHHDEXWWRQWKDWVD\V6LJQ,Q%HORZWKDW\RXZLOOVHHLQ
small print to click the link to sign in as a different user.
Here is the button and what is below it:


www.Biznulled.com
202

-XVWFOLFNWKHKHUHOLQNDVVKRZQLQWKHLPDJHDERYHDQG\RXZLOOEH
taken to a page where you will begin the set up process.

6HHWKHLPDJHDERYH1RZ\RXZLOOFOLFNWKH6LJQXSEXWWRQ7KH
next page that shows will be the Sign In page as shown here:


www.Biznulled.com
203

As you can see in the image above, what you must do is check the
first selection: I am a new customer. Then click the long yellow button
and proceed to the next page.
Before you can go forward, you must provide an email address, even if
\RXDUHVLJQLQJLQDVDQHZXVHURU\RXZRQWEHDEOHWRSURFHHG
further.
Once you provide the correct email address, you will be sent to a page
where your registration will begin. You will need to provide your full
name, and password. When you have done that, your account will
have been created.
You will then be presented with your account page, where you can set
up your account like I showed you before. You will need to fill in your
company/publishing information, tax info, and bank info.


www.Biznulled.com
204

Whether you sign up for the first time, or you have an account
already, once you have logged in, you will have access to all your
account information.
Points to Ponder
If you are a new user to Amazon and to Kindle,
do you find the sign up process to be easy, or
is it hard for you?

Manage Your Account

You can now log into your account and check to see how any of your
published books are doing. You will find what you are looking for when
you view your bookshelf.
Bookshelf
You can use the bookshelf to see your book titles. It is here you can
see the title, who contributed the book, the amount for the book, the
book status, etc.
You can also add titles. When you add titles, you just need to click the
$GGQHZWLWOHEXWWRQ,OOJHWWRWKLVODWHU)RUQRZ,ZRXOGOLNHWRJR
over reports. This is one way to manage your account.


www.Biznulled.com
205

When you log into your account, you will be taken to your dashboard.
It is here at the dashboard, you can have access to everything related
to your account.

Take a look at the image above. This is what you will see when you
click the Reports tab.
You will have three choices of reports to view. You could ask for a
month-to-date report. This report will show all sales of your books
from the beginning of the month you want to know about till the
present date. The month that will be shown will be the prior and
current month. So if you wanted to see sales up to September 17,
2012, you would click this link. You will see all sales from the entire
PRQWKRI$XJXVWWLOOWRGD\VGDWH


www.Biznulled.com
206

Take a look at the above image. You can see the month-to-date unit
sales that cover the month you are interested in. Above that is a link
to review sales for the previous month. This is what you get for using
the first option.
Amazon does a great job of helping to keep track of your sales for you
VR\RXZRQWKDYHWR%XWZhat if you wanted to see your past royalty


www.Biznulled.com
207

payments, especially for the last six weeks. You just go for the section
option.

:KHQ\RXILUVWVWDUWXVLQJ.LQGOH\RXZRQWVHHDQ\WKLQJLQWKHVH
UHSRUWV6RGRQWZRUU\LI\RXGRQW
In the above image, you saw how to view royalties for the last six
weeks. You can also see royalties for the past 12 months.

The reports will be in Excel format, so you will need Excel or some kind
of spreadsheet viewer to open and look at the file.

www.Biznulled.com
208

If you look at your menu, you will notice the Community tab. This is
where you can go for help and support. For example, if you have any
problems with your books showing up on Kindle, or payment
problems, you can access the proper forum to get help.
The last button you may want to look at is KDP Select. You will need to
go over this by going to https://kdp.amazon.com/self-
publishing/KDPSelect. It explains a lot.

Points to Ponder
Do you think, after seeing the areas where you
can manage your account, that it includes
everything you should have access to as an
author of your book?

Adding Your Book
If your book has been completed and you want to proceed to publish it
with Kindle, the first step is to log into your account. You will be
presented with your Dashboard. It is here that you will be able to add
your book.


www.Biznulled.com
209

If you look at this page, you will notice it is also your Bookshelf page.
$OO\RXKDYHWRGRWRJHWVWDUWHGLVFOLFNWKH\HOORZ$GGQHZWLWOH
button.

Right after you click the add button, you will be taken to the first steps
to getting your book published on Kindle.


www.Biznulled.com
210

When you fill out this info, your next step is to verify your publishing
rights.

You have to let Amazon know whether or not the work is your own or
is public domain.
The next step is to target your book to customers. With this step, you
will need to add categories of where the book will be located. You can
add categories if you wish. You should also add keywords to describe
your book.
Here is what I mean:

Once you have completed step 3, your next step is to upload your
book cover. ,I\RXGRQWKDYHJUDSKLFH[SHULHQFH\RXPD\QHHGWR


www.Biznulled.com
211

hire someone to create one for you. There are places online, where
you can have a cover image created for you at a low cost.
When you have decided on your book cover, just follow the
instructions as provided with this step.

The image you upload will show in the image spot and on Kindle when
it is purchased. It will also be used as a thumbnail.
The next step is to upload your book. The formats that Kindle will
accept include Word (DOC or DOCX), HTML (ZIP, HTM, or HTML),
Mobipocket (MOBI), ePub (EPUB), Plain Text (TXT), Rich Text Format
(RTF), and Adobe PDF (PDF). Once you have completed your book and
saved it in the format as stated in the above paragraph, it is time to
upload your book.
Take a look at the image below. This shows the step you have to take
to upload your book file.


www.Biznulled.com
212

Now, here is a confusing part of this process. Amazon gives you two
choices regarding rights. You can either enable your digital rights or
not. With digital rights enabled, you are preventing others from
sharing your book with others. Most authors like to protect their work,
and so, thereby, click the top option.
When you have decided on your protection rights and uploaded your
ERRNFOLFN6DYHDQG&RQWLQXHDQG$PD]RQZLOOEHJLQWKHSXEOLVKLQJ
process. You will be taken to the next step where you will finish your
registration and publishing of your book.
AlthouJK$PD]RQGRHVQWQHFHVVDULO\VKRZVWHSWKLVVWHSLV
integrated with step 5.
On the next page, you will begin with step 7. This step is where you
will indicate rights and pricing. You will have a chance to choose where
you hold the rights to your book. If you know you have the rights to
publish your work worldwide, select the first option, otherwise, go for
option two.


www.Biznulled.com
213

Some books are not permitted in certain countries because of the
content. It may be too controversial. If this is your case, you may
have to go with individual territories. It depends on what your book is
about.

The next step in the process requires you to specify your royalties and
how much to price your book. You have two choices to go with here.
You can either go with 35% or 70%. Keep in mind there are some
FRXQWULHVZKHUH\RXFDQWJHWUR\DOWLHV,QWKLVFDVH\RXU
royalties will automatically be set to 35%.


www.Biznulled.com
214

The last step in the process is deciding whether you want to lend your
book to others or not. If you do want to allow others to review your
work for 14 days before they buy it, select the option. If you prefer not
to give others the right to review your book for 14 days, make sure
the button is unchecked.


www.Biznulled.com
215

7KHODVWVWHSLVWRFOLFNWKHSave and PublishEXWWRQ Once you do
that, Amazon will begin the publishing process. They will provide a
popup window to show what they are doing. Take a look at the
following image to see exactly how they show that they are publishing
your work. When you see this for yourself, you will know that your
work has been or is being published.

Now that I have covered how to manage your account, by way of
adding books to your Kindle account, I will now go back to review how
to manage your account by looking at certain parts of it from your
dashboard.
One such part of it is in regard to reports. This function will allow you
to see at a view how your book is doing.


www.Biznulled.com
216

Points to Ponder
Now that you have seen how to add your book,
do you think this is a practical way to get your
book published? Or do you think there is a
better way to do it without Kindle?

CreateSpace
If you are looking for an alternative method of getting your books
published, perhaps you might want to look at CreateSpace. Amazon
developed CreateSpace to make it easy, fast, and economical for
authors to self-publish their work, as well as to make the book
available to millions of Amazon customers worldwide. The type of
formats CreateSpace works with includes books, DVDs, CDs, videos,
and MP3s.
CreateSpace uses a manufacturing-on-demand system. This means
that as the customer orders your book, Amazon uses CreateSpace to
create and print your book so they can ship it to the customer. This
shipping as customer orders is something like POD (Print-on-Demand).
It works off the same principle.
CreateSpace not only creates and prints the books when the order is
received, they also take care of any customer service issues that may


www.Biznulled.com
217

arise. Basically, CreateSpace takes care of your orders and fulfills
them, while you focus on promotion.
Many authors choose CreateSpace for their self-publishing needs
simply because there is no membership fee required. There is also no
set up fee needed. They provide a flexible royalty plan that you can
control.
If you decide to sign up to use CreateSpace, you will find a large
community of authors, filmmakers, and musician that have used the
service and will be more than willing to share what they know about
the system with you.
Plus, you get a non-exclusive contract that allows you to publish an
distribute your book elsewhere, should you decide to go that route. If
\RXGRQWKDYHan ISBN or UPC number available for your book,
CreateSpace can get one for you for free.

Points to Ponder
After reading about CreateSpace so far, what
do you think of it? Is it something you may
want to work with? Why or why not?

Getting Started

www.Biznulled.com
218

If you are ready to get started with CreateSpace, you need to visit
CreateSpace.com and sign up for a free account:
https://www.createspace.com/Signup.jsp?&ref=115576&utm_id=4598

What you need to do is fill out everything from the website as shown
in the image above. Once you do this, an account will be set up for
you.
You will be presented with a Member Agreement first. You must read
over and agree to its terms and conditions or yRXZRQWJRDQ\IXUWKHU
Here is what the Member Agreement partially looks like:


www.Biznulled.com
219

After you agree to this agreement, you will be taken to a web page
where you will have to enter a verification code. The code was sent to
the email you provided in the sign up form.
Enter the code in the space that is requested.


www.Biznulled.com
220

When you click the Submit button, you will be taken to the main page
where you will have the chance to start your new book or talk to a
consultant about your next step.

At this point you can either click the yellow button to set up your book,
RU\RXFDQFOLFNWKH0\$FFRXQWWDEDQGFOLFN&UHDWHD7LWOHEither
way, you will be taken to the creating page that looks like this:


www.Biznulled.com
221

If you are not ready to create your first book yet, you can always go to
WKH'DVKERDUGE\FOLFNLQJWKH&RQWLQXHWR\RXU0HPEHU'DVKERDUG
link located at the bottom of the Welcome page as shown in the image
below:


www.Biznulled.com
222

Or, if you prefer, you can click the My Account tab and select Member
Dashboard.
* Take note of this: If you already have an account with Amazon, all
you have to do is sign in to CreateSpace using that account. If you do
have an account, just fill in your email address and password.


www.Biznulled.com
223

Sign in and you will be taken to the main page. From here you can go
to My Account tab to create your title or to go to your Dashboard.


www.Biznulled.com
224

If you are new to CreateSpace, you can go to the Community Center
by clicking Community on the drop-down menu. Here you can ask
questions about anything you have a problem with.
The resources page can help you with many facets of the publishing
industry. Whatever you need help with, you can find it by using the
Free Publishing Resources tab.
Here is what you will find when you click the tab. The drop-down menu
shows what is there.

$UH\RXUHDG\WRFUHDWH\RXUILUVWWLWOH",IVRJRWRWKH0\$FFRXQW
WDEDQGVHOHFW&UHDWHD7LWOH

www.Biznulled.com
225

Provide the name of your book, the type of book it is, and the way you
want to be guided in the process. When you have filled in all details,
\RXDUHUHDG\WRJRRQ-XVWFOLFN*HW6WDUWHGDQG\RXZLOOEHJLQWKH
process of creating your project.
Points to Ponder
After reviewing how to get started, does it
seem like a good way to get your or other
media published? Why or why not?

Look Inside the Book Program


www.Biznulled.com
226

The Look Inside the Book program is a free program that Amazon
provides authors and publishers. Have you ever been on a book detail
page and saw the image? Did you look at the image carefully and
notice that there may just be DClick to /RRN,QVLGHVKRZQabove the
image? What this function does is it allows people to get a view of a
ERRNEHIRUHWKH\EX\LW6RPHDXWKRUVGRQWPLQGWKLVIXQFWLRQDV
they believe it reinforces the idea that the consumer needs to buy it.
They will read certain parts of the book, realize how good it is, and
purchase it.
The Look Inside the Book helps authors and even publishers promote
their books faster and easier, as people can actually see what the book
is about before they buy it. You can find this program also works for
books for Kindle as well.
Points to Ponder
Do you think the Look Inside the Book program
was a great idea by Amazon? Why or why not?

Benefits of Using Program

When you take part in the Look Inside the Book program, you are
putting yourself into the position where you can sell your books three
different ways:


www.Biznulled.com
227

1. Point-of-Sale Sampling
2. 1-Click Purchasing
3. Improved Search Results
1. Point-of-Sale Sampling
When you review a book to purchase, you may see on the detail page,
an image of the book. At the top of the image you will see the words
Click to Look Inside.This helps customers to sample pages of the
book, even if it is in Kindle format.
Of course, the customer has the ability to switch back and forth
between the print and Kindle samples, without even leaving the
reader. Customers can even view books that are related to the book
under view.
2. 1-Click Purchasing
If the consumer views a book and likes what he/she sees, all it takes is
a click of the mouse, and the purchase will be made. They can do this
because an Add to Cart or Buy with 1-Click button has been
conveniently added to the previewing area.
3. Improved Search Results
When Amazon lists a title, they go by the actual words that are inside
WKHERRN7KH\GRQWMXVWJRE\WKHQDPHRIWKHDXWKRUWKHWLWOHRIWKH
book, and keywords that the publisher supplied. This way when a


www.Biznulled.com
228

customer types in a keyword in the search field, if your book contains
this keyword somewhere in the book, your book will show.
This feature allows Amazon to show more books in search results than
they may have been able to before.
Sign Up Now
If you are ready to sign up, just go to this web page:
http://www.amazon.com/gp/help/customer/display.html?ie=UTF8&no
deId=14061791&ld=AZSearchMakeM DQGFOLFNWKH6LJQ8S1RZOLQN
You will be taken to a page where you will have to read over and sign
a Sign-Up Agreement. Here is one the page looks like:


www.Biznulled.com
229

When you scroll down the page, you will have to select that you agree
to the Participation Agreement and that you are the rights holder. The
name step is to provide your name, professional title (if any),
publishing company name (if you are a publisher), address, city, state,
zip, country, email, and telephone. After you have filled out the entire
form, then click Submit and you are done.
You will get an email from Amazon letting you know when the program
has become active.

Points to Ponder
After reading over the benefit, does it seem like
something you still want to do?

Summary
In this lesson you learned a great deal about how Amazon helps you
publish your work. They have two programs that you can use to
publish your work and one program that will help promote your book
so many people will buy it.
There is the Kindle. Nowadays, everyone knows about the Kindle. This
is one of the most popular ways to publish books online. All you do is
upload your file to Amazon in the format they specify, and within 24

www.Biznulled.com
230

hours after you upload your file, your book is published by means of
Kindle.
Many authors that have used Kindle have done well financially. The
more books you publish through Kindle the more money is available to
you.
The other program is CreateSpace. WithCreateSpace, you have the
opportunity to publish many kinds of media free of charge. You just
need to sign up, upload the media you wish to publish, and let
CreateSpace do the work.
7KHODVWSURJUDPZKLFKUHDOO\LVQWDSXEOLVKLQJSURJUDPDVLWLVPRUH
of marketing and promotion program, is the Look Inside the Book
program. This program will help authors and publisher sell more of
their books, since people will be able to view the contents of the book
and be able to tell quickly if the book is what they are looking for. If it
is, they just buy it.
Amazon provides the tools to help publish your work. You just have to
use them.



www.Biznulled.com
231

Assignment
For this assignment, look at the two programs I wrote about in this
OHVVRQ'RQWZRUU\DERXWWKH/RRN,QVLGHWKH%RRNSURJUDPEHFDXVH
that is not a function or app that helps promote books, although it has
been useful for authors to make a lot of money.
Instead, please choose either Kindle or CreateSpace and sign up for an
DFFRXQW'RQWWU\WRVLJQXSIRUERWKDWWKLVWLPH<RXFDQVLJQXSIRU
the other one later.
If Kindle is your choice, you can start the process by logging into
Kindle by going to www.amazon.com. Once you have logged in, scroll
to the bottom of the web page where you will see a menu. Look under
WKH0DNH0RQH\ZLWK8V<RXZLOOVHH,QGHSendently Publish with Us.
Click this link. Then when the page comes up, click Get Started. Then
FOLFNWKH\HOORZ6LJQ,QEXWWRQRQWKHULJKW
If you'd rather go with CreateSpace, just go to www.createspace.com
and sign up. If you already have an account with Amazon, just use
that information to log in.



www.Biznulled.com
232

Quiz
1. There are three ways to make money as an independent
publisher. One way is by using Kindle. What are the other two?
a. Publisher
b. CreateSpace
c. Search Inside
d. b + c
e. a + b
f. a + c
2. When publishing with Kindle, your work will appear only on
Amazon and nowhere else.
a. True
b. False
3. Kindle uses ACX technology for publishing e-books. They also
use what other technology?
a. Publisher
b. Word
c. Whispersync
d. Voiceover
4. When adding your book on Kindle, how many steps do you have
to go through to complete the process?
a. 2
b. 4
c. 7
d. 9

www.Biznulled.com
233

5. CreateSpace was developed to make it ____, ____, and
________ for authors to self-publish their work.
a. easy, convenient, fast
b. fast, sturdy, and economical
c. easy, fast, and economical
d. easy, sturdy, and fast
6. CreateSpace offers you a free account.
a. True
b. False
7. The Look Inside the Book Program was created to help authors
and publishers do what with their books and media?
a. Sell
b. Promote
c. Make
d. Develop
8. Using Look Inside the Book program provides three benefits.
One is point-of-sale sampling. What are the other two?
a. 1-Click Purchasing
b. Improved Search Results
c.
d.
e.
f.
Support from technicians

A + B
A + C
None of the above


www.Biznulled.com
234



www.Biznulled.com
235

Final Test
1. What is Amazon?
a. A retail store that sells strictly books?
b. An online retail store that sells pretty much a lot of stuff?
c. A retail store that works with Kindle only?
d. An online retail store that sells a lot of stuff but also a
place where you can make a lot of money?
2. What is "Sell Your Own Stuff" about?
a. It allows vendors to sell their own items
b. It allows writers to find work
c. It helps publishers find writers
d. It helps vendors purchase supplies
3. What is the limit to join "Sell Your Own Stuff?"
a. 10
b. 20
c. 40
d. 60
4. What is one requirement to take part in the "Sell Your Own
Stuff" program?
a. Verify the item is the exact one you have to sell.
b. Verify the other vendors are selling legitimate products.
c. Make sure the item you have is authentic.
d. Make sure you have plenty of money to list the item.

www.Biznulled.com
236

e. None of the above.
5. If you have more than 40 items, which account do you best
qualify for?
a. Sell Your Own Stuff
b. Professional
c. Vendor Supported
d. Vendor Awarded
6. One way to make money with Amazon is by their affiliate
program?
a. True
b. False
7. There are how many ways to make money as an affiliate?
a. 1
b. 2
c. 3
d. 4
e. 6
8. Of the six ways to make money as an affiliate, one way is by
using more than one tracking ID. What is another one?
a. Go with bestsellers
b. Focus on slow periods
c. Do not use affiliate links
d. Make sure all images are not clickable
9. How many steps are involved in signing up to be an affiliate?

www.Biznulled.com
237

a. 1
b. 2
c. 3
d. 4
e. 5

10. Amazon provides a number of tools to help you with you make
money as an affiliate. How many were listed in lesson 2?
a. 1
b. 2
c. 3
d. 4
11. How does Fulfillment by Amazon program work?
a. You sell products from your own website
b. You list products and send the products for Amazon to take
care of
c. You tell what Amazon what products you are selling and
ship them yourself
d. You list your item, but have a third-party take care of
shipping
12. Fulfillment by Amazon provides many benefits. Name two of
them
a. Free shipping
b. Many channels

www.Biznulled.com
238

c. Multiple websites
d. a + b
e. a + c
f. b + c
13. Joining Fulfillment by Amazon costs money
a. True
b. False
14. Joining Fulfillment by Amazon is free, but there are costs
involved
a. True
b. False
15. The Fulfillment by Amazon program follows five steps. Which of
the following is not one of those steps?
b. Amazon stores your products
c. Customer orders your product
d. Amazon retrieves and packs your products
e. You ship the item from your home
16. Signing up for Amazon is ____?
a. Hard
b. Quick
c. Easy
d. Difficult
e. A waste of time
17. Advantage is a self-service ______ program.
a. listing

www.Biznulled.com
239

b. Winning
c. Consignment
d. Valuable
18. In order to sell your items, you must have a ____ _____ ____
to them.
a. valid legal obligation
b. valid legal access
c. Valid legal right
d. Legal access rights

19. How is the Advantage program different from the Fulfillment
program?
a. Amazon takes care to make sure inventory is available
b. Amazon contacts you with a request to ship more inventory
c. Amazon hires a third-party to contact you about shipping
more items
d. You are responsible for filling all orders as they come in
20. How many ways are there to sign up for the Advantage
program?
a. 1
b. 2
c. 3
d. 4

www.Biznulled.com
240

e. 5
21. In order to use the Advantage program, you have to follow
certain guidelines. What is one of them?
a. Access to e-mail
b. Access to a phone
c. Access to a fax
d. Access to copy machine
22. How many types of Webstores can you set up?
a. 3
b. 4
c. 5
d. 6
e. 7
23. Regarding a webstore off the following, which is not a reason
for starting one?
a. Making more money
b. Generating more traffic
c. Reaching more people
d. Becoming better than Amazon
e. Have security and scalability
24. Regarding a webstore of the following, which is not a feature?
a. Template designs
b. Custom navigation
c. Widgets
d. Amazon Technical support

www.Biznulled.com
241

e. Page Masters
25. When signing up for a Webstore, Amazon provides you with two
options.
a. True
b. False
26. Why is the Amazon Webstore with Selling on Amazon a better
deal?
a. You not only have a webstore, but you can also place those
same items on Amazon
b. You can only use Amazon for your items
c. You can only list your items on your webstore
d. You can list your items on Amazon, but at a price Amazon
decides
27. Amazon has developed tools to help drive traffic to your site
and keep them there.
a. True
b. False
28. What is Checkout by Amazon?
a. It is a checkout and payments service for e-commerce
retailers.
b. It is a system that helps vendors buy products.
c. It is a system that forces buyers to order from Amazon only
d. It allows buyers to buy from vendors only when a link is
shown on the products page

www.Biznulled.com
242

29. What is the biggest problem for website owners on the
Internet?
a. Converting visitors to buyers
b. Converting customers to friends
c. Influencing buyers to purchase goods and services
d. Helping people learn more about Amazon
30. Checkout by Amazon works by means of a five step process. Of
the following, which is not a part of the process?
a. Set up your account and configure Checkout by Amazon
buttons
b. Place Checkout by Amazon button on your website
c. Call Amazon to confirm buttons are real and available
d. Customer places order by clicking Checkout by Amazon
button
31. Amazon has a way for you to make money by displaying ads on
their system. How many ad locations are available?
a. 1
b. 2
c. 3
d. 4
e. 5
32. When Amazon displays your ads, the ads will appear in highly
targeted areas of Amazon.com
a. True

www.Biznulled.com
243

b. False
33. When setting up your ads, there are restricted categories you
cannot touch. Groceries is one of them. What are the other
three?
a. Groceries, meat, dairy
b. Jewelry, shoes, watches
c. Jewelry, meat, dairy
d. Meat, shoes, dairy
e. Groceries, shoes, meat
34. There are four different ads. Name them
a. Detail page
b. Search and Browse
c. Buy box
d. Tower ad
e. All the above
f. None of the above
35. When you first start the sign up process, the first question
asked is what your business sells One choice is that you sell
products. The other choice is services.
a. True
b. False
36. There are two ways to publish on Amazon. One way is by
Kindle. What is the other method?
a. CreateSpace
b. Search Inside!
c. Publisher

www.Biznulled.com
244

d. Amazon Seller
37. Amazon provides various means of publishing and promoting
your book or other media. Name them?
a. Kindle
b. CreateSpace
c. Search Inside
d. All the above
38. Kindle is available on all devices including iPad, iPhone, iPod
touch, PC, Mac, and what other two devices?
a. Kindle, CreateSpace
b. Publisher, Word
c. BlackBerry, Android-based devices
d. All the above
39. In your account for Kindle, what is the bookshelf for?
a. Displays your titles and allows you to add another one
b. Displays your titles but prevents adding another one
c. Displays reports about your sales
d. Displays reports about your royalties
40. When adding your book, it takes 12 hours for the book to be
published and to show in your account.
a. True
a. False


www.Biznulled.com
245

Glossary A
Lesson One Test Answers
1. Amazon has only one seller program and that is the professional?
a.True
b.False
Answer=b
2. There are five programs you can join to make money with Amazon.
Of the following, which is not one of them?
a.Starting Your Own Store
b.Become an Amazon Affiliate
c.Joining Fulfillment by Amazon
d.Hiring Amazon to Create Your Website
e.Building Your Own Amazon Webstore
Answer=d
3.When you confirm your listing, how long does it take to show the
system?
a.A few minutes
b.A day
c.A week
d.A month
Answer=a
4.When providing shipping, you must provide standard shipping?

www.Biznulled.com
246

a.True
b.False
Answer=b

5.What is the cost Amazon pays for standard shipping?
a.$2.00
b.$3.00
c.$3.99
d.$4.50
Answer=c

Lesson Two Quiz Answers
1.Amazon decides on what products affiliates promote?
a.True
b.False
Answer=b
2.There are six ways to make money as an affiliate. One way is to use
more than one tracking ID? What is one other way?
a.Provide your name on each product you sell.
b.Tell the customer the name of the product to buy.
c.Go for Bestsellers that Amazon promotes.
d.Make sure images are not clickable to mess up numbers.

www.Biznulled.com
247

Answer=c
:K\LVWKH%X\1RZ%XWWRQLPSRUWDQWWRXVH"
a.It makes sure your visitors take action.
b.It makes your site look better.
c.It tells visitors you are a salesperson.
d.None of the above.

Answer=a
4.When signing in for the first time, why is providing so much
information about your website important?
a.Amazon wants to know about your site to see if it fits with their
affiliate program.
b.Amazon wants to make sure you are for real and not a robot.
c.Amazon wants to know if your web page has enough space to fit
their widgets.
d.None of the above.
Answer=a
5.aStore is another great way to make money as an affiliate.
a.True
b.False
Answer=a

Lesson Three Quiz Answers

www.Biznulled.com
248

1.Of all the benefits Fulfillment by Amazon provides, what is NOT one
of them:
a.Free shipping
b.Competitive pricing
c.Many channels
d.$100 for referrals to the program
2.When joining Fulfillment by Amazon, you have to pay a fee.
a.True
b.False
Answer=b
3.Fulfillment by Amazon works by following five steps. Of the following
steps, which is NOT a step?
a.Send your products to Amazon
b.Amazon will store your products
c.The customer orders your product
d.You are responsible for logging in and selling your product when it is
sold.
Answer=d
4.Signing up for Fulfillment by Amazon is really easy?
a.True
b.False
Answer=a

www.Biznulled.com
249

5.Under the "Select your rate schedule" you have a few selections you
can make. Choose the best answer from the following:
a.media, non-media
b.oversize, and zero fee fulfillment
c.a + b
d.b + c
e.None of the above
Answer=c

Lesson Four Quiz Answers
1.Advantage is considered a self-service consignment program.
a.True
b.False
Answer=a
2.Advantage allows you to do what?
a.Market your products on Amazon
b.Market your products on your own website
c.Market your products on Barnes & Noble website
d.Market your products on Borders website
Answer=a
3.How does the Advantage program work?


www.Biznulled.com
250

a.The Seller adds items that he/she is going to send to Amazon for
sale
b.The seller takes items and returns them for a refund
c.The buyer contacts the seller directly with an offer to buy a certain
book outside of Amazon
d.The buyer gets to return any item to the seller regardless of
condition of book
Answer=a
4.To get started you have to sign up. Amazon gives you three ways to
sign up. You can sign up by way of the Membership Agreement. What
is one other way?
a.The Instructions and Rules Page
b.The application page
c.A + B
d.B + C
Answer=c

5.Signing up for Advantage is a fast process.
a.True
b.False
Answer=b

Lesson Five Quiz Answers


www.Biznulled.com
251

1.The type of webstore you may wish to get involved with will depend
on how many items you plan to sell.
a.True
b.False
Answer=a
2.There are many types of webstores. One of them is an individual
seller account. What are the other two.
a.Small/Medium Business
b.Large Business
c.A + B
d.B + C
e.None of the above
Answer=c
3.There are many reasons for starting a webstore. One reason is to
make more money. What is one other reason?
a.Generate more traffic
b.Help others make money
c.Help spread Amazon's reputation
d.Develop your web design skills
e.None of the above
Answer=a
4.There were eight different features that were mentioned in the
lesson. Name two of them?

www.Biznulled.com
252

a.Template Designs
b.Widgets
c.A + B
d.A + C
e.None of the above
Answer=c
5.Signing up for a webstore account is very complicated and takes at
least 20 to 30 minutes to complete.
a.True
b.False
Answer=b
6.With Checkout by Amazon, you are signing up for an Amazon
_____account.
a.Checking
b.Savings
c.Payment
d.Receipts
e.None of the above
Answer=c

Lesson Six Quiz Answers


www.Biznulled.com
253

1.What two tools did Amazon develop to help those selling Amazon
products on their website to make checkout easier? One is Checkout
by Amazon. What is the other one?
a.Amazon Simple Payment
b.Amazon Direct Plus
c.Amazon Webstore
d.Amazon Fulfillment
e.None of the above
Answer=a
2.Checkout by Amazon is a payments service for e-commerce
retailers.
a.True
b.False
Answer=a
3.Checkout by Amazon makes the ordering process hard for
consumers.
a.True
b.False
Answer=b
4.With Standard Checkout, customers are able to do what?
a.Call you to complain
b.Email you with a big thank you
c.Review the order to make sure the order is correct

www.Biznulled.com
254

d.Look at order to make sure it comes from Amazon
e.None of the above
Answer=c
5.With Inline Checkout, the checkout process is ____?
a.Built-in
b.Manual
c.Integrated
d.Automatic
e.None of the above
Answer=c

Lesson Seven Quiz Answers
1.You can drive traffic to your website by using Amazon's Product Ads
program.
a.True
b.False
Answer=a
2.When Amazon displays your ads they will focus on four main areas.
One such area is the detail page. Of the following, which is a valid
response?
a.Buy box
b.Email box
c.Forms box

www.Biznulled.com
255

d.Results box
e.None of the above
Answer=a
3.Amazon allows for two categories. One is the open category, what is
the other?
a.Office Supplies
b.Electronics
c.Restricted categories
d.Pet supplies
e.Sports equipment
Answer=c
4.The first step in the process after registering is to set up a budget.
a.True
b.False
Answer=b
5.When you upload your catalog file, Amazon will except file types like
____ or ____?
a.PDF, DOC
b.TEXT, XML
c.PDF, XML
d.TEXT, PDF
e.DOC, XML


www.Biznulled.com
256

Answer=b
6.When you set your budget, you always go lower than the default
setting.
a.True
b.False
Answer=b

Lesson Eight Quiz Answers
1.There are three ways to make money as an independent publisher.
One way is by using Kindle. What are the other two?
a.Publisher
b.CreateSpace
c.Search Inside
d.b + c
e.a + b
f.a + c
Answer=d
2.When publishing with Kindle, your work will appear only on Amazon
and nowhere else.
a.True
b.False
Answer=b


www.Biznulled.com
257

3.Kindle uses ACX technology for publishing e-books. They also use
what other technology?
a.Publisher
b.Word
c.Whispersync
d.Voiceover
e.None of the above
Answer=c
4.When adding your book on Kindle, how many steps do you have to
go through to complete the process?
a.2
b.4
c.7
d.9
e.None of the above
Answer=d
5.CreateSpace was developed to make it ____, ____, and ________
for authors to self-publish their work.
a.easy, convenient, fast
b.fast, sturdy, and economical
c.easy, fast, and economical
d.easy, sturdy, and fast
e.None of the above

www.Biznulled.com
258

Answer=c
6.CreateSpace offers you a free account.
a.True
b.False
Answer=a
7.The Look Inside the Book Program was created to help authors and
publishers do what with their books and media?
a.Sell
b.Promote
c.Make
d.Develop
e.None of the above
Answer=b
8.Using Look Inside the Book program provides three benefits. One is
point-of-sale sampling. What are the other two?
a.1-Click Purchasing
b.Improved Search Results
c.Support from technicians
d.A + B
e.A + C
f.None of the above
Answer=d


www.Biznulled.com
259

Glossary B
1. What is Amazon?
a. A retail store that sells strictly books
b. An online retail store that sell pretty much a lot of stuff
c. A retail store that works with Kindle only
d. An online retail store that sell a lot of stuff but also a place where
you can make a lot of money
Answer=d
2. What is "Sell Your Own Stuff" about?
a. It allows vendors to sell their own items
b. It allows writers to find work
c. It helps publishers find writers
d. It helps vendors purchase supplies
Answer=a
3. What is the limit to join "Sell Your Own Stuff?"
a. 10
b. 20
c. 40
d. 60

www.Biznulled.com
260

Answer=c
4. What is one requirement to take part in the "Sell Your Own Stuff"
program?
a. Verify the item is the exact one you have to sell.
b. Verify the other vendors are selling legitimate products.
c. Make sure the item you have is authentic.
d. Make sure you have plenty of money to list the item.
e. None of the above.
Answer=a
5. If you have more than 40 items, which account you best qualify for?
a. Sell Your Own Stuff
b. Professional
c. Vendor Supported
d. Vendor Awarded
Answer=b
6. One way to make money with Amazon is by their affiliate program?
a. True
b. False
Answer=a

www.Biznulled.com
261

7. There are how many ways to make money as an affiliate?
a. 1
b. 2
c. 3
d. 4
e. 6
Answer=e
8. Of the six ways to make money as an affiliate, one way is by using
more than one tracking ID. What is another one?
a. Go with bestsellers
b. Focus on slow periods
c. Do not use affiliate links
d. Make sure all images are not clickable
Answer=a
9. How many steps are involved in signing up to be an affiliate?
a. 1
b. 2
c. 3
d. 4
e. 5

www.Biznulled.com
262

Answer=c
10. Amazon provides a number of tools to help you make money as an
affiliate. How many were listed in lesson 2?
a. 1
b. 2
c. 3
d. 4
Answer=d
11. How does Fulfillment by Amazon program work?
a. You sell products from your own website?
b. You list products and send the products for Amazon to take care of?
c. You tell Amazon what products you are selling and ship them
yourself?
d. You list your item, but have a third-party take care of shipping?
Answer=b
12. Fulfillment by Amazon provides many benefits. Name two of them
a. Free shipping
b. Many channels
c. Multiple websites

www.Biznulled.com
263

d. a + b
e. a + c
f. b + c
Answer=d
13. Joining Fulfillment by Amazon costs money?
a. True
b. False
Answer=b
14. Joining Fulfillment by Amazon is free, but there are costs involved?
a. True
b. False
Answer=a
15. The Fulfillment by Amazon program follows five steps. Which of
the following is not one of those steps?
b. Amazon stores your products
c. Customer orders your product
d. Amazon retrieves and packs your products
e. You ship the item from your home
Answer=e
16. Signing up for Amazon is ____?

www.Biznulled.com
264

a. Hard
b. Quick
c. Easy
d. Difficult
e. A waste of time
Answer=c
17. Advantage is a self-service ______ program.
a. listing
b. Winning
c. Consignment
d. Valuable
Answer=c
18. In order to sell your items, you must have a ____ _____ ____ to
them.
a. valid legal obligation
b. valid legal access
c. valid legal right
d. legal access rights
Answer=c

www.Biznulled.com
265

19. How is the Advantage program different from the Fulfillment
program?
a. Amazon takes care to make sure inventory is available
b. Amazon contacts you to with a request to ship more inventory
c. Amazon hires a third-party to contact you about shipping more
items
d. You are responsible for filling all orders as they come in
Answer=a
20. How many ways are there to sign up for the Advantage program?
a. 1
b. 2
c. 3
d. 4
e. 5
Answer=c
21. In order to use the Advantage program, you have to following
certain guidelines. What is one of them?
a. Access to e-mail
b. Access to a phone
c. Access to a fax


www.Biznulled.com
266

d. Access to copy machine
Answer=a
22. How many types of Webstores can you set up?
a. 3
b. 4
c. 5
d. 6
e. 7
Answer=a
23. Regarding a webstore, of the following, which is not a reason for
starting one?
a. Making more money
b. Generating more traffic
c. Reaching more people
d. Becoming better than Amazon
e. Have security and scalability
Answer=d
24. Regarding a webstore, of the following, which is not a feature?
a. Template designs
b. Custom navigation

www.Biznulled.com
267

c. Widgets
d. Amazon Technical support
e. Page Masters
Answer=d
25. When signing up for a Webstore, Amazon provides you with two
options.
a. True
b. False
Answer=a
26. Why is the Amazon Webstore with Selling on Amazon a better
deal?
a. You not only have a webstore, but you can also place those same
items on Amazon
b. You can only use Amazon for your items
c. You can only list your items on your webstore
d. You can list your items on Amazon, but at a price Amazon decides
Answer=a
27. Amazon has developed tools to help drive traffic to your site and
keep them there.
a. True


www.Biznulled.com
268

b. False
Answer=a
28. What is Checkout by Amazon?
a. It is a checkout and payments service for e-commerce retailers.
b. It is a system that helps vendors buy products.
c. It is a system that forces buyers to order from Amazon only
d. It allows buyers to buy from vendors only when a link is shown on
the products page
Answer=a
29. What is the biggest problem for website owners on the Internet?
a. Converting visitors to buyers
b. Converting customers to friends
c. Influencing buyers to purchase goods and services
d. Helping people learn more about Amazon
Answer=a
30. Checkout by Amazon works by means of a five step process. Of
the following, which is not a part of the process?
a. Set up your account and configure Checkout by Amazon buttons
b. Place Checkout by Amazon button on your website

www.Biznulled.com
269

c. Call Amazon to confirm buttons are real and available
d. Customer places order by clicking Checkout by Amazon button
Answer=c
31. Amazon has a way for you to make money by displaying ads on
their system. How many ad locations are available?
a. 1
b. 2
c. 3
d. 4
e. 5
Answer=d
32. When Amazon displays your ads, the ads will appear in highly
targeted areas of Amazon.com?
a. True
b. False
Answer=a
33. When setting up your ads, there are restricted categories you
cannot touch. Groceries is one of them. What are the other three?
a. Groceries, meat, dairy
b. Jewelry, shoes, watches


www.Biznulled.com
270

c. Jewelry, meat, dairy
d. Meat, shoes, dairy
e. Groceries, shoes, meat
Answer=b
34. There are four different ads. Name them?
a. Detail page
b. Search and Browse
c. Buy box
d. Tower ad
e. All the above
f. None of the above
Answer=e
35. When you first start the sign up process, the first question asked is
what your business sells? One choice is that you sell products. The
other choice is services.
a. True
b. False
Answer=a
36. There are two ways to publish on Amazon. One way is by Kindle.
What is the other method?
a. CreateSpace


www.Biznulled.com
271

b. Search Inside!
c. Publisher
d. Amazon Seller
Answer=a
37. Amazon provides various means of publishing and promoting your
book or other media. Name them?
a. Kindle
b. CreateSpace
c. Search Inside!
d. All the above
38. Kindle is available on all devices including iPad, iPhone, iPod touch,
PC, Mac, and what other two devices?
a. Kindle, CreateSpace
b. Publisher, Word
c. BlackBerry, Android-based devices
d. All the above
d. None of the above
Answer=c
39. In your account for Kindle, what is the bookshelf for?

www.Biznulled.com
272

a. Displays your titles and allows you to add another one
b. Displays your titles but prevents adding another one
c. Displays reports about your sales
d. Displays reports about your royalties
Answer=a
40. When adding your book, it takes 12 hours for the book to be
published and to show in your account.
a. True
b. False
Answer=a



www.Biznulled.com

Amazon Riches Manual

Caricato da

Informazioni sul documento

Copyright

Formati disponibili

Condividi questo documento

Condividi o incorpora il documento

Opzioni di condivisione

Hai trovato utile questo documento?

Questo contenuto è inappropriato?

Copyright:

Formati disponibili

Amazon Riches Manual

Caricato da

Copyright:

Formati disponibili

1

Adapted from a Declaration of Principles jointly adopted by a

Insider Online Secrets, Inc

94 Reservoir Park Dr, Rockland, MA 02370

94 Reservoir Park Dr, Rockland, MA 02370

94 Reservoir Park Dr, Rockland, MA 02370

94 Reservoir Park Dr, Rockland, MA 02370

94 Reservoir Park Dr, Rockland, MA 02370

Starting Your Own Store

Become an Amazon Affiliate

Joining Fulfillment by Amazon

Promoting and Selling Your Products using Advantage

Building Your Own Amazon Webstore

94 Reservoir Park Dr, Rockland, MA 02370

Lesson 1-How to Start Your Own Amazon Store

94 Reservoir Park Dr, Rockland, MA 02370

The First Program

94 Reservoir Park Dr, Rockland, MA 02370

94 Reservoir Park Dr, Rockland, MA 02370

94 Reservoir Park Dr, Rockland, MA 02370

Sell Your Stuff

94 Reservoir Park Dr, Rockland, MA 02370

94 Reservoir Park Dr, Rockland, MA 02370

94 Reservoir Park Dr, Rockland, MA 02370

Listing Your Item

94 Reservoir Park Dr, Rockland, MA 02370

94 Reservoir Park Dr, Rockland, MA 02370

for you to list your item, or do they make it

Listing with an Account

94 Reservoir Park Dr, Rockland, MA 02370

94 Reservoir Park Dr, Rockland, MA 02370

do you think that Amazon provides enough

Listing without an Account

94 Reservoir Park Dr, Rockland, MA 02370

94 Reservoir Park Dr, Rockland, MA 02370

94 Reservoir Park Dr, Rockland, MA 02370

94 Reservoir Park Dr, Rockland, MA 02370

94 Reservoir Park Dr, Rockland, MA 02370

94 Reservoir Park Dr, Rockland, MA 02370

Lesson 2-Make Money as an Amazon Affiliate

Six Ways to Make Money as an Affiliate

94 Reservoir Park Dr, Rockland, MA 02370

94 Reservoir Park Dr, Rockland, MA 02370

94 Reservoir Park Dr, Rockland, MA 02370

94 Reservoir Park Dr, Rockland, MA 02370

94 Reservoir Park Dr, Rockland, MA 02370

94 Reservoir Park Dr, Rockland, MA 02370

94 Reservoir Park Dr, Rockland, MA 02370

94 Reservoir Park Dr, Rockland, MA 02370

94 Reservoir Park Dr, Rockland, MA 02370

94 Reservoir Park Dr, Rockland, MA 02370

Site Stripe as a Sales Tool

94 Reservoir Park Dr, Rockland, MA 02370

94 Reservoir Park Dr, Rockland, MA 02370

94 Reservoir Park Dr, Rockland, MA 02370

94 Reservoir Park Dr, Rockland, MA 02370

overboard with creating such banner ads?

Deals Widgets: With these widgets, you can showcase the

Carousel Widgets: These widgets allow you to do exactly like

My Favorites Widgets: You can even create widgets that display

94 Reservoir Park Dr, Rockland, MA 02370

94 Reservoir Park Dr, Rockland, MA 02370

94 Reservoir Park Dr, Rockland, MA 02370

94 Reservoir Park Dr, Rockland, MA 02370